1MNGA

Structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
203
structure length
198
Chain Sequence
PYPFKLPDLGYPYEALEPHIDAKTMEIHQKHHGAVTNLNAALEKYPYLHGVEVEVLLRHLAALPQDIQTAVRNNGGGHLNSLFWRLLTPGGAKEPVGELKKAIDEQFGGFQALKEKLTQAAMGRFGSGWAWLVKDPFGKLHVLSTPNQDNPVMEGFTPIVGIVWEAYYLKYQNRRADYLQAIWNVLNWDVAEEFFKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function in Escherichia coli iron superoxide dismutase: comparisons with the manganese enzyme from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase(superoxide acceptor)
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
total genus 73
structure length 198
sequence length 203
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1994-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1mngA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1mngA02
1GN3A 1VARA 4JYYA 2AW9A 1BS3A 3AK1A 1ZLZA 3AK2A 1JA8A 4X9QA 4JZGA 1LUWA 1IDSA 1QNMA 1AVMA 1XUQA 1PL4A 3EVKA 3LSUA 2RCVA 1ZTEA 1KKCA 1Y67A 2ADQB 1GN6A 1XREA 1VEWA 1BT8A 1PM9A 1ZUQA 1ZSPA 1I0HA 3IC9A 1P7GA 3TJTA 1N0NA 5AG2A 3C3TA 3RN4A 3C3SA 1XILA 2CE4A 3DC6A 2ADPA 1AP5A 1AR5A 4JZ2A 1MA1A 1EM1A 3CEIA 2GDSA 1JR9A 1N0JA 3MDSA 1EN6A 4YIOA 1B06A 3AK3A 4BR6A 5A9GA 4F6EA 3BFRA 1MSDA 1AP6A 3DC5A 1SZXA 2QKAA 1MNGA 1WB7A 1GN4A 2P4KA 3OT7A 1EN4A 1IX9A 3K9SA 4C7UA 1LUVA 4E4EA 1XDCA 1AR4A 2QKCA 3QVNA 1GN2A 4YIPA 1MMMA 1D5NA 1BSMA 1IXBA 4FFKA 1I08A 3KKYA 1WB8A 2CDYA 4GUNA 1EN5A
chains in the Genus database with same CATH superfamily
2WLHA 4GT1A 4HYOA 1N32B 1OCCB 3MAQA 4I50A 1SC5B 4DRXB 1JA8A 4BIUA 2EIMB 4ABMA 2ZNJA 5J2UA 4IHJA 1LUWA 4EB6A 1M1KW 2P7TC 3WG7C 1N34O 3B40A 3LSUA 1L8DA 3HKCB 4RQFA 3E8FA 2Y4UA 3SPCA 4DR6O 2UUCO 1R3KC 4JASA 4X1YA 3W7SA 3FYIB 5LGNA 2VS0A 1NBMG 3B77A 4UCUA 1XHXA 4BIOA 5B5EZ 3AG7A 5IJ9A 4WFHA 5LXTA 1GM9A 4JTDB 1U96A 5LMNO 3AG3B 4J42A 3B8MA 4LWSA 5CA1A 1M90W 1PL0A 3M7MX 4DV3O 3LDDA 1I94O 5CA3A 4ZOLB 1VF5B 3DC6A 3WB2A 5D5QA 3OUSA 1ROPA 3OR7C 4B3SO 2UXBO 1YJNV 2E5LB 1HW7A 3ABKB 1PV0A 1I5XA 2R9RB 3LSSA 3P32A 3K5MA 2PTMA 3LDCA 2EBOA 2FKXA 3RT3C 4NYKA 1H8HG 2YEVB 3A0RA 1MNGA 4LFAO 1R6TA 5B3SB 3DGEA 1EN4A 1FJGO 2D3OW 1IBLB 1GTOA 5CMUA 4DV6O 4E4EA 3G6EV 3OUFA 2YIBD 1SQVH 1W0JG 1Y4MA 4JI3B 2BE3A 4PI0A 1VQOV 4UUJC 4PDMA 1V54C 1D5NA 2QWQB 1SQQH 2ITDC 4BIZA 5KHHA 4JAUA 4DV6B 3W7UA 4IHJB 4DV7O 1YDXA 4PDVA 5J2UB 1YF2A 3GWKC 4O4LB 1GAXA 2E75B 2WLKA 1QLEB 4HBNA 4AHCA 1S5LZ 5LL6Y 1BE3H 4PD4F 2DYRB 1S0VA 4JF3A 1BQ0A 3E2EA 4DR4O 1W0KG 3B8NA 3K06A 2XAJA 4DW1A 3AG2C 2P06A 2P4VA 3K04A 1KUQA 1BT8A 1PM9A 4FIPC 3FYEB 5KUKA 3T4DA 3FAVB 4A5UB 1VQPV 1ZSPA 2GSMB 3MHSC 4DUYB 2JEUA 1VQKV 3BCCH 5LMNB 1MG1A 5E79Z 1YEWA 1R73A 4DV0B 3CCUV 1AI5A 2EJ7A 3CRMA 3CC2V 2PY5A 2VRZA 4MVSA 1KKDA 3CXHF 4GX5A 5CA0A 4JPRA 3STLC 4MTGA 3TCUA 3ABLC 4JI5B 1JR9A 2WPDG 3OTOB 1N34B 4UXNA 4PA7A 1ZWIC 4TUYB 1BGYH 3JSLA 3FFQA 3T1YO 4QE9A 4CS2A 1Z5VA 1K4CC 4L8JA 1XOUA 3KCXA 3ZS8C 1JJ2U 2GHYA 4FJCC 2YC0A 2K9PA 2M7WA 3H01A 1CP9A 5JH7B 3SJBC 1N4CA 3SJCC 5KAFZ 1G1XB 3JCZA 2DQ0A 1F23A 1U97A 3HKDA 3ICXA 2ZE7A 1FXVA 2JEXA 4J9YB 1J5EO 3AEIA 1THZA 3U0ZA 3AG2B 4X65O 5CA0B 3TXSA 5JVDB 2DN9A 1KP2A 3BAAA 4P9OA 4X1YB 4JI5O 3OTFA 1KU9A 3A8TA 4RAIA 2UU9B 4I0XA 5TISZ 1NH2B 1DK1A 3UT5B 2F4VB 3ASOC 1D2DA 3SJAC 1N33O 1SS3A 1K97A 4ZI7B 1QHTA 4LF4B 4KHPB 4FLXA 2JVDA 4DV0O 5EIBD 1WPXA 3K59A 3H1IH 4LCUC 3JCUZ 5A2QN 5EYPB 2FMLA 1NR1A 3IC9A 3FB7C 3TJTA 1F7YA 5DEDA 3K0GA 5AG2A 2QTSA 5BMVB 2OTJV 4NVPA 3QNEA 1PKXA 3HB3B 3N2KB 4B3MB 2P90A 4LF5B 2JDIG 2QKSA 4YJ2B 3BHPA 1ZAUA 2ADPA 3ZHTA 3OMAB 1YTFD 4FM0A 4MVRA 4I55A 5EBLC 3LNNA 4JAVA 3CEIA 2Q68A 2UUBO 2YICA 4UV9A 4YIOA 3ZX6A 3AK3A 3CB2A 4ZIBA 1SQGA 2YXYA 4F6EA 3T1CA 1NS1A 4F6RB 4G27B 3E8BA 4ZBMA 1FYJA 4U3FH 4I0XB 5KHGA 4K3AA 5KX5A 4R8CA 1NKDA 1B04A 2VWJA 2IJIA 1S77D 5KLVH 2ODMA 4X1KB 3CCSV 4JI3O 4LF8B 3CJHA 1IBLO 1LR1A 4IIJB 1I08A 2R70A 4TV8B 2B9ZA 5FPOA 2O57A 3L70H 1VARA 4F4LA 5IDJA 1RP3B 4DV5B 2Z5UA 2RMKB 3KDRA 4FMTA 4X62O 1QR8A 4WFGA 2UXBB 1QNMA 1YXBA 1SKVA 1A32A 2W6IG 1TA8A 3BPZA 5ITZB 3UKMA 1RM1C 1BL8A 5H5NA 1G4YB 1P84F 4I9QA 4DV3B 4MVQA 3AG3C 2NNUA 1E79G 4PV1B 3MHHC 2DYSC 2N04A 3E35A 4QJFB 1XMQO 2EIJC 