1MNAA

Thioesterase domain of picromycin polyketide synthase (pics te), ph 8.0
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
281
structure length
276
Chain Sequence
AGMFRALFRQAVEDDRYGEFLDVLAEASAFRPQFASPEACSERLDPVLLAGGPTDRAEGRAVLVGCTGTAANGGPHEFLRLSTSFQEERDFLAVPLPGYGGTALLPADLDTALDAQARAILRAAGDAPVVLLGHSGGALLAHELAFRLERAHGAPPAGIVLVDPYPPGHQEPIEVWSRQLGEGLFAGELEPMSDARLLAMGRYARFLAGPRPGRSSAPVLLVRASEPLGDWQEERGDWRAHWDLPHTVADVPGDHFTMMRDHAPAVAEAVLSWLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into channel architecture and substrate specificity from crystal structures of two macrocycle-forming thioesterases of modular polyketide synthases
pubmed doi rcsb
source organism Streptomyces venezuelae
molecule tags Transferase
molecule keywords polyketide synthase IV
total genus 92
structure length 276
sequence length 281
chains with identical sequence B
ec nomenclature ec 2.3.1.239: 10-deoxymethynolide syntase.
pdb deposition date 2002-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mnaA00
3EQ8A 2VTVA 1THTA 1F0PA 4G5XA 3F8SA 3C6ZA 5AK3A 1RWQA 5ALIA 2AJBA 3R3ZA 4H0CA 4ARBA 3X3HA 3ANTA 3IDAA 1XKLA 5FP0A 1MAHA 4H7HA 2JGIA 2OGSA 3I6ZA 2QR5A 2BFNA 1ZOIA 3ESBA 2ZSIA 4Y2JA 1PFQA 2XQJA 1QO7A 4B82A 1FFDA 1Q0ZA 2WHQA 1LPNA 4Y9SA 3SWWA 4EY7A 3A6ZA 5CMLA 1JMKC 1QLWA 4BB0A 1F8UA 5KWJA 5C8VA 3P2MA 4F0JA 5HFAA 3O95A 5BWCA 3DL4A 4KJXA 4B84A 3H1AA 3W2TA 5AOAA 5IH7A 3W06A 5ALMA 1A8UA 4U2FA 5AI0A 4B7ZA 3C45A 3QITA 4ARAA 5AM2A 2WILA 1QIMA 1YR2A 1SOMA 1ZD3A 5CH5A 5AM3A 3H2IA 4CCYB 5EHZA 2XMDA 5ALPA 4FOLA 4N8SA 4W1SA 1UK6A 3V1KA 2VAXA 2ZYSA 3PF9A 2XUAA 5AH0A 2H7YA 2WFZA 3M82A 1F6WA 1WCYA 4HTAA 1LBSA 2PUHA 4KAAA 1R9MA 4C4YA 2XQKA 2VJAA 1XLVA 2CUTA 3D7RA 3EIOA 3AFIA 1CQZA 5D7BA 5AHXA 5AKGA 4X00A 1E8NA 1E8DA 3ZLVA 2OG1A 4AO7A 1Q84A 2PSHA 1HL7A 3UUFA 2AXEA 4PW0A 2XQIA 2OPHA 1CLEA 3WL8A 4X91A 4M0MA 5A7HA 1C4XA 3I2KA 4A5SA 3D4LA 3WKBA 1IVYA 5ALTA 5AK4A 3R0VA 4HRYA 5AM0A 4B80A 4HRXA 2XLCA 4L72A 4ZREA 5JAUA 4OCZA 1CUZA 4KE7A 3FCYA 2XI4A 1BROA 1EK2A 3C8HA 2GYWA 2PL5A 5JD6A 2JGMA 3AUKA 3D5EA 5JAPA 5K3AA 1K63A 3OC0A 4YASA 3WMRA 3O4JA 5LKAA 1G5FA 3PFCA 3C6BA 4EHBA 5IVIA 3R3VA 4P9NA 3STXA 3C5VA 1N5RA 2EEPA 3WWPA 2D5LA 5EIAA 4G8CA 4AXBA 2XMRA 1XFDA 1IUPA 1FFAA 1MU0A 2WTMA 1K6EA 1CR6A 2B61A 1QO9A 4EY4A 4AN1A 4UHDA 3V9AA 1QZ3A 4Y2VA 1XLUA 1TIBA 1JJIA 4K6KA 3VJLA 2XUHA 2VT6A 4J3JA 1UKBA 3AIMA 1ZIXA 4KE9A 4YK7A 3WK7A 5DTIA 3PF8A 2RGUA 5AOCA 4F21A 2OXEA 3QBJA 1XZEA 2WIFA 1IZ8A 2JGFA 3ED1A 2BKLA 2AJCA 3ESAA 3R3XA 1ORWA 1KEZA 3WWCA 3WIBA 1TCAA 3H17A 5AI9A 1XZFA 1CV2A 3VVMA 5HKAA 3BJRA 2PX6A 1QTRA 1W52X 3E0XA 3WK4A 1JU4A 2Z5GA 4IHAA 3KD2A 4ZXFA 1BS9A 4EA6A 3WK6A 4DSZA 3FYUB 2W22A 4QWMA 1EHYA 1THGA 5D3KA 4CG1A 1G66A 4MQMA 5AM1A 4RE6A 1BEZA 3E3AA 1UK8A 2B4KA 2O2HA 3N0TA 3ESDA 2XMBA 1NU6A 2Z8ZA 1HDEA 1P0IA 1L7QA 2XT0A 1UKAA 3AIKA 1TQHA 2WIJA 4FHZA 2VA9A 3MUOA 2QUAA 1MX1A 3WQHA 2QVBA 1DX6A 2QXUA 3W9BA 4BVKA 2O7VA 4G8BA 1VZ3A 2WKWA 5F4ZA 2O2IA 1QFMA 3U1TA 2J3QA 1CUWA 3GELA 1Q83A 3YASA 2JBWA 1WPRA 5JZSA 5LZ2A 4N8EA 5C7YA 3M83A 2JGLA 5EHXA 4DTCA 4KAFA 3STYA 2XDWA 3HACA 1GT6A 5A2GA 4MWSA 5ALEA 1DINA 4HZGA 4BATA 4OD0A 4AB1A 1K5PA 5K3DA 2HA4A 4AZ3A 4JEIA 1QIJA 1VXRA 3FSGD 3OG9A 5YASA 1LPSA 4EZIA 1XZMA 2DHEA 1NU8A 5AKXA 1VKHA 1UOQA 4Y2QA 7YASA 4Q3KA 5J3JA 1SCIA 4B9EA 3QZUA 5IVKA 4GEGA 5FPQA 5FV4A 2YXPX 3DCNA 4J0IA 4GI1A 5CT9A 3WWDA 3LP5A 4GDMA 3C8DA 5AKEA 5CBKA 1JU3A 4CIBA 4H7JA 4WCVA 1USWA 1UXOA 4DMFA 4EBBA 3DJYA 3AZQA 2H7CA 3QPAA 4B6GA 3AINA 1UOPA 5CTAA 1KU6A 2WJ4A 2CJPA 1QTIA 5FUMA 4QDXA 4UBOA 2B9VA 3B3QA 2XMQA 4BBZA 4GLBA 1QIGA 1VA4A 4C88A 4QDUA 2ZYHA 2RAUA 1GZ7A 2Y2VA 4Y2UA 1BN6A 3FOBA 3WKCA 4HXFB 4X93A 1BEEA 1AMNA 2ZSHA 4H18A 1ZI9A 3WL7A 2WLSA 2G5PA 1DT5A 2PSFA 3JW8A 4OU4A 5JIBA 5CT5A 1A88A 3PICA 1LZLA 2BUCA 2O7RA 3STVA 3WJ1A 1XRPA 1EX9A 2DSNA 1AURA 5HQ3A 5E4JA 2CKMA 3RKSA 1QGED 2HU5A 5JZBA 4CIAA 1CFJA 2HA3A 1WM1A 2FX5A 5AM5A 2Z3WA 2FUKA 4ZWNA 5FKJA 3IIIA 4DMHA 2WG2A 2J4CA 1R88A 3W9UA 5ALRA 3IBTA 3FLEA 3M3DA 1ODSA 2PSJA 4H35A 4NMWA 4DSAA 5ALQA 4G9GA 1BN7A 4NS4A 1EDBA 1U2EA 3VISA 5HK9A 4W1RA 4DYHA 1BRTA 2G63A 5CH8A 3B5EA 1ZD5A 5H3HA 4C01A 5DNVA 3DKKA 4AN0A 4W1QA 3S2ZA 3Q8WA 1ODCA 3EBLA 3VKFA 4QLAA 2PUJA 1XQXA 4B83A 2O2GA 4FMPA 1BCRA 4BTLA 3LLCA 1W75A 1CUEA 2GBFA 5ALKA 4ITVA 1EVEA 5AKJA 5LYYA 3WK9A 1FJ2A 5LP1A 1MTZA 4CG3A 5JASA 3DYIA 4FFWA 4EUSA 1R50A 2QJRA 5FLKA 5A71A 1AGYA 1YS2X 3WI7A 1CUCA 1BE0A 1T4MA 5HF8A 2YASA 4UHEA 4PSCA 5AP9A 4BDSA 2HA6A 1GPKA 2WIKA 2IIVA 2HA0A 5JYCA 4XWGA 3IURA 5EGNA 3MGAA 4YX9A 1Z68A 2C7BA 3H2KA 5AM4A 3AZPA 4P08A 1XQVA 2VJCA 3H19A 3KWFA 1R4ZA 4DIUA 1WPXA 4M0EA 2JGJA 5CT6A 5KREA 1GQSA 4WJLA 2DFPA 4OYYA 4P92A 4C4ZA 4X6XA 5DNWA 4LXHA 3WL6A 1CUYA 4K6GA 1OXMA 2VSQA 5ALGA 4Q3OA 2XUDA 5JD5A 4HS9A 3D3NA 2CBGA 2HU7A 3GA7A 5IVHA 1DWPA 5AK5A 2VQ6A 5SYNA 2ORYA 1N1MA 1ZIYA 2GYVA 3DD5A 4J7AA 1ODTC 3F97A 1CUVA 2FJPA 4H7FA 1XZCA 1CUHA 3IUMA 2AJLI 3E4DA 1MNQA 3T4UA 3DEAA 4J0HA 3H1BA 2CZQA 5KBYA 3I2HA 2XMGA 3IUJA 4W9RA 5T4EA 4INZA 3I6MA 5A7GA 1CUFA 2R11A 2XQFA 1UWCA 4RPCA 1ACLA 4RGYA 1E5TA 2GBGA 3NUZA 2RHWA 2HIHA 2XUJA 2J3DA 