1MNGA

Structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
203
structure length
198
Chain Sequence
PYPFKLPDLGYPYEALEPHIDAKTMEIHQKHHGAVTNLNAALEKYPYLHGVEVEVLLRHLAALPQDIQTAVRNNGGGHLNSLFWRLLTPGGAKEPVGELKKAIDEQFGGFQALKEKLTQAAMGRFGSGWAWLVKDPFGKLHVLSTPNQDNPVMEGFTPIVGIVWEAYYLKYQNRRADYLQAIWNVLNWDVAEEFFKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Structure-function in Escherichia coli iron superoxide dismutase: comparisons with the manganese enzyme from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase(superoxide acceptor)
total genus 73
structure length 198
sequence length 203
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1994-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1mngA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1mngA02
1IX9A 1IDSA 1VARA 3DC6A 1BS3A 4JZGA 1IXBA 1MMMA 2CDYA 1QNMA 3MDSA 4YIOA 1LUVA 1KKCA 1ZSPA 3AK3A 1AP6A 1GN2A 1D5NA 2ADQB 4JYYA 1VEWA 1XDCA 1AR4A 3LSUA 1SZXA 1JR9A 4BR6A 3C3TA 1P7GA 1N0NA 3TJTA 1MA1A 3CEIA 1ZTEA 3IC9A 4C7UA 1EN4A 3C3SA 1Y67A 4X9QA 4YIPA 4FFKA 2QKCA 1GN6A 2GDSA 3AK1A 1PM9A 1EN6A 1I08A 1XREA 1AR5A 2CE4A 1GN3A 1EN5A 3DC5A 1WB7A 1JA8A 4E4EA 4F6EA 1MSDA 1ZUQA 1GN4A 1N0JA 1ZLZA 3RN4A 2AW9A 3EVKA 1AVMA 5A9GA 1PL4A 3BFRA 2QKAA 1BSMA 1LUWA 1B06A 1EM1A 4JZ2A 2ADPA 3AK2A 1MNGA 1XILA 2RCVA 4GUNA 1I0HA 5AG2A 1AP5A 2P4KA 3QVNA 3OT7A 1XUQA 1WB8A 3K9SA 3KKYA 1BT8A
chains in the Genus database with same CATH superfamily
5KUMA 1NZ6A 4JZGA 4HBNA 2P90A 3UT5A 4QJFB 1S5HC 4LF9B 3MD0A 2XNDG 3BY6A 3JD1A 3FFQA 1IBLO 5IE9A 1LUVA 2HR3A 2AHYA 3ASNB 3N27A 3CB2A 3LUTB 1XMOO 1MOFA 2LP7A 2XOKG 3K3WA 4FMTA 4JYCA 5H6RA 4XBFA 4B7EA 4MVRA 4EFEA 3I5DA 4F4LA 3K5NA 2MK3A 4N23A 2B1IA 3AG3C 1U96A 4JI4O 1XMQB 2E3CA 2IJHA 2YSUB 4FPPA 2E76B 3TXSA 4YY3B 3G71V 1XNRO 3ZHUA 4MVSA 2JS5A 2GBOA 3SYQA 4DV1B 4TT3G 2ZDIA 3VQVA 5LHGA 3L73H 4DV7O 3PJSK 4UB8Z 5KLVH 4EFBA 3OFNG 4DUYO 4I55B 3FAVB 2X6CA 2UU9B 1NKDA 1V55B 5DECA 3ASOB 3HKBA 1MSWD 2EIJB 4O2BA 4LFBB 3OEEG 4DR3B 4Q6GA 4K3AA 3RW0A 1YSCA 2LW1A 2ZIMA 1EM1A 1FS0G 4BIUA 4UVAA 2YEVB 5LGTA 3RYHB 2L35A 4OX9O 3OE7G 5AG2A 4B3TO 4HYOA 3T2MA 2WWWA 1M90W 4O4HB 1K4DC 1V54B 5EIBD 2XUMA 3W7WA 4IIJB 1VARA 3SDLA 3ZHRA 1L8DA 2ODMA 3ASNC 3ICXA 4FLUA 1AI5A 4IYIA 4CS3A 5LOVA 5CMUA 1Z5WA 1W0KG 4RO2A 4TV9B 2QM4A 3HPLC 4IYHA 3LSUA 1I94O 3FYEB 1JFFA 4PV1B 2WAMA 3B09A 3ZIAG 2UXDO 4O4IA 1M5IA 5H5NA 2D2CB 3H1HH 2P67A 2Y48A 2DN9A 3OTFA 4YHHO 3CC2V 1HNWB 3ZX6A 1SQVH 3ZMSA 4KHPO 2R9IA 1GM8A 4RUEA 3A2FA 2F4VB 4DR7B 3B4SA 3CPWU 2Q8VA 4K0KO 1FYJA 3G80A 3E8BA 3BABA 3SPIA 3T1HO 1THZA 1V55C 3ASOC 3GVMA 2EIJC 2OCCB 4UXNA 2BTQB 2AXTZ 5H2FZ 1EN5A 3M8AA 2JGUA 2ZINA 3G6EV 1ZAUA 5BR8B 4WFEA 3TCUA 1VF6C 2PTMA 4I0XB 5C8YB 3E8GA 2KKWA 1N33O 1LUWA 3P32A 3GWOA 4X1YA 2XAQA 2NN4A 1O9HA 2XASA 2Q5ZA 3UM7A 1Y6XA 1R1BA 3JAKB 4U7OA 4UCVA 1V54C 1HDJA 2YXLA 5BXZA 4BIOA 3JCUZ 2AGAA 1AR1B 2KG7B 3OT7A 2ZXWB 2AHZA 4GX5A 2E75B 2CAZC 4WFFA 4J42A 2WA4A 4YXWG 4JI4B 1FAFA 1D5AA 2Q9LA 2E5LO 1IXBA 3SR2C 1HNXO 5H9CA 2ETNA 3E86A 1XNRB 3CWBH 1PKXA 4I7ZB 4OXSA 5FNVA 4MTOA 1XDCA 1AR4A 1F4MA 5EIBC 5GTIZ 3JCZA 2P6JA 1IURA 2MW2B 5IJ9B 3EHBB 4DUYB 1BE3H 4DK0A 4J80A 1Q81W 1S76D 3OW2U 4JI1O 1OV9A 4GYCB 3OR6C 1IZ3A 3RYCB 3CS5A 1K5SA 1AJQA 5TISZ 3B8MA 3CCQV 1BQ0A 3D36C 5LMUO 1NT2B 2OCCC 2XAJA 2LO1A 4UV8A 2OCHA 4OPHA 4DO2A 4OX9B 4GX0A 1TVKB 1XREA 4JF3A 3BRCA 5L3BA 5L3CA 2JGDA 4J7ZA 1YHQV 4YJ2A 4I50B 1JCHA 4G2KA 4TQDA 2AW9A 2ITDC 4UB6Z 1NI8A 2UXCB 4H33A 1S5JA 2Q0AA 2QKAA 4MSWC 2F93B 3APOA 3IFXA 1XHXA 1N34O 3ZHVA 5B1BB 1ZL8B 1ROPA 3RVZA 4CH3A 2ZXWC 4D7TA 2QM7A 3K9AA 4B3MB 1US6A 4GCZA 2EIMB 3KCYA 2VWKA 5IDJA 3HB3B 2ZQMA 3SJCC 3JD2A 3SPJA 4PA3A 2CH7B 5LMNO 1YJWV 2E74B 1O9GA 2ZCEA 2PGGA 3DC6A 3HKEA 4O2AA 5EC1C 5BY1A 4LF6O 2CDYA 2OWOA 4KHPB 1KKCA 4TUYB 3AK3A 1AP6A 4X1KA 3S3WA 3CCVV 2F43G 4BW9A 4GKJO 4K0KB 1HR0B 4LF4B 1K34A 3HKCB 2Z5UA 1YJNV 4JI5O 1LR1A 4JI2B 1NH2B 2R72A 1YVWA 4K8XA 5GONA 4ZI7A 2QA4V 2ZD9A 1J5EO 4DW1A 4FK5C 1Q6IA 3OAAG 2RQ6A 4JV5O 1N33B 4FFKA 3HR0A 3J7AU 4D6TH 3SGIA 3M7MX 5BMVA 2X6BA 4B3RO 4DR5O 3JD4A 5ITZA 2ZR3A 3K79A 3ML0A 4PDLA 2ZM6O 3CRRA 1H2LA 4X62B 4DRXA 1K3EA 4MVOA 