1ZL8B 4G28B 3T1HO 3C3TA 1FFXA 1M57C 1MZEA 4NR1A 5KHIA 3L74H 4P30A 4MVUA 1AJPA 3JASB 1Q6IA 3E22B 3RYFA 4B7EA 4NXMB 1FOUA 4J11A 3X2QB 3QO8A 2WSSG 4CZZA 5CB4A 4GLXA 3CXCU 1JNBA 3I55V 2VQFO 1UPGA 2Q67A 3W7XA 4MTFA 2XAQA 3OM3B 4IGGA 4TQDA 4IYIA 4PA6A 3CRQA 2Q69A 3S3WA 2QKAA 1YCIA 1SQFA 3E83A 2P4KA 3ZRXA 3F7YC 1IX9A 1VIBA 5GTHZ 2L35A 3K9SA 2CK3G 5B1OA 4X1IA 3CJHB 3QO5A 1ORQC 3RWRD 3CMEV 3QVNA 3K57A 3BEHA 5IYBO 1SRYA 5BXZA 4K0KO 4KHPO 3T1HB 1EBOA 2F1MA 5JVDA 1HNWO 1KB9F 5CN0A 2IJHA 4H13B 3CMAV 5CBFA 2Y0PA 2F4VO 3FX7A 5IJ9B 1HNZO 4RUFA 2LFSA 2F93B 2JGDB 2ZQMA 3HPLC 4JAAA 2N05A 4OX9B 1XMOB 1W59A 2P6JA 3HKEB 3CRCA 5B1NA 4X1IB 1M57B 4I5SA 2GUZB 2EIKC 1VMGA 4XDKA 4WBNB 1QVGU 2YIBA 2CH7B 2DQ3A 1SQXH 3ZMTA 4JI0O 1VEWA 1M56B 4MTXA 1D5AA 2BTOA 1I0HA 2PI4A 3PN1A 1HR0O 3R66A 4NXNO 3ZEDA 3MD0A 1WLEA 1XNQO 1RM1B 3M99B 2Z3YA 3IJ4A 3O65A 1XILA 4JYCA 4MVZA 2AZ2A 4JI1B 3CPWU 2ZE5A 1YSCA 4HAMA 3WFVA 5IY5B 3BABA 3CCEV 4RQEA 3ABMC 2G38A 2ZM6O 5L3BA 3ETQA 5IWAB 1QVFU 3BY6A 4J9ZB 3OT7A 1O9HA 1VQNV 4DUYO 1JFFB 4TWKA 3JAWB 1TUBB 2EINC 2YI8A 2ZCEA 5GW7A 4LF5O 4YJ3A 5H9CA 1AI7A 4OXSA 5JJJB 1WPBA 4YIPA 3JD2A 1WP7A 1FXKA 2H3OA 1K7DA 3ABLB 5LYJA 3LSQA 2CTWA 4GX1A 1SQBH 1H8EG 5FL7G 5B66Z 2XHBA 5KUMA 1EN5A 4DV2B 1V9PA 4ZOLA 3ZRWA 3IC7A 2Y48A 3CRRA 4DK0A 1OHHG 4JZGA 3JYCA 5EC2C 1PL4A 5HFLA 2EULA 2RCVA 1ZTEA 1XHZA 5LMUB 1Y67A 4AILC 1J95A 4X65B 3FB6C 2IJJA 1M93A 2XAFA 1XNQB 1V55C 3JD1A 1Q3EA 5FLXN 4K8XA 4WFBV 1JPXA 1H5WA 4J41A 2Q5ZA 3JALB 4U7OA 1L1FA 2WA3A 2WWWA 3JD3A 5F2VO 4Z1VA 3CSXA 2PYJA 2PYLA 4YHHB 3O9OA 2XOKG 3VQVA 4TV8A 1NU1H 3N2KA 2CGOA 1VF6C 3KG2A 3K08A 2QWRB 4R6ZA 4K8ZA 1IURA 1EM1A 1SZTA 4JTCB 2YXLA 1VQ9V 3GWOA 3HKBA 4JYAB 2XNDG 1M5IA 2CTQA 4GKJO 4IL6Z 3U10A 3I5DA 2GUZA 4LBEC 4FLVA 4GKKO 2DWDC 2HR3A 4LF9O 1X59A 3L71H 3RVZA 1Z2GA 3JARB 4LF7O 2V4DA 4D7TA 1YJWV 1YITV 2QKCA 4CH4A 1COWG 1RPRA 4R50A 3JAKA 1K92A 2QEXV 4FFKA 2B5UA 5LOVB 4X88A 4CC5A 3RYHA 1OCRC 2XASA 1GN3A 5BMVA 4QPKA 1NH2D 4X9QA 4B08A 3K5NA 1QU7A 4J7JA 4FM2A 1IDSA 3CC7V 3RYIB 1YJ9V 2WLLB 1IZ3A 5CB4B 1KKCA 2QSAA 3N2GB 5GONA 1XNRO 1N36B 1VQ5V 1SQPH 3SJQC 4H44B 3SR2C 4DR1B 1CEZA 3JAWA 3SPJA 3K0DA 2A9HA 1P7BA 1CXZB 2LFRA 1JQ0A 3OMIB 3K03A 4FLYA 4X66B 2X7RB 1L0NH 5JQGA 2X0LA 5FNVB 5LMUO 1FFXB 3C3SA 2XAGA 4NTXA 2EIJB 3OE7G 4TQFA 4OPAA 3HKDB 3H1KH 3JD0A 3BRCA 4MTOA 3VOUA 4UCVA 5BZBA 3CC4V 2ZKOA 1BZKA 4JI4O 5L3GA 2DW4A 1E1QG 4PELA 4O2AA 3F7VC 1VQ7V 1GK9A 1YI2V 4J7ZA 4DUZO 4FLZA 2EILB 1NTZH 3THOA 1PNMA 4DV5O 1R6NA 1AI6A 4XDLA 3E86A 4CBCA 2KG7B 2IH3C 2XT9A 2IU0A 3AG4B 2EINB 3T2MA 4MS2A 3SYCA 5JH7A 5KA5A 4ZHQB 4LFBB 5LGUA 1I94B 3JAKB 1DF5A 1MMMA 1GMGA 1Q5OA 2UXXA 3Q4HB 1GO3F 1B6QA 3L9DA 3H1JH 4Z1MG 1WB8A 1Y6XA 2ZNIA 2F43G 3CCRV 4P9PA 3ZMZA 4KFMA 3ZBHA 5BR8O 1WA8B 2Y0IA 1I5YA 2UUCB 4U7NA 4UCRA 2JS5A 1K9MW 5BR8B 5KHKA 4EEQA 1Y74B 1SERA 3TGUH 4DR3O 3E8GA 4TV9A 1GKFA 2WLLA 2ZDIC 3SYAA 3G80A 1XREA 5JJNB 2UUAO 4WF9V 4DV1O 4J80A 1K5SA 3TXQA 2CTRA 4AQYO 4NTWA 4O4JA 2OWOA 1N0NA 1NTMH 3SYPA 4W4KA 2BCCH 2ZR2A 3RYHB 2AHZA 4PA4A 2AGAA 2YUAA 4I7ZB 3BA9A 2EZPA 3ZHSA 3D36C 4JZ2A 1I7FA 5LP6B 3ZHQA 2ZR3A 3TETA 5H6QA 2OCHA 1DLBA 1S72V 3UO2A 2PGGA 2YIAA 3ML0A 5L3DA 1L0LH 2RJZA 2ETNA 1Y76B 1WA8A 1TVKA 4H37A 5EBMC 4EKWA 3IFXA 2P67A 4JI6O 4J7KA 4FM1A 4IYHA 3GVMA 1N8RW 4FFBA 3NR7A 4C7UA 2A0LA 1MZFA 1YZBA 4DR1O 3KCYA 2NR5A 2F95B 3A2FA 5KMGB 2DE0X 3APQA 5EK0A 1VQ4V 3SPHA 3CCVV 5DN6G 3C90A 2RN9A 2MW2B 2QA4V 4O4HA 1K73W 2IBZH 1SESA 3L72H 2QE7G 2VWKA 2DMXA 4D6TH 4CS3A 4JYYA 2VQFB 2OCCB 4DV4B 4FK5C 3CE2A 2N74A 3WB1A 3ABTA 1IBKO 3QG5A 2KSDA 1PD3A 3A0BZ 4DO2A 1FD9A 4DR3B 1OZ0A 5IYDO 5B1BB 4ZKIA 4DW0A 1AROP 4K35A 2QR4A 5LHHA 5IJ0A 1R1BA 1SF9A 1HNXO 3K5LA 5LGTA 4RO2A 3CCJV 1Y74A 2F66C 2JRIA 5LXTB 5KHJA 4X1KA 2FB5A 3P3PA 1S3JA 2ZE8A 4YY3O 1XL6A 3SYQA 4MVMA 5LBQA 3A0HZ 3OGIB 2Q0OC 1EFRG 4JYAO 4NB5A 3Q4HA 5JWPA 2GDSA 3ABKC 2DYSB 1K3EA 3FB5C 4WFEA 1XQ8A 2Q8VA 1NVPD 1YTFB 2WLNA 3OFNG 3L73H 1UJWB 1EZVH 3DC5A 5IYZB 3E8HA 5K1XA 1SZXA 3CCQV 4KUMA 1OJHA 2YSUB 1JJOA 4B3RB 2RNBA 3B4SA 2KB1A 2BSKA 2IH1C 4OPHA 3OEEG 4JTAB 1V54B 1BSMA 2R72A 2R9IA 5FPRA 3RYCB 3WG7B 1AJQA 2IM9A 4P2ZA 2RDCA 2L6LA 4QNHB 3J7AU 2UXCO 4DR2B 