3VVLA 4XJVA 4ETWA 1BU8A 5AOBA 5AI4A 3HRHA 3SK0A 4BDTA 1CIJA 1WOMA 1UK7A 3FNBA 4MEBA 5AKLA 3HXKA 1GKKA 2OGTA 2I03A 2RI6A 4ZI5A 5HF9A 3C70A 4GHWA 1YCDA 4AQDA 4C87A 4BP9A 1K8QA 3ZWQA 4BCDA 4M0FA 2Z3ZA 1AX9A 3ESCA 5IKXA 1YASA 2OGZA 1JI3A 3GBSA 2WJ6A 3H0CA 5SYMA 1MJ5A 4BCBA 3MVEA 1VZ2A 3ZPXA 1ACJA 3H2HA 5CURA 3VJMA 3G8YA 5AIAA 2VJBA 5BV7A 5T4BA 1CUJA 5KWIA 1EXWA 5I9IA 3CCBA 1CPYA 5K3CA 1MNAA 3G9ZA 4DM7A 1SCQA 1UT6A 5I8PA 4E11A 1ETHA 2V9ZA 2XB6A 1CUIA 1MX9A 3FLAA 5LZ4A 4WY8A 5EIEA 4J0CA 2C5FA 4LIPD 1YA4A 2PU7A 2DHCA 3FBWA 4UFNA 2PVSA 2WHPA 2RHTA 1DQYA 4FKBA 3TRDA 3DNMA 4IQ4A 4HXEB 5HF5A 5C81A 2ZJFA 5K3FA 1T2NA 1PJAA 4KE6A 3BF7A 4MEAA 3RLIA 4ZRDA 2HM7A 4DLNA 3DOIA 2PSDA 5JZ9A 1XRNA 2VF2A 2C0QA 4K6HA 4FWBA 4BRSA 3ANSA 3G9TA 1B41A 3FWHA 4UPDA 2FJ0A 4N5IX 4UBJA 1XRLA 1GKLA 2X8BA 1HBJA 4G9EA 2WHRA 1XQYA 1EINA 2JGEA 4UBMA 3ILSA 1GQRA 3WA7A 5ALSA 3I2FA 5ALZA 1Y37A 3HC7A 4PNZA 3G0GA 2RONA 1QFSA 4IH9A 3A2MA 2UZ0A 2ZVDA 1LGYA 3Q0TA 3WWEA 4AX4A 4F5ZA 3AIOA 1TCCA 2HFKA 1HLGA 4GBGA 1MPXA 3WA6A 3HYSA 1JJBA 4A16A 2Q0XA 4Q82A 1Q0RA 1OCEA 4OPMA 4PV7A 5D3ZA 1OILA 3RARA 4N5HX 4Y7DA 1P0MA 3FYUA 4PQEA 3F9CA 5FRDA 4DNQA 3QMMA 1W4LA 2G5TA 5LZ9A 5ALHA 4FDMA 3QMVA 1CRLA 1F0NA 4BVJA 1E8MA 1H2WA 2XUFA 4QDTA 3D0KA 3DOHA 1AC5A 1DQZA 2XMZA 1FFEA 1VA5A 1AUOA 4QZVA 1U4NA 4FLEA 3FCXA 3EF3A 3TJMA 2WUFA 1EDDA 1ZI6A 4W63A 3IA2A 3FSGA 1TKRA 1QIKA 3O9MA 1DWQA 2WFMA 2WUGA 3IVMA 1XZJA 2WHPB 4I19A 3WLAA 5HF6A 3OOSA 2R8BA 4E46A 3B12A 4IH1A 3PUHA 1PV1A 4XIIA 1XRMA 2ES4A 5AK6A 3R3YA 4J0GA 4WFIA 4B85A 4X92A 4DNFA 1QIFA 1H2XA 4PO3X 3EQ7A 1X70A 1WB5A 2HRRA 3BIXA 4FFVA 1LPAB 4Y2XA 2DCMA 4X94A 4H7IA 4MWTA 3F67A 1S8OA 1Y7HA 5CH3A 1VXOA 3F98A 2EDCA 2WU4A 3O4IA 2K2QB 2HRQA 4BTVA 1MT3A 1UKCA 4G4IA 2ACKA 5FXMA 5ALJA 3AJAA 5AJHA 3VDXA 5AI5A 3CCCA 2PU5A 1XRQA 2PSEA 3R41A 3W05A 1CUXA 3FVTA 3I1YA 1Y7IA 5DTJA 4BZZA 3A2NA 1DWOA 2WIGA 3QYJA 1O6GA 1ZICA 1N8SA 3OM8A 4LXGA 2X76A 1AZWA 1HPLA 1VOTA 1HQDA 4OU5A 1TAHA 5CXXA 1CQWA 5BOVA 2ECFA 2WUDA 2DQYA 4WFKA 1U65A 1R9NA 3G9UA 1KU0A 4X97A 4L0CA 1GPNA 1ZJ4A 2QOEA 4B9AA 2ACEA 3QPDA 4QA9A 5ALOA 4OB8A 4Y2SA 4RE5A 2BAGA 4MYDA 5DLPA 4AMZA 4BYMA 3R3UA 1G42A 5AI8A 2WM2A 1W76A 1UOOA 5I7UA 4OB6A 3K2IA 2OQVA 4UHHA 3WZMA 2BUBA 2LIPA 4LYDA 4BAZA 1IMJA 2OCKA 1CUBA 1YAJA 2I78A 4AZ0A 3AILA 4KAJA 4DMKA 2ROQA 2OCIA 5JAHA 5CRIA 4PSUA 2BGRA 4CCWA 4ZV9A 5CW2A 3D2BA 5JATA 3I2JA 2V96A 1L7AA 2PPLA 3FAKA 3DS8A 3E1GA 4J03A 2XMSA 1YAHA 4Q34A 2WTNA 2QZPA 4NZZA 5LKRA 4EY5A 1YB7A 4KR0A 4LHEA 3OPMA 3BJMA 2H1IA 2HFJA 2CB9A 4B0PA 1H22A 4JUIA 3SC2A 1P0PA 2QT9A 1DX4A 1QIIA 4O08A 4FNGA 1AKNA 4QLOA 1J2EA 1EDEA 5DYTA 3BWXA 1LNSA 2OLEA 4U2GA 3IB3A 3BF8A 1FSSA 3ICVA 4Y2PA 1EVQA 1A8QA 3KOOA 3WK5A 1UZAA 3PE6A 3BIWA 4GWLA 3CXUA 3PI6A 4X85A 5LZ7A 1MO2A 3HZOA 5ALXA 2QXTA 2X5XA 4QNNA 4B81A 4UHBA 3H18A 5ALDA 1SC9A 4PSDA 4ROTA 5AICA 3H2JA 3G02A 1AQLA 1JJFA 4FBLA 4HAIA 4MYSA 5C8XA 1SFRA 3MUNA 3T52A 1R1DA 1JKMA 1QONA 3V1LA 2C5GA 4KACA 1XZHA 5AKIA 2WG1A 1XZDA 4FLMA 4KRYA 1ZD2P 2E3JA 4OYLA 4WDRA 1CUDA 5DNUA 3A2LA 3O4HA 3VXKA 5K3EA 1ZJ5A 1EB9A 3WKAA 1LPMA 2HA5A 5ALNA 4J0DA 1VE6A 1DT3A 3I2GA 1LLFA 1NX9A 2PM8A 3BL8A 3WWOA 4I4CA 1FFCA 2WJ3A 4MJ3A 1I6WA 3M81A 4QDZA 3CN7A 2NW6A 2P8SA 4AO8A 5AIBA 1CUSA 4WFJA 4P93A 1EA5A 2HU8A 1TK3A 1W1IA 4AO6A 2XQGA 3O0DA 2ZJ6A 4UHCA 4X6UA 5JALA 4X7BA 4ZV7A 4CCYA 1L7RA 3K9BA 1QIDA 3W04A 1DU4A 4E14A 4I3FA 2W6CX 3FVRA 4BE4A 3TGLA 2C0PA 3WIOA 2VJDA 1J07A 4MXDA 5C8ZA 1C7IA 4Y2RA 1E89A 2J4FA 1XRRA 2WFLA 2AJDA 1BCSA 2XUKA 5HK8A 3WYDA 1J1IA 3TEJA 2GZSA 2PKYX 4FLFA 4F60A 3D2AA 4K2AA 4L9AA 4BAGA 4S0XA 3PFBA 4KRXA 2WFLB 1J06A 4J0KA 1IZ7A 1JMYA 3U0VA 1SCKA 4UHFA 3QMWA 2XMCA 3WK8A 3DKRA 3I2IA 5JARA 1XZAA 4UBNA 1UK9A 3G0DA 5ALYA 5JADA 5ALWA 3JYHA 2OAGA 3IUNA 4L3WA 3DQZA 4UFPA 3HEAA 2HADA 2GBIA 2Z8XA 2BUAA 1E3QA 4JH0A 1P0QA 5A6VA 1N5MA 2ZYIA 4XX1A 3D2CA 5AKHA 3KSRA 5EI5A 3WKDA 4HXGA 4X95A 1EI9A 2ZJ7A 3LIPA 2HL6A 4H7DA 5D6OA 4JYPA 3HABA 4OUKX 1LPBB 1XZKA 4LXIA 5DWDA 2Y6VA 1G4HA 3WJ2A 3DLTA 5AKZA 1QE3A 3LCRA 2QUBA 3STWA 4A23A 2VAVA 2WSLA 3RM3A 5JANA 3C43A 2YYSA 5HQ3B 3G0IA 5FOQA 1X2EA 1ZD4A 1JFRA 4D9JA 2C58A 4Y2YA 4BRZA 1U8EA 2OAEA 3IULA 4KEAA 4H7KA 2I3ZA 2B20A 2JEZA 4BP8A 2H9YA 2WG0A 2IITA 3QVMA 2C4HA 3KDAA 3PUIA 4FBMA 5EIHA 1H2YA 3L1JA 3R40A 1X2BA 4H77A 2RIPA 3DYVA 3HLKA 3WZLA 5DYWA 2CEKA 3QH4A 1XKTA 1E66A 4NVRA 1IUOA 4IH4A 2GYUA 2Y6UA 1CEXA 2I3DA 3QPCA 4U2CA 2JF0A 1LZKA 3I1IA 5EHNA 3BDVA 4J0JA 4GW3A 4LYEA 1K4YA 2OCGA 4CG2A 3IUQA 4Y2TA 2DQZA 3C87A 4V2IA 5JAOA 3H2GA 5T4HA 3V1NA 4TPKA 3V1MA 1RP1A 5IVDA 2XLBA 4IO0A 3WL5A 5LZ8A 4BC1A 4N8DA 1JT2A 4FNMA 4EY6A 1GGVA 2ZYRA 3HJUA 3R3WA 2QS9A 3L1HA 3C5WP 3BDIA 3G0BA 1XLWA 4JYMA 3FLBA 4ZGBA 4Z49A 2VT7A 1R3DA 2WQZA 5LIPA 1LPPA 4GECA 1WB6A 1XQWA 2DR0A 4C6HA 3G9XA 4GXNA 5JD4A 3RK4A 4QE3A 4DNPA 1GXSA 3GROA 4X6YA 4TGLA 2JGKA 1QOZA 1DTEA 5K5EA 2H7XA 4H7EA 1EK1A 1W6RA 2XUGA 1ISPA 3G0CA 2QM0A 2V97A 1LPOA 4HVTA 1QIHA 4UBIA 2GBCA 3ZLTA 1IUNA 4Q3LA 4EY8A 3V48A 1XZLA 5T4FA 1H23A 2CMFA 3C6YA 4X90A 4BVLA 1WHTA 3BE8A 2XE4A 4G1FA 2XUIA 5EFZA 5ALLA 3I6YA 3PDCA 1D07A 2DHDA 1WB4A 3G7NA 1ZGCA 5ALUA 3DL7A 4G4JA 3DDUA 1TRHA 