5B1BC 3H01A 2QDOA 3ABKB 5LGNA 4JZ2A 2HP8A 2JDIG 2EIMC 2LFRA 1SA0B 1YCIA 3JASA 4E2LA 2Q67A 1N4CA 3CCJV 4QE7A 4U3FH 2ILMA 2N04A 1YF2A 4LWSA 3K9SA 5EK0A 1WLEA 4JGSA 3KKYA 4I4TB 4FLWA 2FB5A 5JVDA 4JI1B 2YXYA 4I5SA 2Y0PA 3JD0A 3OEHG 5L3DA 4LF5B 1GM9A 3N2KB 1QVGU 4PA6A 3RYFA 2HFEC 2PI4A 3E8HA 5LXTB 2XT9A 5CBFA 1OHHG 3L74H 1PP9H 1Y76B 2OIEA 4DV0B 1Y66A 2DMXA 2ZT9B 4MVQA 2GUZA 2QEXV 3ZRWA 2QTOA 3WFVA 3DGEA 3JYCA 1FD9A 4FVMA 1VF7A 3ZJZA 1SKVA 3A0HZ 1XNQO 5CB4B 3CMEV 3CX5F 3SJBC 4JAAA 2AZ0A 1QR8A 2JEXA 4JI0O 2F23A 4BW5A 4X9QA 4YIPA 4JI3O 3ABLB 2OYQA 3JALA 3ZN0A 2N74A 3AK1A 3CJHB 3T1YB 3SPCA 4DV2O 1FJGB 4BWAA 2KB1A 2ZNJA 1TA8A 2A0LA 2X0LA 4TOIA 3ABKC 5A2QN 2W6IG 1G6UA 3RN4A 1F7YA 1Y74B 4IGGA 4MTGA 1SESA 3BFRA 2UUCO 4F6RA 4QPKA 4PJ0Z 2R9AA 5JJJB 4EB6A 2V1DA 1GK9A 5LHIA 1RSOA 4OGQB 4CH6A 4MW3A 4FIPC 4GUNA 4X20B 2Z0AA 3AG4B 2VQFB 4H0LB 1NVPD 3LSSA 4GKJB 4B3SB 2YC0A 4AI8A 5EC2C 4LFAB 4R8CA 4UCTA 2WLLB 1RFYA 3ZBHA 1IX9A 1IDSA 3O65A 3K5OA 1TAEA 2NR5A 3K03A 4YJ3A 4G28B 4P9PA 4DUZB 4NVPA 4YIOA 3ETDA 4DR1B 1VQMV 5JWPA 1GN2A 5IWAO 1YEWA 2WLKA 5IJ0B 1XOUA 4JPRA 3CXHF 1NVPB 1JQ0A 1KECA 3OM3B 4DR5B 1IBKB 3HKDB 5EBMC 1H38A 4MVZA 4X1IA 5J2TA 1UPGA 1P49A 2Y4TA 2BSKA 4UFZA 3ABLC 2IH3C 3F7YC 5JQGA 5LP6B 2ZE7A 1XL6A 5KX5A 1VQ4V 4RQFA 4J11A 5CBGA 2GDSA 4NYKA 4B7KA 2B9ZA 5IYZB 4R50A 4CC5A 4DV3B 1FXVA 2Q7GA 1W59A 2Q0OC 1OCOB 1Z2GA 4X66B 3LSQA 3RWRD 1SERA 1AVMA 3FD9A 2JK5C 3ZMUA 1H2SB 1NR7A 4NTXA 3D3QA 2UXXA 2W0FC 3AG4C 5KHIA 1N8RW 4X88A 1EZJA 2QWNB 1FFXA 2LGWA 2PI5A 2IH1C 1F23A 4ZOLB 1OZ0A 1N32B 3CCEV 1S77D 4WBNB 4J10A 3OR7C 2HEPA 1NTZH 4WFBV 2PY5A 2GTSA 2YIBD 1S0VA 2OTLV 1L0NH 4DR2O 3W7XA 2QWRB 1Q8IA 5LYJB 3ZRXA 3LDEA 1K33A 5B66Z 3U0ZA 4Z1MG 2LQTA 4NXMB 2D3OW 2LJ2A 1GO3F 3AG1B 4MTXA 5KHGA 4JI0B 3LDCA 4LR3A 2ADQB 3SYOA 1NS1A 3CYOA 2YXHA 5LGUA 3FYIB 2EINB 5E79Z 4DV2B 1R3JC 4ABMA 1Q6HA 1Q86W 4B08A 4IHJB 3JATB 4BR6A 4LCUC 1N36B 4JTDB 3E89A 1I5YA 1E1RG 5LP6C 3CCUV 4LFCO 1ZX3A 4FFBB 5KMGB 2WLIA 2YICA 4ZHQA 5KHKA 4PDRA 1R6KA 1DTOA 2B5UA 1WP8A 3ZCCA 2XTAA 1OCZB 2YIAA 2WA3A 2PYJA 5FPRA 3JARA 2YDEA 3SYCA 5CA0B 3KDRA 1PV0A 2DWDC 4NTYA 2HVKC 1NTMH 2AZ2A 1M4UA 4GZRB 1OCOC 1DGSA 4O4LB 1JNBA 1AR5A 3ETQA 3L72H 5KAFZ 2DE0X 5JJNB 2R70A 4GKKO 2Z3YA 1QLEB 3OTOO 3OMNB 4X65B 3OD4A 1N0JA 1F51A 2K9PA 4PDVA 5CA1B 2QJ1A 3LDDA 4O4JA 3FX7A 5EYPB 5LA6A 2IW5A 3N2GA 5J2UB 3DXRA 1HNZB 3ZHSA 2FMLA 3EFFK 3K0DA 2BOBC 1VIBA 4D7SA 5IWAB 2FYUH 2RDCA 3BAAA 3SJAC 2VQEO 1P4RA 5IYDO 4MVUA 1B6QA 4DV5O 2RN9A 3E22B 3SPGA 5HFLA 3APQA 1AJNA 3AG1C 3IC7A 1VQNV 4G27B 1WJZA 1IBLB 4W4KA 1P84F 1QNMA 2VS0A 5BZBA 2EINC 3BPZA 1XMOB 1IXMA 1XL4A 4H44B 3VOUA 4OPAA 5EZYB 4PELA 4U3JB 2JJ1G 4UCSA 1DF4A 1NJIW 1WNSA 4BIZA 3CEIA 4GT1A 3JD3A 1D2DA 5EBLC 3SJQC 2QWPB 4KP4A 3JAWB 4AQYO 4DV4O 3Q4HB 1Q3EA 1JMKC 1OCZC 2P06A 3CCLV 3D3IA 4C7UA 3P3NA 4DV7B 5HFMA 4TSFG 2ZE8A 1FXKB 1Q90D 1B04A 2HG5C 1Q6UA 4DW0A 3IJ4A 3ZEDA 1EBOA 1QLEC 3J81N 4NXNO 2UXBO 5EBWC 1K9MW 4I55A 1QU7A 3FAVA 4PI2A 1GN3A 3NXSA 2P22C 3OMAB 1RP3B 4NKGB 1JA8A 4F6EA 4NTWA 3EVKA 4FZ1A 1VF6A 3ZMTA 1SC5B 5FL7G 3K04A 1BHBA 2YEVA 3RYHA 4L8JA 2OT5A 1MNGA 1F4NA 4DR6O 2QM8A 2H3OA 2G38A 4HNAB 4B3TB 4DXWA 2Q68A 4LNUB 1SS3A 1IVSA 4O4HA 3FB6C 3FKSG 4FM2A 4IIJA 2CUGA 1BMFG 1HWYA 4J9ZB 3UKMA 4X8AA 1BT8A 4Q20A 3STLC 3RYIB 3ABTA 3B40A 3CRQA 1WA8B 4QIWF 2UUBO 2O57A 3W7SA 1YIJV 1DF5A 4TV9A 5JCOC 3H1JH 3SPHA 5F2VO 2FTKA 1I94B 1B3QA 1NH2D 1VQLV 1G4YB 2UXDB 4JI8O 1TUBB 2WPDG 1SRYA 3QO5A 3K57A 2QTSA 3IC9A 4DYLA 4GKKB 2EBOA 4YHHB 3OTOB 4HZ3A 3T4ZA 5JH7B 1Q43A 4LH7A 1VQOV 1FXKC 4JYAO 3X2QB 5CN0A 1IBMO 5KHHA 4A5UB 3LNNA 2A06H 3TXQA 3T1HB 4FM1A 1GM7A 3D36A 1PM9A 4CS2A 1MZEA 2BTQA 3H1KH 4L87A 3OUFA 5DM6V 1ZWIC 2VQEB 3CRMA 1M56B 4DR4O 4FLVA 4I0XA 5C8YA 1SQBH 3BA8A 4LF7O 1PL4A 3GWKC 2GSMB 3S3XA 4X64O 1OCCB 2H8PC 3AK2A 4JTCB 4KXRA 5C93A 1VQ9V 3JAKA 3E35A 4TV8B 3WB2A 1FKAO 2YI8A 2IJKA 3ZN1A 5KA5A 2IJJA 1AP5A 2KG7A 2Q69A 3QVNA 1SETA 4I9WA 4EEQA 1H5WA 3H9VA 1AI7A 2A9HA 2NLJC 3QF7A 3I55V 2HHHO 3C90A 3RVYA 2PZSA 1YJ9V 2ZNIA 2EJ7A 1HP8A 3K58A 2E5LB 4H13B 2CK3G 4DV6O 1JPXA 3K06A 1HNXB 3AG2C 3UT5B 1M93A 2IU3A 3MDSA 4LF9O 1FFTB 2P7TC 1P7BA 3G4SV 4HAMA 