1MNAA

Thioesterase domain of picromycin polyketide synthase (pics te), ph 8.0
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
281
structure length
276
Chain Sequence
AGMFRALFRQAVEDDRYGEFLDVLAEASAFRPQFASPEACSERLDPVLLAGGPTDRAEGRAVLVGCTGTAANGGPHEFLRLSTSFQEERDFLAVPLPGYGGTALLPADLDTALDAQARAILRAAGDAPVVLLGHSGGALLAHELAFRLERAHGAPPAGIVLVDPYPPGHQEPIEVWSRQLGEGLFAGELEPMSDARLLAMGRYARFLAGPRPGRSSAPVLLVRASEPLGDWQEERGDWRAHWDLPHTVADVPGDHFTMMRDHAPAVAEAVLSWLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into channel architecture and substrate specificity from crystal structures of two macrocycle-forming thioesterases of modular polyketide synthases
pubmed doi rcsb
source organism Streptomyces venezuelae
molecule tags Transferase
molecule keywords polyketide synthase IV
total genus 92
structure length 276
sequence length 281
chains with identical sequence B
ec nomenclature ec 2.3.1.239: 10-deoxymethynolide syntase.
pdb deposition date 2002-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mnaA00
3GELA 4WDQA 4BATA 3FAKA 1EXWA 3IB3A 4J0CA 3H18A 1U2EA 4Y7DA 4OB7A 3C6ZA 1LPMA 2I03A 1HLGA 4TGLA 3O4GA 4PW0A 4FDMA 3ED1A 5ALFA 3OC0A 5A7GA 4G8BA 3G9UA 1ZI9A 1E89A 2WU4A 2D0DA 2WFLA 1UZAA 5LZ5A 4HXEB 4C89A 1ISPA 1DX4A 3V9AA 5I9IA 3H19A 1BEEA 4X93A 4BAGA 1X2BA 2Z8XA 2WSLA 4IH1A 4FLEA 4J0DA 2WHPA 5AK5A 4B6GA 4DNQA 1VA4A 2VAXA 4RGYA 5FP0A 1ZGBA 3R3ZA 4QA9A 2JGIA 5ALTA 2ZYSA 1WHSA 3WL6A 2V96A 5LZ7A 4Q1VA 3CCCA 2ONCA 2HA5A 4LYDA 1UFOA 2G5TA 5AM0A 3Q0TA 4ARAA 3HC7A 1UOOA 2BCEA 1XZFA 4Q3LA 3WMRA 4LXIA 4EY6A 1A8SA 1GPNA 1HKHA 4G4GA 5ESRA 5LZ4A 2RONA 2XUHA 2HHAA 5JAOA 4DGQA 3H2KA 3WK6A 4P08A 4L9AA 2ZSHA 2HA0A 1GKKA 4Y9SA 5CT5A 1XFDA 2D5LA 1MU0A 1DU4A 4G8CA 3PF9A 1CUIA 1ORWA 3IUMA 5DYYA 2CJPA 2LIPA 5ALIA 3W9BA 2XQGA 1R4ZA 2ZYIA 2WTNA 2DHEA 2C58A 3TEJA 5A7HA 5CH5A 1E3QA 3O9MA 1K5PA 3MUOA 4QNNA 4H7EA 3QPCA 3AUKA 2WQZA 2B9VA 5JATA 1XZEA 4P93A 1EDDA 4QLAA 4BVKA 2UZ0A 1VZ3A 1EK1A 3BDIA 2QZPA 4ZXFA 5EIAA 1AGYA 3MGAA 4ZV7A 1AQLA 2V98A 4H7HA 4JYPA 1UWCA 5HQ3A 1CV2A 1CUFA 1CRLA 2OPHA 2WFLB 2JGFA 5ALQA 3CN7A 4GLBA 5AM2A 3GBSA 2O2GA 4ZV9A 4LXGA 4FMPA 2PVSA 1ZIYA 4GBGA 5FXMA 1ZI6A 3D2AA 5LP1A 1J1IA 5HZGA 5ISMA 4AN0A 4X71A 5JAPA 1ZD3A 1CUZA 4JH0A 3BIWA 1CUXA 1DQZA 3IBTA 3BWXA 3I2JA 5D7BA 5ALMA 2QJWA 1BROA 2H7YA 3DL7A 1XRLA 4M0MA 3I2IA 3SC2A 3R3VA 4B82A 4S0XA 2VATA 4ZREA 3A2MA 5K5EA 2ZJFA 1R9MA 3FYUC 3ZLUA 4AN1A 4FBMA 1AMNA 4H7FA 4EY4A 2QXTA 4KEAA 5EFZA 2QXUA 4N8SA 2XI4A 1USWA 4EA6A 2ZVDA 1IZ8A 2Y6UA 2V9ZA 4UHHA 2VTVA 5AM4A 4X97A 2QS9A 5CXUA 2BUBA 3AIMA 2J3DA 4BCBA 3RK4A 5JZBA 4K2AA 1ZD2P 3C8HA 4KE6A 2HA3A 1XQYA 2ZYRA 2OAEA 3F67A 4PSDA 2JEYA 4OCZA 4CG3A 2VJBA 3V1NA 3I2GA 2WIJA 2RIPA 1DQYA 2VJAA 3I2HA 5EIEA 4Y2JA 3D2BA 4RE5A 5SYMA 4X6XA 1E5TA 2H1IA 2RHTA 2WJ4A 2XUOA 1FFDA 3G9ZA 1G5FA 2ACKA 3I1IA 3OOSA 2AJ8A 3EBLA 2P8SA 3R40A 2JGEA 1YAHA 1F6WA 3F98A 1A8UA 2Y2VA 4G9GA 1C7IA 4MYSA 3QM1A 5AKHA 5AHXA 5FOQA 3OPMA 3G0GA 1XZMA 3C5VA 4EB0A 1EVQA 3O4JA 5DLPA 5C7YA 1UKCA 2PUJA 2WM2A 1DT5A 3G0DA 5HF9A 4HRXA 3D0KA 1EDBA 3SK0A 5C81A 4B7ZA 1RP1A 4UHDA 1JJFA 4DYHA 3R3UA 2VJDA 2O2IA 2WIKA 2Z3ZA 1DWQA 5HK8A 5ALPA 3I6YA 4FFWA 1VE6A 1QTRA 1MX5A 5ALYA 2OQVA 2JIDA 2XE4A 4OU4A 2EDCA 2AJDA 5HFNA 2OCKA 1YCDA 3R3XA 1UOQA 3QVMA 5D3ZA 5ALGA 1XQXA 3ZLTA 5EHZA 5IKXA 4HXFB 1WB5A 5CT9A 4KJXA 4C88A 3QMVA 3PDCA 3WWEA 4CG1A 3W06A 3BF8A 3WL5A 3V1LA 2WKWA 7YASA 3QPDA 4U2EA 3ILSA 1XZKA 2ZYHA 4V2IA 4B85A 1QO9A 4NVRA 1I6WA 2HADA 2XUIA 4KAJA 4C4ZA 3C6XA 3R3WA 3G9TA 5JD5A 3M83A 1R88A 1EB9A 2YASA 3QMMA 1XRPA 3AIOA 1XQWA 5CT6A 4WY8A 4CFSA 2GBFA 1BU8A 4MWSA 2GYWA 3DJYA 2WIDA 1CIJA 1C4XA 5BWCA 3D59A 1WPXA 3QBJA 1CLEA 3ICVA 5BV7A 2WUEA 4U2FA 5AM5A 4QDZA 4PO3X 4XVCA 3WI7A 4KE7A 2BJHA 5IVHA 1WCYA 4PV7A 4FFVA 2RI6A 3H0CA 4OB6A 2EEPA 1Z68A 1VA5A 2WG2A 2JGLA 4W1QA 1R50A 2VSQA 1Y7HA 4ETWA 1W75A 3CCBA 3BL8A 1TCCA 4ITVA 5JAHA 4YASA 5EHQA 2PU7A 1VZ2A 2O2HA 1SOMA 4KR0A 2HIHA 4UFNA 2CMFA 1AX9A 4BP9A 2VJCA 2C5GA 3STVA 3NWOA 1P0QA 3E3AA 3WIOA 4UHFA 2FJPA 1XZIA 1MX1A 2WU3A 3ICWA 2WUGA 4UHEA 3DDUA 3TRDA 2AXEA 1AZWA 3ESCA 4I4CA 2HDWA 4FHZA 2Y2UA 1MNAA 2VF2A 4Y2QA 5KWJA 1BN6A 5IVKA 3I6MA 3DOHA 1XRMA 2XLCA 5ALJA 3WA6A 3C6BA 3NOXA 1OILA 4C87A 4CCWA 3FOBA 4AQDA 3EQ7A 3V1MA 3STWA 3WK8A 4X91A 2PSEA 5C8XA 3TJMA 1EK2A 3RARA 4BDSA 5AKJA 2PBLA 3QMWA 1JMKC 2HA7A 4YX9A 3ESAA 1JI3A 2HU7A 4UBMA 3DEAA 2OGSA 4N5HX 5AKXA 1VXRA 1MT3A 4BTLA 3PE6A 1EX9A 5AKKA 1CFJA 1WB4A 1LPNA 1KU0A 5CT8A 5ALHA 5HCUA 4AZ3A 4Q34A 5JADA 4EBBA 5CBKA 2DR0A 1HBJA 2XT0A 4DMFA 1A8QA 1MNQA 1QONA 4B9AA 3G0IA 2BGRA 4AO6A 4OYLA 4O08A 1D07A 4QEKA 1MO2A 3I1YA 4MEAA 2OLEA 3T52A 2WHPB 1FFBA 4B81A 4PSUA 3GROA 3JWEA 5AIAA 3VJMA 4E11A 5AOCA 2FJ0A 2C0QA 5LYYA 1G42A 4Q3OA 4FOLA 2Y1KA 4GEGA 2HA2A 4IH9A 4CCYB 3WA7A 5ALSA 2HRRA 4XJVA 2PL5A 2CBGA 4BAUA 4GWLA 1DWOA 1TQHA 1YS2X 3E4DA 3B12A 1ODTC 2OCIA 1VXOA 1HQDA 1N5MA 2YH2A 3VXKA 3OTQA 1BN7A 4IHAA 3F96A 4UBKA 4KAFA 1VKHA 3K2IA 3EQ9A 2VAVA 2AJCA 1CUBA 5CXXA 3VKFA 1CUGA 4JEIA 1YB6A 4BVJA 4Q3KA 3STTA 1RWQA 4UBIA 3VJLA 5BWBA 5D6OA 4K6KA 1QIKA 1QGED 4B84A 4WY5A 5HF5A 1J06A 2XQFA 1TIBA 2HU5A 1QZ3A 1XLVA 