2JS3A 4B3RO 3RYIA 2IU3A 2AW9A 2W0FC 3K58A 3CS5A 1GRJA 4N23A 4DV2O 4O4HB 2ZDIA 1BHAA 2ZE6A 3G67A 4XDJA 2BOCC 2WLMA 1JCHA 1XEQA 2XAHA 3ETGA 2ZT9B 4B3SB 3CHXA 2CH7A 1NR7A 4H33A 2PI5A 2ATKC 2A7WA 4FPPA 2QM4A 3F5TA 2A06H 3JALA 2AZ0A 2JK5C 4IIJA 1NI8A 3FD9A 2LO1A 1PNLA 1IXMA 1OV9A 2YXHA 3S3XA 5LOVA 1N33B 2BSKB 1Y76A 5LP6A 2QM8A 1JOYA 1M56C 3CRAA 3QO7A 3OD4A 1SA0A 2LQTA 3H9VA 5E1AC 2HJDA 1H2LA 3D8CA 4X20B 2F23A 2B1IA 5L3FA 2EX3A 3JSNA 4UFZA 5B1BC 5IJ0B 1J5EB 3OMNB 2V7QG 4U3JB 1WP8A 4NXNB 4LFCB 4IT5A 2HJFC 3FAVA 3RFRA 2JJ2G 2LGWA 1IBMB 4O4JB 4QPJA 3OW2U 1ENVA 1XBLA 1AR4A 3P30A 1K8AW 1KYOF 2GV9A 2Q4PA 3ABMB 4B7KA 1YHQV 1AJNA 1RSOA 4LFCO 4LWSB 3KKYA 4KL1A 2CAZC 2X6CA 2ZIMA 4LR3A 2QWNB 4HNAA 1KC8W 2PF4E 1P49A 3E22A 2UXDB 4X64O 4FZ1A 3ZHVA 2OT5A 2H8PC 1NZ6A 3WU2Z 2EZOA 1EZJA 3N27A 4EB6B 2XUMA 1KECA 1Q86W 2JIZG 2RQ6A 4BW5A 4K0KB 5JCOC 1VF7A 1GN6A 2Q6AA 3EFFK 2QWPB 4PHZA 5IE9A 1Q6HA 3VQYA 1P4RA 1P7GA 1QCEA 1CPYA 1AILA 3JATB 3RN4A 1YIJV 1NQTA 4DV1B 1AI4A 2UUAB 4TOIA 1XL4A 2EILC 4OGQB 1FS0G 5EC1C 3T4ZA 1GM7A 4AI8A 2KQXA 5IT9N 4O2BB 4Q6GA 4JI7O 3UT5A 1B06A 1PNKA 1HWYA 1TUBA 3BFRA 4E2LA 1TVKB 4BWAA 3RW0A 5C8YA 2PZSA 4DV7B 2JGDA 2Q7EA 2B1GA 4JGSA 3ZRVA 1WB7A 2ZXWC 2EJRA 2D2CB 3ZRSA 1XMQB 3OEHG 4JI1O 2HFEC 1TAEA 2WLIB 1HDJA 4I9WA 1IVSA 3DSQA 4UB6Z 1IXBA 4LFBO 1KMIZ 3ASOB 4I4TA 4PA9A 1WAZA 2Q0AA 4YJ2A 4DR5O 2HVKC 3ZIAG 1RFYA 2WAMA 4X62B 2W6JG 3VQWA 1AB3A 2IW5A 1BMFG 1NJIW 2WLJA 3HKEA 3SYOA 1H2GA 5L3EA 3DXRB 2KKWA 2WLIA 5LHGA 5L3CA 1Q90D 2E74B 2X6BA 1XMOO 4JI4B 4CH3A 4FZ0A 2ARHA 4ZI7A 2LP7A 1HNZB 4RWUA 4LF8O 3NXSA 2HG5C 1IJGA 1VQLV 2Y69C 3LDEA 1ZL8A 2A3QA 1HNWB 3CCMV 3FKSG 2NN4A 2HVJC 3STZC 4EFEA 2ILMA 1US6A 3I56V 4KP4A 1XI1A 5FNVA 4NKGB 1R3JC 1JMKC 1XNRB 1BHBA 1QR9A 4JI7B 5C8YB 3ZN0A 5ITZA 1WN7A 1OCOC 3H1HH 2UUBB 3ZN1A 1IBKB 2GTAA 1N0JA 2E76B 5LHIA 4LH6A 3UM7A 1EN6A 5A9GA 1QLNA 3L75H 1VQMV 1N32O 2LW7A 3R65A 3SGIA 2EIKB 3ABUA 2A79B 2FTKA 2CGNA 5H2FZ 1K4DC 4YJ3B 4QGPA 1H2MA 1UFIA 2HLDG 4UB8Z 4O4IB 4X8AA 1H2NA 3D3QA 1VF6A 2OCCC 2EIMC 2Y4TA 1Q43A 5JQGB 2CDYA 2CUGA 1HP8A 4Q20A 1GM8A 4LF9B 3RVYA 1BS3A 3ZRWB 1ZLZA 1E1RG 3N2GA 5GONB 3TK1A 4WFFA 3F5WC 4W4LA 4LF6B 1OCRB 1XUQA 4GZRB 4UVCA 4ICGA 3K9AA 1R3LC 5DM6V 4I55B 5B1AB 5KA6A 1FKAO 2NLJC 1GH6A 2Q7HA 2HP8A 3JATA 2ZXWB 2V1DA 4MW8A 4YHHO 3SPIA 4PA3A 4DR5B 2AHYA 5LA6B 2OTLV 4UVAA 1VQ6V 2QTOA 2WA4A 1K34A 2HKOA 3KZIZ 4FLTA 3D36A 4JV5O 1AP5A 3JD4A 1AR5A 3OR6C 1NVPB 1FXKC 1MA1A 2Y69B 5IY5C 1NT2B 4G2KA 4BR6A 1SA0B 3ASNC 3ZHUA 1MSDA 3IGAC 3VQXA 4HNAB 4JI8O 3CYOA 5J2TB 2OIGA 4FVMA 3WB0A 5KX5B 3CWBH 1GN4A 4PI2A 3PJSK 4F6RA 4PDLA 1BQZA 2QWOB 5IYZA 1XDCA 4H0LB 3W7TA 3OGCC 1X4TA 2UXNA 3RBZA 2JJ1G 3EHBB 1OCCC 3VBBA 5B1AC 1TUEB 5D5PA 3GB7C 4MW3A 1AR1B 2FYUH 4GUNA 5KAIZ 2FL4A 4QIWF 3CP1A 1VP7A 3M8AA 1MSWD 4BW9A 4UCTA 4CS4A 3AK2A 4TT3G 4JI8B 4LF4O 1M9NA 4TV9B 2QJ1A 1JFFA 2YIDA 3QF7A 1AVMA 5J2TA 3EVKA 3E89A 5JCOA 1R3IC 2DWEC 2ZD9A 3U11A 1TGOA 3ZHRA 4DK1A 4FLUA 1KBHA 2UXDO 1R6KA 2XTAA 4LH7A 3ZMVA 2LJ2A 2C2AA 2W0XA 1V55B 2DYRC 1ZUQA 1Q8IA 1HR0B 1KQSU 4DRXA 3X2QC 2LGQA 4GCZA 2H94A 3ZMSA 3ZMUA 4J10A 1RPOA 4UCSA 1WNSA 4JI0B 5LA6A 3K79A 2OYQA 1OCOB 5H6RA 4LNUB 2E5LO 4DR7O 2ZIOA 2K1EA 5EIBC 1H2SB 3SPGA 5DECA 4O4LA 3T1YB 3LNMB 4GX0A 4OX9O 3SDLA 1B3QA 1WJZA 2X6AA 3D3IA 3ETDA 1BCCH 3OTOO 1MOFA 4YY3B 4XBFA 3RYCA 1T5EA 2OIEA 2PUSA 4UCOA 1S5JA 5EZYA 4LC1A 1Q82W 2E3CA 4R7CA 4Z2WA 4KXRA 4LF7B 1HNXB 2Q9LA 1DGSA 1M4UA 5EBWC 4GX2A 3AG1C 4GKKB 2Z0AA 4LNUA 4EFBA 4WCEV 4GKJB 4O2BA 4DV4O 3UCSC 4DR4B 3QTCA 4PJ0Z 1W2BU 5LYJB 4DR7B 1S76D 1Y66A 4MSWC 3K5OA 3UQ8A 1KD1W 4WBNA 2ZINA 1JX9A 2HHHO 3B2EE 4NXMO 1QBZA 1F4NA 1G8MA 3BVOA 4D7SA 2ADQB 2BOBC 4NTYA 1Q81W 1G6UA 3AG4C 4DR2O 2UXCB 4N21A 5GTIZ 1S5HC 3OAAG 4DYLA 5CA1B 4ASUG 2P22C 3RYFB 3P3NA 1ZX3A 1O9GA 3IAYA 2Q73A 2HEPA 2ITCC 3RGBA 1URFA 2CE4A 4QE7A 4JI2O 2QDOA 1FJGB 4CH5A 1NTKH 4LP8A 4LFAB 1FXHA 3MDSA 1F51A 1DF4A 3FB8C 5C93A 1AP6A 3UO3A 3DXRA 3DTUB 4I50B 1SETA 1JVMA 2QM7A 3ZJZA 1Q7YW 4U3JA 3HKBB 4DXWA 5CBGA 1H2KA 5HFMA 2KG7A 4AQYB 1LUVA 4X20A 2M6YA 5KMGA 1Q6UA 2JGUA 1GN2A 2LW1A 5EYPA 1YVWA 1LNQA 3B09A 2VQEO 4I4TB 3G71V 3K3WA 4FFBB 5EZYB 4CC6A 5K1PA 5IWAO 