1YDXA 3B2EE 4KFMA 5IYBO 1RPOA 2JRIA 1CXZB 2IM9A 1ENVA 3ZMZA 3QO8A 5IJ9A 1JR9A 1K97A 3F7VC 1QHTA 4JI6O 1P7GA 1MA1A 3RYCA 3X2QC 3WB1A 4R7CA 3K0GA 5E1AC 1EN4A 1Y67A 5LMUB 1Z5VA 4FJCC 3A0RA 4DV1O 1FPOA 3J80N 1TVKA 1L0LH 4LF8O 1M56C 4I50A 2DQ0A 1AILA 3QNEA 1KKDA 2Q7HA 4U7NA 1MG1A 2UU9O 1OCCC 2M6YA 3HKBB 3D8CA 4LFBO 4O2BB 2QE7G 1BQZA 2HKOA 1N34B 4WFAV 4DR3O 2A7WA 2NNUA 3K59A 2R9RB 1B06A 1DLBA 1ZL8A 2Q73A 1FXHA 5L3FA 1NR1A 1CPYA 3DSQA 1VQ6V 1KMIZ 3GB7C 2JS3A 3VQYA 4IT5A 3QTCA 1S72V 2IJIA 2QSAA 2CH7A 5LMNB 3G6BA 2KQXA 3ZMVA 1AI4A 4ASUG 3VBBA 3FB7C 4PDMA 4LF6B 4LC1A 1YZBA 3NR7A 1PNKA 3F5TA 4AILC 3UQ8A 5D5PA 4JYAB 4TUYA 1H2KA 4UCUA 5GTHZ 2H94A 3R66A 5LOVB 1K8AW 1YXBA 1VEWA 3RBZA 2QKSA 3HKCA 3ETGA 3ZHTA 3WG7B 1KP2A 5H6QA 2UUAO 1VQ8V 4JI5B 1JFFB 1JJOA 4JASA 4ZKIA 1N0NA 2XAFA 4O4IB 3TJTA 1Q5OA 4GLXA 3ZRVA 4XDJA 2VWJA 1J5EB 4DR4B 2ZE6A 4JAVA 4JV5B 4PA9A 3JAMN 2ZDIC 3RGBA 3C3SA 4UCOA 1HNWO 2BOCC 1TGOA 1M57B 5L3EA 1KC8W 2HJDA 1GKFA 4CH5A 3BA9A 4LBEC 1QBZA 2WLJA 4B3RB 2ZKOA 3E2EA 3ABUA 1JOYA 1CP9A 4CZZA 2CE4A 2ZM6B 3ZS8C 3VQXA 1MABG 4QPJA 1MSDA 1ZUQA 1ZLZA 2HHHB 5BR8O 5LL6Y 4DV6B 1SA0A 2RNBA 4X1YB 1XILA 4FZ0A 2DW4A 3PN1A 4NR1A 4PA7A 3U10A 3CC4V 3VQWA 1SQQH 2WLMA 4I4TA 4JI6B 1JVMA 1Q7YW 1W0JG 4FLTA 2RJZA 2N05A 2M7WA 1G1XB 3N2KA 4MVMA 4EKWA 4AHCA 3WG7C 5LXTA 2X7RB 1GRJA 1ZSPA 2XAGA 4MTFA 1Y76A 5KHJA 4JYYA 1PNLA 2JIZG 4J7KA 4JTAB 5FNVB 1M9NA 2ATKC 2PUSA 4LF8B 1J95A 4CC6A 4PD4F 2K1EA 1EZVH 1QLNA 1RPRA 1KU9A 2Y0IA 2HLDG 2L6LA 3B8NA 1XNQB 5CB4A 1M57C 2WLHA 3MAQA 2QGNA 5D5QA 4X89A 3A8TA 4JI3B 1WP7A 1AJPA 3QO7A 5DN6G 2QWOB 3CJHA 3WU2Z 1GN6A 1I08A 1S3JA 1WN7A 3TGUH 1RM1B 1VQPV 3CMAV 3MHHC 2EIKB 1VQ7V 2JGDB 5IT9N 4YJ2B 4E4EA 1Y74A 3L9DA 1KB9F 5B3SB 2UUCB 2CGOA 3BEHA 2UXCO 1TUEB 3W7TA 3U11A 5KUKA 4N21A 3TK1A 1GH6A 4X20A 2RCVA 1BGYH 1R73A 4B3MO 3F5WC 1SQPH 1K7DA 1SQGA 2UUAB 1XUQA 2WLLA 5K1PA 1PD3A 3CD6V 2IBZH 1Q82W 3HKEB 4O2AB 1VP7A 3CC7V 1GMGA 3K5MA 2EX3A 5IJ0A 2RMKB 4KL1A 4R6ZA 4X1KB 1A32A 3STZC 1YI2V 2BE3A 1URFA 2CTPA 1HR0O 4LF4O 2UXNA 3HKDA 4FLZA 4UUJC 3C3TA 4JI2O 2ZR2A 4IL6Z 4GX2A 4QE9A 1NQTA 2B1GA 4ICGA 5GONB 4ZI7B 5FLXN 5LP6A 1KUQA 3CRAA 4JAUA 1RM1C 1V9PA 2F66C 3G67A 2X6AA 4P30A 2EIKC 2ITCC 3RFRA 2OIGA 5IYZA 1EFRG 1K5QA 5BMVB 5B3SC 2DOSA 3A0BZ 5B5EZ 3AEIA 2JJ2G 1WB7A 3CRCA 4RQEA 1VMGA 5ITZB 1R6NA 2LGQA 1R3KC 1KP3A 1AB3A 4MS2A 4WFGA 4ZBMA 1R6TA 4X62O 1BSMA 4DRXB 3I56V 5JJEB 1KQSU 4CBCA 4QNHB 3L70H 1YTFD 1NBMG 3JASB 4Z1VA 4ZOLA 3WB0A 2WLNA 4WBNA 4K35A 1E79G 1U97A 1VF5B 1QR9A 3BVOA 3ZHQA 1QVFU 1NU1H 5L3GA 4DR2B 4LWSB 5LYJA 1LNQA 1XQ8A 5KAIZ 3BCCH 2YI9A 1UJWB 2FL4A 5JVDB 2EZOA 3OGCC 4FM0A 1K73W 3OGIB 1H2GA 4WFHA 4RAIA 4LF5O 3DTUB 3LNMB 1YTFB 1D5NA 3H1LH 3RYFB 1PNMA 3KCXA 1PPJH 5LBQA 1KYOF 4IHJA 4DV0O 3JATA 2LFSA 2YIBA 2IU0A 5B1AB 2GUZB 1SQFA 3ZRWB 4LFCB 1IJGA 4FFBA 5KMGA 1W2BU 5B1NA 4JI7O 2Q4PA 4W4LA 3E8FA 1KD1W 3OMIB 3AG2B 1BZKA 1CEZA 5CA0A 1JX9A 1X4TA 2F1MA 3JALB 5IYCO 1I5XA 1EN6A 4O4LA 2GHYA 4WCEV 1AROP 1BL8A 3T1YO 2C2AA 1R3IC 2EZPA 4J41A 3MHSC 1H8HG 1FJGO 4ZIBA 4QGPA 2DJVA 2YUAA 3FB5C 1VQ5V 2FKXA 5CA1A 4NB5A 3R65A 2GTAA 2EILB 5EYPA 1M1KW 1ORQC 2ARHA 1SZTA 5J2UA 2QR4A 4F6RB 2ADPA 2DYRB 3UCSC 3ZRSA 4LP8A 4EB6B 4MT8A 2Q6AA 1RSOB 4K8ZA 1I0HA 4JYBA 2VQFO 3CHXA 4B3SO 1X59A 2DWEC 4I9QA 4DV5B 3P30A 3E22A 4LFAO 2OTJV 1Y4MA 3ABMB 4UVBA 4H37A 3CCMV 5FPOA 4TQFA 1KBHA 1MMMA 2BTOA 4P2ZA 3UO3A 4YJ3B 4DUZO 2A3QA 1OJHA 1S5LZ 5B1AC 4DR1O 5JCOA 5EZYA 4U3JA 4XDKA 4RWUA 1PL0A 4TWKA 2PYLA 1WPBA 3B77A 4PI0A 3FB8C 3QG5A 3JAWA 1ZTEA 5B1OA 3SYPA 2Y4UA 3H1IH 3Q4HA 5IY5B 4DV4B 4AQYB 1IBKO 3P3PA 1SF9A 1H2NA 2ZIOA 1WAZA 5LHHA 1VQKV 4CH4A 4X1IB 5J2TB 2BSKB 4XDLA 5JQGB 2GV9A 1FXKA 1I7FA 2DYSB 1COWG 3L71H 1SQXH 2EJRA 2QKCA 3JSLA 4DK1A 1UFIA 1E1QG 5KX5B 4NXNB 2UXBB 2Q7EA 3TETA 1AI6A 2XAHA 2P5OA 3DC5A 1H2MA 3M99B 4DV3O 2EILC 1XMQO 5K1XA 2CGNA 2QWQB 1OCRB 4YY3O 3K5LA 2DYRC 2CTRA 4X66O 3UO2A 2LW7A 3E83A 4DR6B 4HNAA 1T5EA 2Y69B 1JJ2U 4Z2WA 2F95B 4RUFA 1FFXB 3K08A 4LNUA 2JVDA 2P4KA 4KUMA 1N32O 3L75H 4J9YB 2CTWA 4UV9A 3ABMC 3THOA 5J9PC 3RYIA 1DK1A 3O9OA 2YS8A 3JSNA 1WA8A 1BS3A 1QCEA 4MW8A 1H8EG 2UUBB 4JI7B 2V4DA 3KZIZ 2CTQA 1BCCH 4NXMO 2W0XA 