5FDFA 3GZJA 4DTCA 1YS1X 1FSSA 4U2DA 1CUWA 1WPRA 5AOBA 1FFAA 4QLOA 3KSRA 4BBZA 4MJ3A 3JW8A 1JU3A 5AM1A 2WTMA 2PUHA 2WIGA 5A7FA 1QO7A 4CG2A 2OG1A 2BFNA 4XIIA 2XUPA 1N1MA 5LKAA 1XLUA 5A71A 3WIBA 3DL4A 3VVMA 1XZGA 3ESBA 2JEZA 4DLNA 5AI6A 1RYYA 3WKAA 4F0JA 1XZAA 3HZOA 4RNCA 5E2IA 2DCMA 4GW3A 3PF8A 2PSFA 3WL8A 1FFCA 3DNMA 3KDAA 5JZ9A 4B83A 3ESDA 1MAHA 4U2CA 1QJ4A 2JGMA 4A23A 5HFAA 1QOZA 5E4JA 3I2KA 4J03A 4BVLA 3UMJA 4EY8A 2QJRA 3LIPA 2AJBA 1QE3A 1QIMA 2X76A 1QLWA 5AI8A 3D2CA 4X00A 4K5QA 2RGUA 1GXSA 1GGVA 5CURA 1XRRA 5DNUA 4FNMA 4W1SA 4BZWA 3E1GA 3P2MA 4AMZA 1SCIA 4UBLA 5AKEA 1XZBA 4J0KA 2OCLA 2C5FA 3WQHA 1IUNA 1VE7A 1NX9A 1YAJA 1K8QA 1QIEA 3O9VA 1MAAA 3QYJA 4CIAA 1LPOA 4BCCA 3L1IA 3WYNA 4FNGA 5C8VA 4Y2RA 4B0OA 2WG0A 4OYYA 5AKGA 1THGA 3DOIA 4AZ0A 1K63A 4NZZA 4E14A 1SFRA 4QDTA 3ZWQA 3CN9A 4INZA 1CUVA 3FYTA 5FPQA 1HPLA 4J3JA 4QDUA 4F21A 3WK9A 4LIPD 4PQEA 1THTA 4LKOA 1IUPA 3C6YA 4J0IA 3BXPA 1UK6A 4I19A 1WB6A 5LZ2A 4U2GA 3WKEA 3H1BA 3K6KA 5CT4A 5EGNA 1Q84A 5AI9A 1LBSA 1XROA 4BE9A 2QVBA 3BF7A 3DD5A 1TRHA 2G5PA 3AINA 3LCRA 4K6HA 3S8YA 1CUJA 5ALWA 1PFQA 1FJ2A 1L7AA 1QIIA 1G66A 5C8ZA 1CUSA 2Y6VA 1MPXA 1YA8A 2WLSA 1E8DA 4IQ4A 3FVRA 2QRUA 5LZ8A 5AH0A 1LPBB 3H17A 2PU5A 1EDEA 1GKLA 1BS9A 1LGYA 1E66A 4BYMA 4BRZA 3PUIA 4GXNA 5JALA 2DSNA 3SX4A 1A7UA 1B6GA 4F5ZA 4UHCA 3ANTA 3IUJA 4LXHA 2WJ6A 1IZ7A 2CB9A 4CIBA 1ODCA 1HDEA 1NU6A 2XUDA 4DMKA 1W52X 3STYA 4A16A 1OXMA 2HFKA 1CUYA 5JIBA 3ANSA 2R8BA 3SWWA 4XX1A 4L3WA 3TGLA 1UT6A 2QUAA 1LBTA 1L7RA 3AJAA 3LP5A 5AP9A 4ZGBA 5J3JA 4QWMA 1IUOA 5LKRA 4DSAA 3M81A 1KEZA 4J7AA 3IUNA 2HFJA 3STUA 4A5SA 4G8DA 5T4HA 2DHCA 2C0PA 1SCQA 3VDXA 1R1DA 1X70A 4FLFA 1MJ5A 2DFPA 4IH4A 3HEAA 2PX6A 5K3CA 1Q0RA 1K4YA 5AKLA 3WZLA 4WCVA 2GBGA 5DJ5A 2PKYX 1SC9A 2GZRA 4CCYA 3FBWA 1UK8A 4AX4A 5HQ3B 5T4EA 3AZOA 4OPMA 3EF3A 5CH8A 1WOMA 2BUAA 4H7KA 3D7RA 1CUUA 3U0VA 5AI0A 2ORYA 5DYWA 5A62A 3FCXA 3W2TA 3FCYA 3HXKA 3D4LA 4X92A 3IURA 1SCKA 1ZIXA 4K6GA 4B9EA 3L1HA 2ZJ7A 3PFBA 2XDWA 1QIGA 1XZHA 2HRQA 2X8BA 4W9RA 3A2LA 4KAAA 1GZ7A 2O7VA 4Y2UA 3IIIA 2OCGA 3WWCA 4Y2YA 3O95A 4X6UA 3V1KA 1E8MA 1LPAB 1XQVA 2ZJ6A 1W1IA 1ACLA 5K3AA 4X94A 5FKJA 4DIUA 3S2ZA 5FV4A 1BRTA 1S8OA 4J0HA 4UFPA 3IULA 2HA4A 5LZ9A 3ZV7A 3G8YA 1YSCA 3G02A 4JNCA 3PICA 3H04A 5JAUA 5FRDA 3G0CA 5AI5A 5ALVA 5BOVA 3V48A 3MVEA 5AK4A 1WM1A 5ALNA 3I28A 5E4YA 1H2YA 5JD4A 2XMGA 3KOOA 4BC1A 1J07A 3QPAA 3HI4A 4H7JA 1TAHA 3B5EA 5K3FA 3W05A 2XUAA 2NW6A 5AKZA 5AKIA 1JJBA 4Y2TA 5DYTA 1XRNA 2OQIA 5FLKA 2EDAA 4H77A 1UK7A 2O7RA 3H1AA 2Z5GA 3H2IA 2CUTA 3RLIA 4PF1A 3FSGA 3PI6A 4W1RA 2YYSA 4OUKX 5K3BA 3ZI7A 5FUMA 4BZZA 4QZVA 3IUQA 4KRYA 1DTEA 1Q0ZA 4ZWNA 4EHBA 3LLCA 5EHXA 2HA6A 2J3QA 5D3KA 1ZJ4A 3CXUA 1AURA 4B80A 2VA9A 3WZMA 1FFEA 4RE6A 5K3DA 4J0JA 2W6CX 4C4XA 4Q05A 1TK3A 1ZICA 4OD0A 4P92A 1BE0A 4DNPA 5JYCA 4N8DA 4BC0A 3ZLVA 3AFIA 4OSEA 4GECA 4ZRDA 1N8SA 5ALKA 3IDAA 1VJ5A 3MUNA 4AXBA 5HF8A 3A6ZA 1LNSA 4H0CA 5JD6A 3WL7A 4G1FA 4DNOA 3HRHA 4DNFA 5CTAA 5T4BA 2DHDA 3WKDA 1U4NA 4L0CA 1CEXA 3R41A 4X90A 3B3QA 3QH4A 4EZIA 1Q83A 4UPDA 4XWGA 3R0VA 1EA5A 2XUGA 4NMWA 3WK7A 3WKBA 3I6ZA 1TKRA 2QM0A 4E15A 2XUFA 1T2NA 3AIKA 3DQZA 4KACA 1UK9A 5K3EA 2B4KA 3HJUA 2B61A 4H7IA 1QIFA 1ZD4A 2H9YA 4EY5A 4JUIA 3QZUA 5HF6A 1ZJ5A 4N5IX 4UBNA 1JU4A 5FPPA 2RAUA 2GBIA 1DINA 1O6GA 3U1TA 1UOPA 2HU8A 5DNWA 4WJLA 2IX9A 2AJLI 4UBOA 2XQIA 4NS4A 2WFZA 4G4IA 1EH5A 2CKMA 3KWJA 1CVLA 5KBYA 5AKYA 5E4TA 2E3JA 1AC5A 2XB6A 3UUFA 4X95A 5DTIA 3HSSA 4KE9A 2PSHA 3F8SA 4C01A 5A2GA 4UBJA 4Y2XA 3O4IA 1CPYA 1PV1A 1QFMA 1XZLA 2OXEA 3BDVA 1JJIA 5I8PA 4X85A 2I3DA 5AK3A 4X7BA 4UFOA 4BAZA 4AO8A 2J4CA 3STXA 3KD2A 4BP8A 5HK9A 1LLFA 3PFCA 4ZI5A 3EQ8A 4W63A 1TCAA 4G5XA 3GFFA 1YA4A 3DYVA 5AIBA 4EUSA 5A6VA 4Q82A 3WJ1A 1JMYA 1VOTA 4G9EA 4HZGA 4WFIA 3D5EA 5CRIA 3C43A 3DKRA 4HXGA 4FWBA 1DX6A 3QITA 1GQSA 4HVTA 1EI9A 2JF0A 3ZPXA 5ALLA 2IITA 1HL7A 1F0PA 4BTVA 1YR2A 3KWFA 1CUCA 1UKAA 3FYUA 3G0BA 1DWPA 3AILA 4U2BA 1MN6A 5LLSA 3WK5A 5JANA 4BDTA 3VJKA 1AKNA 3WYDA 4TVKA 1Y37A 2ROQA 2YXPX 1XKLA 3DCNA 2W22A 2WHQA 3FLBA 2WHRA 3O0DA 2JGJA 3A70A 2K2QB 1AUOA 2WUDA 4J0GA 4H7DA 5JASA 2XMQA 4M0EA 1UXOA 1E8NA 1LPPA 2XMZA 4AO7A 3C70A 5IH7A 5SYNA 4Y2PA 3HABA 2ZSIA 3IA2A 1UKBA 4BRSA 5I7UA 5IVDA 1F0NA 4WFJA 1U65A 5ALOA 5T4FA 3WLAA 3BE8A 1H22A 1K6EA 2OAGA 1QIDA 4FTWA 4YPVA 1GT6A 1PJAA 2QMQA 2GYUA 5EI5A 2Q0XA 5HKBA 2GBCA 1Y7IA 5ALUA 1CQZA 3GA7A 2DQZA 5CW2A 1L7QA 2WUFA 4HTAA 2XMDA 2PM8A 2H7CA 4P9NA 2V97A 1P0MA 5AI4A 1X2EA 4DSZA 1R9NA 3F97A 4QDXA 3X3HA 1LZKA 3C8DA 1QFSA 2VT7A 3BJRA 1LZLA 4B0PA 3WWDA 3DLTA 3AZQA 2BGNA 5IVIA 3HACA 4BB0A 2XMSA 2DQYA 1BCSA 4KYVA 4LHEA 4H35A 4MQMA 4PNZA 5JZSA 1GQRA 5HKAA 3T4UA 1XZCA 2JBWA 5F4ZA 4DM7A 1NU8A 3VISA 1P0PA 3N0TA 1MX9A 4CI9A 5DWDA 4ROTA 2VQ6A 1B41A 1JFRA 4LYEA 4QE3A 5ALZA 1IVYA 4AMYA 3PUHA 5KREA 2XMCA 4HAIA 1TCBA 4Y2SA 4MQLA 1T4MA 4UUQA 3WKCA 2G4LA 3HYSA 4MXDA 4Y2VA 1DT3A 1LPSA 3RKSA 4GHWA 1G4HA 3M82A 1H2WA 1ZGCA 2C7BA 2XUQA 4QDOA 1CUAA 1CUHA 4KE8A 3RM3A 2ES4A 2XMBA 1QIHA 2QTBA 1BEZA 4C6HA 1J2EA 1U8EA 1A88A 2OGZA 4MEBA 4HS9A 3AZPA 2C4HA 2WG1A 3W9UA 4TPKA 2QUBA 3H2HA 3H2GA 5AJHA 1EINA 1W6RA 1QIJA 2J4FA 1H2ZA 1GPKA 