4MVOA 4PDRA 3JAMN 4GYCB 2ZM6B 3CX5F 4MT8A 1FPOA 3BA8A 2P5OA 1KP3A 3AK1A 4DR6B 5LP6C 3APOA 4UVBA 1QLEC 1FAFA 2Q7GA 4JV5B 1DTOA 4YXWG 2IJKA 1PPJH 3G4SV 4TSFG 5B3SC 3HKCA 2VQEB 3J80N 3ASNB 2MK3A 1OCZC 2DJVA 2BTQB 2YDEA 4B3MO 3H1LH 4CH6A 3CCLV 2GTSA 1FFTB 2YS8A 5BY1A 2AXTZ 1K5QA 4HZ3A 3EXAA 4B3TB 1FXKB 4TUYA 3AG1B 4DUZB 1MABG 2QGNA 5IYCO 4LF6O 3JASA 1Z5WA 2R9AA 4JI6B 3G6BA 5J9PC 4JI2B 2YI9A 4JYBA 4FLWA 2UU9O 1QQCA 4O2AB 4L87A 4UV8A 5CBHA 4X64B 3ETEA 1H38A 3HR0A 4O4IA 4X66O 3JARA 3ZCCA 2CTPA 2DOSA 3LUTB 5JJEB 3J81N 2GBOA 4WFAV 4X89A 4ZHQA 1N36O 4RUEA 4BAYA 4B3TO 2YEVA 3W7WA 1F4MA 1K33A 1RSOB 2BTQA 1IBMO 1PP9H 1VQ8V 2HHHB 3CD6V 1OCZB
chains in the Genus database with same CATH topology
1GN3A 1VARA 4JYYA 2AW9A 1BS3A 3AK1A 1ZLZA 3AK2A 1JA8A 4X9QA 3KDRA 4JZGA 1LUWA 1IDSA 1QNMA 1AVMA 1XUQA 1PL4A 3EVKA 3LSUA 2RCVA 1ZTEA 1KKCA 1Y67A 2ADQB 1GN6A 1XREA 1VEWA 1BT8A 1PM9A 1ZUQA 1ZSPA 1I0HA 3IC9A 1P7GA 3TJTA 1N0NA 5AG2A 3C3TA 3RN4A 3C3SA 1XILA 2CE4A 3DC6A 2ADPA 1AP5A 1AR5A 4JZ2A 1MA1A 1EM1A 3CEIA 2GDSA 1JR9A 1N0JA 3MDSA 1EN6A 4YIOA 1B06A 3AK3A 4BR6A 5A9GA 4F6EA 3BFRA 1MSDA 1AP6A 3DC5A 1SZXA 2QKAA 1MNGA 1WB7A 1GN4A 2P4KA 3OT7A 1EN4A 1IX9A 3K9SA 4C7UA 1LUVA 4E4EA 1XDCA 1AR4A 2QKCA 3QVNA 1GN2A 4YIPA 1MMMA 1D5NA 1BSMA 1IXBA 4FFKA 1I08A 3KKYA 1WB8A 2CDYA 4GUNA 1EN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GN3 A;  1VAR A;  4JYY A;  2AW9 A;  1BS3 A;  3AK1 A;  1ZLZ A;  3AK2 A;  1JA8 A;  4X9Q A;  4JZG A;  1LUW A;  1IDS A;  1QNM A;  1AVM A;  1XUQ A;  1PL4 A;  3EVK A;  3LSU A;  2RCV A;  1ZTE A;  1KKC A;  1Y67 A;  2ADQ B;  1GN6 A;  1XRE A;  1VEW A;  1BT8 A;  1PM9 A;  1ZUQ A;  1ZSP A;  1I0H A;  3IC9 A;  1P7G A;  3TJT A;  1N0N A;  5AG2 A;  3C3T A;  3RN4 A;  3C3S A;  1XIL A;  2CE4 A;  3DC6 A;  2ADP A;  1AP5 A;  1AR5 A;  4JZ2 A;  1MA1 A;  1EM1 A;  3CEI A;  2GDS A;  1JR9 A;  1N0J A;  3MDS A;  1EN6 A;  4YIO A;  1B06 A;  3AK3 A;  4BR6 A;  5A9G A;  4F6E A;  3BFR A;  1MSD A;  1AP6 A;  3DC5 A;  1SZX A;  2QKA A;  1MNG A;  1WB7 A;  1GN4 A;  2P4K A;  3OT7 A;  1EN4 A;  1IX9 A;  3K9S A;  4C7U A;  1LUV A;  4E4E A;  1XDC A;  1AR4 A;  2QKC A;  3QVN A;  1GN2 A;  4YIP A;  1MMM A;  1D5N A;  1BSM A;  1IXB A;  4FFK A;  1I08 A;  3KKY A;  1WB8 A;  2CDY A;  4GUN A;  1EN5 A; 
#chains in the Genus database with same CATH topology
 2WLH A;  4GT1 A;  4HYO A;  1N32 B;  1OCC B;  3MAQ A;  4I50 A;  1SC5 B;  4DRX B;  1JA8 A;  4BIU A;  2EIM B;  4ABM A;  2ZNJ A;  5J2U A;  4IHJ A;  1LUW A;  4EB6 A;  1M1K W;  2P7T C;  3WG7 C;  1N34 O;  3B40 A;  3LSU A;  1L8D A;  3HKC B;  4RQF A;  3E8F A;  2Y4U A;  3SPC A;  4DR6 O;  2UUC O;  1R3K C;  4JAS A;  4X1Y A;  3W7S A;  3FYI B;  5LGN A;  2VS0 A;  1NBM G;  3B77 A;  4UCU A;  1XHX A;  4BIO A;  5B5E Z;  3AG7 A;  5IJ9 A;  4WFH A;  5LXT A;  1GM9 A;  4JTD B;  1U96 A;  5LMN O;  3AG3 B;  4J42 A;  3B8M A;  4LWS A;  5CA1 A;  1M90 W;  1PL0 A;  3M7M X;  4DV3 O;  3LDD A;  1I94 O;  5CA3 A;  4ZOL B;  1VF5 B;  3DC6 A;  3WB2 A;  5D5Q A;  3OUS A;  1ROP A;  3OR7 C;  4B3S O;  2UXB O;  1YJN V;  2E5L B;  1HW7 A;  3ABK B;  1PV0 A;  1I5X A;  2R9R B;  3LSS A;  3P32 A;  3K5M A;  2PTM A;  3LDC A;  2EBO A;  2FKX A;  3RT3 C;  4NYK A;  1H8H G;  2YEV B;  3A0R A;  1MNG A;  4LFA O;  1R6T A;  5B3S B;  3DGE A;  1EN4 A;  1FJG O;  2D3O W;  1IBL B;  1GTO A;  5CMU A;  4DV6 O;  4E4E A;  3G6E V;  3OUF A;  2YIB D;  1SQV H;  1W0J G;  1Y4M A;  4JI3 B;  2BE3 A;  4PI0 A;  1VQO V;  4UUJ C;  4PDM A;  1V54 C;  1D5N A;  2QWQ B;  1SQQ H;  2ITD C;  4BIZ A;  5KHH A;  4JAU A;  4DV6 B;  3W7U A;  4IHJ B;  4DV7 O;  1YDX A;  4PDV A;  5J2U B;  1YF2 A;  3GWK C;  4O4L B;  1GAX A;  2E75 B;  2WLK A;  1QLE B;  4HBN A;  4AHC A;  1S5L Z;  5LL6 Y;  1BE3 H;  4PD4 F;  2DYR B;  1S0V A;  4JF3 A;  1BQ0 A;  3E2E A;  4DR4 O;  1W0K G;  3B8N A;  3K06 A;  2XAJ A;  4DW1 A;  3AG2 C;  2P06 A;  2P4V A;  3K04 A;  1KUQ A;  1BT8 A;  1PM9 A;  4FIP C;  3FYE B;  5KUK A;  3T4D A;  3FAV B;  4A5U B;  1VQP V;  1ZSP A;  2GSM B;  3MHS C;  4DUY B;  2JEU A;  1VQK V;  3BCC H;  5LMN B;  1MG1 A;  5E79 Z;  1YEW A;  1R73 A;  4DV0 B;  3CCU V;  1AI5 A;  2EJ7 A;  3CRM A;  3CC2 V;  2PY5 A;  2VRZ A;  4MVS