2DQ3A 2W6JG 2KSDA 3CXCU 4JI8B 2HJFC 1TUBA 2BCCH 3CCSV 1SZXA 4P9OA 4J7JA 5IY5C 2HVJC 1HW7A 1NTKH 1GTOA 5DEDA 1N36O 5JH7A 1K92A 3EXAA 2DYSC 2WLIB 1IBMB 1XEQA 3AG3B 4PHZA 3OUSA 1YITV 4WF9V 2P4VA 4ZHQB 2WSSG 2JEUA 3JARB 1GAXA 3W7UA 4PA4A 1K4CC 1XHZA 3ETEA 4UVCA 1OCRC 4GX1A 1G8MA 4UCRA 1QQCA 3CP1A 1GN4A 4FLXA 3IAYA 2VRZA 1L1FA 5CBHA 4X65O 3RT3C 4LF7B 4CS4A 3T1CA 5A9GA 3CSXA 2EULA 1BHAA 2A79B 5GW7A 4X64B 1R3LC 2Y69C 2YIDA 2F4VO 4O4JB 4DR7O 5LA6B 4TV8A 3N2GB 2PF4E 3DXRB 2V7QG 3KG2A 3IGAC 1HNZO 5KA6A 4BAYA 3BHPA 1MZFA 1XI1A 5CA3A 2XHBA 1WPXA 3SYAA 4LH6A 3T4DA 3CCRV 4FLYA 2ZE5A 3AG7A 1WB8A 1FOUA 3CE2A 1XBLA
chains in the Genus database with same CATH topology
1IX9A 1IDSA 1VARA 3DC6A 1BS3A 4JZGA 1IXBA 1MMMA 2CDYA 1QNMA 3MDSA 4YIOA 1LUVA 1KKCA 1ZSPA 3AK3A 1AP6A 1GN2A 1D5NA 2ADQB 4JYYA 1VEWA 1XDCA 1AR4A 3LSUA 1SZXA 1JR9A 4BR6A 3C3TA 1P7GA 1N0NA 3TJTA 1MA1A 3CEIA 1ZTEA 3IC9A 4C7UA 1EN4A 3C3SA 1Y67A 4X9QA 4YIPA 4FFKA 2QKCA 1GN6A 3KDRA 2GDSA 3AK1A 1PM9A 1EN6A 1I08A 1XREA 1AR5A 2CE4A 1GN3A 1EN5A 3DC5A 1WB7A 1JA8A 4E4EA 4F6EA 1MSDA 1ZUQA 1GN4A 1N0JA 1ZLZA 3RN4A 2AW9A 3EVKA 1AVMA 5A9GA 1PL4A 3BFRA 2QKAA 1BSMA 1LUWA 1B06A 1EM1A 4JZ2A 2ADPA 3AK2A 1MNGA 1XILA 2RCVA 4GUNA 1I0HA 5AG2A 1AP5A 2P4KA 3QVNA 3OT7A 1XUQA 1WB8A 3K9SA 3KKYA 1BT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IX9 A;  1IDS A;  1VAR A;  3DC6 A;  1BS3 A;  4JZG A;  1IXB A;  1MMM A;  2CDY A;  1QNM A;  3MDS A;  4YIO A;  1LUV A;  1KKC A;  1ZSP A;  3AK3 A;  1AP6 A;  1GN2 A;  1D5N A;  2ADQ B;  4JYY A;  1VEW A;  1XDC A;  1AR4 A;  3LSU A;  1SZX A;  1JR9 A;  4BR6 A;  3C3T A;  1P7G A;  1N0N A;  3TJT A;  1MA1 A;  3CEI A;  1ZTE A;  3IC9 A;  4C7U A;  1EN4 A;  3C3S A;  1Y67 A;  4X9Q A;  4YIP A;  4FFK A;  2QKC A;  1GN6 A;  2GDS A;  3AK1 A;  1PM9 A;  1EN6 A;  1I08 A;  1XRE A;  1AR5 A;  2CE4 A;  1GN3 A;  1EN5 A;  3DC5 A;  1WB7 A;  1JA8 A;  4E4E A;  4F6E A;  1MSD A;  1ZUQ A;  1GN4 A;  1N0J A;  1ZLZ A;  3RN4 A;  2AW9 A;  3EVK A;  1AVM A;  5A9G A;  1PL4 A;  3BFR A;  2QKA A;  1BSM A;  1LUW A;  1B06 A;  1EM1 A;  4JZ2 A;  2ADP A;  3AK2 A;  1MNG A;  1XIL A;  2RCV A;  4GUN A;  1I0H A;  5AG2 A;  1AP5 A;  2P4K A;  3QVN A;  3OT7 A;  1XUQ A;  1WB8 A;  3K9S A;  3KKY A;  1BT8 A; 
#chains in the Genus database with same CATH topology
 5KUM A;  1NZ6 A;  4JZG A;  4HBN A;  2P90 A;  3UT5 A;  4QJF B;  1S5H C;  4LF9 B;  3MD0 A;  2XND G;  3BY6 A;  3JD1 A;  3FFQ A;  1IBL O;  5IE9 A;  1LUV A;  2HR3 A;  2AHY A;  3ASN B;  3N27 A;  3CB2 A;  3LUT B;  1XMO O;  1MOF A;  2LP7 A;  2XOK G;  3K3W A;  4FMT A;  4JYC A;  5H6R A;  4XBF A;  4B7E A;  4MVR A;  4EFE A;  3I5D A;  4F4L A;  3K5N A;  2MK3 A;  4N23 A;  2B1I A;  3AG3 C;  1U96 A;  4JI4 O;  1XMQ B;  2E3C A;  2IJH A;  2YSU B;  4FPP A;  2E76 B;  3TXS A;  4YY3 B;  3G71 V;  1XNR O;  3ZHU A;  4MVS A;  2JS5 A;  2GBO A;  3SYQ A;  4DV1 B;  4TT3 G;  2ZDI A;  3VQV A;  5LHG A;  3L73 H;  4DV7 O;  3PJS K;  4UB8 Z;  5KLV H;  4EFB A;  3OFN G;  4DUY O;  4I55 B;  3FAV B;  2X6C A;  2UU9 B;  1NKD A;  1V55 B;  5DEC A;  3ASO B;  3HKB A;  1MSW D;  2EIJ B;  4O2B A;  4LFB B;  3OEE G;  4DR3 B;  4Q6G A;  4K3A A;  3RW0 A;  1YSC A;  2LW1 A;  2ZIM A;  1EM1 A;  1FS0 G;  4BIU A;  4UVA A;  2YEV B;  5LGT A;  3RYH B;  2L35 A;  4OX9 O;  3OE7 G;  5AG2 A;  4B3T O;  4HYO A;  3T2M A;  2WWW A;  1M90 W;  4O4H B;  1K4D C;  1V54 B;  5EIB D;  2XUM A;  3W7W A;  4IIJ B;  1VAR A;  3SDL A;  3ZHR A;  1L8D A;  2ODM A;  3ASN C;  3ICX A;  4FLU A;  1AI5 A;  4IYI A;  4CS3 A;  5LOV A;  5CMU A;  1Z5W A;  1W0K G;  4RO2 A;  4TV9 B;  2QM4 A;  3HPL C;  4IYH A;  3LSU A;  1I94 O;  3FYE B;  1JFF A;  4PV1 B;  2WAM A;  3B09 A;  3ZIA G;  2UXD O;  4O4I A;  1M5I A;  5H5N A;  2D2C B;  3H1H H;  2P67 A;  2Y48 A;  2DN9 A;  3OTF A;  4YHH O;  3CC2 V;  1HNW B;  3ZX6 A;  1SQV H;  3ZMS A;  4KHP O;  2R9I A;  1GM8 A;  4RUE A;  3A2F A;  2F4V B;  4DR7 B;  3B4S A;  3CPW U;  2Q8V A;  4K0K O;  1FYJ A;  3G80 A;  3E8B A;  3BAB A;  3SPI A;  3T1H O;  1THZ A;  1V55 C;  3ASO C;  3GVM A;  2EIJ C;  2OCC B;  4UXN A;  2BTQ B;  2AXT Z;  5H2F Z;  1EN5 A;  3M8A A;  2JGU A;  2ZIN A;  3G6E V;  1ZAU A;  5BR8 B;  4WFE A;  