2BUCA 3NUZA 1C7JA 2XQJA 5AK6A 2ECFA 3M3DA 5DNVA 2ACEA 4UHBA 1W76A 4D9JA 4F60A 1CR6A 3C87A 3FSGD 1JKMA 2HL6A 2XMRA 1EVEA 5ALRA 2XUKA 1XRQA 2VT6A 2RHWA 1H2XA 2JGKA 4MYDA 2CZQA 2GZSA 5K3FB 5JARA 2VEOA 1VLQA 4PSCA 3DS8A 4WFKA 1WHTA 3D3NA 2IIVA 2Z8ZA 3IVMA 2XQKA 4H18A 4JYMA 2H7XA 1OCEA 2WILA 6YASA 2XUJA 5AO9A 1GPLA 4BCDA 1ODSA 5YASA 1IMJA 1M33A 2PPLA 3G7NA 5CMLA 3VVLA 1JT2A 2G63A 3N2ZB 3BIXA 4GI1A 1W4LA 3OURA 2OGTA 1ZI8A 3GUUA 1YB7A 2QR5A 1ORVA 4M0FA 5DTJA 4DMHA 1XLWA 2QOEA 4C4YA 4L72A 2I78A 4WDRA 4MWTA 5EIHA 1N5RA 1ZD5A 2Z3WA 3NGMA 1H23A 4N8EA 3OG9A 5ALDA 2WFMA 3LIIA 2HM7A 2QT9A 2WIFA 4ARBA 1MTZA 2B20A 4OB8A 3FWHA 5AICA 2BAGA 4IO0A 4FBLA 1QTIA 3WJ2A 5KWIA 3JYHA 5H3HA 2XLBA 1BCRA 4AB1A 3KXPA 2X5XA 3W04A 4X6YA 4DMCA 3DKKA 1KU6A 1EB8A 1CUDA 3EIOA 3R3YA 3I2FA 3YASA 2R11A 3BJMA 3Q8WA 3FYUB 4Z49A 2CEKA 1CQWA 5CH3A 4EY7A 3A2NA 4OU5A 2FX5A 3O4HA 5EHNA 5LIPA 1YASA 3C45A 1EHYA 3E0XA 5ALEA 3FNBA 1ETHA 4FKBA 3G9XA 3OM8A 4E46A 3WWPA 5ALXA 3C5WP 4G4JA 2FUKA 1XZDA 4QWWA 3FLAA 3DYIA 1R3DA 2PSDA 3FVTA 5AM3A 1XZJA 2PSJA 4RPCA 4HRYA 4X3CA 3H2JA 3FLEA 4I3FA 4BE4A 3LS2A 4YK7A 2QKYA 2BKLA 2WJ3A 1P0IA 3F9CA 2I3ZA 3WK4A 1ACJA 3L1JA 4GDMA 1XKTA 3UUEA 5AOAA 4W1PA 1ZOIA 1O6FA 3HLKA 4FLMA 1CUEA 3WWOA 4KRXA 3K9BA 1F8UA 2GYVA
chains in the Genus database with same CATH superfamily
1II8A 1XDSA 4KSBA 2CVQA 5FNVF 2M1XA 3LPCA 3FMVA 3QWFA 1JP7A 3H18A 4QUBA 3OJEA 3TDKA 4MCHA 1AKMA 1SG0A 2HDHA 4PZYA 2GN2A 3P97A 3PRYA 1ZNYA 2BEVA 4YJFB 1HE8B 2XYQA 3KSMA 1BMDA 2Q0QA 3OCXA 4EKGA 2WQ6A 3OE7A 4DBLC 1X1QA 1IQRA 4YUXA 4Y98A 1L4GA 3RUHA 2O5CA 4LSZA 2WMOB 4TS1A 3FAZA 1HORA 5BV2P 4YI5A 4PW0A 2P40A 4QHTA 2R25B 3ONVA 3DR5A 3GMTA 3IP5A 2P9GA 3NHLA 3QA9A 3X1ZA 5BQ3A 4AS2A 1OSNA 3TG2A 4YUZA 1S0UA 1DG1G 2CFSA 4Q3NA 5A7GA 5SZIA 4M9RA 4ZAZA 4KDEA 3F3YA 3FB4A 1D4FA 4QPDA 2I8AA 4HAOA 1V5GA 2D0DA 2G6TA 2WFLA 4LXXA 1FSPA 1QGZA 1S4QA 2JGDB 2FN9A 3CT4A 1ETUA 3GT7A 2IYUA 3ODGA 3GUHA 4HXEB 4NCJA 5EHIA 4X64B 3U4QB 4BEWA 4EEKA 3OJCA 1DX4A 3PFWO 2FWPA 1BEEA 2X8AA 1M1YE 4TT3A 3GYGA 4BAGA 1T9AA 4C6TA 3UHAA 5HVNA 4P8RA 3IV7A 4BNDB 4ZYVA 3H1EA 3C3PA 1G7SA 2VXOA 2ZIVB 4XGQA 1MOPA 4XUEA 2VZLA 1EWQA 1S1CA 4IYRA 2BFFA 1BO6A 1DZ3A 2H1FA 3MBIA 4XPZA 5FOTA 1EU1A 5LQRA 3M1YA 3OQOA 2O8FB 2XY4A 4E2FA 1OREA 3INYA 3LYAA 1EX7A 1KQNA 1ESCA 4B6GA 4JJ4A 3NM4A 1VA4A 4XFDA 4XQCA 5HUJA 2O0KA 1SNYA 2A7XA 5JC8A 3ZU4A 1LX6A 4QPCA 4RGYA 5EKTA 4CLEA 2B2NA 3KIPA 4G63A 1NY6A 2EP7A 2VDVE 1YZVA 1BX3A 3R3ZA 4P54A 2PVCA 2ZI5A 3VFDA 4F6RB 1M5UA 1UT8A 4LNUA 4U9IS 2V96A 2B8JA 3KQYA 4ZYLA 1BMFD 3CCCA 3IPLA 1CX9B 1ZCFA 4FS8A 2ONCA 1E7YA 1PSDA 2HA5A 2C4TA 4IO1A 1GR0A 4YJHB 5BQPA 2G8NA 3M6XA 3S68A 4ESVA 2XD4A 1Q2XA 2AOWA 1S3FA 3L0SA 3OO1A 4OIMA 4ENVA 5DTRA 1VL0A 1N9ZA 3OE7D 4TSFD 3WMRA 1V5FA 3OESA 1Y81A 1TB4A 3B3FA 3GLTA 3K8QA 3NDPA 2P30A 4LN1A 5ESRA 4RJTA 5BY2A 4MJLA 1V41E 3PC6A 2SICE 4DQXA 1P1BA 2XCOA 4K28A 1F0YA 5AJUA 3UK6A 4DGQA 2WYUA 4ZFNA 1M6EX 5AJTA 4AQ7A 1EFPB 3QX7A 1KKLA 2NZWA 1DFGA 2HBZA 3F5QA 3QLTA 1V9CA 4R8KA 1GKKA 4ZOEA 5E7IA 3HR4A 3ZU5A 1GSOA 1NLZA 2D5LA 2O1WA 3CF2A 3L1VA 2O48X 1RMYA 2HEIA 1CWUA 5EESA 3RU7A 1GFWA 4YMHA 4LF7B 3EZLA 4O2LA 2JASA 5J4VA 1YR9A 2WTEA 4LJ7A 2QY6A 2VJQA 3WRXC 4R8SA 1KL7A 5GQSA 1ORWA 4YRNA 4DLLA 4B4KA 3NTQA 2REOA 4MYHA 1R0WA 2GKOA 4MW4A 5HBGA 2BSAA 1T8SA 1NBHA 3W9BA 3THWA 2XQGA 4Z9FA 3LRPA 4IVNA 4JLVA 4NTZA 5DHRA 5K51A 1AQ6A 2XXJA 3V1TC 4ZK2A 1RM4A 4FILA 4UNSA 1MGOA 3OZWA 4JYCA 4O4JB 2LCQA 1UDBA 1ZMBA 3R8CA 1Q0LA 4EJ0A 4B6EA 3DV0A 1TO6A 1KO4A 5DCWA 1X9IA 2LDBA 4NL4H 4LX8A 6ABPA 3QPCA 2RG7A 3E58A 1DKLA 3KJQA 3M6LA 3QFRA 2VC2B 2WQZA 3VBCA 1X7HA 2LKCA 4MR8B 3WGLA 2CW5A 3L4EA 1HC7A 4P93A 4BN5A 3BMQA 1AM4D 2I6TA 2QG6A 3TRJA 2WSSD 4H4CA 3S2UA 4B33A 3VNQA 1Z2AA 2AD1A 3CEMA 3E1KA 1CIVA 2M6KA 3P4YA 1T91A 4JB8A 4LQLA 2FMIA 4JROA 2F8LA 1BGXT 2YZNA 2E4ZA 2ZU6A 3AJRA 3BDIA 3HWSA 3SCZA 3IP7A 1G6OA 1RWVA 2YY6A 5LB4A 3FRJA 5E3JA 3T7CA 1RQNA 4ZYYA 3R6TA 2ZUTA 4CMEC 3LZCA 4CM6A 4HH1A 2FV8A 2Q9BA 1IN5A 1O4WA 3PPYA 3ISVA 3V7FA 3ZGXA 5JZVA 1YR1A 1CRLA 1H4TA 5DNDA 3EF1A 2IEDA 1SC4A 1QPBA 2WFLB 2JGFA 2Z8YM 3PDUA 4UM9D 1PLKA 1Z7YA 3CN7A 2OP1A 3EWNA 3GAZA 3I34X 4H6WA 3LC1O 3V32A 1Q7CA 1ZXLA 5AQ1A 1YONA 3I61A 1UMCA 2PVSA 1ZIYA 2ZYGA 1B6SA 3QKIA 4O59O 4U0JA 4F8EA 1GDDA 4MMYB 5BN3B 5JS8A 1JYSA 1E2QA 1P5RA 1PJBA 4MDFA 1QAQA 3T3DA 2X4LA 2W6IA 2ZE7A 4EJMA 4GZ6A 1N0UA 5AVVA 4Q3BA 5ISMA 4BN0A 3INGA 4X71A 2MR6A 4I08A 2EVWX 5JAPA 4EFNA 4W5RA 3OPXA 3RHSA 3Q8XB 2CXPA 5CHEA 3VR4H 2AG6A 1R10A 2GZHA 3B13B 1GAXA 3BIWA 1MXHA 1AS0A 1WY7A 5J58A 1PUIA 1E5XA 2V4ZA 4MV9A 3B53X 4I5IA 2VBCA 2WSBA 1KJNA 2IC5A 3UK1A 3W5VA 1FU8A 2PQ0A 1M73E 3I2JA 4DCJA 3ENWA 2OBBA 4DMRA 2H7YA 2WVGA 3GBPA 4AM8A 2N75A 2XKJE 1UBGA 3G2KA 4IBOA 2QRVA 4M0MA 2P62A 4GUAA 5CA1F 3S0JA 3LJKA 3BXOA 3SC2A 4CMEA 3E2IA 4DG8A 1QX3A 2J32A 4ZREA 1ZKMA 4PYJA 4NPCA 2COKA 1G3RA 3EXEA 3U1VA 4MHTA 5F98A 1RM3A 2YZKA 2IHZA 1TJPB 3FPHA 5A2QA 1BOFA 5FWXB 3T5PA 3JWJA 4DCUA 3V3KA 2VZ9A 4JBIA 1BKYA 3CKYA 3LKZA 3RK0A 2A1IA 2FPIA 2HH9A 3WBFA 4DCNA 2FXVA 2GHTA 4CFYA 4CGZA 3H4VA 4BQFA 5F3WB 1PFWA 4R41A 1MX3A 1NW5A 4FOTA 1LKZA 4UC0A 4D4GA 2EFHB 1P45A 1GTJ1 