A;  1KKD A;  3CXH F;  4GX5 A;  5CA0 A;  4JPR A;  3STL C;  4MTG A;  3TCU A;  3ABL C;  4JI5 B;  1JR9 A;  2WPD G;  3OTO B;  1N34 B;  4UXN A;  4PA7 A;  1ZWI C;  4TUY B;  1BGY H;  3JSL A;  3FFQ A;  3T1Y O;  4QE9 A;  4CS2 A;  1Z5V A;  1K4C C;  4L8J A;  1XOU A;  3KCX A;  3ZS8 C;  1JJ2 U;  2GHY A;  4FJC C;  2YC0 A;  2K9P A;  2M7W A;  3H01 A;  1CP9 A;  5JH7 B;  3SJB C;  1N4C A;  3SJC C;  5KAF Z;  1G1X B;  3JCZ A;  2DQ0 A;  1F23 A;  1U97 A;  3HKD A;  3ICX A;  2ZE7 A;  1FXV A;  2JEX A;  4J9Y B;  1J5E O;  3AEI A;  1THZ A;  3U0Z A;  3AG2 B;  4X65 O;  5CA0 B;  3TXS A;  5JVD B;  2DN9 A;  1KP2 A;  3BAA A;  4P9O A;  4X1Y B;  4JI5 O;  3OTF A;  1KU9 A;  3A8T A;  4RAI A;  2UU9 B;  4I0X A;  5TIS Z;  1NH2 B;  1DK1 A;  3UT5 B;  2F4V B;  3ASO C;  1D2D A;  3SJA C;  1N33 O;  1SS3 A;  1K97 A;  4ZI7 B;  1QHT A;  4LF4 B;  4KHP B;  4FLX A;  2JVD A;  4DV0 O;  5EIB D;  1WPX A;  3K59 A;  3H1I H;  4LCU C;  3JCU Z;  5A2Q N;  5EYP B;  2FML A;  1NR1 A;  3IC9 A;  3FB7 C;  3TJT A;  1F7Y A;  5DED A;  3K0G A;  5AG2 A;  2QTS A;  5BMV B;  2OTJ V;  4NVP A;  3QNE A;  1PKX A;  3HB3 B;  3N2K B;  4B3M B;  2P90 A;  4LF5 B;  2JDI G;  2QKS A;  4YJ2 B;  3BHP A;  1ZAU A;  2ADP A;  3ZHT A;  3OMA B;  1YTF D;  4FM0 A;  4MVR A;  4I55 A;  5EBL C;  3LNN A;  4JAV A;  3CEI A;  2Q68 A;  2UUB O;  2YIC A;  4UV9 A;  4YIO A;  3ZX6 A;  3AK3 A;  3CB2 A;  4ZIB A;  1SQG A;  2YXY A;  4F6E A;  3T1C A;  1NS1 A;  4F6R B;  4G27 B;  3E8B A;  4ZBM A;  1FYJ A;  4U3F H;  4I0X B;  5KHG A;  4K3A A;  5KX5 A;  4R8C A;  1NKD A;  1B04 A;  2VWJ A;  2IJI A;  1S77 D;  5KLV H;  2ODM A;  4X1K B;  3CCS V;  4JI3 O;  4LF8 B;  3CJH A;  1IBL O;  1LR1 A;  4IIJ B;  1I08 A;  2R70 A;  4TV8 B;  2B9Z A;  5FPO A;  2O57 A;  3L70 H;  1VAR A;  4F4L A;  5IDJ A;  1RP3 B;  4DV5 B;  2Z5U A;  2RMK B;  3KDR A;  4FMT A;  4X62 O;  1QR8 A;  4WFG A;  2UXB B;  1QNM A;  1YXB A;  1SKV A;  1A32 A;  2W6I G;  1TA8 A;  3BPZ A;  5ITZ B;  3UKM A;  1RM1 C;  1BL8 A;  5H5N A;  1G4Y B;  1P84 F;  4I9Q A;  4DV3 B;  4MVQ A;  3AG3 C;  2NNU A;  1E79 G;  4PV1 B;  3MHH C;  2DYS C;  2N04 A;  3E35 A;  4QJF B;  1XMQ O;  2EIJ C;  1ZL8 B;  4G28 B;  3T1H O;  3C3T A;  1FFX A;  1M57 C;  1MZE A;  4NR1 A;  5KHI A;  3L74 H;  4P30 A;  4MVU A;  1AJP A;  3JAS B;  1Q6I A;  3E22 B;  3RYF A;  4B7E A;  4NXM B;  1FOU A;  4J11 A;  3X2Q B;  3QO8 A;  2WSS G;  4CZZ A;  5CB4 A;  4GLX A;  3CXC U;  1JNB A;  3I55 V;  2VQF O;  1UPG A;  2Q67 A;  3W7X A;  4MTF A;  2XAQ A;  3OM3 B;  4IGG A;  4TQD A;  4IYI A;  4PA6 A;  3CRQ A;  2Q69 A;  3S3W A;  2QKA A;  1YCI A;  1SQF A;  3E83 A;  2P4K A;  3ZRX A;  3F7Y C;  1IX9 A;  1VIB A;  5GTH Z;  2L35 A;  3K9S A;  2CK3 G;  5B1O A;  4X1I A;  3CJH B;  3QO5 A;  1ORQ C;  3RWR D;  3CME V;  3QVN A;  3K57 A;  3BEH A;  5IYB O;  1SRY A;  5BXZ A;  4K0K O;  4KHP O;  3T1H B;  1EBO A;  2F1M A;  5JVD A;  1HNW O;  1KB9 F;  5CN0 A;  2IJH A;  4H13 B;  3CMA V;  5CBF A;  2Y0P A;  2F4V O;  3FX7 A;  5IJ9 B;  1HNZ O;  4RUF A;  2LFS A;  2F93 B;  2JGD B;  2ZQM A;  3HPL C;  4JAA A;  2N05 A;  4OX9 B;  1XMO B;  1W59 A;  2P6J A;  3HKE B;  3CRC A;  5B1N A;  4X1I B;  1M57 B;  4I5S A;  2GUZ B;  2EIK C;  1VMG A;  4XDK A;  4WBN B;  1QVG U;  2YIB A;  2CH7 B;  2DQ3 A;  1SQX H;  3ZMT A;  4JI0 O;  1VEW A;  1M56 B;  4MTX A;  1D5A A;  2BTO A;  1I0H A;  2PI4 A;  3PN1 A;  1HR0 O;  3R66 A;  4NXN O;  3ZED A;  3MD0 A;  1WLE A;  1XNQ O;  1RM1 B;  3M99 B;  2Z3Y A;  3IJ4 A;  3O65 A;  1XIL A;  4JYC A;  4MVZ A;  2AZ2 A;  4JI1 B;  3CPW U;  2ZE5 A;  1YSC A;  4HAM A;  3WFV A;  5IY5 B;  3BAB A;  3CCE V;  4RQE A;  3ABM C;  2G38 A;  2ZM6 O;  5L3B A;  3ETQ A;  5IWA B;  1QVF U;  3BY6 A;  4J9Z B;  3OT7 A;  1O9H A;  1VQN V;  4DUY O;  1JFF B;  4TWK A;  3JAW B;  1TUB B;  2EIN C;  2YI8 A;  2ZCE A;  5GW7 A;  4LF5 O;  4YJ3 A;  5H9C A;  1AI7 A;  4OXS A;  5JJJ B;  1WPB A;  4YIP A;  3JD2 A;  1WP7 A;  1FXK A;  2H3O A;  1K7D A;  3ABL B;  5LYJ A;  3LSQ A;  2CTW A;  4GX1 A;  1SQB H;  1H8E G;  5FL7 G;  5B66 Z;  2XHB A;  5KUM A;  1EN5 A;  4DV2 B;  1V9P A;  4ZOL A;  3ZRW A;  3IC7 A;  2Y48 A;  3CRR A;  4DK0 A;  1OHH G;  4JZG A;  3JYC A;  5EC2 C;  1PL4 A;  5HFL A;  2EUL A;  2RCV A;  