3TCU A;  1VF6 C;  2PTM A;  4I0X B;  5C8Y B;  3E8G A;  2KKW A;  1N33 O;  1LUW A;  3P32 A;  3GWO A;  4X1Y A;  2XAQ A;  2NN4 A;  1O9H A;  2XAS A;  2Q5Z A;  3UM7 A;  1Y6X A;  1R1B A;  3JAK B;  4U7O A;  4UCV A;  1V54 C;  1HDJ A;  2YXL A;  5BXZ A;  4BIO A;  3JCU Z;  2AGA A;  1AR1 B;  2KG7 B;  3OT7 A;  2ZXW B;  2AHZ A;  4GX5 A;  2E75 B;  2CAZ C;  4WFF A;  4J42 A;  2WA4 A;  4YXW G;  4JI4 B;  1FAF A;  1D5A A;  2Q9L A;  2E5L O;  1IXB A;  3SR2 C;  1HNX O;  5H9C A;  2ETN A;  3E86 A;  1XNR B;  3CWB H;  1PKX A;  4I7Z B;  4OXS A;  5FNV A;  4MTO A;  1XDC A;  1AR4 A;  1F4M A;  5EIB C;  5GTI Z;  3JCZ A;  2P6J A;  1IUR A;  2MW2 B;  5IJ9 B;  3EHB B;  4DUY B;  1BE3 H;  4DK0 A;  4J80 A;  1Q81 W;  1S76 D;  3OW2 U;  4JI1 O;  1OV9 A;  4GYC B;  3OR6 C;  1IZ3 A;  3RYC B;  3CS5 A;  1K5S A;  1AJQ A;  5TIS Z;  3B8M A;  3CCQ V;  1BQ0 A;  3D36 C;  5LMU O;  1NT2 B;  2OCC C;  2XAJ A;  2LO1 A;  4UV8 A;  2OCH A;  4OPH A;  4DO2 A;  4OX9 B;  4GX0 A;  1TVK B;  1XRE A;  4JF3 A;  3BRC A;  5L3B A;  5L3C A;  2JGD A;  4J7Z A;  1YHQ V;  4YJ2 A;  4I50 B;  1JCH A;  4G2K A;  4TQD A;  2AW9 A;  2ITD C;  4UB6 Z;  1NI8 A;  2UXC B;  4H33 A;  1S5J A;  2Q0A A;  2QKA A;  4MSW C;  2F93 B;  3APO A;  3IFX A;  1XHX A;  1N34 O;  3ZHV A;  5B1B B;  1ZL8 B;  1ROP A;  3RVZ A;  4CH3 A;  2ZXW C;  4D7T A;  2QM7 A;  3K9A A;  4B3M B;  1US6 A;  4GCZ A;  2EIM B;  3KCY A;  2VWK A;  5IDJ A;  3HB3 B;  2ZQM A;  3SJC C;  3JD2 A;  3SPJ A;  4PA3 A;  2CH7 B;  5LMN O;  1YJW V;  2E74 B;  1O9G A;  2ZCE A;  2PGG A;  3DC6 A;  3HKE A;  4O2A A;  5EC1 C;  5BY1 A;  4LF6 O;  2CDY A;  2OWO A;  4KHP B;  1KKC A;  4TUY B;  3AK3 A;  1AP6 A;  4X1K A;  3S3W A;  3CCV V;  2F43 G;  4BW9 A;  4GKJ O;  4K0K B;  1HR0 B;  4LF4 B;  1K34 A;  3HKC B;  2Z5U A;  1YJN V;  4JI5 O;  1LR1 A;  4JI2 B;  1NH2 B;  2R72 A;  1YVW A;  4K8X A;  5GON A;  4ZI7 A;  2QA4 V;  2ZD9 A;  1J5E O;  4DW1 A;  4FK5 C;  1Q6I A;  3OAA G;  2RQ6 A;  4JV5 O;  1N33 B;  4FFK A;  3HR0 A;  3J7A U;  4D6T H;  3SGI A;  3M7M X;  5BMV A;  2X6B A;  4B3R O;  4DR5 O;  3JD4 A;  5ITZ A;  2ZR3 A;  3K79 A;  3ML0 A;  4PDL A;  2ZM6 O;  3CRR A;  1H2L A;  4X62 B;  4DRX A;  1K3E A;  4MVO A;  5B1B C;  3H01 A;  2QDO A;  3ABK B;  5LGN A;  4JZ2 A;  2HP8 A;  2JDI G;  2EIM C;  2LFR A;  1SA0 B;  1YCI A;  3JAS A;  4E2L A;  2Q67 A;  1N4C A;  3CCJ V;  4QE7 A;  4U3F H;  2ILM A;  2N04 A;  1YF2 A;  4LWS A;  3K9S A;  5EK0 A;  1WLE A;  4JGS A;  3KKY A;  4I4T B;  4FLW A;  2FB5 A;  5JVD A;  4JI1 B;  2YXY A;  4I5S A;  2Y0P A;  3JD0 A;  3OEH G;  5L3D A;  4LF5 B;  1GM9 A;  3N2K B;  1QVG U;  4PA6 A;  3RYF A;  2HFE C;  2PI4 A;  3E8H A;  5LXT B;  2XT9 A;  5CBF A;  1OHH G;  3L74 H;  1PP9 H;  1Y76 B;  2OIE A;  4DV0 B;  1Y66 A;  2DMX A;  2ZT9 B;  4MVQ A;  2GUZ A;  2QEX V;  3ZRW A;  2QTO A;  3WFV A;  3DGE A;  3JYC A;  1FD9 A;  4FVM A;  1VF7 A;  3ZJZ A;  1SKV A;  3A0H Z;  1XNQ O;  5CB4 B;  3CME V;  3CX5 F;  3SJB C;  4JAA A;  2AZ0 A;  1QR8 A;  2JEX A;  4JI0 O;  2F23 A;  4BW5 A;  4X9Q A;  4YIP A;  4JI3 O;  3ABL B;  2OYQ A;  3JAL A;  3ZN0 A;  2N74 A;  3AK1 A;  3CJH B;  3T1Y B;  3SPC A;  4DV2 O;  1FJG B;  4BWA A;  2KB1 A;  2ZNJ A;  1TA8 A;  2A0L A;  2X0L A;  4TOI A;  3ABK C;  5A2Q N;  2W6I G;  1G6U A;  3RN4 A;  1F7Y A;  1Y74 B;  4IGG A;  4MTG A;  1SES A;  3BFR A;  2UUC O;  4F6R A;  4QPK A;  4PJ0 Z;  2R9A A;  5JJJ B;  4EB6 A;  2V1D A;  1GK9 A;  5LHI A;  1RSO A;  4OGQ B;  4CH6 A;  4MW3 A;  4FIP C;  4GUN A;  4X20 B;  2Z0A A;  3AG4 B;  2VQF B;  4H0L B;  1NVP D;  3LSS A;  4GKJ B;  4B3S B;  2YC0 A;  4AI8 A;  5EC2 C;  4LFA B;  4R8C A;  4UCT A;  2WLL B;  1RFY A;  3ZBH A;  1IX9 A;  1IDS A;  3O65 A;  3K5O A;  1TAE A;  2NR5 A;  3K03 A;  4YJ3 A;  4G28 B;  4P9P A;  4DUZ B;  4NVP A;  4YIO A;  3ETD A;  4DR1 B;  1VQM V;  5JWP A;  1GN2 A;  5IWA O;  1YEW A;  2WLK A;  5IJ0 B;  1XOU A;  4JPR A;  3CXH F;  1NVP B;  1JQ0 A;  1KEC A;  3OM3 B;  4DR5 B;  1IBK B;  3HKD B;  5EBM C;  1H38 A;  4MVZ A;  4X1I A;  5J2T A;  1UPG A;  1P49 A;  2Y4T A;  2BSK A;  4UFZ A;  3ABL C;  2IH3 C;  3F7Y C;  5JQG A;  5LP6 B;  2ZE7 A;  1XL6 A;  5KX5 A;  1VQ4 V;  4RQF A;  4J11 A;  5CBG A;  2GDS A;  4NYK A;  4B7K A;  