1LSSA 2QLMA 2ZVDA 2I6FA 3UNXA 5K99A 2MCFA 1IZ8A 3UOWA 5LIRA 5A5GA 4LDJA 2HJSA 2JD2A 4W82A 1J99A 1ZJ6A 3GAFA 5IT9A 3L7JA 2GTIA 4NU8X 2V9ZA 3HLTA 3UA4A 5BN4B 3UJ8A 1ND6A 4NSNA 3HFSA 2ZYDA 3ELUA 1X13A 3NBQA 2BMWA 4X97A 2P41A 4ML3A 5AM4A 3E35A 1BKSB 1W88B 3RVDA 5K8IA 3ZTTA 1GNSA 2QS9A 1O94C 3JQCA 3JU3A 4D44A 2BUBA 3AIMA 4HWKA 2A8YA 2BEWA 2J3DA 4NENA 3ZCRA 4BCBA 5C18A 3FVVA 3WWZA 3OHSX 3ZWYA 1CR1A 3WQRA 3IIEA 1ENOA 2LV8A 3ABSB 2EBUA 4HS4A 3ESRA 4NONA 3PXCX 4KE6A 2HA3A 1OC2A 1OF1A 1YDEA 2DWOA 1N2XA 4ZO9A 3E9YA 2FJUA 4EYGA 1PV4A 2OAEA 1GQOA 2ZAOA 3FZGA 1PHPA 1QGDA 2G8LA 2NG1A 4NCXA 2BI7A 3DFFA 3HU2A 3LXMA 4KQFA 3M3HA 1QP0A 1E1QD 3Q3HA 2QL5A 2VJAA 3MIZA 1E1RD 3OFND 4PSVA 5FNVB 3DDSA 3N8GA 5EIEA 3UGJA 3M9LA 2FSPA 3SVLA 2D1FA 1X1BA 1WBJB 4POAA 3QPVA 5HCIA 4D4JA 1E5TA 1GZVA 2FMXA 1O54A 5KCZA 1ZD8A 2WJ4A 3E9RA 1TYBE 1FFDA 3IAEA 4FHFA 4IFBA 2XZOA 5L3ZA 5LUBA 2FW1A 4Z99A 2DU8A 3IEKA 2ZB3A 1XTRA 2PWBA 5T67A 3TK1A 2OXCA 2XTNA 3IAM1 1N2SA 3F8WA 5AW9A 3R40A 4KOAA 4XDGA 1CW2B 4UUOA 3HBLA 2BD0A 4HAUA 4OSOA 3FD8A 4TKUB 1KRXA 3KTAA 5IXSA 1D4AA 3CS3A 4IIXA 3PVZA 4JCCA 3G7UA 2V4UA 1H42A 2E55A 3EXAA 5TV2A 1C7IA 4ASUD 4LEIA 1VI2A 2VJOA 2X5OA 5TPWA 2R68A 1M0WA 4NXNB 3D31A 3U4IA 3HKBB 3OPMA 1GUDA 4PAWA 3WOHA 3V4PB 3G0GA 3ZHCA 3K7EA 4EB0A 1Z8HA 5F35A 2F4VB 1ZJJA 4R98A 2KWIA 3ROXA 3M2PA 3O4JA 1W4BA 3KKKA 4OX9Y 5DI9A 1HNNA 4F7DA 2AXPA 4FT4A 3PLNA 4B73A 1DT5A 2OHHA 3MG9A 4M0UA 5HYVA 4P4TA 4HUTA 3G0DA 4TWRA 2WFAA 3D0KA 2HF2A 3N2LA 3T99A 3HR7A 1U8XX 4FGWA 2W90A 4MO2A 4IJ6A 2CXNA 4O4LF 3BMCB 1J6UA 1P0FA 3K1AB 4J16A 1P62B 5HUHA 3SDZA 5BWMA 3BYZA 4QU0A 1Z4QA 4OHZA 1P75A 2O3TA 2VNKA 3T38A 1NQOA 2BTQA 2QLJA 4E1AA 4G0MA 3R7LA 2NN3C 4EJFA 3CRQA 4S1VA 4WK6A 1SJ9A 4F9GA 5K6AC 4DXDA 3PJRA 1E94E 1DVRA 4FFWA 3WGJA 1VE6A 3E03A 4TMVA 3H9EO 1XR3A 3NTOA 2JFYA 4UZSA 3UV3A 3GOHA 4D45A 3J81k 3NHWA 1QHGA 1RRKA 3H1PA 5IAAA 3FSRA 1ID1A 5IAJA 4D9HA 2LDXA 1Q77A 2FFAA 3AVOA 4OH7A 2XCRB 4KR3A 1YMVA 2CJWA 2HWUA 4I9HA 1YJQA 4GMDA 2J41A 1NF3A 3Q7RA 4Q7LA 3ZV4A 2CDBA 2F7SA 3KWMA 2JB9A 4LZOA 1L5MA 4B71A 3MJRA 4ZDJA 3COJA 3EIFA 4OUDA 4E7PA 3HQ4O 4LJYA 1DEHA 1Y5LA 3LD9A 3MEQA 5EZQA 2A9FA 1QF6A 3PHCA 5KJCA 3NM6B 1MAUA 3A1NA 1GNVA 2PEYA 1XCOA 4M9SA 4AY2A 3JZIA 4Q4AB 1BVUA 1UC4B 1ZISA 3NEYA 3QUAA 3M89A 2FPPB 1K3UB 2ZUBA 3ZY5A 4P5EA 3ANMA 3QPDA 5D01A 1KE2A 1NZDA 1O95D 1XZKA 2BKXA 3A4TA 3R9WA 3ZJ5A 4PIMA 3SZUA 2X5NA 4KGVA 2ZYHA 2H0RA 4PZUA 4V2IA 1AO3A 1A9ZA 4KNYA 4N76A 1NDHA 3C4QA 4QIHA 2YV4A 4K9QA 4IFIA 4PYOA 4ZODA 1NVXQ 4XM1A 1CETA 1PVDA 2XUIA 3SSAA 3F5MA 1UJ6A 2ZUUA 3GF4A 5IAOA 3I9V6 1AQIA 5EIBC 1JQBA 3KZXA 3DEIA 4EIWA 4X65B 3UMBA 4D8WA 2GGSA 1R88A 1C0EA 2AHRA 3EA0A 4M8SA 2HSWA 1ORIA 4YA6A 2XTMA 1Z08A 2ZB2A 5DMHA 5TVKA 3UIEA 2WIBA 1FDWA 4JU9A 2NXWA 3D1VA 2NUTA 4FYIA 3IOCA 3T7TA 4C22A 3ND9A 3PGA1 4CFSA 2GBFA 2IHNA 3AVQA 3GCDA 2XHEA 2GH1A 2OHVA 4PZAA 1PYDA 1YBAA 5HMMA 1IN1A 3ZV5A 4EF5A 3T7JA 3V4LA 1RR6A 2Z2KA 3PE4A 4MQEA 5EJ8A 3BH7A 1E6EA 5LNK1 2IK8A 4FWTA 3ICVA 5SY9A 4L6CA 2IP4A 3R0IA 1V25A 4U2FA 5AM5A 2JGNA 2MSCB 3CPHA 1BE8A 5WRFA 1PFVA 3P4UA 3LOQA 2XB8A 1QP4A 5TEWA 2EKLA 4MS1A 3EF0A 4OX9B 4XVCA 3HB1A 4NQRA 4KE7A 3DKIA 3TEFA 1JHAA 4V02A 3E05A 1LWOA 4MCJA 4CM5A 5KYYB 5IVHA 4IRUB 4QUJA 2QTTA 2O8FA 4HDNA 5I4BA 3X1JA 3ZVNA 1SUSA 1LX7A 10MHA 2EEPA 3IMFA 3MELA 3NEJA 1E3EA 2PKWA 3RYHB 3S1LA 3T35A 1TU0A 3OZAA 3MCAA 3UK0A 2J3EA 1NVTA 3PJGA 3TQHA 3VH1A 1F1JA 4EA8A 2GHQA 2D06A 4O1HA 2P0YA 1TJ4A 1P1FA 2QZ4A 1R50A 5AVKA 4B4UA 4D3XA 4D82A 1Y7HA 2AA3A 3RC1A 2KW5A 4R8LA 3VYRB 2QGFA 3CCBA 4OQZA 4NFHA 4KR7A 5LM3A 4JLOA 5BRJA 3UAXA 1QVVA 2PWPA 4BV9A 2ODTX 4ITVA 1YC2A 1JQAA 3PDHA 4TT3D 1ULSA 3SXJA 3AHCA 3CEHA 4YASA 3UCXA 4B8YA 1N77A 4N03A 5BORA 4H08A 2VDWB 3I9JA 1J1UA 1VB5A 2O2HA 5HGXA 5KSOA 3RUFA 3KB1A 4KR0A 2ONJA 4Z54A 3VMMA 5AUNB 1JFVA 1L5FA 2HIHA 3G85A 2NU9A 1BJTA 3HEMA 3QRWA 4OAOA 4LRTB 1Q6ZA 3EUEA 4TT8A 1SPBS 4UFNA 4NABA 5JW6A 1PEDA 3LSYA 3D0OA 2P9YA 4RVDA 2Y8EA 1ZU5A 1DELA 1DJOA 1JEYB 3L06A 4PHHA 1E2KA 3BB3A 4ISCA 1CY8A 3GD5A 3KQVA 4AF7A 4UMFA 3L40A 4BUJA 1BMFA 4G97A 4HEA6 2DH5A 4PONA 1P0QA 1M6YA 4LXUA 1B23P 2W4MA 2P65A 3A9TA 4P86A 1Y63A 3IA7A 1X74A 3WRYC 3OF5A 5A4AA 1XZIA 2NZUG 3KLMX 4TTIA 4CTJA 3RT1A 1FXWA 5DIFA 1QU2A 3PCTA 3CX6A 3AY7A 3EDCA 2JCSA 4PVCA 1B26A 4YWHA 2B99A 4OFZA 5J2TB 2B2XA 1NNUA 1YZFA 3NVAA 2QG4A 5ER9A 1P73A 1GN8A 3ESCA 1DPFA 1PYGA 4B3IA 1NXVA 4RMHA 3FRIA 3FOAA 3MJTA 1NOKA 1MR3F 2XGSA 3LRXA 4FHZA 5MFPA 2G71A 2RC6A 1HEIA 1XVAA 1VPTA 2JAXA 4QOFA 3HMKA 1KBQA 2CLIB 2VQEB 4XVQA 3ZC3A 2H54A 4EATA 2ZJ8A 4BFVA 1BN6A 2RJNA 4B6QA 2H7VA 5KWJA 1UAYA 1LJUA 1UPAA 5IVKA 3I6MA 2PMBA 2GCEA 4RLHA 2UXBB 3SJZA 3BAFA 2CKDA 3VPDA 2GEKA 4NC9A 3IOMA 4C87A 3PJDA 2IKSA 1JKIA 3T15A 3TCXB 3WNQA 4AQDA 1KHTA 3CURA 3MCVA 3EDQA 3L4KA 2UYHA 2H59A 1DLJA 2ZAIA 3V1MA 4PFKA 4ZO8A 5LQJA 4GZLA 5LP6A 1IEWA 4H3HB 1BXGB 4PSKA 3DAYA 4J16C 3LHSA 2FLKA 1H6CA 4ENQA 4YCBA 1Z7BA 1XTQA 2F62A 3RSZA 4Q9HA 4DWWA 1VYTA 1XPUA 5CNMA 3OQNA 1V1MA 3RAEC 3B60A 5SZJA 3B6KA 5AKJA 4UUAA 3K73O 2VXYA 5DW3A 3QMWA 3ROFA 3VPBA 4BDSA 1CVRA 4BO0A 3ESAA 2NXJA 2Q0HA 5JJ5A 4ZEVA 2R4TA 1MQ9A 2HU7A 3C8ZA 3RYCA 5HOEA 