1MNGA

Structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
203
structure length
198
Chain Sequence
PYPFKLPDLGYPYEALEPHIDAKTMEIHQKHHGAVTNLNAALEKYPYLHGVEVEVLLRHLAALPQDIQTAVRNNGGGHLNSLFWRLLTPGGAKEPVGELKKAIDEQFGGFQALKEKLTQAAMGRFGSGWAWLVKDPFGKLHVLSTPNQDNPVMEGFTPIVGIVWEAYYLKYQNRRADYLQAIWNVLNWDVAEEFFKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Structure-function in Escherichia coli iron superoxide dismutase: comparisons with the manganese enzyme from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase(superoxide acceptor)
total genus 73
structure length 198
sequence length 203
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1994-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1mngA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1mngA02
2QKCA 4JYYA 2CE4A 1QNMA 4YIPA 1XUQA 4BR6A 3AK2A 1AP6A 1IXBA 4YIOA 3QVNA 3LSUA 2QKAA 1IDSA 2ADPA 1MA1A 1JR9A 4GUNA 1KKCA 3BFRA 1GN4A 1AP5A 3KKYA 3IC9A 1PL4A 1JA8A 1Y67A 1MNGA 3DC6A 4JZ2A 4E4EA 1XDCA 3TJTA 2RCVA 4FFKA 2CDYA 1VARA 2GDSA 1EN5A 1GN2A 3C3TA 3K9SA 1AVMA 3AK1A 1WB7A 5A9GA 1ZTEA 3C3SA 1WB8A 1ZLZA 1EN6A 1GN6A 1AR4A 3AK3A 3DC5A 4C7UA 3CEIA 1AR5A 1BS3A 1ZSPA 1ZUQA 5AG2A 1N0JA 1IX9A 1MSDA 3EVKA 3MDSA 1BT8A 4F6EA 1I0HA 3OT7A 1I08A 1D5NA 1EM1A 3RN4A 1B06A 1GN3A 1EN4A 1N0NA 1SZXA 4X9QA 1PM9A 2P4KA 1LUWA 2ADQB 4JZGA 1BSMA 1LUVA 1XILA 1XREA 1VEWA 1MMMA 2AW9A 1P7GA
chains in the Genus database with same CATH superfamily
1BGYH 3L75H 2YDEA 4PA9A 3IFXA 4YIPA 2QWQB 3FD9A 4DK1A 2UUCO 4FJCC 4X1YB 2YIBD 3SR2C 1FPOA 2EULA 1QR8A 4DUZO 3W7UA 3ZRVA 4DYLA 1VQNV 4PELA 2XT9A 1RFYA 2BOBC 3FFQA 2LGWA 3MHHC 3E35A 4YJ3A 4W4KA 5JJNB 3B2EE 1K97A 1OCOC 3T1CA 4GX0A 3O9OA 4I4TA 1BQ0A 3TJTA 2WLIB 2WWWA 2W6IG 3K0GA 2BE3A 2DYRB 5J2UB 3HB3B 4DR3O 1FAFA 4JV5B 4DV1O 5A2QN 3VOUA 3WB2A 2UUBO 