2B9Z A;  5IYZ B;  4R50 A;  4CC5 A;  4DV3 B;  1FXV A;  2Q7G A;  1W59 A;  2Q0O C;  1OCO B;  1Z2G A;  4X66 B;  3LSQ A;  3RWR D;  1SER A;  1AVM A;  3FD9 A;  2JK5 C;  3ZMU A;  1H2S B;  1NR7 A;  4NTX A;  3D3Q A;  2UXX A;  2W0F C;  3AG4 C;  5KHI A;  1N8R W;  4X88 A;  1EZJ A;  2QWN B;  1FFX A;  2LGW A;  2PI5 A;  2IH1 C;  1F23 A;  4ZOL B;  1OZ0 A;  1N32 B;  3CCE V;  1S77 D;  4WBN B;  4J10 A;  3OR7 C;  2HEP A;  1NTZ H;  4WFB V;  2PY5 A;  2GTS A;  2YIB D;  1S0V A;  2OTL V;  1L0N H;  4DR2 O;  3W7X A;  2QWR B;  1Q8I A;  5LYJ B;  3ZRX A;  3LDE A;  1K33 A;  5B66 Z;  3U0Z A;  4Z1M G;  2LQT A;  4NXM B;  2D3O W;  2LJ2 A;  1GO3 F;  3AG1 B;  4MTX A;  5KHG A;  4JI0 B;  3LDC A;  4LR3 A;  2ADQ B;  3SYO A;  1NS1 A;  3CYO A;  2YXH A;  5LGU A;  3FYI B;  2EIN B;  5E79 Z;  4DV2 B;  1R3J C;  4ABM A;  1Q6H A;  1Q86 W;  4B08 A;  4IHJ B;  3JAT B;  4BR6 A;  4LCU C;  1N36 B;  4JTD B;  3E89 A;  1I5Y A;  1E1R G;  5LP6 C;  3CCU V;  4LFC O;  1ZX3 A;  4FFB B;  5KMG B;  2WLI A;  2YIC A;  4ZHQ A;  5KHK A;  4PDR A;  1R6K A;  1DTO A;  2B5U A;  1WP8 A;  3ZCC A;  2XTA A;  1OCZ B;  2YIA A;  2WA3 A;  2PYJ A;  5FPR A;  3JAR A;  2YDE A;  3SYC A;  5CA0 B;  3KDR A;  1PV0 A;  2DWD C;  4NTY A;  2HVK C;  1NTM H;  2AZ2 A;  1M4U A;  4GZR B;  1OCO C;  1DGS A;  4O4L B;  1JNB A;  1AR5 A;  3ETQ A;  3L72 H;  5KAF Z;  2DE0 X;  5JJN B;  2R70 A;  4GKK O;  2Z3Y A;  1QLE B;  3OTO O;  3OMN B;  4X65 B;  3OD4 A;  1N0J A;  1F51 A;  2K9P A;  4PDV A;  5CA1 B;  2QJ1 A;  3LDD A;  4O4J A;  3FX7 A;  5EYP B;  5LA6 A;  2IW5 A;  3N2G A;  5J2U B;  3DXR A;  1HNZ B;  3ZHS A;  2FML A;  3EFF K;  3K0D A;  2BOB C;  1VIB A;  4D7S A;  5IWA B;  2FYU H;  2RDC A;  3BAA A;  3SJA C;  2VQE O;  1P4R A;  5IYD O;  4MVU A;  1B6Q A;  4DV5 O;  2RN9 A;  3E22 B;  3SPG A;  5HFL A;  3APQ A;  1AJN A;  3AG1 C;  3IC7 A;  1VQN V;  4G27 B;  1WJZ A;  1IBL B;  4W4K A;  1P84 F;  1QNM A;  2VS0 A;  5BZB A;  2EIN C;  3BPZ A;  1XMO B;  1IXM A;  1XL4 A;  4H44 B;  3VOU A;  4OPA A;  5EZY B;  4PEL A;  4U3J B;  2JJ1 G;  4UCS A;  1DF4 A;  1NJI W;  1WNS A;  4BIZ A;  3CEI A;  4GT1 A;  3JD3 A;  1D2D A;  5EBL C;  3SJQ C;  2QWP B;  4KP4 A;  3JAW B;  4AQY O;  4DV4 O;  3Q4H B;  1Q3E A;  1JMK C;  1OCZ C;  2P06 A;  3CCL V;  3D3I A;  4C7U A;  3P3N A;  4DV7 B;  5HFM A;  4TSF G;  2ZE8 A;  1FXK B;  1Q90 D;  1B04 A;  2HG5 C;  1Q6U A;  4DW0 A;  3IJ4 A;  3ZED A;  1EBO A;  1QLE C;  3J81 N;  4NXN O;  2UXB O;  5EBW C;  1K9M W;  4I55 A;  1QU7 A;  3FAV A;  4PI2 A;  1GN3 A;  3NXS A;  2P22 C;  3OMA B;  1RP3 B;  4NKG B;  1JA8 A;  4F6E A;  4NTW A;  3EVK A;  4FZ1 A;  1VF6 A;  3ZMT A;  1SC5 B;  5FL7 G;  3K04 A;  1BHB A;  2YEV A;  3RYH A;  4L8J A;  2OT5 A;  1MNG A;  1F4N A;  4DR6 O;  2QM8 A;  2H3O A;  2G38 A;  4HNA B;  4B3T B;  4DXW A;  2Q68 A;  4LNU B;  1SS3 A;  1IVS A;  4O4H A;  3FB6 C;  3FKS G;  4FM2 A;  4IIJ A;  2CUG A;  1BMF G;  1HWY A;  4J9Z B;  3UKM A;  4X8A A;  1BT8 A;  4Q20 A;  3STL C;  3RYI B;  3ABT A;  3B40 A;  3CRQ A;  1WA8 B;  4QIW F;  2UUB O;  2O57 A;  3W7S A;  1YIJ V;  1DF5 A;  4TV9 A;  5JCO C;  3H1J H;  3SPH A;  5F2V O;  2FTK A;  1I94 B;  1B3Q A;  1NH2 D;  1VQL V;  1G4Y B;  2UXD B;  4JI8 O;  1TUB B;  2WPD G;  1SRY A;  3QO5 A;  3K57 A;  2QTS A;  3IC9 A;  4DYL A;  4GKK B;  2EBO A;  4YHH B;  3OTO B;  4HZ3 A;  3T4Z A;  5JH7 B;  1Q43 A;  4LH7 A;  1VQO V;  1FXK C;  4JYA O;  3X2Q B;  5CN0 A;  1IBM O;  5KHH A;  4A5U B;  3LNN A;  2A06 H;  3TXQ A;  3T1H B;  4FM1 A;  1GM7 A;  3D36 A;  1PM9 A;  4CS2 A;  1MZE A;  2BTQ A;  3H1K H;  4L87 A;  3OUF A;  5DM6 V;  1ZWI C;  2VQE B;  3CRM A;  1M56 B;  4DR4 O;  4FLV A;  4I0X A;  5C8Y A;  1SQB H;  3BA8 A;  4LF7 O;  1PL4 A;  3GWK C;  2GSM B;  3S3X A;  4X64 O;  1OCC B;  2H8P C;  3AK2 A;  4JTC B;  4KXR A;  5C93 A;  1VQ9 V;  3JAK A;  3E35 A;  4TV8 B;  3WB2 A;  1FKA O;  2YI8 A;  2IJK A;  3ZN1 A;  5KA5 A;  2IJJ A;  1AP5 A;  2KG7 A;  2Q69 A;  3QVN A;  1SET A;  4I9W A;  4EEQ A;  1H5W A;  3H9V A;  1AI7 A;  2A9H A;  2NLJ C;  3QF7 A;  3I55 V;  2HHH O;  3C90 A;  3RVY A;  2PZS A;  1YJ9 V;  2ZNI A;  2EJ7 A;  1HP8 A;  3K58 A;  2E5L B;  4H13 B;  2CK3 G;  4DV6 O;  1JPX A;  3K06 A;  1HNX B;  3AG2 C;  