3SVZA 2VCYA 2HHCA 1Y6RA 3P32A 2FSHA 3HCOA 4CR8A 2BFDB 4N3NA 4E21A 4PTLA 1XJQA 2C2OA 3FN4A 4K46A 4EJSB 2O8NA 3JATB 2JDID 4IGEA 4ZCLA 5AKXA 2WABA 2XWBF 5HA5A 3RT7A 2F6RA 2Z1DA 3N87A 5KJ6A 4WOCA 2GWHA 1CJMA 1CFJA 1KJYA 4AZVA 3FOZA 2ID9A 1IY1A 3AP1A 4NU0A 4GQAA 4IY1A 4L8GA 4I4IA 5CT8A 3K30A 5K6TA 2EAUA 1N25A 1S8NA 5KDLA 4URVR 2QMZA 2AZDA 5HJ7A 5U9CA 5E1DA 1NW7A 4GXQA 2YZ7A 2I3GA 2Y92A 3BIOA 3ZNOA 4COKA 3GCWA 2BH2A 1Z2EA 3L4SO 1P18A 1N6KA 5H83A 3BGSA 1OX4B 3AVTA 3MSCA 4JLSA 2FY8A 4UNPA 4DMFA 2R8YA 5IAEA 2J6IA 3RVPA 1B3BA 1MNQA 1O6BA 4LCEA 3TL6A 1X7YB 2B34A 4KMOA 4B9AA 4PCUA 4C6TB 1YF3A 1W5SA 4C1BA 4FXPA 1J8QA 4OYLA 1E2PA 3H2ZA 5IUKC 5SY4A 1RBQA 4O08A 2R87A 1JIIA 1D07A 4I2NA 1MO2A 1T8WA 2K4MA 2NX2A 3AM3A 3I9LA 1T13A 4NYMR 4QEKA 3T52A 3R8XA 3EZ9A 4DDKA 5IT0A 3DGFC 4IDNA 2ZXUA 1CY4A 4JLJA 2QI9C 2WD9A 4JJ6A 1KY3A 2GWRA 3JWEA 4DDVA 5EQTA 3NZEA 3RUDA 2XWJI 2ZVQX 3IALA 4G6ZA 521PA 4BX9A 5T8KC 5B2EA 4UXIA 1CDEA 1R4MB 2G9VA 2LCIA 1T3SA 3HCBA 2YUTA 2QVLA 3N53A 2QYHA 2F3TA 4QUKA 5FIUA 2FI1A 2QD3A 4GYWA 4FOLA 4DV1B 1PR3A 1LC3A 2ZJOA 3UZUA 4AJKA 2AQKA 1QZTA 4PIPA 3TOZA 3AETB 1R3UA 1W4RA 2WUWE 2WHEA 4ZI2A 4RZ3A 2IS4A 2O0HA 4KI7A 3IT1A 2FN7A 3LFHA 3W2HA 3ZWWA 1Q0QA 4C7OA 1A9QA 3ET5A 1W5BA 3KJGA 2OD9A 2QLFA 4Y0AA 4MZDA 2GFQA 5JECA 3T1OA 1RLTA 3JTMA 2OB2A 3P0EA 4BVHA 3GNLA 4CQMB 4EAQA 2R6JA 2HWXA 1U2GC 1YFKA 3NM5A 4BFWA 2RH9B 1DARA 1DWOA 1F5SA 1PDOA 3MS7A 4BQRA 1TEXA 3THSA 4OGGA 1YS2X 5JAIA 3VPHA 1ODTC 1U28C 3DBRB 3B52X 3AMVA 3QA3E 1O96B 1P5FA 1H9AA 2Z2ZA 1DAMA 3GFQA 1Z73A 4JWKA 4NECA 4Q3AA 2V4MA 3WLSA 4ZHQB 3W90A 4YT4A 2BFBA 2UZ3A 2WTAA 1J22A 3D3JA 3V8BA 5LQAA 4E5YA 1C7EA 3TLJA 2FZEA 3NI2A 2PRYA 4CIVA 1BN7A 1VL8A 4DPMA 4GVLA 4QJ3A 4OXKA 1C8KA 3IJ5A 1P2FA 1KSFX 5JG7A 1DXOA 1XD9A 4ZZ3A 7REQA 3F6PA 5ERGB 2YJGA 1IQ0A 2R5NA 2JKZA 4YRJA 1LW6E 1PZNA 4IM7A 1VKHA 4J6FA 5MHTA 2GETA 1JIVA 4MUJA 4G65A 2O59A 5C7OO 3I9V1 5EERA 5COBA 3CVYA 1JKFA 4FE4A 3SN6A 4LDRA 3N5KA 5M2QA 4L8YA 4QASA 4MB6A 4EMTA 5CD1A 3T9CA 5BSKA 4KREA 1CUGA 2FPGB 4ZPJA 4P7BA 1YB6A 2BEWB 2SNIE 2K7ZA 2NUAA 1JLLA 3TLAA 1NXPA 1E96A 1FA9A 3IESA 4IKOA 4Y6GB 1W34A 3TD2A 2YZMA 2YWXA 3V7WA 5KJ1A 4LDAA 5JSQA 6REQB 3RV4A 3L9XA 1GU1A 2ZATA 3PPWA 4GG1A 3FIJA 3OCWA 5BO5A 1GTL1 1UJ2A 1P44A 1ZONA 2YDYA 1P7CA 1QGED 2QP4A 3ZBUA 3RYTC 3WAKA 1FYXA 3HVUA 4WY5A 1UPUA 2ZPTX 3V2IA 2XQFA 4QYMA 1UBOS 4I3HA 2CUKA 5EHGA 3GLFB 1F2UB 3GZJA 3RG2A 4MW7A 3W8FA 4JYZA 3OEYA 5BSFA 1YZYA 2FSFA 2H00A 1CY1A 1QVZA 1T5BA 4NV0A 1PS9A 4YCAA 3CUUA 3RUAA 4AF8A 4QRHA 4BRUA 2O8DA 4G1CA 3IOYA 4DXHA 4MJ3A 4UDXX 3OOWA 3IVGA 4RF3A 4DSUA 1HE4A 4IJ5A 3CH4B 3VKGA 4PYNA 1JU3A 5AM1A 3EPLA 3QSYA 4NU5A 4JB3A 3HHEA 2HKIA 3RIGA 4A6EA 2QVCA 5A7FA 3UMMA 3N2YA 5EXXA 4BJ5A 4TYYA 1SURA 4IWYA 1YBVA 3TS1A 2AC2A 2VWGA 2L69A 1GZ5A 2XNJA 2QN6A 3LVRE 3RVBA 3ZCVA 4DKXA 4ZOQI 2Q49A 4XIIA 1RRVA 2QN3A 2XUPA 4QQNA 1E0SA 5EKXA 4Z4FA 1OLSA 3EIWA 3H3JA 1WCV1 5A04A 1MD9A 2OO7A 5BQFA 1CYEA 3L7MA 1C3EA 1Y9EA 5DX8A 1VE3A 1YHYA 2XITA 3QOYA 4GGPA 1UDWA 2XXBA 5A71A 3WIBA 1UXHA 1A2OA 2ESRA 4PFSA 6LDHA 2FH5B 4WZZA 1XZGA 1E9BA 1SBIA 3E27A 2JEZA 3C3JA 4JQYA 2BHNA 3W4JA 5AI6A 4BQPA 3WKAA 2F9MA 3Q7IA 2C2XA 5H4HA 4RKEA 1W30A 3ND7A 4RNCA 4F2HA 4ALLA 2UUCB 4ZEOA 2HPVA 2A14A 5BSWA 2EKDA 4GW3A 1W6UA 2A9OA 1VIVA 3GPBA 3JQ6A 1OGYA 2IPLA 3X1XA 1ISHA 4JI6B 3WL8A 4EI9A 2I87A 1XPOA 1NASA 4TZ6A 2IOYA 3DNMA 4C0LA 1L7BA 3KDAA 1I5EA 2D2EA 3OPNA 3BPSA 4G2NA 1QK5A 2V7BA 1RHQA 5T6BA 4HDKB 4U2CA 1R0SA 4CM4B 5D1NA 1A82A 2BZGA 1QOZA 4N7BA 5EC8A 4D99A 4MKGA 5KHAA 1RQ7A 3G5LA 3QE2A 3N76A 1SKMA 3I2KA 3AJDA 2QUZA 5EQDA 2ZJBA 3GIDA 3ZHTA 4N4AA 3W7AA 3ZWCA 4TTQA 2HSJA 4J0EA 3BCRA 2W37A 3HWX1 1E2FA 4PGFA 1HDRA 3FWNA 3UFBA 2DR2A 3LIPA 2OSVA 4C04A 4IXWA 1B2RA 3O4RA 3NIWA 3PR1A 1OW3B 1GGNA 4X00A 1W35A 4KXQA 2H5LA 4K5QA 4JSYA 4UOEA 4JGBA 1W9HA 2D5IA 3VSDA 1DAEA 4IZ6A 2JLXA 3I62A 1VDZA 3L07A 5K20A 2FP4A 1WRBA 1E2JA 2ZI3A 3E1GA 4X8LA 2W7TA 3H13A 4F2PA 2A0XA 2JFXA 2NXEA 3PHJA 1MVOA 4N3GA 2EX1A 2HYDA 4QVKA 2R84A 2VHCA 4IUYA 4BMVA 1T25A 4L4ZA 1E7QA 1V3TA 2OCLA 1RABA 2CUNA 2VLBA 1LF5A 3H11B 4CTNA 4KQHA 3WQHA 3DNFA 5I4CA 3JYNA 5KWEA 3GRFA 3D7KA 4V0ME 5EJFA 5DCLA 3AUSA 1TZKA 1XEXB 3HCCA 2Y1OA 2YIDA 3EOZA 4PC6A 1VE7A 1NBEA 2XT9A 3FMGA 3NVDA 1Q0TA 2DXIA 1YAJA 5TR9A 1JLSA 2XYGA 2YZGA 1K8QA 4MMZB 4C3ZA 4ESEA 4MS3B 4O29A 1TXGA 2AK2A 4HAVA 1QYIA 2ZP1A 4ZXPA 4D2IA 4DC9A 4EI7A 1ADJA 4H3VA 1P2TA 4R1TA 5CUQA 3TD6A 4ZMBA 1N8TA 2C04A 3A4MA 1QS0B 3RSQA 3IUEA 4BO7A 3FNRA 2P9QA 4KLCA 2VK1A 1UQRA 2QMYA 1XWWA 4UHJA 2CCKA 3T9FA 1SUBA 3IQEA 3TN7A 4EHHA 4GDFA 2NLOA 3L1IA 2DT5A 2P77A 3WYNA 1WUKS 3SQMA 2CJFA 2EBFX 3KLBA 2OYCA 3TNFA 2CLOB 2CV2A 4I4TB 2PQ2A 4XKJA 2R2GA 4GRDA 4CL3A 1JEAA 3UTDA 1FFXA 3LY7A 2HIGA 5IAGA 4OHWA 5AKGA 1EFHA 1TM3E 3G2HA 3GV0A 3M70A 4O2AA 1TX4B 5LDGA 2QVGA 2O8EA 1CQIA 1T6YA 1U0LA 2PRZA 4LNAA 4DR6B 2X8JA 2XSZD 4AZ0A 4CL2A 2BTEA 5JH7B 2Q5EA 2GD6A 4IQ8A 2OXTA 4E14A 1VC2A 4I14A 2ODPA 1K3TA 1TQDA 2DJIA 2OO3A 4MVJE 4POOA 4RTQA 3RHTA 3UTCA 3CN9A 1CUVA 4S1TA 1VE9A 5EE5B 1EGVB 4J3JA 4B2IA 3I5YA 4Q1AA 5IDXA 5G53C 2C3OA 2F3SA 3CNLA 4LIPD 1C9MA 3AIIA 4PQEA 4XIFA 4DDUA 3N05A 1KAMA 1H2BA 2WVHA 