2LGQA 5CN0A 3CMEV 2JJ2G 5D5QA 4QE9A 5A9GA 2YICA 4LR3A 4JI0O 3C3SA 1X59A 4IHJB 3D3IA 1PPJH 4EB6B 3CX5F 5LGTA 1Q7YW 3GVMA 1KP2A 1GH6A 1QLNA 3RYHA 4CH3A 4IL6Z 2YS8A 2BSKB 3A8TA 2KQXA 3OMAB 2R9RB 3SYQA 3G6BA 3IC7A 3P3NA 1V55C 4X65O 5JH7B 4ZHQB 3OMNB 4NKGB 1M90W 1Q6HA 2JS5A 3I5DA 2GHYA 3M99B 3S3XA 3CP1A 4YHHB 4FLUA 2ADQB 5CB4A 4UCUA 5EIBD 3DTUB 2WA4A 4CBCA 3K58A 1XREA 3T1HO 4WBNA 2BSKA 5KUKA 3ABMB 4K3AA 3ZHTA 1ORQC 2JJ1G 3K57A 3JAWB 4DV6B 3ZHQA 2EIJB 4B08A 4QPJA 5JH7A 2RDCA 3IGAC 3OUSA 1N34B 1X4TA 5KX5B 4JI5O 2LP7A 1VF6C 4JI4O 1JJOA 5EZYB 1JR9A 4I0XA 5IDJA 3AG1B 3BFRA 2K1EA 1IBMB 1KBHA 1NTZH 4UV9A 5JCOA 4IT5A 2PYLA 2EJ7A 4HBNA 5LMUO 3ZMSA 1E79G 4BW5A 1XL4A 2OIGA 4DR6B 3ZX6A 1R3JC 5LYJA 5IYZA 3HKEA 2DJVA 3KCYA 4G2KA 1OCZB 1VQMV 4GKKO 4KHPB 1SRYA 2R72A 3K5OA 4K8XA 3AK1A 1M4UA 1NTKH 4WCEV 1BHBA 5EC2C 4B3SB 3W7SA 1NR7A 1N32B 1TA8A 1H2NA 5BR8B 1KP3A 2IH3C 3B4SA 3FX7A 2L35A 4XBFA 4X1KB 1ZSPA 4B3RO 2UU9B 2JEXA 2R9IA 1OV9A 3G67A 1LR1A 4XDLA 1AI4A 3AG3C 2FL4A 2NNUA 1I08A 3CMAV 3H9VA 4GX2A 2Z3YA 3CE2A 1V9PA 3AEIA 4X1KA 3E8GA 3HR0A 4DV2B 3WFVA 4UUJC 2HLDG 4U7OA 2EIKC 1G8MA 1WP8A 2XHBA 1YJ9V 2CGOA 4WFAV 3DGEA 4LC1A 1GK9A 4U3FH 1R6KA 3RFRA 1VQ4V 5CMUA 2QSAA 3G6EV 3D36C 3I56V 3K5MA 3BABA 4ICGA 1S77D 5FL7G 4BIUA 2EILB 5FLXN 2Y0PA 5H5NA 4BW9A 4MVOA 3L73H 2CH7B 4Q20A 2D2CB 2W0FC 4PD4F 2V7QG 2ODMA 1R6NA 5BXZA 2H8PC 4CC5A 1OCZC 2RN9A 2XOKG 3ZRWB 1MNGA 2QTSA 3DC6A 3OTFA 3ZHUA 2IU3A 2EBOA 4YJ2A 3QNEA 5IJ9B 5IE9A 3CCQV 1VF5B 4MTXA 2DOSA 3RT3C 4FLYA 1MSWD 3CCJV 2P67A 4GZRB 1Y74A 1H2KA 2GV9A 1Q86W 4FFBB 5IJ9A 3HKCB 1N34O 3PJSK 2YEVB 2ZM6B 1BS3A 2Q0AA 3AG4B 3D8CA 4DR2O 5DM6V 3RVYA 1PNMA 4AI8A 1TGOA 4F6EA 1W2BU 5KHIA 2Q8VA 4UXNA 2JIZG 4LF7B 1EN4A 4EFBA 5H2FZ 4DR5B 3ASOB 5CBGA 2UXBB 1LUWA 2F23A 3EXAA 4TQFA 4E2LA 4IIJB 5BMVA 5BZBA 4UB8Z 3JASA 4DRXB 1DF5A 