5AKYA 3STTA 4LKOA 3HI4A 4C89A 1UFOA 3BXPA 3D59A 3GZJA 1A7UA 4UFOA 3GFFA 3H04A 1FFBA 2HDWA 4UBLA 1RYYA 1YS1X 4RNCA 1XZBA 3I28A 1YA8A 4WY5A 2HA7A 5LLSA 4G8DA 3ICWA 4CFSA 5E4YA 2XUQA 3KXPA 1CUGA 3N2ZB 2WIDA 5AO9A 4QWWA 1H2ZA 5ISMA 2OCLA 5DJ5A 3UUEA 4U2DA 2VATA 2Y1KA 2QJWA 2BGNA 4FTWA 4K5QA 3O9VA 1EB8A 5AKKA 5CXUA 4EB0A 5A62A 5ESRA 5ALVA 1VE7A 1MX5A 2AJ8A 4X71A 3OURA 4QEKA 2IX9A 4KE8A 1EH5A 2BCEA 3L1IA 2XUOA 5CT4A 4BC0A 3STUA 2QRUA 4BZWA 3OTQA 2HA2A 5E4TA 5HZGA 5DYYA 3ZV7A 3WKEA 1XROA 1ORVA 4G4GA 1A8SA 1MN6A 4MQLA 5K3FB 3NOXA 1XZIA 4OB7A 3EQ9A 5HKBA 1YSCA 4XVCA 3SX4A 1ZI8A 3QM1A 5AI6A 1QJ4A 3LIIA 1GPLA 4E15A 4B0OA 4C4XA 2ONCA 3A70A 5FPPA 2Y2UA 5CT8A 2WUEA 4Q1VA 4UBKA 2OQIA 1B6GA 4U2EA 1M33A 2XUPA 4BCCA 2PBLA 3FYUC 6YASA 1ZGBA 3UMJA 2YH2A 3LS2A 1VJ5A 3AZOA 4JNCA 5ALFA 3FYTA 1YB6A 3O4GA 2GZRA 3NWOA 5A7FA 1HKHA 4AMYA 1C7JA 1QIEA 4U2BA 5K3BA 2G4LA 4WDQA 2V98A 4PF1A 3KWJA 2JIDA 4BAUA 5FDFA 4DGQA 1CVLA 5HFNA 1VLQA 4BE9A 2QMQA 3JWEA 2QKYA 4DNOA 4YPVA 4TVKA 4Q05A 2VEOA 5EHQA 4W1PA 2BJHA 5LZ5A 1WHSA 5BWBA 3HSSA 3ZI7A 2QTBA 4UUQA 3WYNA 3S8YA 2JEYA 3F96A 3GUUA 1CUAA 4KYVA 3VJKA 1O6FA 1MAAA 5E2IA 4OSEA 2EDAA 3C6XA 3ZLUA 4QDOA 1TCBA 2HHAA 4CI9A 3K6KA 4X3CA 1CUUA 2WU3A 3CN9A 1XZGA 4DMCA 1LBTA 3NGMA 2D0DA 5HCUA
chains in the Genus database with same CATH superfamily
4EVSA 2C5EA 5EXEA 5PGMA 1YC2A 3R75A 3X43A 2RK6A 2X3YA 2WSMA 4G0NA 1XI2A 3HEMA 5FTJA 4S2UA 4XGKA 1F0PA 1A7JA 1MV8A 3R4VA 4Q4HA 3C6ZA 1XU4A 4DN6A 4LS3A 1MAVA 3AF2A 1NI4B 1SVUA 4E7OA 2TMKA 4WGFA 1O77A 1F6BA 4X1KA 4YMIA 1G7SA 1FJHA 1FMLA 1K8RA 5DSTA 2ZRLA 1RLMA 2ZKIA 2UAGA 2P79A 3GLSA 3LKDA 4HEA1 4M8SA 1QMGA 1XKLA 1MAHA 4LXQA 2GFHA 1RZRA 4H7HA 1NDHA 2ZB8A 5CR9A 1Z36A 4ZVRA 3L49A 3A27A 3SBOA 1GAJA 4Z8YA 2ZE6A 1J0DA 1RI1A 2GZAA 3W78A 3HYNA 1PKEA 4JI6B 3ORFA 3X0DA 1E62A 3C7TA 1GA6A 2BFNA 3IKJA 1KNXA 1ZOIA 3MJVA 2I7VA 1ZW6A 4RZSA 4W82A 3TOCA 5B36A 5K9ZA 4YB8A 1F2VA 1MC8A 1HLPA 1QQ5A 1XCGB 2BHNA 2PRKA 2C5BA 2ZSIA 3QU9A 2AC4A 3DOCA 2X0DA 4FYIA 4REMA 3X1DA 1QH0A 3GB9A 4MV7A 1Q0ZA 1VE9A 2JAXA 5FBVB 2WHQA 1JBEA 1LPNA 3LX8A 3RV3A 2J0UB 3OOHA 1R0SA 3CVOA 1FY2A 1A27A 1MFPA 2Q07A 4PHTA 4FP9A 4EY7A 1JKXA 2SCUB 1J8FA 4A6PA 1M10A 1ZEJA 3BB3A 2AFRA 1X7ZA 2LGJA 3WIDA 6LDHA 5JCJD 1QLWA 2BY4A 2EKDA 2ODPA 4DA9A 1SVMA 2ZETA 4RELA 4LBYA 1WUTA 1ZM9A 4DJEC 1MENA 3F2IA 1HV8A 4ZT4A 3U13A 3P2MA 4F0JA 1Q3TA 4DV2B 2XHEA 4UATA 6Q21A 3N8DA 4JOBA 1LY1A 2V55B 3DL4A 4KV9A 1Z4NA 2AUMA 1NLMA 3K1AA 1KZ6A 2IYSA 5B1IA 1E9VA 2JI6A 2DPLA 2QD2A 1PT6A 3KVNA 4MUEA 5KVCA 1CIPA 1GILA 2RI1A 4JBWA 4K6OA 3ZVNA 1A2OA 2CKDA 3RBXA 2PT7A 4N76A 5ALMA 1A8UA 1BVHA 3SLKA 1BWSA 5L3SA 1XJCA 5LUBA 3TZCA 3FH0A 3VZPA 4NYIQ 3LAWA 1A9ZA 1CJBA 3UICA 1GNTA 1ZOSA 1KZYC 3SS9X 1O57A 3RASA 1H8HD 3C45A 3BL5A 2QX4A 4RHXA 4ANFA 4AX8A 3N39C 1G41A 1JYEA 1DBQA 3IAM6 2J3HA 5U9CA 1EESA 1DG1G 1ZD3A 3QU7A 5CA0F 1IK4A 4MV0A 4RBNA 5CH5A 1E2HA 5F1KA 3X2SA 4YJGA 2BMAA 4HLUA 4RXTA 4Q1EA 5E8RA 1QH1A 1YVEI 2ID7A 2IDZA 1OWMA 2JFXA 5EHZA 5IFLA 5KYYB 1DAIA 1L5WA 5ALPA 5F1OA 5DM70 2F8SA 3AR3A 1QGAA 1Z0SA 1NE7A 4EW1A 2QI9C 1T5OA 2GAFA 1PGQA 2FUCA 4V03A 5EIOA 3NTVA 3Q40A 3QKTA 4JOCA 2VAXA 2SKCA 2JLQA 1JHMA 4M86A 2XDQB 3ZQUA 1MO4A 2VH5R 2WVJA 3N8KA 3QSYA 3HKCA 1C0KA 2RMKA 4MGKR 1RMYA 4Z0TA 4CKCB 3A1CA 3SI7A 2WWYA 1NXOA 4I9GA 2PEYA 2XVAA 3H5RA 1KJZA 2OEPA 4GKAA 2C1XA 3V8RA 4YP7A 2ZJ4A 1Y3CE 1M1NB 2HWWA 4JJZA 4PQGA 4NBUA 4HLCA 1OXXK 2B83A 4XD7A 2XQKA 3TQOA 1IOZA 1P5ZB 2VJAA 1OI3A 2YMQA 3NT5A 4OKIA 4WZAB 4ALJA 5B6PA 4EG4A 2I29A 3EIOA 1Y8AA 2IF0A 4GOND 4MUIA 4LF8B 5DM1A 2C00A 3U7FB 4M2LA 1JKIA 1G8GA 1NJGA 3CTPA 3P9KA 3GOQA 4CTJA 4MHOA 1JA9A 1CYDA 1IC6A 3GLHE 3D0QA 1U3VA 4B4UA 4JMPA 2G1JA 2BEKA 4MZXA 5DEIA 3ZLVA 4AO7A 2F8TA 4KHPB 2O1EA 4HYQA 5A5DA 1N2ZA 4IO1A 1Q84A 3MERA 1B26A 1KOLA 3L79A 5CGQB 1GUYA 1P1CA 3UUFA 2V65A 3H1FA 1JAHA 4OGFA 3OU7A 4JT4A 5KQPA 1SIBE 1Y9ZA 4PW0A 3RSCA 3ZHYA 2XQIA 2OPHA 4W5JA 5IW8A 4X91A 3TMYA 1DAFA 3SZUA 4M0MA 3JD0A 4QOFA 2D7DA 1HC7A 1TUBA 3SSMA 3MAJA 4B7AA 1ZR4A 3P2EA 4XAQA 1JFFB 2IV3A 5ERGB 4EL5A 4NX2A 3W6NA 2P5YA 5I9BA 3UIEA 3UK1A 2B1RA 1LLUA 1WETA 1IVYA 1EFTA 5BSFA 4AF8A 1XEAA 4PG8A 1JSLA 3QNWA 3WHIA 3IAHA 4E2WA 3DT6A 1JP7A 3K1TA 4M7WA 1AHPA 3R0ZA 1KQOA 1NUPA 5FB3A 2Q4OA 5CHEA 1HE8B 2V6BA 3KZXA 1JI0A 3F7TA 2J3JA 1U90A 3OEHA 3P9PA 1FRQA 1WKBA 3DZKA 1CUZA 4OCZA 4OQXA 4YRGA 4PBSA 3IQGX 4KE7A 3FCYA 1I7QB 4ZPJA 2PFKA 3I45A 1BROA 1OZGA 3Q7EA 1L4HA 5HMLA 4H4EA 3PWSA 4TMWA 1NXVA 2UUPA 2VPWA 1MFZA 4UMVA 6NULA 2FDCA 2CWWA 5E95A 1AU9A 1Z5WA 4Q66C 3ONFA 5HM6A 4KC0A 1PZXA 4AZWA 1IY9A 1N2BA 3AHHA 3B1YA 2OO7A 4FHGA 4JUFA 3HYRA 3SEFA 3O4JA 3OTGA 3U56A 2H2IA 2IEZA 3HO8A 1RBMA 1N25A 4K9SA 4EARA 3QRWA 2JS7A 5IFKA 1JTVA 1CTQA 4NOJA 4U2KA 3KWMA 4EECA 1RZRD 2OHVA 2WIAA 1S2DA 3C6BA 1UUFA 3DEHA 4AUEA 4EHBA 1T5LA 2YWDA 3U60B 5IVIA 4NQRA 1IM5A 1SOWA 1ECCA 5E1MA 4EZEA 2B8NA 3HI6A 3RUPA 2Y1WA 1K0UA 1P8AA 1SWWA 4EFLA 1ZGAA 2A33A 4B6SA 2SKDA 2Y0BA 4AG5A 1EP2B 4R40A 3RDPA 3H3FA 5EPUA 2IHTA 3B89A 2ECQA 2D5LA 1RRFA 1ZKDA 5EIAA 2QF7A 5AHRA 2VDPB 4DV7B 2V54A 1NLUA 1E79D 4PGGA 5F9HA 4AIIA 3R09A 1DLJA 4FFDA 1OGJA 3JQ8A 4JVMA 2FP4B 2OENG 3IOEA 3WXMA 