1ZTE A;  1XHZ A;  5LMU B;  1Y67 A;  4AIL C;  1J95 A;  4X65 B;  3FB6 C;  2IJJ A;  1M93 A;  2XAF A;  1XNQ B;  1V55 C;  3JD1 A;  1Q3E A;  5FLX N;  4K8X A;  4WFB V;  1JPX A;  1H5W A;  4J41 A;  2Q5Z A;  3JAL B;  4U7O A;  1L1F A;  2WA3 A;  2WWW A;  3JD3 A;  5F2V O;  4Z1V A;  3CSX A;  2PYJ A;  2PYL A;  4YHH B;  3O9O A;  2XOK G;  3VQV A;  4TV8 A;  1NU1 H;  3N2K A;  2CGO A;  1VF6 C;  3KG2 A;  3K08 A;  2QWR B;  4R6Z A;  4K8Z A;  1IUR A;  1EM1 A;  1SZT A;  4JTC B;  2YXL A;  1VQ9 V;  3GWO A;  3HKB A;  4JYA B;  2XND G;  1M5I A;  2CTQ A;  4GKJ O;  4IL6 Z;  3U10 A;  3I5D A;  2GUZ A;  4LBE C;  4FLV A;  4GKK O;  2DWD C;  2HR3 A;  4LF9 O;  1X59 A;  3L71 H;  3RVZ A;  1Z2G A;  3JAR B;  4LF7 O;  2V4D A;  4D7T A;  1YJW V;  1YIT V;  2QKC A;  4CH4 A;  1COW G;  1RPR A;  4R50 A;  3JAK A;  1K92 A;  2QEX V;  4FFK A;  2B5U A;  5LOV B;  4X88 A;  4CC5 A;  3RYH A;  1OCR C;  2XAS A;  1GN3 A;  5BMV A;  4QPK A;  1NH2 D;  4X9Q A;  4B08 A;  3K5N A;  1QU7 A;  4J7J A;  4FM2 A;  1IDS A;  3CC7 V;  3RYI B;  1YJ9 V;  2WLL B;  1IZ3 A;  5CB4 B;  1KKC A;  2QSA A;  3N2G B;  5GON A;  1XNR O;  1N36 B;  1VQ5 V;  1SQP H;  3SJQ C;  4H44 B;  3SR2 C;  4DR1 B;  1CEZ A;  3JAW A;  3SPJ A;  3K0D A;  2A9H A;  1P7B A;  1CXZ B;  2LFR A;  1JQ0 A;  3OMI B;  3K03 A;  4FLY A;  4X66 B;  2X7R B;  1L0N H;  5JQG A;  2X0L A;  5FNV B;  5LMU O;  1FFX B;  3C3S A;  2XAG A;  4NTX A;  2EIJ B;  3OE7 G;  4TQF A;  4OPA A;  3HKD B;  3H1K H;  3JD0 A;  3BRC A;  4MTO A;  3VOU A;  4UCV A;  5BZB A;  3CC4 V;  2ZKO A;  1BZK A;  4JI4 O;  5L3G A;  2DW4 A;  1E1Q G;  4PEL A;  4O2A A;  3F7V C;  1VQ7 V;  1GK9 A;  1YI2 V;  4J7Z A;  4DUZ O;  4FLZ A;  2EIL B;  1NTZ H;  3THO A;  1PNM A;  4DV5 O;  1R6N A;  1AI6 A;  4XDL A;  3E86 A;  4CBC A;  2KG7 B;  2IH3 C;  2XT9 A;  2IU0 A;  3AG4 B;  2EIN B;  3T2M A;  4MS2 A;  3SYC A;  5JH7 A;  5KA5 A;  4ZHQ B;  4LFB B;  5LGU A;  1I94 B;  3JAK B;  1DF5 A;  1MMM A;  1GMG A;  1Q5O A;  2UXX A;  3Q4H B;  1GO3 F;  1B6Q A;  3L9D A;  3H1J H;  4Z1M G;  1WB8 A;  1Y6X A;  2ZNI A;  2F43 G;  3CCR V;  4P9P A;  3ZMZ A;  4KFM A;  3ZBH A;  5BR8 O;  1WA8 B;  2Y0I A;  1I5Y A;  2UUC B;  4U7N A;  4UCR A;  2JS5 A;  1K9M W;  5BR8 B;  5KHK A;  4EEQ A;  1Y74 B;  1SER A;  3TGU H;  4DR3 O;  3E8G A;  4TV9 A;  1GKF A;  2WLL A;  2ZDI C;  3SYA A;  3G80 A;  1XRE A;  5JJN B;  2UUA O;  4WF9 V;  4DV1 O;  4J80 A;  1K5S A;  3TXQ A;  2CTR A;  4AQY O;  4NTW A;  4O4J A;  2OWO A;  1N0N A;  1NTM H;  3SYP A;  4W4K A;  2BCC H;  2ZR2 A;  3RYH B;  2AHZ A;  4PA4 A;  2AGA A;  2YUA A;  4I7Z B;  3BA9 A;  2EZP A;  3ZHS A;  3D36 C;  4JZ2 A;  1I7F A;  5LP6 B;  3ZHQ A;  2ZR3 A;  3TET A;  5H6Q A;  2OCH A;  1DLB A;  1S72 V;  3UO2 A;  2PGG A;  2YIA A;  3ML0 A;  5L3D A;  1L0L H;  2RJZ A;  2ETN A;  1Y76 B;  1WA8 A;  1TVK A;  4H37 A;  5EBM C;  4EKW A;  3IFX A;  2P67 A;  4JI6 O;  4J7K A;  4FM1 A;  4IYH A;  3GVM A;  1N8R W;  4FFB A;  3NR7 A;  4C7U A;  2A0L A;  1MZF A;  1YZB A;  4DR1 O;  3KCY A;  2NR5 A;  2F95 B;  3A2F A;  5KMG B;  2DE0 X;  3APQ A;  5EK0 A;  1VQ4 V;  3SPH A;  3CCV V;  5DN6 G;  3C90 A;  2RN9 A;  2MW2 B;  2QA4 V;  4O4H A;  1K73 W;  2IBZ H;  1SES A;  3L72 H;  2QE7 G;  2VWK A;  2DMX A;  4D6T H;  4CS3 A;  4JYY A;  2VQF B;  2OCC B;  4DV4 B;  4FK5 C;  3CE2 A;  2N74 A;  3WB1 A;  3ABT A;  1IBK O;  3QG5 A;  2KSD A;  1PD3 A;  3A0B Z;  4DO2 A;  1FD9 A;  4DR3 B;  1OZ0 A;  5IYD O;  5B1B B;  4ZKI A;  4DW0 A;  1ARO P;  4K35 A;  2QR4 A;  5LHH A;  5IJ0 A;  1R1B A;  1SF9 A;  1HNX O;  3K5L A;  5LGT A;  4RO2 A;  3CCJ V;  1Y74 A;  2F66 C;  2JRI A;  5LXT B;  5KHJ A;  4X1K A;  2FB5 A;  3P3P A;  1S3J A;  2ZE8 A;  4YY3 O;  1XL6 A;  3SYQ A;  4MVM A;  5LBQ A;  3A0H Z;  3OGI B;  2Q0O C;  1EFR G;  4JYA O;  4NB5 A;  3Q4H A;  5JWP A;  2GDS A;  3ABK C;  2DYS B;  1K3E A;  3FB5 C;  4WFE A;  1XQ8 A;  2Q8V A;  1NVP D;  1YTF B;  2WLN A;  3OFN G;  3L73 H;  1UJW B;  1EZV H;  3DC5 A;  5IYZ B;  3E8H A;  5K1X A;  1SZX A;  3CCQ V;  4KUM A;  1OJH A;  2YSU B;  1JJO A;  4B3R B;  2RNB A;  3B4S A;  2KB1 A;  2BSK A;  2IH1 C;  4OPH A;  3OEE G;  4JTA B;  1V54 B;  1BSM A;  2R72 A;  2R9I A;  5FPR A;  3RYC B;  3WG7 B;  1AJQ A;  2IM9 A;  4P2Z