1RLUA 1XIVA 4M60A 3LDGA 2YMMA 1QUEA 3O8DA 4MWEA 5G41A 4J2OA 2HK8A 4PHCA 4XJSA 1HYQA 1ONPA 1CNMA 2O52A 2W2KA 3CWQA 4D41A 1HT3A 5LJLA 2AFVA 1RYHA 2OWDA 4ARZB 4ZI3A 2GLUA 4QVIA 2DPMA 3QE3A 2J6HA 2XGMA 3DHVA 4U2GA 4BGVA 3EVZA 3IS3A 4R5MA 4TL7A 1JDSA 5BRNA 1PE0A 1PR0A 1MP0A 1Q84A 4LWZA 1YJBA 3H83A 1PJSA 5AI9A 4N82A 4OXQA 1QCZA 4WUVA 1P91A 4CU2A 4DA7A 3D4NA 4Z9XA 3VYWA 1IPHA 1C8LA 1P5ZB 4D79A 4DV4B 3BF7A 5F1PA 3PQFA 3FFWA 3E18A 3SP1A 2Z1NA 2YV5A 1RXVA 1Z28A 2XRFA 1JN0A 3AEUB 2PZJA 2G5PA 3BD6A 3OX3A 1C9DB 1I4LD 2V5UA 1GLGA 1X1EA 1ZH6A 1UH5A 3VO8A 3ZCTA 3FF4A 4AWAA 4DDWA 4JWTA 5ALWA 1J5XA 3NP9A 1KSHA 1GL6A 1PK7A 1QIIA 2WF5A 2X1LA 3QNUA 4G0XA 1PUJA 1LFDB 1QKKA 3B2QA 4C05A 4L16A 1P61B 1DMRA 5FTWA 1MPXA 2XJ4A 2WLSA 5LCXA 2Q62A 4OQLA 4EKIA 1CY6A 1MB2A 2XVAA 5LZ8A 5AH0A 1LPBB 3IQZA 3JQ7B 4RD2A 4B87A 3ZD6A 1HH4A 2Z6QA 2IP1A 2Y9MB 5BSTA 3T6KA 2P6RA 1GKLA 5I9SA 2WYWA 2DBRA 4GR4A 2UZ1A 2Y93A 1UPBA 5FPYA 4WBNF 3UMSA 2RB5A 5ICSA 2OT3B 2PJUA 1Y4AE 3ORYA 4GYJA 2JD0A 4QYXA 3PT9A 2UXDB 1C8VB 1PJRA 1EXMA 4MYUA 2C2YA 1KR2A 4FYKA 2YJNA 5EKUA 2GK3A 4WNAA 2DSNA 2IUEA 2OTCA 2GVNA 2V5VA 4NYIR 4RK5A 4LGYA 4KR2A 1HV8A 1L4YA 2Y3IA 2XH8A 1A7UA 2VP4A 4BV3A 1R00A 4MRMB 1FTGA 3I09A 1LDGA 4MI3A 2AI1A 3R9KA 3UO8B 4UHCA 3W4KA 3KKZA 4LXHA 3IT0A 4R6WA 5ILGA 1TF7A 3CONA 5AUQA 3UYLA 1IZ7A 3MCWA 1T43A 2BM9A 5GONF 3L3BA 3QHQA 2HXGA 2Q3HA 3QGMA 3OTWA 1JR6A 2HY7A 2XUDA 3QKUA 3W0LB 2VF7A 3D4OA 1FBTA 3PXGA 1F8FA 1JQ3A 3STYA 2ZSFA 3BIFA 4U7PB 5CYOA 1NMQA 1B6TA 3A0RB 4LXYA 4DLPA 2GCOB 3R5TA 2NUBA 4QAQA 3U7JA 1N6RA 1QZZA 5A4DA 3FHOA 4E2ZA 2YFKA 3C97A 5LYJF 3DF9A 5FA6A 4XX1A 2NUAB 4AJJA 4HDQB 1VHTA 3IDSA 1KS9A 3M9WA 2FQ1A 2C20A 1Q1EA 4BGUA 1DKRA 4OHFA 4DQ0A 3ET4A 3TGLA 1E3TA 2IHUA 1NUPA 1SVKA 1GG8A 3FPAA 3JXEA 4LVUA 4PPNA 1ESDA 3DB1A 4MRMA 4TS4A 4TTAA 3NONA 3AJAA 3SYMA 4CKBA 5AP9A 5B2FA 4ZGBA 1RI2A 1NOIA 3TX6A 2E85A 1WZNA 1AF4A 1T6BY 1SWVA 1SB8A 1IUOA 1ZIOA 3NFRA 3T7DA 3UGKA 4YYEA 4YIKA 3H75A 4PS0A 4DSAA 1UBKS 3GWZA 3M81A 1OHHA 4MO9A 4WNCA 5EJMA 1MEJA 1A72A 1UR5A 3L7CA 4QPPA 4ZC8A 2O2CA 4J1TA 4D8UA 1M6VB 4R54A 3ZZ0A 2BEKA 4QVGA 5K8UA 1IJFA 2QV7A 3V4SA 3CNQS 2YRFA 5T4HA 3FCAA 3ZHYA 1AVTA 5GTDA 4BMDA 2CVOA 4XQ9A 3TQTA 2OC9A 3C7KA 4Y1FA 5L3SA 4YLGA 4HWPA 1R1DA 1X70A 1XRJA 2EWVA 2IOHA 2O2JA 3OZDA 1SY7A 2NQTA 2OMKA 3BL5A 3KR2A 1VGQA 4AJ4A 1WXGA 1VGVA 4N3BA 2I4RA 2V59A 3R24A 3KP1A 1FTWA 1KTVA 3HVKA 4IXMA 4R6XA 4IJWA 4MUXA 2AZTA 2VNSA 2ZKLA 3HEAA 2G17A 4QOJA 2O4CA 2XB2A 4BNIA 3OEED 3WZLA 4CKEA 4WCVA 2OILA 2PKYX 3RS5A 3O6VA 4K26A 4X3OA 5K8JB 1RQ2A 4UVDA 1SBNE 1S6YA 3IDOA 4HB3A 4I1VA 4I2VA 4M1SA 5BNZA 3G2IA 1AZSC 1NF8A 2JJ8A 2VG8A 1FVOA 2DY1A 3DQPA 5ELMA 5K6AA 1DC7A 4RTSA 3P52A 3L0ZA 4TMKA 2V7EA 4LVNA 3OHMA 4DM4A 1XU4A 4HGZA 5E6UA 3T5CA 1GG2A 1RMQA 1Y48E 1V7CA 2PS9A 3C16C 4PLYA 5HG0A 3LPLA 1JEJA 1IFXA 2P4SA 2C8LA 3KT6A 1Z6AA 3I39X 1RJGA 3BFJA 4LYGA 4TMYA 4TVOA 4F1WA 4KITB 4ZARA 2G1AA 2CYBA 3CX8A 3T7EA 4YMGA 4ETIA 2ZUCA 1NXOA 1XQ1A 4BO8A 5B7NA 4DUGA 3CQ9A 1M3SA 3K1TA 3EGIA 3F49S 4IUCS 3WB0A 4BNWA 3LWNA 2RGRA 1WP9A 2EKZA 2PX2A 1P6UA 2HMWA 2JBAB 4OHBA 4P0QB 1KS2A 4KRFA 5DHSA 3ZDAA 3L4BC 2HSDA 4Y0VA 2QHXA 1Q1AA 2WKPA 4RAOA 1KRHA 5EQFA 3REFA 3G0OA 4QUDA 2DSTA 2JK0A 3HCNA 3GUCA 4NFLA 1TEVA 2Z5FA 4J1QA 5AW5A 3IURA 3BSSA 3I53A 2C9OA 1NOJA 3U4HA 5JDCA 4AKHA 2NTEA 3U56A 1NUQA 2VYVA 1WKBA 1SCKA 1ZIXA 3UFXB 4K6GA 4X1IA 4FZ3A 2YJ6A 3GJQA 3JATA 2ODQA 1D0SA 1U9IC 3C7DB 4OKSA 1U6JA 3L1HA 1SBTA 3NT2A 5CYPA 3UXYA 4BV2A 3KQHA 4G09A 2B92A 1QIGA 4LWOA 4PLVA 3LUCA 1S2MA 2FKAA 2R7KA 5DBOA 2OOSA 3SHVA 4TKVB 4A3SA 1KI1A 2PGJA 3KC2A 6Q21A 3FNFA 4MI1A 5ARCA 3DFKA 3RRXA 3OOEA 1Y1LA 3SXUB 1BVRA 3KX2A 2CSUA 2O7VA 3BXGA 4YC7A 4XB2A 3FPGA 3U7GA 3V1KA 4FX5A 3ROMA 3ZZMA 4JP2A 2C4MA 5TRTA 1E8MA 2WT8A 3OE5A 1KYIA 2G82A 3RABA 3ZHQA 5FTLA 3S2EA 1ZX1A 1W1IA 3P9KA 2XBMA 1O89A 3QV2A 3DV9A 2QAIA 5GV7A 1GZSA 4ZV4A 5BNFA 3JWIA 1ST2A 5FKJA 2P6PA 2QTVB 3AEKA 4DIUA 4H1WA 3S2ZA 4Z8XA 2Q9CA 1YKSA 2ZCJA 3M7IA 1KP2A 2GPWA 2IHBA 4GX2A 1NDUA 1S8OA 2W4IA 2ZRNA 2QL9A 3ABIA 4ZI7A 4H6VA 4L2IA 4RDIA 2W8BB 3MLBA 5IN4A 1XUOA 4WW0A 1PR5A 1WIWA 4JNCA 3TGPA 1ZSYA 5EP4A 4M76B 2CBZA 3DAPA 4DKJA 1NDQA 5C2JB 2R47A 3C5EA 1AXRA 2PLAA 3FDZA 3G0CA 5AI5A 4ZQBA 5IJ0B 5L45A 5G2OA 2AN3A 3OT5A 2QR3A 3HFGA 4IQGA 4ALMA 4YHHB 3H8WA 5CLGA 2GILA 1SIWA 2O1SA 3MVEA 3QEOA 1NNLA 4J3FA 3V48A 4RW0A 3FPBA 1AXEA 4JBWA 5E4YA 5IDYA 1SELA 1H2YA 1HFWA 1LLDA 1WMAA 2REBA 1VKOA 4PICA 5TQ2A 4MH0R 4HNUA 1KTIA 2P1ZA 2MDTA 1OAOA 5F4BA 1SOVA 2PTHA 3B1XA 3C6QA 1C1DB 4LWQA 1J07A 2X9NA 3QPAA 4XAQA 5DBHX 3UW1A 1ZC4A 3GN2A 4ZJZA 4G5OA 3UWSA 5AVYA 1BA3A 1ISFA 1DIRA 1I3NA 3B70A 3GP8A 1ZUD1 1QF9A 4ECEA 1V8ZA 2NW6A 4IOKA 2NNLD 1I5RA 2CFRA 3F8TA 1QQBA 1H4VB 1S9HA 2P9EA 5DYTA 3RYIB 1XNJA 4PZ9A 1S2IA 2RKWA 4L22A 2RE8A 4H77A 1JG3A 4M1WA 4N5DA 5EIFA 5EMHA 5CGQB 1QORA 4EL0A 1MHTA 1UC9A 3FKQA 1Z4LA 3IAHA 3I01A 3NATA 5CYFA 2C4NA 1FZTA 1SQFA 1ZGZA 1EEXB 3C3MA 2BFCB 1EXNA 3KEFA 4HR7A 1KH3A 3FSGA 1SVWA 4ZN6A 3AK4A 5LP6B 1HRKA 4N48A 3BK2A 1USKA 2YYSA 4B4DA 1JVNA 3KE8A 5K3BA 3ZI7A 1Z29A 4NBRA 4Q4CA 4X44A 4JR0A 5TSDA 3USZA 3PHBE 2XZPA 1LI7A 2QPOA 3GH1A 2H11A 2X0JA 