2HWUA 4OP2A 4H31A 4GGOA 5DXAA 3ZWPA 3T9CA 4EKNB 3GDFA 3DZ8A 5DCYA 1XALA 4MR9A 3JR3A 5GINE 2HH9A 4KZKA 4N7JA 3SNHA 1NM5A 2IOFK 1BVYF 3FPCA 1N5JA 4UNNA 3U39A 3OY7A 3TIFA 2C77A 1YRLA 3B9PA 3OLQA 4D8XA 4HAXA 4D5GA 1W94A 3HFSA 4QJBA 1KEWA 4B32A 2H4JA 1UKBA 1WY5A 2WINI 3JZAA 4E4TA 3EOBI 3SYMA 1ZIXA 2J33A 1Q92A 1Z6PA 3D5QA 3D4OA 3BFXA 4LFBB 1XHFA 3UJ3X 3ZDXB 3R9IA 3VR0A 2RGUA 5AOCA 5K05A 2OXEA 1Z2CA 5FTNA 1ZFNA 3CR7A 3NANA 4X8OA 1E5QA 4D9EA 2WIFA 2X13A 5DISB 4DIFA 2IEDA 5K8LA 5KX5A 3V42A 2OTCA 3A4YA 1YD7A 2B8TA 3ED1A 4WK4B 4D97A 3QU5A 3E7XA 4FGWA 5LJLA 4XB1A 1P80A 2BKLA 2PGIA 1KEPA 1LDNA 3ESAA 3IUEA 3OJEA 4KXXA 3PVCA 1Q7CA 4JBYA 1CNEA 5F7XA 4QGAA 4BB6A 5CLQA 4NCBA 3RFCA 3WIBA 3GVIA 3L4JA 3AIIA 2JGNA 1JG6A 1YBMA 2DH5A 3TB4A 1ITZA 5H81A 3AR4A 4TWJA 2JBAA 3DFIA 3WLFA 2X8JB 4BRUA 1X7YB 2Z4RA 3BBPA 3MUEA 5K4HA 2I33A 3QTTA 4UXHA 1I4EB 2QU7A 3PQ6A 3BJRA 4LTDA 3P9SA 3WYEA 4WBNF 1T3TA 3RHZA 2Z6AA 1QTRA 2CT8A 2J5XA 1UBKS 2BI8A 4ZEVA 3GF4A 2KMLA 2QY9A 2VC2B 2JGDB 1V25A 4FFRA 3VSBA 4Z7OB 2VNHA 3K8ZA 3QYPA 1V0JA 4ZAWA 3VSCA 1JU4A 2J0VA 4F5WA 2DFLA 1JBKA 3E61A 1L4LA 4BMVA 4YTEA 1P2GA 2AW3A 5L7WA 2E6KA 3K5HA 1NY5A 2XNKA 1ZRSA 2ORED 4R2IA 5U4XA 1DUIA 4WK0B 2WSYB 3DL0A 4DSZA 5CFNA 2NN3C 3FYUB 3DPIA 3DMFA 3QUBA 4XGRA 4G0WA 2OBMA 3OEYA 2Q29A 4F91B 1WPGA 1BMTA 2CXQA 2OK7A 1USVA 3V1UA 1CDEA 3QLEA 4XB6B 1OKKA 4URUR 3N2NA 4JELA 2RHDA 4RE6A 2Q99A 2NT3A 2A7XA 1BEZA 3UHOA 2YV5A 1CHNA 3D54D 3QTBA 4R3NA 4DY6A 1KP9A 3GIWA 1UK8A 1BXGA 2VRBA 4F2HA 4L9RA 3U1BA 4OAQA 4A0QA 2JFGA 3AXSA 4EKGA 2F3PA 1YQUA 3SX0A 2ZRBA 3L6BA 3K0CC 4MV1A 2GM5A 4P4UA 1QG0A 2GD2A 4PLCA 1HXHA 4RPIA 3I6QA 5H7XA 1Y8CA 1WZCA 1F4PA 2E4WA 4MPJA 3ESDA 3T7EA 1PFWA 3H1PA 4YRIA 6REQA 4QYXA 2V1XA 1HDEA 2Q3FA 4K26A 1ZH0A 4I99A 2D13A 2FV8A 4HDRB 4ZYXA 3G1WA 2Y1DA 3DO6A 2XZTA 3AHJA 4QUAA 1Z8HA 4M99A 4EYKA 4XASA 1EM8B 1KFEB 3NALA 2YMLA 2Q8PA 1FLDA 2CFOA 1UJ2A 1SCDA 1MABA 4R1SA 1TEZA 2H07A 3RRJA 4MITA 3K0KA 2DU8A 3OE7D 3MUOA 2EHJA 1AGXA 2H31A 1XJQA 1AIPA 3AOEC 3WQHA 2XADA 3BRWD 5BSTA 2ZQYA 1RJFA 1YR9A 2QXUA 2ZRGA 3W9BA 4ND4A 5D3QA 2DKOA 3H6GA 5BV8A 1VPEA 2ZYUX 3W2GA 4XJXA 3VNAA 3OSZA 3IEKA 3OFNA 5IABA 1SVIA 3EA4A 3KYBA 5BSMA 3PKJA 3AR6A 5BW4A 3U1TA 2YYZA 2JI4A 2WT8A 2YOHA 2HBYA 1AKTA 1T5DX 1QYVA 2EL7A 2J3QA 1CUWA 2X0NA 2XUZA 4IQGA 5EYPB 5A4DA 1IFXA 3OT4A 4P1ZA 4ND3A 2JBWA 4NCHA 4R31A 2P77A 3ILYA 1L8LA 3UG6A 2JAHA 1UM8A 3MQ2A 1WPRA 4PHFA 1RKXA 5EWJA 3TRJA 2ZYTX 4LV6A 3N0XA 1P2DA 4KU4A 4YUYA 5LZ2A 1QQAA 3CH4B 1ZJJA 1ENZA 3M83A 1F48A 5JCOC 4PWYA 4L5CA 3F5QA 3HU3A 3IHTA 1X1QA 1TW2A 3HP4A 3QI2A 5EHXA 2RHBA 4NH4A 1T1RA 4BNFA 2ZTVA 3FAZA 3KB8A 3G2KA 3KSBC 1OBFO 1W0JD 5A2GA 3ECCA 4YMLA 4U9UA 5DMXA 1D2AA 4LXXA 1NT2A 2ORWA 1K5PA 1SKUA 2FEWB 1T5SA 3HEBA 3PNSA 2AD5A 3V8VA 4A1OA 5JNUA 2VP0A 2OV6A 3VR4A 4AZ3A 2O5RA 3FSGD 3NBQA 1DO8A 3ESXA 3AHGA 3T5BA 2ZIEA 1RQXA 1YE8A 4EZIA 2ET6A 4HB2A 4N48A 1L5MA 1JLLA 3S1LA 4Y2QA 4NE7A 1KJ8A 2NSLA 3K72B 5A2QA 2PKQP 1Z2NX 3I4LA 3LVRE 4K7JA 2KYRA 4MDYA 4X5OA 3W9SA 5I7EA 3AM3A 1ZBQA 4GEGA 4GQAA 5DM4A 3RD5A 1VG0B 2AR7A 1W8DA 3HWX1 3A10A 3ABZA 2OBLA 5FV4A 5EIWA 3AQ4A 1ZDMA 2B25A 2YXPX 2Z3VA 3DCNA 5EMMA 5HM8A 2H4WA 3TSZA 5IJZA 1B74A 2YKGA 1PFKA 4GI1A 4LKRA 1ZA2A 3I4CA 3BMCB 3UAXA 2JI9A 1VJDA 2BZ0A 2IEYA 3A1EA 1FMJA 4IDFA 3AY7A 5AKEA 4H7JA 1SUAA 1PDVA 3AF3A 1UXOA 3TD6A 2PMFA 4DMFA 3ED5A 1V5IA 4QYMA 2CJYA 3RFFA 3DJYA 4BX9A 4UEWA 4KR2A 3ZV3A 2EU8A 2H7CA 3QPAA 2QA5A 3RQSA 1O95C 3WQBA 4B3IA 2ZT8A 1VJCA 5F12A 1FX0A 5CTAA 4W9NC 4RX1A 1SPBS 2WJ4A 4OIFA 2CWDA 2JJ1A 4X62B 4XYEA 3UH0A 1V4NA 1UBLS 1L7MA 5C8DA 2X9VA 2JFVA 2H4FA 4JXKA 2X23A 3D7LA 1A5SB 3B3QA 1P17A 1QYXA 2AEEA 2BEUA 3E5MA 3LF2A 4UEJA 2HSJA 3RTGA 4DCVA 4BNIA 4WVLA 1P4SA 3GFBA 4C0KA 3PEFA 3SBEA 2PLRA 4C88A 1L8AA 1TGYA 2VHYA 4E94A 5ERXA 1GZ7A 1G5IA 2GTPA 2Y2VA 4I5EA 2DTEA 1TT5B 3FOBA 5K6RA 2CHFA 1RTTA 3WKCA 5M34A 2VAWA 3NATA 4YMSA 2Q7OE 7AT1A 4OI2A 1G2OA 2ZSHA 5K0ZA 3JAWB 4OBBA 1DIOB 1KR2A 1UBFA 5KU1A 1FJGB 3WL7A 1OQAA 1GGMA 2G5PA 3G68A 1EBFA 1H6BA 1B43A 4L7QA 4LGVA 3TLZA 1JYSA 3FXAA 2I7XA 4JJ8A 1KPGA 3DCJA 4ME6A 4OU4A 4UTOA 3SS7X 5JIBA 3LV8A 3HVRA 1REQB 4DCOA 5HUJA 1QVWA 2C7QA 4N12A 2F1HA 5G53C 5BXYA 1I4TD 3PICA 2QVCA 4I5GA 2BUCA 1ARZA 1XD9A 2I4NA 2Y9MB 3ML1A 3HVIA 3WJ1A 3LT4A 4WNAB 2ZYVX 5EQDA 2P90A 3T35A 4BIMA 2XJ4A 1YNOA 5C1IA 1E1KA 1AURA 2QW1A 2OSBA 3PFNA 4B71A 5JE8A 1JQLB 2WKRA 1Z4IA 3O75A 1SC1A 4IHJF 4TVBA 3BB4A 4RD1A 1FQOA 4BVFA 3VHXB 3VTZA 3REQB 1DJNA 3DE6X 1QGED 5LOVB 3KWLA 4F38A 1V3TA 4Y98A 2Z2ZA 4B1FA 1OR8A 2J9FA 4L0DA 5KU7A 3C97A 3FTPA 2NOAA 4WXRA 4HUTA 1H9CA 2QRVB 3KKPA 4HAYA 2HA3A 3DAFA 3CH5A 2J9RA 1V5EA 3C8UA 3K0BA 3Q85A 2Z3WA 5AM5A 1ENPA 1LQTA 3OZTA 3TPCA 2ONKA 3ZV6A 4OGWA 3SSOA 3TE6A 2B78A 1TM1E 3K8QA 2IUSA 3AB3A 3U7JA 2DKFA 3S2UA 4O2BF 2GVNA 3RANA 3VU9A 1T5BA 4MGIR 4IJVA 4A8JC 5BPFA 3QKSA 3QKUA 4QJ5A 3IBSA 3CWZA 2GHRA 5HZMA 3WL4A 3ZN2A 4ENVA 1R88A 1Z6XA 1TW3A 1G8PA 3H83A 3MELA 1GM5A 1K3UB 4KK4A 1X7HA 5ALRA 1BDMA 4OAPA 2FNAA 5ELLA 3TS1A 2OVBA 3M3DA 1U1IA 4TMKA 4XVRA 3TW4A 2P35A 4UHKA 3TLEA 5JNTA 4US2R 3BCUA 2I7CA 2CLDX 5DMHA 3KQOA 1ZL0A 3V4VB 3FYHA 6ABPA 3HYCA 5ALQA 4ESEA 4ZU1X 