A;  2RDC A;  2L6L A;  4QNH B;  3J7A U;  2UXC O;  4DR2 B;  2JS3 A;  4B3R O;  3RYI A;  2IU3 A;  2AW9 A;  2W0F C;  3K58 A;  3CS5 A;  1GRJ A;  4N23 A;  4DV2 O;  4O4H B;  2ZDI A;  1BHA A;  2ZE6 A;  3G67 A;  4XDJ A;  2BOC C;  2WLM A;  1JCH A;  1XEQ A;  2XAH A;  3ETG A;  2ZT9 B;  4B3S B;  3CHX A;  2CH7 A;  1NR7 A;  4H33 A;  2PI5 A;  2ATK C;  2A7W A;  4FPP A;  2QM4 A;  3F5T A;  2A06 H;  3JAL A;  2AZ0 A;  2JK5 C;  4IIJ A;  1NI8 A;  3FD9 A;  2LO1 A;  1PNL A;  1IXM A;  1OV9 A;  2YXH A;  3S3X A;  5LOV A;  1N33 B;  2BSK B;  1Y76 A;  5LP6 A;  2QM8 A;  1JOY A;  1M56 C;  3CRA A;  3QO7 A;  3OD4 A;  1SA0 A;  2LQT A;  3H9V A;  5E1A C;  2HJD A;  1H2L A;  3D8C A;  4X20 B;  2F23 A;  2B1I A;  5L3F A;  2EX3 A;  3JSN A;  4UFZ A;  5B1B C;  5IJ0 B;  1J5E B;  3OMN B;  2V7Q G;  4U3J B;  1WP8 A;  4NXN B;  4LFC B;  4IT5 A;  2HJF C;  3FAV A;  3RFR A;  2JJ2 G;  2LGW A;  1IBM B;  4O4J B;  4QPJ A;  3OW2 U;  1ENV A;  1XBL A;  1AR4 A;  3P30 A;  1K8A W;  1KYO F;  2GV9 A;  2Q4P A;  3ABM B;  4B7K A;  1YHQ V;  1AJN A;  1RSO A;  4LFC O;  4LWS B;  3KKY A;  4KL1 A;  2CAZ C;  2X6C A;  2ZIM A;  4LR3 A;  2QWN B;  4HNA A;  1KC8 W;  2PF4 E;  1P49 A;  3E22 A;  2UXD B;  4X64 O;  4FZ1 A;  3ZHV A;  2OT5 A;  2H8P C;  1NZ6 A;  3WU2 Z;  2EZO A;  1EZJ A;  3N27 A;  4EB6 B;  2XUM A;  1KEC A;  1Q86 W;  2JIZ G;  2RQ6 A;  4BW5 A;  4K0K B;  5JCO C;  1VF7 A;  1GN6 A;  2Q6A A;  3EFF K;  2QWP B;  4PHZ A;  5IE9 A;  1Q6H A;  3VQY A;  1P4R A;  1P7G A;  1QCE A;  1CPY A;  1AIL A;  3JAT B;  3RN4 A;  1YIJ V;  1NQT A;  4DV1 B;  1AI4 A;  2UUA B;  4TOI A;  1XL4 A;  2EIL C;  4OGQ B;  1FS0 G;  5EC1 C;  3T4Z A;  1GM7 A;  4AI8 A;  2KQX A;  5IT9 N;  4O2B B;  4Q6G A;  4JI7 O;  3UT5 A;  1B06 A;  1PNK A;  1HWY A;  1TUB A;  3BFR A;  4E2L A;  1TVK B;  4BWA A;  3RW0 A;  5C8Y A;  2PZS A;  4DV7 B;  2JGD A;  2Q7E A;  2B1G A;  4JGS A;  3ZRV A;  1WB7 A;  2ZXW C;  2EJR A;  2D2C B;  3ZRS A;  1XMQ B;  3OEH G;  4JI1 O;  2HFE C;  1TAE A;  2WLI B;  1HDJ A;  4I9W A;  1IVS A;  3DSQ A;  4UB6 Z;  1IXB A;  4LFB O;  1KMI Z;  3ASO B;  4I4T A;  4PA9 A;  1WAZ A;  2Q0A A;  4YJ2 A;  4DR5 O;  2HVK C;  3ZIA G;  1RFY A;  2WAM A;  4X62 B;  2W6J G;  3VQW A;  1AB3 A;  2IW5 A;  1BMF G;  1NJI W;  2WLJ A;  3HKE A;  3SYO A;  1H2G A;  5L3E A;  3DXR B;  2KKW A;  2WLI A;  5LHG A;  5L3C A;  1Q90 D;  2E74 B;  2X6B A;  1XMO O;  4JI4 B;  4CH3 A;  4FZ0 A;  2ARH A;  4ZI7 A;  2LP7 A;  1HNZ B;  4RWU A;  4LF8 O;  3NXS A;  2HG5 C;  1IJG A;  1VQL V;  2Y69 C;  3LDE A;  1ZL8 A;  2A3Q A;  1HNW B;  3CCM V;  3FKS G;  2NN4 A;  2HVJ C;  3STZ C;  4EFE A;  2ILM A;  1US6 A;  3I56 V;  4KP4 A;  1XI1 A;  5FNV A;  4NKG B;  1R3J C;  1JMK C;  1XNR B;  1BHB A;  1QR9 A;  4JI7 B;  5C8Y B;  3ZN0 A;  5ITZ A;  1WN7 A;  1OCO C;  3H1H H;  2UUB B;  3ZN1 A;  1IBK B;  2GTA A;  1N0J A;  2E76 B;  5LHI A;  4LH6 A;  3UM7 A;  1EN6 A;  5A9G A;  1QLN A;  3L75 H;  1VQM V;  1N32 O;  2LW7 A;  3R65 A;  3SGI A;  2EIK B;  3ABU A;  2A79 B;  2FTK A;  2CGN A;  5H2F Z;  1K4D C;  4YJ3 B;  4QGP A;  1H2M A;  1UFI A;  2HLD G;  4UB8 Z;  4O4I B;  4X8A A;  1H2N A;  3D3Q A;  1VF6 A;  2OCC C;  2EIM C;  2Y4T A;  1Q43 A;  5JQG B;  2CDY A;  2CUG A;  1HP8 A;  4Q20 A;  1GM8 A;  4LF9 B;  3RVY A;  1BS3 A;  3ZRW B;  1ZLZ A;  1E1R G;  3N2G A;  5GON B;  3TK1 A;  4WFF A;  3F5W C;  4W4L A;  4LF6 B;  1OCR B;  1XUQ A;  4GZR B;  4UVC A;  4ICG A;  3K9A A;  1R3L C;  5DM6 V;  4I55 B;  5B1A B;  5KA6 A;  1FKA O;  2NLJ C;  1GH6 A;  2Q7H A;  2HP8 A;  3JAT A;  2ZXW B;  2V1D A;  4MW8 A;  4YHH O;  3SPI A;  4PA3 A;  4DR5 B;  2AHY A;  5LA6 B;  2OTL V;  4UVA A;  1VQ6 V;  2QTO A;  2WA4 A;  1K34 A;  2HKO A;  3KZI Z;  4FLT A;  3D36 A;  4JV5 O;  1AP5 A;  3JD4 A;  1AR5 A;  3OR6 C;  1NVP B;  1FXK C;  1MA1 A;  2Y69 B;  5IY5 C;  1NT2 B;  4G2K A;  4BR6 A;  1SA0 B;  3ASN C;  3ZHU A;  1MSD A;  3IGA C;  3VQX A;  4HNA B;  4JI8 O;  3CYO A;  5J2T B;  2OIG A;  4FVM A;  3WB0 A;  5KX5 B;  3CWB H;  1GN4 A;  4PI2 A;  3PJS K;  4F6R A;  4PDL A;  1BQZ A;  2QWO B;  5IYZ A;  1XDC A;  4H0L B;  3W7T A;  3OGC C;  1X4T A;  2UXN A;  3RBZ A;  2JJ1 G;  3EHB B;  1OCC C;  3VBB A;  5B1A C;  1TUE B;  5D5P A;  3GB7 C;  4MW3 A;  