4KQGA 1A4RA 3A9RA 4FHDA 4L6AA 5TMBA 3N74A 1Q0ZA 2FZCA 1P33A 1NYRA 5JCJA 3T5BA 3VC2A 5EHXA 1KH2A 3ZH9B 4M89A 5KHLB 1LK0A 4REMA 1OU0A 1STOA 2ODAA 3CXUA 4PRYA 3WXBA 2XR1A 3GX1A 3NHFA 2WF8A 4PFQA 4LAFA 4HH0A 4ND2A 2FCAA 4RYDA 3X44A 2XNDD 4LDZA 4EB8A 3MTBA 5C7IO 1QHFA 3DO6A 4ZAFA 4EUNA 3HDYA 1TNDA 2JIOA 3AUAA 4RE6A 2WMNB 1VPDA 5K3DA 3P27A 2O6LA 2O1EA 3FNQA 3MIIA 4IMRA 4R01A 4C4XA 2YFHA 1TO2E 1T10A 2AF4C 3QEKA 3ZS9A 4Q05A 4MAAA 4NBKA 1C3JA 1AH2A 1ZS9A 1D5WA 1FVHA 1MABB 3GO4A 3HDGA 1OXKB 4YBRA 3T7AA 4F7WA 4P92A 5I9TA 4G5SA 4ZEMA 1J8FA 1WW2A 5DHPA 4MVJH 4MLPA 4BC0A 5EJ6A 1E3WA 4FFNA 1YE8A 3PKIA 1G1AA 5T41A 4D8YA 3ROPA 2GJ8A 4GECA 3LYLA 1N8SA 4ZRDA 5HPYB 4ND7A 2NUTB 1H8EA 2QBYA 4CEHA 1E61A 1KERA 1DKQA 4RU1A 2G4CA 1MKYA 3IDAA 3UWMA 1PS8A 1IHYA 2JCYA 1OLUB 3SBEA 3VR4A 3W6ZA 2LPMA 5C35A 5HRAA 4A26A 3C3WA 5JD6A 1JZTA 4RSRA 4DNOA 3HRHA 2E18A 1QVWA 1M2OA 2WAAA 1HUQA 2PVPA 1AHHA 3AU9A 3QUQA 5D87A 4FGZA 3U3XA 4C6SA 1Q17A 5CTAA 4XGKA 3ZQUA 4M7WA 2F64A 2DHDA 1R6XA 2XEXA 4LHXA 4EVIA 3R7BA 2DJ5A 4O02B 2V45A 4R05A 3KKQA 3B5JA 2QNIA 2VQDA 3PD7A 4KYIB 5DXFA 4EZIA 3W78A 4BNVA 3KPWA 3OEWA 3R0VA 4IXNA 3A37A 1HURA 3DH0A 3LPAA 4RIGA 5DPMA 4CMGA 4DMGA 1FDVA 2O8EB 1GQQA 2WWFA 4PN7A 3PYXA 2FWMX 2Q5LA 2C1XA 1R5OA 2QQ5A 4MI9A 1PTKA 2D74A 2VN8A 3B9RA 3FDZB 2QM0A 3H7AA 3ZTWA 3MJHA 3ACCA 3P45A 1HE1C 1CZNA 3DQZA 1FP7A 3RIEA 1T3LA 5FOUA 3EPJA 4IXDA 4N18A 3RSLA 3QW2A 3DLCA 1F4PA 4EEXA 1FMFA 4J9UE 3NAMA 1UMKA 4M37A 3R0XA 1MOSA 2DKFA 5FWXA 4QATA 3DWEX 4B7XA 1U4OA 5FJJA 3JPYA 2RFLA 3KV1A 2PX5A 4I4TA 4WSOA 2BGKA 1QIFA 2VXBA 3LNTA 2IPNA 4F4IA 1ST3A 4RHFA 1G5IA 3AESB 4QU8A 1J56A 4RELA 3GJ3A 1L5HA 5K45A 3WYEA 1XMPA 3EEYA 4G67A 4I9UA 3TLCA 1QQ7A 3V55A 4AJ2A 1E2IA 3BH0A 1JU4A 2CN1A 5M3BA 3PDWA 4JASB 4E30A 4K9RA 3I8SA 1VSVA 3KBBA 4C78A 5FPPA 2FSGA 1IUKA 1ZN7A 1IM8A 5CR9A 2VNAA 4ER6A 3IKTA 2EKQA 5K3OA 5I5GA 4DR4B 4FQ7A 5HQTA 5DLEA 4A8JC 3B1WA 1KFJB 3LC0A 5DNWA 5GJVC 2J85A 4WJLA 2IX9A 1NBAA 2DG2A 2R8RA 2XQIA 3N58A 3G2NA 3FYHA 1YQWA 4GYYA 3RNLA 2FHSA 4I1IA 1TU3A 3N70A 2CKMA 3ZQ4A 1E2HA 3GJRA 1DJLA 3KWJA 1KOJA 2J3LA 5B36A 4QJBA 3ITKA 3UC9A 2JARA 3GWGA 4R2MA 1YVEI 4TWJA 5U4XA 2D2VA 2XE6A 3T06B 1G3UA 1AC5A 4IP0A 3UUFA 2Q27A 1Z5WA 5DTIA 1JE0A 2I54A 3EARA 6GPBA 3HSSA 3ORRA 3NX4A 4C01A 3FMPB 5A2GA 1KY4A 1TPYA 5JLJA 1X80B 5L9AA 4LUCA 5CA1B 1FUKA 3SLRA 3TWOA 1X7DA 4OQDA 1HL3A 5H16A 2O0JA 1EZ1A 1N5KA 2IJGX 2VUUA 4FFMA 4XRRA 3U13A 1FQOA 2CFIA 4Z2AA 3L82B 2GEUA 1NPTO 2B0CA 3AKDA 5DU2A 4FFBA 1KMMA 1XNRB 4Q4AA 1Y7LA 2HZ7A 4YAUA 4EG0A 3ZKAA 2QUHA 4JVMA 3IP8A 3Q3VA 3IRUA 1K06A 4X7BA 4UFOA 4ZVTA 1KHHA 1J5PA 1KVSA 4CLOA 2NVBA 3S28A 4AO8A 1GUFA 3N0WA 3SICE 5IRCD 3AV0B 2GEDA 1G16A 3A6KA 3EVBA 4P2BA 3O2QB 3QU4A 2WJJA 1E1LA 5IVPA 5HK9A 5JJIA 4BO5A 3PFCA 4C21A 2H2WA 3EQ8A 3PI7A 3MW8A 1J7KA 4G5XA 2JJYA 3NWPA 4MDYA 4HMPA 4MQBA 4RJJA 4RFLA 4WLFA 3COVA 3ZVLA 4DLWA 2PBZA 5A6VA 2IELA 2Z95A 5B53A 4YDQA 3GLIE 4RA6A 5TC4A 2H2DA 1O8BA 3IEVA 2FU5C 3KJIA 1WCIA 3SJCA 3OCZA 4HT3B 4Q4JB 2YVUA 4CI0B 5B3AA 4BQSA 4G9EA 4JXZA 2FSSA 2C92A 4F56A 3D5EA 1Z6TA 3KELA 1JEOA 4QXQA 4BQNA 1U2TA 1NJFA 1VG8A 3DKRA 4XUCA 5FLXA 4KBYA 3PU6A 2PD6A 4O3MA 1DX6A 1JSLA 4ENWA 1GQSA 4HVTA 2FPKA 4OGFA 4WLVA 4MV7A 4ARSA 3ZPXA 4QJIA 3H6KA 2VNJA 4RMIA 3V2HA 3GMSA 1HL7A 4FJ0A 4PIVA 1Z35A 3KR0A 3GB9A 3HPQA 3TW6A 5BWOA 5E3IA 3CISA 3KWFA 5CG1A 2RMKA 1CUCA 3HJBA 2IEGA 4P58A 5ICCA 4V0OA 1GA4A 3FYUA 1Z0AA 1SVIA 1W87A 3DFUA 2BEJA 3O74A 2SKCA 1QG6A 1XAHA 1JDTA 1DEXA 2NXNA 2XOXA 3WK5A 1G20E 2H4ZA 4ZA2A 3R9XA 5JANA 4AS3A 2CLFB 2Q2WA 1FYDA 2TMKA 1X7ZB 2PV0A 2QIPA 3ZU2A 2IY7A 4DMLA 4BOYA 5COQA 1X7GA 4RDXA 2ENUA 2Z6AA 3E5MA 2BONA 1K86A 1NBOA 1SUCA 2BWJA 1UWVA 3I0MA 3HO8A 1Z06A 4L51A 4TRRA 1X94A 3JQFA 3LBFA 4LMBA 5H68A 1PJQA 3ICPA 4J7CA 3FLBA 1G4AE 2OMEA 2WHRA 2IYOA 3KZCA 2JGJA 5FOXA 4DG9A 5KQLA 1BJRE 2GK4A 3X1MA 4G24A 4JQZA 1SUEA 5IT4A 1TVMA 4H7DA 1KOGA 2EFEB 2WJZB 3DZHA 3C3EA 5C1BA 1UXOA 1YE5A 1ZZGA 3EXEB 4BMPB 4A8PA 4F3TA 2FYTA 2JFZA 4EO7A 4K9KA 1KJJA 5KYUA 4AO7A 1F5NA 2MU1A 2YVLA 3C70A 3F4LA 4BUCA 2GEJA 3IIKA 4BBPA 4HYQA 5SYNA 2R7NA 3HJRA 1EWVA 1Z0KA 1SQ6A 3H5LA 4GSLA 4EYOA 5JSFA 1EM8B 2QN8A 3KQMA 3QHAA 4Z53A 5IH3A 1E99A 2ADOA 4TLCA 1PQUA 2H2GA 3BVPA 2P11A 4BRSA 2ZZMA 3TUZC 2IUFA 1UM9A 5G0TA 4YEDA 1PX2A 4HEJA 4NU6A 4Q9DA 1A4UA 3HU1A 4OH1A 3ND5A 4UJ5A 3NHMA 4MS1B 4RTLA 4KIFA 5A1JA 2PEZA 3RSSA 3NVKI 2GJ4A 1A5ZA 1Z2PX 1H22A 1K6EA 2X1VA 4HQRA 3VR4D 4FTWA 2ISQA 2NIPA 3CUEF 4JD5A 4A1FA 3AF2A 2WF6A 1RJEA 2GO7A 4WESA 4HQFA 4DB4A 1GTSA 2RARA 2ISCA 1DTWA 1A69A 3K2BA 1ZKDA 3NTLA 4LQDA 1SIBE 1NP6A 1IDN1 2GYUA 5EI5A 2H65A 3RHZA 2C4KA 4E03A 1YR3A 4EG4A 4PN3A 2V9CA 1OLOA 1W4AA 4C7XA 1GFZA 2XT6A 1XD8A 3HP4A 3RRMA 1Y7IA 4NNJA 1QPGA 5ALUA 1KFCB 5TJ9A 1JDPA 4FYPA 5IK2A 3HK2A 1CQZA 2Z56A 1E6UA 3SZOA 3LVBA 4ZCQA 5CJ2A 5E7JA 1A7KA 5EEHA 3ZVMA 1MH1A 3D43A 4ALJA 4P9NA 5JJCA 1E60A 1UC8A 5A0FA 3RAFC 2FMTA 4WBNA 5E1OA 2F17A 3H65A 2RHDA 4G1UC 4HYEA 4HUQA 3H5RA 2RAVA 4E0BA 3L92A 5THKA 4A6PA 4RMGA 1NONA 2JBAA 5I9BA 1ZGAA 4PG4A 1R9NA 4LZWA 1BIFA 3F97A 3VR1A 3X3HA 1E0KA 4YMTA 4BGDA 4S35A 1JB1A 2BI8A 4MV8A 5BN5A 4D9KA 1Z5ZA 2YDXA 2JPDA 2IBSA 