1AQNA 1GSIA 5K45A 5H8WA 3WLHA 4QD3A 2G1PA 4UZSA 4JB8A 3TNYA 3VISA 5BY2A 4QBTA 4PNEA 2FCAA 4Y6SA 3R9KA 1G8KA 4DYHA 1BRTA 1RC0A 4RDHA 1CZOA 1XXHB 4JT2A 1LI4A 5H3HA 5JVDF 5CVCA 4B47A 3ND9A 3PYLA 5DNVA 2YCBA 1DAGA 2P9CA 1KYXA 1XYYA 2MWMA 3DP9A 3PLRA 3W8EA 4PQFA 4QHSA 4AN0A 4W1QA 2FPKA 1WE2A 2AGVA 3S2ZA 5FUWA 5JCJA 2X6QA 4OHCA 1K1EA 3NIFB 4AULA 4LWZA 1M66A 2V1UA 1XQXA 1Z2OX 4PCUA 1NVKA 2E4UA 1NI5A 1EZ4A 1O3YA 4GM4A 3CUWA 3ZE0B 5LMNB 1NE2A 2IYXA 2VSXA 3AR7A 4P7GA 2FCRA 3FCAA 4MKGA 4CVNA 4D9MA 4TLMB 2WE8A 1MLDA 2GBFA 4IDCA 1ZSYA 4B7CA 5A5GA 5BT8A 4V1CI 4EHAA 3IV6A 3U6BA 2J7KA 5LYYA 4F92B 5KX5F 2JVKA 2G8LA 1V5GA 3BX1A 4Q39A 3OY2A 2X6RA 2XTJA 2O05A 3BRQA 1C3OB 4QOEA 4DMUB 4DRXB 3FGPA 3H05A 1X1TA 1NA5A 2I1LA 2QJRA 4DG8A 4P7BA 1NBEA 1YBAA 1X39A 5ADVA 5AUPB 5JVDA 4FZJA 3JAWA 1N5KA 4ATNA 3E9NA 1CUCA 2D3TA 1FS4A 1GUZA 1I5EA 4X8LA 4UDNA 3JQFA 2BFFB 5A5EA 3NBAA 2QZ4A 1PR9A 4UHEA 2A7QA 4PSCA 1P2VA 4AW9A 4DB2A 1UJ4A 3FPFA 3QXGA 4PICA 4YRDA 4F3RA 4TN5A 1YE5A 3HU1A 3WFJA 4B7XA 5F5NA 1KA9H 2WIKA 3CUSA 2C03A 3GP5A 3R5HA 5LLTA 3FUXA 1DTSA 1RWOA 4DLWA 1N8KA 1JHXA 1J22A 3PFGA 1EUDB 2DUWA 1DKLA 1WW2A 4DQKA 2WJAA 3EULA 3PIIA 1GGEA 1X7WA 3NHAA 2H6EA 4JWKA 2WF9A 3WLSA 4YO7A 2B35A 4IUBS 1SOAA 4GF5A 4KRGA 5DTRA 2K7FA 4TYWA 4UCFA 1RT9A 1DBPA 2ONYA 3GNQA 1WULS 3GUYA 1OGIA 5AM4A 5KJCA 1DBWA 2M1ZA 3L43A 5L8VA 1XQVA 1K8ZB 5G3ZA 3PRYA 2FSPA 3KWFA 4EJ6A 2JAPA 3IBFA 1UZUA 4DIUA 4ZYZA 5BXQC 1CLUA 1I8TA 1MP0A 3K20A 3K53A 1ZNQO 3MT9A 2Z0MA 5JDCC 4BBJA 1LS1A 5AVTA 1P75A 3C1UA 4Y9UA 3E1SA 3HJAA 1R8QA 1E20A 3M3HA 3M1IA 2DFPA 2FWNA 2A4MA 4LXUA 4C4ZA 1UXIA 2ANBA 3DBOB 4MVJI 3CNOA 4TV8F 4Z2YA 4N5MA 3P0JA 5F21A 3WOVA 2XTNA 4DUYB 3T3MB 2JFOA 4B75A 2QUKA 2Z2IA 1UQTA 5DSXA 5L51A 2RKOA 2AMVA 2HMTA 2J3IA 2BFCB 5DGTA 3UV7A 4AZ3B 1I3NA 1WZ2A 3NV9A 3IQIX 3Q88A 5CVJA 5ALGA 1IQ0A 3G5UA 3GGPA 2XUDA 1ZOLA 1NVTA 2JKYA 3P1JA 2AI2A 4CM9D 5FI3A 4NZYA 5JD5A 3RHSA 1MOSA 2GF9A 1UJ5A 4WX2B 1G8YA 3ZQJA 3NO4A 2HU7A 5CA0B 4RPHA 1O9HA 1SD2A 3GA7A 3CO5A 3KQPA 4CL0A 5KYTA 3HBAA 2VQ6A 3R7AA 4OQMA 2IV2X 3W5SA 2IU6A 4J91A 3JYOA 3TMAA 3GJ3A 4YRBA 1NXTA 1WNFA 2O07A 4U7FA 5G1NA 3DD5A 1ULTA 2Z5LA 4R16A 1ODTC 4J16C 1V48A 1EGVB 2BHRA 1SCJA 2LKDA 1MG0A 2XSZA 3GJRA 4EVQA 1N0VC 1GCGA 3IO3A 2GCOA 4YJ3B 4WXEA 1CUHA 4RA6B 3OKCA 2D1FA 3T4XA 1HG0A 2V74B 1HEYA 1U1FA 1EVJA 1VI6A 4ARZA 1TA0A 3O83A 4I6JA 3DEAA 3SEZA 2J87A 1KRXA 3NEPX 3D81A 1VIMA 1Z0AA 3LC0A 4J0HA 4P0TA 3V00A 1I2AA 4A8TA 1C7QA 2OORA 1K68A 3N0RA 3OFVA 1KNQA 1NVDA 2QZSA 5KBYA 1ADFA 1QJCA 1YMVA 1S5PA 2CUNA 2DHQA 2ZWMA 3FETA 4Z0PA 5LA6A 3VM6A 5DNCA 5JPDA 1OTYA 4RVOA 1ZMOA 3I2HA 3CRMA 1RLJA 1WD5A 3IUJA 1IN8A 1OU4A 4Z4EA 2X4LA 3EGVA 3L41A 4ZDWA 1BMDA 4KRFA 4XSVA 3PKZA 2R11A 3HV2A 5J2TB 4HGQA 3MMZA 2EBWA 3M2PA 3DM9B 1G9XA 2I6QA 1E5TA 2VUTA 3GC6A 3HUTA 4TTVA 4XIJA 3AKZA 1Z7YA 4JNKA 5I4IA 2YJGA 4AKHA 1RBZA 1X1RA 4E5DA 3KVRA 2FEAA 3W3AA 3KKOA 2EGGA 2VIIA 3OMWA 1II8B 2RHWA 3ACDA 4OBWA 4BJ3A 4N18A 2WD7B 4XDYA 4QARA 3NWEA 4I9NA 1NW6A 4REQB 4JLDA 1E0AA 2XUJA 2J3DA 3GU3A 5DB4A 2P6OA 3QW4B 3VVLA 2DOKA 3PGXA 5AOBA 4G24A 1DBVO 5AI4A 1SXQA 3ELBA 3WNCA 1N2HA 3T34A 5HCIA 4MW9A 4ID9A 3IC5A 3ZU3A 4D4IA 1RQ2A 2PX3A 1B3BA 3HHPA 1N0IA 1UK7A 3VYUB 4MEBA 3GMIA 2JZNA 3U80A 2VHTA 1UF9A 1M1NA 1N1GA 3RRBA 2JJ2D 4FFLA 5JJBA 2X14A 2NQTA 1YJAA 2PDAA 3HDVA 3KG2A 2JCGA 1FVFA 4KV7A 4D3DA 9ATCA 3U7GA 4AQDA 3W5JA 2QVZX 2P2LA 2WNIA 3THSA 3ZWQA 4ACAA 4DR6B 4BCDA 3A9UA 4ZZ0A 3UOWA 1GN9A 2BE7A 1OAOA 3UWKA 1D5WA 3AUUA 3A6EA 3CPSA 5A9SA 4HYTA 1M2VB 3W5IA 3PUYA 1FRZA 1L7VC 2NVWA 2Y1EA 2ZT7A 1G55A 3B1WA 3EW7A 5A9RA 3F6PA 1U5CA 1VI5A 4R8VA 3UAOA 2NV2B 1BRMA 2EW2A 3HJTA 5KTMA 1Z6GA 2P9QA 1YZ3A 2PV0A 3Q0EA 1MJ5A 5SYMA 3K8OE 1L7DA 4IG9A 1MDFA 4BCBA 4EQ6B 4F2DA 3W4KA 3OZEA 4RK5A 4C7KA 2Q2OA 3T9FA 5HRAA 3BFKA 4PZPA 1LC3A 2ARKA 1R7RA 2ZCUA 5CURA 3PSHA 3WNBA 4R81A 4G63A 3EPRA 2QN9A 4INJA 5FD8A 3TW0A 1M0EA 4RKYA 5BR7A 1BH2A 1TO1E 1XHEA 4TV9F 4AMVA 4UNIA 2X0FA 1W8IA 1FYFA 1GZ3A 2OHGA 4QYSA 1Y7TA 2FH5B 2VJBA 4DUGD 4QTYA 3VNUA 3JYPA 4LDZA 1Q3KA 3U17A 3NIWA 3JQBC 4HL6A 3KLOA 1A4UA 3CKMA 1GOTA 2P11A 3HLTA 4MQEB 4DILA 4YCMA 2FPIA 3KZMA 3GCDA 1Z2DA 2VSFA 2R65A 1CUJA 3OCVA 4NARA 3ZJVA 3CSDA 3FCUB 3SC3A 4G89A 3S8EA 2IU0A 3CCBA 4GOLD 2ISCA 5IC4A 3HZRA 1HDOA 5G4KA 5LXTF 1SWVA 1SA0B 1FUUA 2FHSA 3LA6A 4JKYA 2FW9A 1K8YB 1OOEA 1VJ0A 1QVRA 5I8PA 2QX8A 3AL2A 4N47A 4KXQA 2R97A 4WY8A 4JLAA 4TQAA 4P5DA 1G3RA 1N3IA 2RGCA 3PC7A 1L2TA 2C5FA 5DCUA 2HUNA 5TQ2A 3UJ9A 5BVHB 4E1VA 2P2NA 3FDZB 3DBRB 3BGWA 3DTNA 4HAUA 4KYTA 3U3XA 3KL4A 3PU6A 1ZAKA 2DHCA 1PT7A 3OMLA 4OIMA 1UBNA 1S2MA 1SBTA 5MHTA 4K88A 2W8BB 2WHPA 5GONF 1PFYA 3T3EA 2YR0A 3CNLA 3ZEIA 1DQPA 3DNMA 2JIRA 2HO4A 3B52X 2AI1A 2RJNA 1NMZA 3FZYA 3KPYA 2ZB4A 4I1IA 2E82A 1YH3A 1UBMS 4AY6A 2PLAA 4NBVA 1J9GA 1P33A 2HDOA 3DWEX 4NCNA 1JDUA 4R69A 2VSNA 2X8AA 2PH1A 3BF7A 4TUYF 1N75A 5M3BA 1S3SA 1A0OA 1PK8A 2CXXA 4AUMA 4ZRDA 4OXYA 2BZGA 1WXWA 2VF7A 3VZSA 5LXTB 1NF2A 1OFHA 1W5SA 2L42A 5I4KA 2PSDA 1NUUA 5DHFA 4GO1A 1QQ7A 1XMSA 3H4IA 5LP6C 4J1SA 4LF6B 3FWHA 2CLHB 5DW0A 5ITVA 4Y67A 2XGSA 3DPSA 1UBUS 1XRLA 4EJSA 1JG1A 4Z3DA 2NZWA 2HB6A 3TF5A 2FTKE 1ZVMA 5FT9A 