1AR1 B;  2FYU H;  4GUN A;  5KAI Z;  2FL4 A;  4QIW F;  3CP1 A;  1VP7 A;  3M8A A;  1MSW D;  4BW9 A;  4UCT A;  4CS4 A;  3AK2 A;  4TT3 G;  4JI8 B;  4LF4 O;  1M9N A;  4TV9 B;  2QJ1 A;  1JFF A;  2YID A;  3QF7 A;  1AVM A;  5J2T A;  3EVK A;  3E89 A;  5JCO A;  1R3I C;  2DWE C;  2ZD9 A;  3U11 A;  1TGO A;  3ZHR A;  4DK1 A;  4FLU A;  1KBH A;  2UXD O;  1R6K A;  2XTA A;  4LH7 A;  3ZMV A;  2LJ2 A;  2C2A A;  2W0X A;  1V55 B;  2DYR C;  1ZUQ A;  1Q8I A;  1HR0 B;  1KQS U;  4DRX A;  3X2Q C;  2LGQ A;  4GCZ A;  2H94 A;  3ZMS A;  3ZMU A;  4J10 A;  1RPO A;  4UCS A;  1WNS A;  4JI0 B;  5LA6 A;  3K79 A;  2OYQ A;  1OCO B;  5H6R A;  4LNU B;  2E5L O;  4DR7 O;  2ZIO A;  2K1E A;  5EIB C;  1H2S B;  3SPG A;  5DEC A;  4O4L A;  3T1Y B;  3LNM B;  4GX0 A;  4OX9 O;  3SDL A;  1B3Q A;  1WJZ A;  2X6A A;  3D3I A;  3ETD A;  1BCC H;  3OTO O;  1MOF A;  4YY3 B;  4XBF A;  3RYC A;  1T5E A;  2OIE A;  2PUS A;  4UCO A;  1S5J A;  5EZY A;  4LC1 A;  1Q82 W;  2E3C A;  4R7C A;  4Z2W A;  4KXR A;  4LF7 B;  1HNX B;  2Q9L A;  1DGS A;  1M4U A;  5EBW C;  4GX2 A;  3AG1 C;  4GKK B;  2Z0A A;  4LNU A;  4EFB A;  4WCE V;  4GKJ B;  4O2B A;  4DV4 O;  3UCS C;  4DR4 B;  3QTC A;  4PJ0 Z;  1W2B U;  5LYJ B;  4DR7 B;  1S76 D;  1Y66 A;  4MSW C;  3K5O A;  3UQ8 A;  1KD1 W;  4WBN A;  2ZIN A;  1JX9 A;  2HHH O;  3B2E E;  4NXM O;  1QBZ A;  1F4N A;  1G8M A;  3BVO A;  4D7S A;  2ADQ B;  2BOB C;  4NTY A;  1Q81 W;  1G6U A;  3AG4 C;  4DR2 O;  2UXC B;  4N21 A;  5GTI Z;  1S5H C;  3OAA G;  4DYL A;  5CA1 B;  4ASU G;  2P22 C;  3RYF B;  3P3N A;  1ZX3 A;  1O9G A;  3IAY A;  2Q73 A;  2HEP A;  2ITC C;  3RGB A;  1URF A;  2CE4 A;  4QE7 A;  4JI2 O;  2QDO A;  1FJG B;  4CH5 A;  1NTK H;  4LP8 A;  4LFA B;  1FXH A;  3MDS A;  1F51 A;  1DF4 A;  3FB8 C;  5C93 A;  1AP6 A;  3UO3 A;  3DXR A;  3DTU B;  4I50 B;  1SET A;  1JVM A;  2QM7 A;  3ZJZ A;  1Q7Y W;  4U3J A;  3HKB B;  4DXW A;  5CBG A;  1H2K A;  5HFM A;  2KG7 A;  4AQY B;  1LUV A;  4X20 A;  2M6Y A;  5KMG A;  1Q6U A;  2JGU A;  1GN2 A;  2LW1 A;  5EYP A;  1YVW A;  1LNQ A;  3B09 A;  2VQE O;  4I4T B;  3G71 V;  3K3W A;  4FFB B;  5EZY B;  4CC6 A;  5K1P A;  5IWA O;  4MVO A;  4PDR A;  3JAM N;  4GYC B;  2ZM6 B;  3CX5 F;  4MT8 A;  1FPO A;  3BA8 A;  2P5O A;  1KP3 A;  3AK1 A;  4DR6 B;  5LP6 C;  3APO A;  4UVB A;  1QLE C;  1FAF A;  2Q7G A;  4JV5 B;  1DTO A;  4YXW G;  2IJK A;  1PPJ H;  3G4S V;  4TSF G;  5B3S C;  3HKC A;  2VQE B;  3J80 N;  3ASN B;  2MK3 A;  1OCZ C;  2DJV A;  2BTQ B;  2YDE A;  4B3M O;  3H1L H;  4CH6 A;  3CCL V;  2GTS A;  1FFT B;  2YS8 A;  5BY1 A;  2AXT Z;  1K5Q A;  4HZ3 A;  3EXA A;  4B3T B;  1FXK B;  4TUY A;  3AG1 B;  4DUZ B;  1MAB G;  2QGN A;  5IYC O;  4LF6 O;  3JAS A;  1Z5W A;  2R9A A;  4JI6 B;  3G6B A;  5J9P C;  4JI2 B;  2YI9 A;  4JYB A;  4FLW A;  2UU9 O;  1QQC A;  4O2A B;  4L87 A;  4UV8 A;  5CBH A;  4X64 B;  3ETE A;  1H38 A;  3HR0 A;  4O4I A;  4X66 O;  3JAR A;  3ZCC A;  2CTP A;  2DOS A;  3LUT B;  5JJE B;  3J81 N;  2GBO A;  4WFA V;  4X89 A;  4ZHQ A;  1N36 O;  4RUE A;  4BAY A;  4B3T O;  2YEV A;  3W7W A;  1F4M A;  1K33 A;  1RSO B;  2BTQ A;  1IBM O;  1PP9 H;  1VQ8 V;  2HHH B;  3CD6 V;  1OCZ B; 
#chains in the Genus database with same CATH homology
 1GN3 A;  1VAR A;  4JYY A;  2AW9 A;  1BS3 A;  3AK1 A;  1ZLZ A;  3AK2 A;  1JA8 A;  4X9Q A;  3KDR A;  4JZG A;  1LUW A;  1IDS A;  1QNM A;  1AVM A;  1XUQ A;  1PL4 A;  3EVK A;  3LSU A;  2RCV A;  1ZTE A;  1KKC A;  1Y67 A;  2ADQ B;  1GN6 A;  1XRE A;  1VEW A;  1BT8 A;  1PM9 A;  1ZUQ A;  1ZSP A;  1I0H A;  3IC9 A;  1P7G A;  3TJT A;  1N0N A;  5AG2 A;  3C3T A;  3RN4 A;  3C3S A;  1XIL A;  2CE4 A;  3DC6 A;  2ADP A;  1AP5 A;  1AR5 A;  4JZ2 A;  1MA1 A;  1EM1 A;  3CEI A;  2GDS A;  1JR9 A;  1N0J A;  3MDS A;  1EN6 A;  4YIO A;  1B06 A;  3AK3 A;  4BR6 A;  5A9G A;  4F6E A;  3BFR A;  1MSD A;  1AP6 A;  3DC5 A;  1SZX A;  2QKA A;  1MNG A;  1WB7 A;  1GN4 A;  2P4K A;  3OT7 A;  1EN4 A;  1IX9 A;  3K9S A;  4C7U A;  1LUV A;  4E4E A;  1XDC A;  1AR4 A;  2QKC A;  3QVN A;  1GN2 A;  4YIP A;  1MMM A;  1D5N A;  1BSM A;  1IXB A;  4FFK A;  1I08 A;  3KKY A;  1WB8 A;  2CDY A;  4GUN A;  1EN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...