1MQ8B 2FOXA 4CQMD 4ZMSA 3CUVA 1JTVA 3BJRA 1EK6A 3FGPA 3DLTA 4ND6A 3HN6A 3TRFA 4TWAA 3AZQA 1U2PA 2BGNA 2Q28A 5KUTA 1C9EA 3CRRA 2MWMA 1O7JA 2WWIA 1P0CA 3U61B 4DV7B 4N40A 4FMDB 2ZBRA 3IO5A 4B45A 4YQZA 1TL7C 5DGDA 4BB0A 2XMSA 4KYVA 2GBLC 4DANA 2Y4OA 4PNZA 5KOHB 1E6LA 5JZSA 3OAAD 2W42A 5DHUA 1WCXA 1XZCA 2R2AA 2RK4A 1D7AA 2GCPA 1Y6QA 3FZYA 1KNQA 1KYQA 1O58A 3B20A 3EPPA 3AEZA 3L02A 3N0TA 4N39A 3RKRA 3FFAA 1MX9A 4TMZA 3E9DA 3TKLA 4C3UA 1ULAA 3PCXA 3ASZA 1C9JA 3GYBA 5BXYA 4CLDA 3RADC 1V1RB 3NCTA 4ROTA 3SQWA 4GI3A 2ZBQA 1P17A 3QVJA 4BJ6A 3F3SA 1M8GA 2AEFA 1E7MA 1YS9A 1SAYA 4U9HS 3ZIAA 4GL2A 2FEKA 4UE2A 4LYEA 1JFRA 3H2SA 4IFEA 4J91A 1ACMA 3HM2A 4UTPA 2FWNA 4QE3A 4DF3A 4O0MA 2CFCA 2B3TA 3C3XA 4X8OA 1XDZA 1BDJA 3B78A 3LUDA 5EWMB 3EK2A 3IL2A 3FPCA 2VTBB 1SUDA 5FWYA 3K9QO 4NULA 5HJ5A 1JI0A 1LNQA 3PL5A 5JNRA 1HQKA 1NURA 2NU6A 3O93A 4P34A 3GDFA 2XYRA 4TSRA 2QW0X 5IWAB 2EXXA 4RK7A 5LN1A 4UUQA 3C8MA 5EWMA 4JI3B 3RRBA 2QAJA 3M4XA 4AT1A 6ADHA 1XTIA 2Y0EA 4BZQA 5HKKA 2BMDA 3JD4A 4GC5A 3KQSA 2W93A 5KOHA 3UMYA 1HFJA 1LPSA 4BJ1A 4TRMA 1BA2A 2E7ZA 2IUTA 1EIWA 3TIIA 1JXQA 3A9VA 1J8MF 1K88A 1ZGCA 4GHWA 2C7BA 4HCJA 4J4TA 1NI4B 1JHZA 3E4CA 2YJ4A 3PNQA 2FN4A 3ERCA 2TRSB 1Q3KA 3FJ1A 3WSWA 3AL2A 3O92A 5EPOA 3CXRA 3PXUA 4R7GA 4MULA 2M9MA 2XBUA 3F2VA 1N2IA 5DHFA 3GDHA 1ZOPA 2GN1A 2AFHA 5FORA 1JLKA 4FI3C 5B5SA 4JBLA 1RACA 1ZINA 3NH9A 4L5IA 4MEBA 3ZZUA 1F51E 2FPWA 1H3NA 4G01B 1FQJA 4NQZA 1C4KA 3PV0A 4KBGA 4L4XA 5A4FS 3DWGA 1KI9A 2O7SA 3FI9A 1W5AA 1NG1A 3PFIA 4Q47A 4RGVA 4B2LA 3OLCX 1AT1A 1DZIA 4RFVA 1EFRD 3FNEA 4O2RA 2AX4A 4QYWA 1RHRA 3SFZA 2QUKA 3ANLA 2YRWA 3UQYS 3VR0A 1MVNA 5I3CA 1MVLA 1Z2CA 1RYNA 2GI4A 2Z57A 2O0LA 3FVWA 3PUVA 1AZLA 3ND8A 2C78A 1Q12A 3BD9A 2BGTA 2IXFA 2YBDA 3FBGA 4YAGA 4INPA 3KT3A 3ZY2A 1NTRA 4MIKA 3DBHB 2YWBA 4UM8B 5CW1A 2PK3A 3D6NB 4YRKA 1W6RA 3SMQA 1WLYA 2ODEA 1K7YA 3EEIA 4G81A 1G7CA 3NDRA 1H2ZA 4M8KA 1GPKA 2BUCA 3WLFA 4RTJA 2DM6A 4GNRA 4HAZA 3HBMA 4CKWA 5LOVB 1PZGA 3K92A 1QC5A 4K40A 3PK0A 4Q93A 3M3DA 5KC9A 2CDAA 3MYYA 2FE4A 2ZWIA 1I4EB 3OSZA 1XNHA 4UHBA 2A9JA 2QZSA 1FK8A 1L5NA 1CR6A 2M2IA 3THYA 3PA6A 2NTVA 2BN4A 1EZZA 2J0UA 4PO8A 1JKMA 3FHTA 3AL0C 5EJ9A 2PMCA 3KLOA 3I23A 4KIWA 4WCFC 2K87A 2VDPB 2VT6A 4OQ4A 4UNNA 4WXPA 4EWLA 3CRNA 3GHYA 1RRPA 3I32A 2JFWA 3AU8A 3ETLA 2CZQA 3O5AA 3D3EA 1V37A 3Q8LA 4MGHA 2PZBA 3MJ4A 3BGDA 3NQ41 3ANYB 3WGKA 5AW6A 4RY2A 1DFHA 5F51A 1VLQA 3F6YA 3M1AA 3DVAA 4OXRA 3T94A 3KAKA 5H5JA 5FR1A 5REQB 4B7CA 5D1HA 1UJ4A 5FL7D 2QIOA 3V6LA 5F23A 5JCXA 1BXRB 3TSAA 4DNXA 1WHTA 5KAMA 3DBOB 1JPNA 4K8OA 1LSUA 1DRUA 2W6ZA 1IWOA 4E3WA 3IVMA 2XQKA 1M6HA 4H18A 4TROA 2FX2A 1N1GA 2H85A 3CTPA 2GEBA 3QEAZ 4YAIA 4AX8A 3GAAA 2H7XA 4XPIB 4B09A 1FJXA 3IUBA 4IDQA 2VAMA 3ZI4A 4FYWA 1G5TA 1OCEA 3CFYA 1E0DA 2XKKA 2ZW9A 2PH5A 5JNLA 3A6EA 3H9JA 2EL9A 3DBRA 1DKOA 4LKRA 4PBRA 4QU5A 2VCEA 4WXHA 3WLKX 4FGKA 2E9SA 5JS1A 1GTZA 4II2A 8LDHA 1YZNA 4G5FA 4M1ZA 4BCDA 5CD9A 5YASA 3LWZA 1UBFA 1E64A 2PRJA 1M33A 1SZJG 3AF5A 4QTUB 3G7NA 4B4OA 4JZYA 821PA 2WA1A 3CLRC 2HK6A 1ESEA 5DOVA 1UXIA 3S2IA 2O7QA 3O3MB 4GOND 3CNBA 4WIAA 4E07A 4DWVA 2X41A 3FMFA 1JT2A 2G63A 2WR8A 2PS0A 1HE2A 2HHLA 2Q5CA 3GA5A 3K96A 4G5GA 4GI1A 4TS3A 4RKYA 3PNOA 2FDXA 3OURA 4IDGA 1ZHFA 4D4HA 1NBIA 4JI7B 4PYMA 2OHGA 4OJNA 4IGAA 1JKJB 1N57A 2QQGA 4M0FA 1A5SB 3VU0A 4DMHA 4N5LA 2PL1A 1SXGA 2QOEA 5GZ6A 4U6NA 2R86A 5IM4F 1L8QA 1FW8A 1L8XA 2GZDA 4GI2A 2JLRA 5H0IA 5TT0A 4TTJA 3IPXA 1N5RA 1K9VF 2BBWA 4E33A 5I8WA 4IMJB 5B37A 4JBXA 1H23A 2MR5A 3FGOA 1E58A 3HYCA 3OG9A 4IZIA 2XDYA 1VIYA 1P4HA 1RKBA 3PB3A 1U99A 5EJIA 6REQA 4TLEA 2QT9A 4HX5A 2F90A 2WIFA 3WISA 4MLZA 1MTZA 2GS9A 3O38A 6CHYA 2R1ZA 2C54A 3OFJA 5E2BA 1HDXA 4PQYA 4EPTA 2D2IA 1DQPA 3M6WA 2DPYA 3MYRA 5KHOC 4OFWA 4WZBB 2F3UA 1SIUA 2OOKA 2PLNA 3U60B 1QB8A 5A5FA 4KZKA 1ZH2A 2DFKB 5AICA 2BAGA 3CCFA 5KSPA 4Y1RB 5H7XA 3SS7X 3F7OA 2ZBFA 2X58A 2C3UA 1SCDA 4EECA 1ZMRA 5CM2Z 3L6OO 4DQDA 1Z6GA 3M0EA 4MV5A 3L8HA 4BBAA 1WXIA 3DE0X 3VGPA 3JYHA 4BFZA 3I05A 4LZPA 2FZVA 1QBGA 1OT3A 2QD4A 3ETDA 4DLXA 3O8QB 2J5BA 2J45A 1RZRA 4ARCA 4Y30A 4NZOA 1BCRA 2JAPA 4AUEA 1HM5A 3OWXA 2X5XA 4J4HA 4RQTA 2HT1A 2BP7A 1V96A 1ZHHA 2H57A 3I1FA 3AFGA 2BVNA 3INRA 4LNHA 4NPAA 2V6IA 4ITUA 4D81A 3T1NA 3DEKA 1J39A 5KNDA 1GDTA 3CZPA 3OCCA 3W5HA 4LBWA 1EB8A 2PR2A 2D7CA 2KX7A 3I5AA 3UYKA 4B3SB 2J0UB 4AZSA 5F7JA 3GRKA 5CIWA 1CUDA 3E22A 1XHEA 3R3YA 4KQEA 3I2FA 1XHFA 1G20A 2YMLA 3CYFA 3ENQA 4NYIQ 3SZMA 3TMAA 2YMQA 1R27A 4ZCIA 1MW8X 2O7NA 4UDYX 5D8DA 2CLLB 4WKCA 1D7OA 4F6CA 3PXEA 3JALB 3KS9A 4WN3A 3S55A 3ANXA 3EB9A 3Q8WA 4KQ2A 3MFYA 4U63A 1Z0SA 4NH0A 3FYUB 1PAUA 1L4EA 3P71T 4EO4A 3NG1A 4E7OA 5BMVB 4EJSA 5CH3A 2NTNA 3MA0A 1GG5A 2FX5A 4NJEA 4RNDB 4DJAA 4EJSC 1LJ8A 4DXAA 4DAEA 1GT91 1V35A 1M34B 3GGJA 5DM4A 4ZDIA 2GM3A 1U3FA 1J49A 5CXSA 1EHYA 5KYXA 1U11A 2E1PA 1K5HA 3L0OA 1ZAKA 3LDHA 1ETHA 1KZYC 2YWHA 4FMCF 4HTFB 2NQ2C 3WGZA 2XGJA 1XMQB 3H0KA 3G9XA 1KI6A 2LTAA 4WLEA 4IDDA 1NNI1 4JLUA 1YR7A 4AZTA 4YT5A 3P7MA 3MAGA 4TYWA 2QA5A 4PG7A 1Y3FE 4QWWA 3LO8A 4XB1A 1E32A 1Q7EA 1JHPA 1YCFA 3DYIA 3N0VA 1R3DA 3PTLA 3R44A 4JEMA 4YJGA 4ZRNA 4B17A 2KBFA 3TXXA 3GLGE 3PWSA 3FVTA 2GQ0