4XD7D 4XCXA 5JSFA 1HBJA 1IZ9A 3HB5X 2I8LA 2GRAA 3ETCA 4LECA 2BIFA 3R5TA 1NMEA 1X1EA 2FDXA 5T57A 1CS0B 1I13A 2FZWA 1K88A 1KOGA 2B8EA 1VTKA 2BBOA 2WKQA 4UBMA 1M5TA 1J1ZA 4YALA 1XN1A 5KI6A 4XDHA 3ZKWB 4NS1A 3JTMA 3NPMA 4DDKA 5TGZA 4ZT6A 3PA8A 5I7FA 1MTOA 2G04A 1KAOA 3SZ3A 1U7UA 4LI3X 5E3IA 3CLRC 3WYBA 4EITA 3U37A 2G70A 2RONA 3ZVLA 1BXZA 4GE0A 4JZKA 1NV8A 1JPUA 1US8B 3T9EA 3TI9A 5BR1A 2CMDA 3UKDA 4IH9A 3TQFA 3BWMA 3KFVA 4L28A 3MLAA 2PD3A 4ZYLA 1MAWA 4GE3A 2WEKA 2R7NA 1Z0UA 2XR1A 3LSTA 3AIOA 1U8FO 1J8YF 2DECA 2FPPB 1JR3D 2GK6A 4RZUA 1TCCA 5I01A 3FHOA 3L4BC 1KMHB 2KWIA 3LQ2A 4L8YA 4DMMA 4PVDA 2H11A 4ZAZA 2H1VA 2O0LA 2PKWA 4NDNE 4QVGA 3WA6A 4A16A 5HKOA 2Q0XA 1P7WA 2ATEA 5FOVA 2Q1YA 4WADA 3SVLA 2G1AA 4LE2A 4ZKDA 3K5IA 1HRDA 1A7AA 1MIOA 2ZBEA 4MTCA 3E2PA 3PDIA 4Q4DA 3CLTD 2QIPA 3VR5A 2XDQA 5DXJA 4D3SA 3RUEA 1IQPA 4RGBA 4YUXA 4YCLA 3HBFA 4QFCA 1R27A 2Q0SA 3NP7A 4GIBA 5JCXA 3T5GA 3U19A 1ND5A 1S2GA 4P0PB 1V1JA 2ERCA 1GTG1 1RJ9A 1YB4A 4LJ4A 3RARA 4N5HX 4BYGA 4JI3B 5LM3A 1TC2A 4Y7DA 4YV2A 3FYUA 3QWFA 1W36D 5FRDA 4WNAA 2FVYA 1PJLA 1TYEB 1JF8A 2FSGA 3HL0A 4QBKA 3TL6A 2FDRA 4G5YA 2G5TA 4G5OA 3RC2A 3VZBA 4HZIA 5LZ9A 2I6FA 3RIXA 2QRPA 5ALHA 3T7SA 3OESA 4BLOA 5DOZA 5IC6A 3A9SA 2C84A 3P9ZA 2W9XA 5DEOA 3QVKA 4PLGA 4PGHA 4Z4GA 3IEMA 4OL9A 1RXEA 3ASYA 2WHXA 4LOIA 4FGKA 4IHQA 1SXJC 1TEXA 1U3UA 1MC4A 4EK9A 3I6IA 2Q2VA 4EUKA 2XD4A 2UUCB 4U02A 1BE1A 2VDVE 2QT1A 3TIVA 1NVVR 4N0DA 2HEIA 4KQJA 1KK0A 4MIYA 4DW8A 3RYFB 2K4MA 4F8JA 4G5GA 4N7RA 3FCXA 1XDZA 2A9KA 4Q1FA 4UTRA 2WYWA 4R7TA 1JFTA 3N5CA 2C9OA 4KODA 5G0VA 4D6YA 1YZQA 4PTYA 1TKBA 1TKRA 3GN2A 1PZEA 3VU8A 4PC1A 2H1LA 4EX7A 3NKFA 3AR2A 2CK3D 4PZ0A 2PE5A 1KS2A 3GJ0A 3GZ4A 3RFXA 1G3MA 5D1NA 1HE4A 5COBA 4HAWA 4WE3A 3GAMA 3U4AA 1KMIY 3ZNQA 4DR3B 1A9PA 4I19A 2PY6A 4D81A 1XZNA 3WLAA 3I72A 2H63A 4EW6A 1VC2A 4PAOA 4QOHA 3RNOA 5BNTA 2BSAA 4L6IA 1S4MA 4P4SB 5HZHA 3UWSA 3BHJA 3H5TA 3PUHA 4IH1A 4MRPA 2HIMA 1FU4A 3FMGA 2D5CA 1TF5A 4JLWA 4R2XA 3T7AA 5KPDA 4DZTA 2R62A 1XRMA 4FQ5A 1ZKMA 3PTAA 1Y3FE 1PNQA 4ZQBA 1JXMA 1V3VA 3AUSA 2VI5A 5A4FS 8GPBA 4GGMX 4P86A 5EWJB 1RWPA 3EH1A 4OHMA 3ZGLA 4CCSA 4R0MA 2ZIGA 1DRVA 1J2YA 4MW4A 1F9AA 4NABA 1QIFA 1PVDA 3OZDA 2Q0HA 1H2XA 4KFCA 5CP8A 2PMEA 4C7VA 3DWIA 2IF2A 4FZVA 4HLUC 4DG9A 2J5QA 4GC9A 4M89A 4ERXA 1E1QD 3UG7A 3BIXA 5IZ4A 5IWCA 1YFKA 3F78A 3FWNA 2PKXA 1SU7A 1CJMA 5FPTA 2WVHA 1NR7A 2IYRA 3AHEA 4ZYYA 1WMAA 3F67A 2FWRA 3MD0A 5CH3A 4DYDA 1VXOA 2AB0A 2JGRA 3O03A 3QUQA 2NU7A 5HNKA 3D64A 1OIXA 2EDCA 3UTCA 2ONJA 3AM1A 3Q6NA 3PDIB 5I3ZA 4YCAA 1OXUA 3DV0A 4XQCA 2HWXA 3QWHA 4L5JA 2K2QB 3R5SA 4FMDB 3P9CA 4UUOA 2LCIA 2JLWA 4RTJA 2FSIA 4UD6A 2HRQA 3D9QX 4NZ9A 1NNUA 4G0XA 1GR0A 3L05A 3ZLBA 1DKNA 4DWOA 5KEIA 2I6UA 2NMVA 1M2OA 2AC2A 3MCTA 2H8GA 3AJAA 4MR9B 4GICA 4DHWA 5FADA 3GFOA 6PFKA 5AI5A 1BDHA 1VB3A 3CCCA 1KO1A 1HORA 2ZS7A 3K6RA 4F8YA 3RG8A 3K3PA 1R9GA 4FIZA 4AI6A 1SH7A 4OFXA 5IJAA 5KSZA 1E3EA 4MVJD 1KY4A 1U8YA 2GK4A 4XRGA 5LLDA 3W05A 1Z15A 1CUXA 2QAGC 2C61A 3FVTA 4HD8A 4UAVA 3I1YA 4ZT2A 1Y7IA 3M1YA 1W5FA 1JWBB 4BZZA 5INTA 3ISTA 1ZHFA 4RO0A 3PIDA 1E6KA 4XJTA 3K1ZA 5T8KA 5KNCH 4YRTA 1NPYA 4EFDA 4XLZA 1QKIA 3NASA 5BMVB 4P54A 4QYTA 4DJJA 1ZICA 2X9GA 3I37X 3OM8A 3SFVA 1EVZA 5TGTA 3RRFA 1NFQA 4BFLA 3PC4A 1NZJA 2VDMB 4OU5A 3T9BA 1UQUA 4YQYA 4Y7CA 3PNKA 3GRPA 7REQA 1R74A 2HSWA 5BOVA 1VPVA 2QSZA 3HGMA 5AWFC 1ECJA 1VKZA 2H2AA 1PJCA 3O2NA 3NHLA 3CUYA 2G1KA 4DOMA 4FR0A 1KU0A 3Q98A 4ZGGA 4IDDA 2Z58A 4UOZA 1ATZA 3WGKA 1E1MA 5BQOA 1X94A 1LRJA 3WIVA 2ACEA 3CEJA 3RWBA 4E5YA 4QA9A 1OI7A 1WO8A 1KI8A 3BHIA 4P3XA 5EEHA 2WM9B 1MABB 4O4IF 3HZHA 4PU0A 3ZCRA 2PWZA 1UJCA 4UULA 4PLZA 2AZ4A 2OV2A 5DLPA 1RPAA 1QHFA 3E3NA 1DE0A 1UEXC 3IP5A 4Q5IA 4U6SA 1U28A 3IAFA 4O29A 3H16A 1ZVJA 2V7VA 1M1UA 3DE5X 3K71B 2WM2A 3E15A 4V0OA 1P9OA 1UOOA 3SJZA 1T4GA 4DBLC 3VZRA 1WXFA 4XDGA 1QHHA 1I30A 3UQZA 1TADA 3GPLA 1HNXB 3RS4A 5LSAA 4UHHA 1QDLB 5HE9A 2C4VA 3IMCA 2BUBA 5CFOA 3DR3A 1Q22A 4ENRA 2UZ1A 2Q7XA 4ZPXA 3KPUA 4WNCA 3WDSA 3WLQA 2FZKA 3VZDA 2DXIA 5BSKA 1RWXA 4OV6B 3WYCA 4AZ0A 3DFZA 2RBGA 4IXDA 2AOTB 1NF3A 4P33A 4KAJA 3U7QA 1WD7A 1ONOA 1Q44A 2MDTA 2EHDA 2QE7A 1HK7A 4OBEA 1B1AA 2Q4BA 4GI7A 1QOPB 2PZLA 3QNUA 3OEWA 3K70B 2V6FA 4ZHQB 1DV1A 1LXCA 4Q9AA 2P91A 1NBAA 4XVHA 3W5BA 3H3XA 1DEXA 3KBOA 4OQPA 5FQOA 4ZV9A 1OX4B 4CCWA 4ZVSA 3W8DA 4EG1A 3DE7X 3RODA 2PH3A 5JXJA 4KQFA 4UVIA 1QAQA 1VHLA 1Y5IA 4MW7A 1L7AA 1DTWB 2XMSA 2ZREA 4Y1GA 2VK4A 5EE0A 2XYGA 3HA3A 3UHJA 4AJ1A 1MA3A 1GD1O 3GGSA 4TWBA 1ZJWA 2VUHB 4GLOA 2JHCA 1H3FA 4LZOA 2FUEA 5CU7A 3L8FA 3R9XA 5CB0A 4ENTA 4Q1AA 1DKQA 1TQ6A 3OZIA 3V8BA 3ZU6A 4GRDA 4PXSA 1UWVA 4X24A 1YI0A 1WA5A 2YN2A 2PO5A 4FGLA 5LKRA 1Q6ZA 4G8JA 1L5LA 2K6GA 1XC7A 4UARA 3TLXA 1OGYA 1RZUA 3V3TA 5DHSA 4TT3A 5KB3A 3IRVA 4EGJA 4BVHA 3PWTA 1A2QA 4EKIA 4DFDA 2GN8A 3KQYA 4LHEA 3R7NA 1NOKA 4EHKA 5JJ5A 1XLTC 2AG6A 1MRNA 2HIAA 1IM8A 3LKVA 4HNQA 4CFYA 4L0MA 1OW3B 4LSZA 1NXPA 4A5OA 2PUDA 2IELA 5HEKA 1RC1A 1AQUA 2YIDA 1W4CA 1T35A 3MTIA 4JUIA 4XQEA 4N9WA 1P0PA 3IDSA 1M1YA 4JQSA 1Z06A 2WA2A 4DSOA 2J30A 2PMCA 4C07A 1DX4A 1Z6YA 1X87A 3NAMA 1DG3A 2ZUSA 4FNGA 3D43A 3U4DA 1M2VA 1AKNA 4KO8A 3TX6A 