3UT5 B;  1M93 A;  2IU3 A;  3MDS A;  4LF9 O;  1FFT B;  2P7T C;  1P7B A;  3G4S V;  4HAM A;  1YDX A;  3B2E E;  4KFM A;  5IYB O;  1RPO A;  2JRI A;  1CXZ B;  2IM9 A;  1ENV A;  3ZMZ A;  3QO8 A;  5IJ9 A;  1JR9 A;  1K97 A;  3F7V C;  1QHT A;  4JI6 O;  1P7G A;  1MA1 A;  3RYC A;  3X2Q C;  3WB1 A;  4R7C A;  3K0G A;  5E1A C;  1EN4 A;  1Y67 A;  5LMU B;  1Z5V A;  4FJC C;  3A0R A;  4DV1 O;  1FPO A;  3J80 N;  1TVK A;  1L0L H;  4LF8 O;  1M56 C;  4I50 A;  2DQ0 A;  1AIL A;  3QNE A;  1KKD A;  2Q7H A;  4U7N A;  1MG1 A;  2UU9 O;  1OCC C;  2M6Y A;  3HKB B;  3D8C A;  4LFB O;  4O2B B;  2QE7 G;  1BQZ A;  2HKO A;  1N34 B;  4WFA V;  4DR3 O;  2A7W A;  2NNU A;  3K59 A;  2R9R B;  1B06 A;  1DLB A;  1ZL8 A;  2Q73 A;  1FXH A;  5L3F A;  1NR1 A;  1CPY A;  3DSQ A;  1VQ6 V;  1KMI Z;  3GB7 C;  2JS3 A;  3VQY A;  4IT5 A;  3QTC A;  1S72 V;  2IJI A;  2QSA A;  2CH7 A;  5LMN B;  3G6B A;  2KQX A;  3ZMV A;  1AI4 A;  4ASU G;  3VBB A;  3FB7 C;  4PDM A;  4LF6 B;  4LC1 A;  1YZB A;  3NR7 A;  1PNK A;  3F5T A;  4AIL C;  3UQ8 A;  5D5P A;  4JYA B;  4TUY A;  1H2K A;  4UCU A;  5GTH Z;  2H94 A;  3R66 A;  5LOV B;  1K8A W;  1YXB A;  1VEW A;  3RBZ A;  2QKS A;  3HKC A;  3ETG A;  3ZHT A;  3WG7 B;  1KP2 A;  5H6Q A;  2UUA O;  1VQ8 V;  4JI5 B;  1JFF B;  1JJO A;  4JAS A;  4ZKI A;  1N0N A;  2XAF A;  4O4I B;  3TJT A;  1Q5O A;  4GLX A;  3ZRV A;  4XDJ A;  2VWJ A;  1J5E B;  4DR4 B;  2ZE6 A;  4JAV A;  4JV5 B;  4PA9 A;  3JAM N;  2ZDI C;  3RGB A;  3C3S A;  4UCO A;  1HNW O;  2BOC C;  1TGO A;  1M57 B;  5L3E A;  1KC8 W;  2HJD A;  1GKF A;  4CH5 A;  3BA9 A;  4LBE C;  1QBZ A;  2WLJ A;  4B3R B;  2ZKO A;  3E2E A;  3ABU A;  1JOY A;  1CP9 A;  4CZZ A;  2CE4 A;  2ZM6 B;  3ZS8 C;  3VQX A;  1MAB G;  4QPJ A;  1MSD A;  1ZUQ A;  1ZLZ A;  2HHH B;  5BR8 O;  5LL6 Y;  4DV6 B;  1SA0 A;  2RNB A;  4X1Y B;  1XIL A;  4FZ0 A;  2DW4 A;  3PN1 A;  4NR1 A;  4PA7 A;  3U10 A;  3CC4 V;  3VQW A;  1SQQ H;  2WLM A;  4I4T A;  4JI6 B;  1JVM A;  1Q7Y W;  1W0J G;  4FLT A;  2RJZ A;  2N05 A;  2M7W A;  1G1X B;  3N2K A;  4MVM A;  4EKW A;  4AHC A;  3WG7 C;  5LXT A;  2X7R B;  1GRJ A;  1ZSP A;  2XAG A;  4MTF A;  1Y76 A;  5KHJ A;  4JYY A;  1PNL A;  2JIZ G;  4J7K A;  4JTA B;  5FNV B;  1M9N A;  2ATK C;  2PUS A;  4LF8 B;  1J95 A;  4CC6 A;  4PD4 F;  2K1E A;  1EZV H;  1QLN A;  1RPR A;  1KU9 A;  2Y0I A;  2HLD G;  2L6L A;  3B8N A;  1XNQ B;  5CB4 A;  1M57 C;  2WLH A;  3MAQ A;  2QGN A;  5D5Q A;  4X89 A;  3A8T A;  4JI3 B;  1WP7 A;  1AJP A;  3QO7 A;  5DN6 G;  2QWO B;  3CJH A;  3WU2 Z;  1GN6 A;  1I08 A;  1S3J A;  1WN7 A;  3TGU H;  1RM1 B;  1VQP V;  3CMA V;  3MHH C;  2EIK B;  1VQ7 V;  2JGD B;  5IT9 N;  4YJ2 B;  4E4E A;  1Y74 A;  3L9D A;  1KB9 F;  5B3S B;  2UUC B;  2CGO A;  3BEH A;  2UXC O;  1TUE B;  3W7T A;  3U11 A;  5KUK A;  4N21 A;  3TK1 A;  1GH6 A;  4X20 A;  2RCV A;  1BGY H;  1R73 A;  4B3M O;  3F5W C;  1SQP H;  1K7D A;  1SQG A;  2UUA B;  1XUQ A;  2WLL A;  5K1P A;  1PD3 A;  3CD6 V;  2IBZ H;  1Q82 W;  3HKE B;  4O2A B;  1VP7 A;  3CC7 V;  1GMG A;  3K5M A;  2EX3 A;  5IJ0 A;  2RMK B;  4KL1 A;  4R6Z A;  4X1K B;  1A32 A;  3STZ C;  1YI2 V;  2BE3 A;  1URF A;  2CTP A;  1HR0 O;  4LF4 O;  2UXN A;  3HKD A;  4FLZ A;  4UUJ C;  3C3T A;  4JI2 O;  2ZR2 A;  4IL6 Z;  4GX2 A;  4QE9 A;  1NQT A;  2B1G A;  4ICG A;  5GON B;  4ZI7 B;  5FLX N;  5LP6 A;  1KUQ A;  3CRA A;  4JAU A;  1RM1 C;  1V9P A;  2F66 C;  3G67 A;  2X6A A;  4P30 A;  2EIK C;  2ITC C;  3RFR A;  2OIG A;  5IYZ A;  1EFR G;  1K5Q A;  5BMV B;  5B3S C;  2DOS A;  3A0B Z;  5B5E Z;  3AEI A;  2JJ2 G;  1WB7 A;  3CRC A;  4RQE A;  1VMG A;  5ITZ B;  1R6N A;  2LGQ A;  1R3K C;  1KP3 A;  1AB3 A;  4MS2 A;  4WFG A;  4ZBM A;  1R6T A;  4X62 O;  1BSM A;  4DRX B;  3I56 V;  5JJE B;  1KQS U;  4CBC A;  4QNH B;  3L70 H;  1YTF D;  1NBM G;  3JAS B;  4Z1V A;  4ZOL A;  3WB0 A;  2WLN A;  4WBN A;  4K35 A;  1E79 G;  1U97 A;  1VF5 B;  1QR9 A;  3BVO A;  3ZHQ A;  1QVF U;  1NU1 H;  5L3G A;  4DR2 B;  4LWS B;  5LYJ A;  1LNQ A;  1XQ8 A;  5KAI Z;  3BCC H;  2YI9 A;  1UJW B;  2FL4 A;  5JVD B;  2EZO A;  3OGC C;  4FM0 A;  1K73 W;  3OGI B;  1H2G A;  4WFH A;  4RAI A;  4LF5 O;  3DTU B;  3LNM B;  1YTF B;  1D5N A;  3H1L