1O5OA 5JQGB 3H4VA 4OK5A 1JVNA 4JL5A 3BWXA 4OQDA 1Q0LA 3B7GA 5CB4F 3KR2A 3N0VA 5E6UA 5H1YA 1LNSA 3FPSA 2V7PA 3FNQA 3SQNA 1M2KA 2NU9A 2QL6A 1H69A 3BF8A 2J08A 2WP8J 2ZR7A 3HWRA 2CXTA 4MV3A 4UCWA 1A8QA 1KJQA 1C3VA 3TYXA 1NF8A 4TWZA 2Z30A 3DNFA 4YJ2B 1G64A 1YZTA 2O6LA 3MRTA 1ZU4A 4JR2A 3PI6A 2O7QA 1U7ZA 3C48A 5LZ7A 2A35A 1MO2A 3IOMA 1KPHA 1U99A 2FK7A 1E3SA 3ZGOA 3WE7A 5JH7F 5K8CA 2HHHB 2HK6A 2QXTA 1NVVQ 1LTQA 2FEKA 2RGNA 2R1VA 3QFCA 1NKSA 3ISJA 3UHPA 3MWEA 4ZU6X 2FRDA 4FR2A 4MZDA 1SC9A 5EQTA 5FWAA 4YWJA 1JSZA 5KMGA 3E8MA 4BMXA 1JXAA 1QHYA 2FMKA 3H2JA 3MJCA 3IR7A 4QG7A 1V35A 4BEBA 5JBNA 3SYTA 3UBTA 5I9TA 3BRWA 4KNYA 4FBLA 3SF8B 4HEJA 4PPFA 2FJUA 1R5JA 3RHFA 4EP1A 5LMZA 2Y0DA 3AQIA 5HIJA 3QVLA 4OXRA 5B6IA 1NVWQ 1SFRA 4QHTA 3J7TA 4E33A 3THYA 3OFND 1NRIA 3DLIA 3IFSA 5JPIA 3R76A 2GAOA 5EXPA 5IP5A 5CDTA 4CIYA 2X3FA 3M70A 1M6NA 3B48A 5DDIP 1PD0A 1KE1A 4JLBA 5AW1A 3GA0A 4ALMA 3WGNA 1XZHA 421PA 3AETA 4DIKA 1HDIA 3O8NA 3IESA 4FFBB 4WZBB 3GRVA 3N7UA 5GTDA 4UEKA 3IJEB 5CEJA 5TR9A 1WDWB 4FLMA 4O2AA 4MWEA 4KRYA 2OM2A 4OYLA 1R8XA 1ZAYA 4TV9B 2W6ZA 4DANA 3UQYS 4EKDA 2RC6A 4HMPA 5JFOA 1CX9B 3BD6A 4WDRA 5FTKA 1AM4D 1AKYA 2GDJA 1CUDA 3I34X 3BMNA 1O0BA 1K0FA 4PANA 3VXKA 4M8IA 4NBLA 2WZQA 2EBHX 3TG8A 3SZOA 2XMPA 5EZYB 2NVUB 2AC7A 2F90A 3EEIA 3SMQA 2I2WA 5JRJA 3PPYA 4E14A 5ALNA 1ZMRA 1DFGA 2QN8A 1P1HA 2VTBB 3OT1B 1RHKA 2YWRA 3I2GA 1LLFA 1XNHA 2WWXA 3OWOA 2O7NA 1IJKA 5I8ZA 4AZTA 4ED9A 3BL8A 3WWOA 1T5IA 4DIOA 3N2LA 1IULA 3MBIA 5F52A 5LB4A 5LQDA 3Q5DA 2QN7A 3N0WA 3PC3A 2EEZA 2WJ3A 2J09A 2XXAB 3ANNA 5K6AC 3QSGA 4MJ3A 4KGVA 1NBHA 1M8KA 2ECKA 2MYNA 3SQWA 2I87A 3O90A 3ER6A 4QDZA 2XIJA 3OZAA 1C4WA 1WR8A 2F55A 4P22A 5DRTA 4YAWA 1Y9EA 2YRXA 1GYQA 1M3SA 1HNNA 1MRZA 3HY6A 2HU8A 3LXXA 4WFJA 3I73A 5FR1A 3AVOA 4TROA 4RH1A 3L7JA 2C96A 1RCUA 1W1IA 2NQ8A 1UEJA 4AO6A 3HM9A 4G26A 5LOVA 3PXCX 4EH1A 1LSSA 1ISGA 4FXPA 4IDNA 2ZJ6A 3UYLA 3HU5A 3BIJA 4UHCA 3ZR4B 4QXRA 4QM6A 1KAHA 5TX7A 2EIXA 4CCYA 1UMDA 4LISA 1FQJA 2GN6A 5E6SB 6ADHA 1QIDA 3KIPA 3GAFA 4KQMA 4P83A 1RYHA 1Q19A 3FJOA 1RYDA 1SKQA 4HV4A 3HNPA 3O94A 3NBUA 4ENUA 4OQFA 3E70C 1L4YA 1HF3A 4LQCA 5E7JA 2A9QA 2LCFA 3C1TA 2GRUA 5JYBA 2HMAA 4BE4A 4ASUD 1BG6A 4X20B 2PKCA 4BO9A 3CB2A 2ZE7A 4KDEA 1VBKA 4QSHA 5H59A 3VI3B 1WKCA 1GA4A 1LJLA 2F1KA 1TZCA 2P9ZA 4ZVMA 2VHEA 1HWYA 2Y76A 3LUDA 3GEHA 3QV1A 2VJDA 3WBBA 5KAMA 1SHLA 3FUVA 3FUWA 1B76A 1CF4A 2NNWB 3G5AA 2EZ8A 2OLJA 3ZDQA 4Y2RA 4DPKA 2PUBA 2PVPA 4QQRA 4B6RA 1E89A 2HBZA 2J4FA 5A62A 1HO3A 4F4FA 1IJBA 5CEEA 3WJAA 5EKXA 2EX0A 3KKMA 1BCSA 3IKVA 2W2MA 3PUVA 4I1SA 4K0RA 3V4RA 4ZYWA 1ZX1A 2NVBA 3UT6A 4BGVA 4KDCA 4KN9S 3ZWOA 4LCJA 2GZSA 2R25B 4CM1A 2UYGA 3QEBZ 4ER6A 3UK2A 1TU0A 1G1AA 1RTKA 1VSBA 3ETJA 3LDHA 5H02A 4F60A 1HT3A 1X7ZB 4ZDIA 2WU8A 1R5NA 2PGDA 1EWTA 4L9AA 1QH8B 3G6KA 3QLUC 3ZUGA 4BAGA 3WYAA 2OB2A 4KRXA 3PFIA 4EHFA 3F4BA 4QQFA 3KOYA 3A1NA 4BQOA 5IAAA 3CCFA 3H8VA 1AZLA 2GNPA 1IZ7A 5KJ6A 1I4LD 2Q5HA 2UZ4A 3EQ2A 3O9ZA 3PQFA 3H2BA 4AP9A 4PRZA 1OA1A 2Q4RA 3K9NA 1B1CA 3WRWA 4I4LA 1SHJA 1BXKA 3V4OA 2FG5A 4E88A 4F3TA 4KQCA 2QRZA 5KTKA 2QJOA 1B2RA 2PSSA 2R2AA 2PMBA 1RHJA 1BKYA 3R3HA 4P32A 5F7JA 5HKLA 4CKBB 1ADBA 2WM3A 1U0SY 4F96A 3G0DA 4I55A 4BNDA 5JADA 1AZTA 2QJFA 1JEYB 2E48A 4C3VA 3KHKA 4S1OA 1SBNE 2CNBA 3HCCA 4L3WA 2OORC 1S01A 5CK5A 1T1GA 5E6RB 4F5EA 1YRHA 4MVJH 3BMQA 1I32A 1JG2A 2GBIA 4COKA 1L5ZA 4MVJG 1O6ZA 3V5NA 4DC1A 4EFNA 3P2YA 1X8KA 3LUGA 1J7JA 3R44A 3IAAA 1UDCA 1VG8A 1UIRA 4XX1A 5AKHA 2ASVA 3K2QA 2O8DB 1P81A 1NN0A 3KSRA 5EI5A 3K5PA 4IIBA 2E55A 4R1PA 1DAOA 1KI6B 4HXGA 4IR7A 2EXXA 2WTXA 2ZJ7A 1ZK4A 4LK3A 4NV1A 4XVQA 5DPMA 2G4VA 3D0RA 3MYRA 4P8RA 1RYMA 1USGA 4H7DA 5D6OA 1DI0A 4C0HA 3KR0A 2QDXA 2C2BA 5FJJA 4D2IA 2I1VB 4F4CA 2XT9A 2P2CA 5FX2A 1Q50A 1H0SA 2LW7A 2ZIXB 4K9QA 5FBQB 4DIDA 2Y6VA 4ND1A 1R4NB 2GHTA 2IIBA 4DSUA 1K4KA 3P97A 1SG9A 2FPLA 1OFGA 4Z9YA 3AB7A 1NP7A 2BM9A 4IGAA 4IIJA 2EQ5A 2ZU0C 3M4YA 1KF0A 5DLYA 5JANA 1GPJA 1U9JA 1ZLYA 4R6WA 2ZAIA 5HDQA 3O8DA 1UODA 3N6RA 2W70A 3SHWA 1R0ZA 2W6JD 3IE2A 4TYMA 4FJ2A 1VMEA 3ME5A 1WNTA 3ZHBA 4PCAA 3G0IA 4XCVA 1Q20A 4A0FA 3A3NA 1X74A 4DBLE 3VO1A 1HYBA 1IY2A 1X2EA 2CXOA 3IDZA 1PR2A 3P0FA 4RKRA 4L3OA 2JI7A 3TBHA 3IDQA 5KWSA 1CDZA 2GKOA 2D4AA 2GRJA 7GPBA 2C07A 1VLHA 1ZCBA 3NHZA 2BRUA 4QTZA 3S68A 4YV7A 3OCXA 3TNFA 4H7KA 5JXHA 4LX0A 3OWXA 1BJTA 2V7EA 2DBZA 5EJ5A 1P3JA 3B70A 4NONA 1KSHA 2NAPA 4AYXA 2OFFA 4CTKA 1INLA 2VHWA 4H17A 1JL3A 2UZ3A 2C4HA 4IYJA 4PZUA 5KNLA 3PUIA 5FWXB 3Q7TA 1E3MA 1OFIA 1YIOA 4NAUA 3NBXX 4FS3A 5EIHA 4BO8A 1G3UA 3FSEA 1JEQB 2BSQA 3CEAA 4RY9A 3IBCA 4FVTA 4FSXA 4QXMA 2IS4A 1U04A 3SQLA 1VBMA 4JLNA 1ECBA 5IXSA 3DH0A 2Q27A 1M2OB 5CB8A 1GZSA 1Y4DE 4IVNA 1GQFA 4C22A 4MNTA 4NU6A 1OMOA 3M89A 3SYKA 3IEIA 4OP3A 5IZCC 1U7WA 2I4MA 3MBOA 2WF7A 3U3MA 1XHLA 1TVEA 2JJ2A 1JHAA 5EJ4A 1XUOA 4I14A 3AEYA 3JWHA 2C97A 3TQSA 1F6DA 3TSCA 1E3LA 3OZVA 1KZHA 1KMNA 1GAWA 2R6R1 1LVGA 3R2JA 2DT8A 3HA7A 2DZDA 3DLHA 4EGAA 2PGNA 3OO0A 4H15A 5DF1A 5KNCD 1K6MA 5EIBC 4EI7A 2AFHB 3D4NA 9GPBA 5I4CA 1WQ4A 1YFZA 2VF5X 3A2KA 1LFAA 2E4YA 4C0QC 1IDN1 1X7DA 4HRAA 1XA3A 5EHNA 4ZJPA 5BV0A 3WZ2A 3BDVA 1T9ZA 5ESDA 3IQWA 3NS7A 3OX1A 4EHIA 1PX2A 1UR5A 1GNQA 3RS8A 4CI0B 5KNBA 4XSGA 2EWMA 3AVPA 1N9GB 4I55B 5K3OA 2RGDA 2Q4DA 5E9QA 5LBIA 2HJVA 4W6ZA 4L15A 2ZJBA 3ENNA 5TY0A 2PXAA 1AN0A 4RPKA 3CX6A 3UAVA 1J23A 1L4NA 4Y2TA 3E9EA 2DQZA 3C87A 2ZUWA 3GEBA 3IXQA 3LLMA 2IY9A 3PD7A 3PGLA 4HGRA 4M37A 4RU1A 4U63A 5HX7A 3H2GA 4JR1A 4WCFB 3IOYA 3HB9A 5T4HA 1O87A 1JDSA 4FINA 3V1NA 4ENPA 1FP1D 2WJWA 3HN6A 4TPKA 3DF9A 4HQKA 3VKUA 4YCSA 3T0GA 1DPGA 2I8CA 3RADC 1U9ZA 2PWBA 3L07A 1NSYA 3A3YA 1JSXA 5DKFA 5CAEB 4CM6A 1C4OA 1E2GA 1JJAA 2XDYA 3DV2A 1WU8A 4MUXA 3AJRA 4N8DA 4C4SA 2OWEA 2RG7A 3RSSA 5J23A 1BE8A 3WFIA 3U4QB 1W7AA 4YJGB 3UV6A 2YOFA 5EMLA 4F9GA 5AVVA 2J0UA 1PVOA 5L6LB 5FR2A 4CLHA 3OKFA 2GEDA 1CZRA 3L1HA 1NKVA 2PA0A 3SJCA 3UTDA 1XLWA 3L4EA 4MS4B 5THKA 1Z62A 3HYLA 5BN3A 3FLBA 1T8UA 2VT7A 1R3DA 3FGZA 5LIPA 2P6RA 3RBVA 3NVKI 1TM7E 2ZXEA 5COAA 4V0RA 4GMFA 5JDCA 5EHIA 1SIUA 1SKAA 4KKVA 4AJPA 3QE9Y 1ZWLA 3EVFA 4AQ7A 3N9IA 2DR0A 3L8ZA 4EBFA 4Y1FA 2HK9A 1G4AE 2ECPA 1DC6A 3AUJB 1JHVA 1QGYA 4LHXA 1OWOA 4ZCLA 3U3DA 3DVAA 2GAJA 2QDKA 3C5EA 4QE3A 1E6CA 2HBRA 3RUIA 2JH3A 4DNPA 5JPCA 5JMWA 1OVMA 3S1SA 1QHXA 2PMDA 3FI9A 4HFNA 5TV2A 3ZDBA 3SHOA 4BEVA 3LZCA 3E4CA 3PZBA 4CMJA 4EQ6A 3JQ8B 1DKMA 1E3JA 1SZJG 2H2GA 2AEMA 3S2YA 1UBCA 3P32A 4DEXA 1C81A 3VV2A 4IMRA 4ZIRA 4QOIA 4TXHA 2G0TA 2QUHA 2F00A 2W4IA 4GPAA 4ZT5A 2XUGA 4EF5A 1ISPA 3FZNA 2LDXA 2P4UA 4BO2A 3AHCA 4RA9B 4PAWA 1QOQB 1LPOA 4QNRA 4P7KA 4RK0A 4HVTA 3FZGA 4Z3OA 3BC1A 5T6MA 2YFKA 1A8IA 1CZUA 4X41A 4MQEA 3RAJA 3C39A 3O2JA 5D3MB 5T4FA 3TH5A 3V48A 4WZ6A 4WFQA 2CMFA 2IBSA 2AXQA 4X90A 3ET5A 4X7RA 4GKBA 1A8PA 4LNUA 4W8GA 1XVUA 2XE4A 1OLXA 1T9HA 4G1FA 1X80A 2MOKA 1A9XB 2YDXA 1IK6A 4JGBA 5ALLA 3VOBA 1WB4A 1SU4A 3EXG1 1HDXA 4YAGA 1ZGCA 5BURA 2B0JA 3JD4A 1PL0A 1T9DA 3F9RA 4MS3B 5J5CA 2UUBB 1J90A 4WN9A 1B93A 1TRHA 2VHCA 1GU7A 2DWOA 4HS4A 1YONA 3HVHA 4QXOA 2QB5A 3ITDA 4MP3A 3GRKA 4LKOA 4YREA 2M2IA 1QF7A 2X2PA 1R64A 1I7SB 4GBJA 1NLFA 1RI3A 2J85A 1Y5NA 1Z56C 2GF0A 4C1BA 2GEVA 1QE0A 4JI0B 4FZRA 3H04A 4GWGA 1GKIA 4I1OA 2HDWA 2H2FA 5CVTA 2CV2A 2E9SA 2XZPA 3VNQA 4JS0A 1EFLA 3G7UA 2KX7A 2WC1A 3DLBA 2A14A 3W34A 2PUEA 4WY5A 5KSWB 2WD8A 3RFVA 3ZHUA 4QODA 1XXLA 2DEUA 4G8DA 5IJXA 2VDQB 2PS9A 1MZVA 2HJSA 2XYVA 4PC7A 2DULA 1Q11A 2ZAOA 4F4IA 4ZHSA 4X65B 1RM4A 1D2CA 1QKKA 1S8NA 3KYCA 4LCBA 3K9CA 3S70A 3UJ7A 3T1HB 3LUAA 1QHNA 1CUGA 1X8XA 2ATVA 3CF4A 4ZI7F 1ZVQA 5FFFA 3JVDA 4YT2A 3BBLA 2UUAB 1N4AA 5GPBA 5GWXA 5AO9A 2P40A 4QWWA 1Y5LA 2XWPA 3FF4A 2OCLA 1BHSA 4WWHA 5M04A 4UU7A 3H0KA 1JR4A 3HU2A 4JB3A 5MFPA 2YOGA 4UMFA 2OO3A 1TK2A 4R98A 2QR3A 1I0ZA 1T0IA 4DQ0A 1W0JA 3IYLW 1N6RA 2CV1A 2VFAA 3T1VA 3GGGA 2QE6A 1BWQA 2TYSB 5TIIA 4NNPA 2IVFA 3LCVB 2BMFA 5FULA 1ABFA 1KHTA 2DH6A 1GPYA 1N77A 2YS7A 3WGOA 4KLNA 1UPBA 1VJRA 1RKQA 2NTYC 5DLQC 4WRRA 1PN3A 1PGOA 3SFTA 5KTTA 1IQUA 2AJ8A 3KTFA 2PNFA 3B3FA 3MSXA 1UT8A 4QBIA 4R9RA 1FBTA 2BCGY 1UJNA 4IIDA 5EERA 2FSSA 3W3ZB 1ZXLA 1FDIA 4UNQA 4LZJA 4GPBA 3TZBA 1SXPA 2HJ9A 3KD3A 4HYYA 4EYOA 3CONA 1V1RB 2NM0A 1UPAA 1T0HB 1W5EA 3AJ8A 4ZXPA 2FPUA 4IEFB 4TM8A 3D8TA 1TA4A 2XWQA 3WLTA 4DUPA 1TDJA 3K05A 3LDFA 4KQGA 1ZUHA 1E0KA 4O3FA 4BQIA 2LR0A 1PQUA 2OG2A 4LRSB 1EPUA 1C7EA 3HGTA 1PEAA 3BTSA 3OTQA 2WZCA 4UCQA 4BFVA 1CFZA 5DYYA 4CM9A 3BULA 2E5FA 2JAWA 4UM7A 3ZV7A 2B34A 2EQAA 4LDJA 3TTVA 4DMGA 2A6PA 3DQQA 2HMYB 2Q6OA 1C9YA 1Z37A 3H99A 4U7TB 2E21A 2NO4A 4ONEA 1PR0A 3NR2A 3IJ5A 2NV0A 2EX4A 3D4PA 5CXSA 3D6AA 3MIIA 1SELA 1RWKA 2YWEA 2FRVA 2A88A 5CDYA 4S04A 2ZKLA 3JQDA 4MQLA 1TCUA 3HR8A 1Q3HA 2Q1SA 1Z38A 1M2EA 4MO9A 1XZIA 2ZJOA 1EXVA 1DNPA 3J81A 5EMKA 4IDHA 4EF6A 1G5QA 3QV2A 2II6A 1Q21A 2J3MA 4AQYB 2IEGA 4JLSA 1WXEA 4WBXC 1DQNA 1DQSA 5GJWC 1XT6A 4XVCA 1ZI8A 3AKCA 2JVIA 3QM1A 4OXXA 4EWLA 2JK0A 5AI6A 1U3DA 5KYUB 1AA6A 5CDGA 4Z4QA 1V47A 4XXHA 1BHQ1 3AUXA 4BKMA 2I65A 2A9FA 5FQNA 4MA0A 4U39A 4RQUA 2JIBA 4L08A 1RJEA 2X41A 3E2MA 3BMCA 1OBVA 2ZQZA 1NRWA 2AKAB 2GPJA 3HCRA 4PIPA 3F7NA 4J4TA 5TMBA 2O2DA 1RAHA 1A77A 2BN4A 2IPLA 2P3LA 2NWQA 2XCLA 1NJFA 1TA9A 2XAUA 3A70A 3C8MA 4TTAA 5FPPA 5C5DA 4PZDA 4KPFC 1MRSA 1AXGA 2RGEA 1D4AA 2IP1A 2VUSA 3LSYA 4KN6A 4O1IA 4C0SA 4BMNA 4IV8A 1GARA 2YIMA 5BQFA 1M33A 2BKVA 5B4TA 3J80A 1ZXBA 3RABA 1YDGA 2QY6A 3FYUC 1ZGBA 3GPBA 3LX6A 3KJXA 3SIPA 1XTUA 3OT5A 1XAHA 2HZBA 1IZZA 4PPNA 2GESA 3NIBA 4QUDA 2O2ZA 2ORIA 4YC7A 1AHIA 2ZWAA 1TX4B 1VJ5A 1JECA 1GA1A 5ELMA 2YY7A 4DY4A 2XCTB 1JKJB 5TE9A 1AH2A 4CM8A 1Z2PX 4M7PA 4Q7EA 1R8JA 2RCNA 4K9PA 3TM4A 1R0RE 2QX9A 2O8FB 3MAGA 4U1RA 1WMSA 4NBKA 4PF1A 1EIZA 1P4HA 3KWJA 4BAUA 4RDCA 4C7JA 4DGQA 4V1CA 2DUUA 3CSUA 4QPCA 2BFEB 1CULC 1PT5A 1WZUA 3G5TA 1KH1A 3GLGE 2QBYB 4KFRA 1Z6ZA 2X1VA 1RYEA 3NM4A 3OUUA 4CTNA 1G21E 2QENA 4DCSA 1LK7A 2HU2A 2QMQA 5G0WA 4F2WA 5FV7A 1AS0A 1WCWA 2BF4A 3IVAA 4DVJA 1QHIA 4OP1A 4TVKA 2NUTB 2TECE 3TFWA 3D6HA 3L9XA 4ZMSA 5IK2D 1NHGA 1BWRA 3C98A 3W1WA 3BWVA 4N1AA 3PQ5A 2OYSA 4FYMA 2VOEA 1XTKA 4PHCA 3CZ5A 4R8SA 3HSSA 4Q47A 1UL1X 2QTBA 4PG5A 3ZI7A 4XUGB 1N2OA 3W5UA 2Z9DA 4KUHA 4QKQA 2BGKA 4TKZA 3F8WA 4LYJA 2GZHA 2ZDQA 2JZCA 2R1UA 2XXJA 4PBRA 4C2TA 1O6FA 3T9DA 3RBZA 4POOA 3TKAA 3GJ5A 1TB4A 4EHDA 2J48A 2X9LA 4NXNB 1GADO 3LWZA 1NUQA 3NGLA 4MWZ