H;  3RYF B;  1PNM A;  3KCX A;  1PPJ H;  5LBQ A;  1KYO F;  4IHJ A;  4DV0 O;  3JAT A;  2LFS A;  2YIB A;  2IU0 A;  5B1A B;  2GUZ B;  1SQF A;  3ZRW B;  4LFC B;  1IJG A;  4FFB A;  5KMG A;  1W2B U;  5B1N A;  4JI7 O;  2Q4P A;  4W4L A;  3E8F A;  1KD1 W;  3OMI B;  3AG2 B;  1BZK A;  1CEZ A;  5CA0 A;  1JX9 A;  1X4T A;  2F1M A;  3JAL B;  5IYC O;  1I5X A;  1EN6 A;  4O4L A;  2GHY A;  4WCE V;  1ARO P;  1BL8 A;  3T1Y O;  2C2A A;  1R3I C;  2EZP A;  4J41 A;  3MHS C;  1H8H G;  1FJG O;  4ZIB A;  4QGP A;  2DJV A;  2YUA A;  3FB5 C;  1VQ5 V;  2FKX A;  5CA1 A;  4NB5 A;  3R65 A;  2GTA A;  2EIL B;  5EYP A;  1M1K W;  1ORQ C;  2ARH A;  1SZT A;  5J2U A;  2QR4 A;  4F6R B;  2ADP A;  2DYR B;  3UCS C;  3ZRS A;  4LP8 A;  4EB6 B;  4MT8 A;  2Q6A A;  1RSO B;  4K8Z A;  1I0H A;  4JYB A;  2VQF O;  3CHX A;  4B3S O;  1X59 A;  2DWE C;  4I9Q A;  4DV5 B;  3P30 A;  3E22 A;  4LFA O;  2OTJ V;  1Y4M A;  3ABM B;  4UVB A;  4H37 A;  3CCM V;  5FPO A;  4TQF A;  1KBH A;  1MMM A;  2BTO A;  4P2Z A;  3UO3 A;  4YJ3 B;  4DUZ O;  2A3Q A;  1OJH A;  1S5L Z;  5B1A C;  4DR1 O;  5JCO A;  5EZY A;  4U3J A;  4XDK A;  4RWU A;  1PL0 A;  4TWK A;  2PYL A;  1WPB A;  3B77 A;  4PI0 A;  3FB8 C;  3QG5 A;  3JAW A;  1ZTE A;  5B1O A;  3SYP A;  2Y4U A;  3H1I H;  3Q4H A;  5IY5 B;  4DV4 B;  4AQY B;  1IBK O;  3P3P A;  1SF9 A;  1H2N A;  2ZIO A;  1WAZ A;  5LHH A;  1VQK V;  4CH4 A;  4X1I B;  5J2T B;  2BSK B;  4XDL A;  5JQG B;  2GV9 A;  1FXK A;  1I7F A;  2DYS B;  1COW G;  3L71 H;  1SQX H;  2EJR A;  2QKC A;  3JSL A;  4DK1 A;  1UFI A;  1E1Q G;  5KX5 B;  4NXN B;  2UXB B;  2Q7E A;  3TET A;  1AI6 A;  2XAH A;  2P5O A;  3DC5 A;  1H2M A;  3M99 B;  4DV3 O;  2EIL C;  1XMQ O;  5K1X A;  2CGN A;  2QWQ B;  1OCR B;  4YY3 O;  3K5L A;  2DYR C;  2CTR A;  4X66 O;  3UO2 A;  2LW7 A;  3E83 A;  4DR6 B;  4HNA A;  1T5E A;  2Y69 B;  1JJ2 U;  4Z2W A;  2F95 B;  4RUF A;  1FFX B;  3K08 A;  4LNU A;  2JVD A;  2P4K A;  4KUM A;  1N32 O;  3L75 H;  4J9Y B;  2CTW A;  4UV9 A;  3ABM C;  3THO A;  5J9P C;  3RYI A;  1DK1 A;  3O9O A;  2YS8 A;  3JSN A;  1WA8 A;  1BS3 A;  1QCE A;  4MW8 A;  1H8E G;  2UUB B;  4JI7 B;  2V4D A;  3KZI Z;  2CTQ A;  1BCC H;  4NXM O;  2W0X A;  2DQ3 A;  2W6J G;  2KSD A;  3CXC U;  4JI8 B;  2HJF C;  1TUB A;  2BCC H;  3CCS V;  1SZX A;  4P9O A;  4J7J A;  5IY5 C;  2HVJ C;  1HW7 A;  1NTK H;  1GTO A;  5DED A;  1N36 O;  5JH7 A;  1K92 A;  3EXA A;  2DYS C;  2WLI B;  1IBM B;  1XEQ A;  3AG3 B;  4PHZ A;  3OUS A;  1YIT V;  4WF9 V;  2P4V A;  4ZHQ B;  2WSS G;  2JEU A;  3JAR B;  1GAX A;  3W7U A;  4PA4 A;  1K4C C;  1XHZ A;  3ETE A;  4UVC A;  1OCR C;  4GX1 A;  1G8M A;  4UCR A;  1QQC A;  3CP1 A;  1GN4 A;  4FLX A;  3IAY A;  2VRZ A;  1L1F A;  5CBH A;  4X65 O;  3RT3 C;  4LF7 B;  4CS4 A;  3T1C A;  5A9G A;  3CSX A;  2EUL A;  1BHA A;  2A79 B;  5GW7 A;  4X64 B;  1R3L C;  2Y69 C;  2YID A;  2F4V O;  4O4J B;  4DR7 O;  5LA6 B;  4TV8 A;  3N2G B;  2PF4 E;  3DXR B;  2V7Q G;  3KG2 A;  3IGA C;  1HNZ O;  5KA6 A;  4BAY A;  3BHP A;  1MZF A;  1XI1 A;  5CA3 A;  2XHB A;  1WPX A;  3SYA A;  4LH6 A;  3T4D A;  3CCR V;  4FLY A;  2ZE5 A;  3AG7 A;  1WB8 A;  1FOU A;  3CE2 A;  1XBL A; 
#chains in the Genus database with same CATH homology
 1IX9 A;  1IDS A;  1VAR A;  3DC6 A;  1BS3 A;  4JZG A;  1IXB A;  1MMM A;  2CDY A;  1QNM A;  3MDS A;  4YIO A;  1LUV A;  1KKC A;  1ZSP A;  3AK3 A;  1AP6 A;  1GN2 A;  1D5N A;  2ADQ B;  4JYY A;  1VEW A;  1XDC A;  1AR4 A;  3LSU A;  1SZX A;  1JR9 A;  4BR6 A;  3C3T A;  1P7G A;  1N0N A;  3TJT A;  1MA1 A;  3CEI A;  1ZTE A;  3IC9 A;  4C7U A;  1EN4 A;  3C3S A;  1Y67 A;  4X9Q A;  4YIP A;  4FFK A;  2QKC A;  1GN6 A;  3KDR A;  2GDS A;  3AK1 A;  1PM9 A;  1EN6 A;  1I08 A;  1XRE A;  1AR5 A;  2CE4 A;  1GN3 A;  1EN5 A;  3DC5 A;  1WB7 A;  1JA8 A;  4E4E A;  4F6E A;  1MSD A;  1ZUQ A;  1GN4 A;  1N0J A;  1ZLZ A;  3RN4 A;  2AW9 A;  3EVK A;  1AVM A;  5A9G A;  1PL4 A;  3BFR A;  2QKA A;  1BSM A;  1LUW A;  1B06 A;  1EM1 A;  4JZ2 A;  2ADP A;  3AK2 A;  1MNG A;  1XIL A;  2RCV A;  4GUN A;  1I0H A;  5AG2 A;  1AP5 A;  2P4K A;  3QVN A;  3OT7 A;  1XUQ A;  1WB8 A;  3K9S A;  3KKY A;  1BT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...