3CCLV 1VEWA 1ZL8A 3J7AU 4KP4A 2O57A 2K9PA 5B3SC 1KU9A 4XDJA 1NZ6A 1OZ0A 2OTJV 1XNQB 1OCRC 4FLVA 4IIJA 4X66O 1N32O 3N2GB 1EBOA 2F4VB 1AI6A 2OCCB 2GUZB 1OCCC 1KKCA 4I55A 3O65A 5EYPA 1RSOA 1TVKB 5B66Z 4XDKA 3A0RA 3KKYA 1FS0G 4X8AA 2UU9O 4PJ0Z 3T4ZA 2VQFB 3L71H 2Q73A 1CXZB 4PI0A 3H1HH 1JX9A 1YITV 3N2GA 3RGBA 1B04A 1SF9A 3CRMA 4DR1O 1ENVA 5JJJB 5H6RA 4JI8B 4DV2O 1H8HG 1K73W 2Y69C 4WFFA 2QA4V 1YSCA 3OM3B 4LFAO 1F7YA 2UUAB 1Z5WA 3AG4C 3WB0A 5K1XA 1VQKV 2V4DA 1U97A 5IJ0B 4FPPA 5LP6A 2P90A 2LW1A 2HHHO 1UJWB 5GONB 3K5NA 2JGDB 4F4LA 2Q68A 3HPLC 4OX9O 1FFXB 5LMNO 4D7TA 1QLEB 4R50A 3OT7A 1D5NA 3SPHA 4PA6A 3GB7C 2CTRA 4X9QA 1WPXA 4NVPA 5JJEB 4GKJB 3ABLC 5JWPA 4I5SA 2E5LB 2HG5C 3F7YC 1FXKB 4DR7B 4P9OA 2OCHA 1QVFU 5HFLA 3OR6C 1M57B 2XAGA 2B9ZA 4DV5B 4YIOA 2F66C 3LSUA 2JS3A 4LF9B 1JFFB 4J41A 5B1BB 2UXDO 4MT8A 3SYAA 4RO2A 1PNLA 4LF4B 3QO8A 4RQEA 1O9GA 3UKMA 2W6JG 2PI4A 3UQ8A 3SPJA 4X1IB 1K5SA 3WB1A 4RUFA 4NXNB 3FYEB 1NS1A 4K35A 1Q6UA 3ZIAG 4RAIA 4E4EA 4KL1A 2E75B 2X7RB 4J9ZB 4PA7A 3BCCH 2ZDIC 2H94A 4B3MB 2FMLA 5IYDO 2AXTZ 3ETGA 3E2EA 2KG7B 2QWOB 3JD0A 3E8HA 2E3CA 2ITDC 3RYCB 3R65A 1FKAO 2WAMA 5L3GA 3NR7A 1XNQO 4ABMA 5J2TA 3FB8C 3SPCA 2F4VO 3CRQA 3U0ZA 4O4JA 2QWNB 4PDVA 3RYFB 4JTCB 4K0KO 3K59A 3A2FA 2OYQA 3JD2A 1UPGA 3LDCA 2DWEC 2F95B 2VQFO 1AI5A 2IBZH 2B1IA 3FB7C 5B1OA 3SYPA 5IWAB 5KA5A 1DGSA 4YXWG 4J11A 2JK5C 4ZI7B 1AR1B 3T4DA 3CCVV 4DUYO 2R9AA 1PL0A 1Q3EA 1O9HA 3M7MX 1XL6A 4JI8O 4JI3B 2Y48A 2YSUB 4W4LA 2PGGA 2UUAO 4P30A 1KMIZ 1ZAUA 3N27A 4BIZA 1PV0A 1VQ6V 1L0LH 1IDSA 3UCSC 1N33O 4JYAB 4LFBB 1R6TA 1XNRB 1YXBA 2Q69A 3APQA 4O2BA 3ZMVA 5LL6Y 2RMKB 2XASA 1PL4A 2ZXWB 4GX5A 4ASUG 3T1YO 3OTOO 4YJ3B 2DWDC 5DN6G 1KC8W 1XHXA 2QEXV 2AZ0A 1Q43A 4I4TB 4TQDA 4NXMB 2AGAA 1SESA 1EN5A 1GN2A 2EX3A 1K4CC 3F5TA 5FNVA 5LGUA 2GBOA 4YY3B 1WB7A 5CBFA 1SQQH 3UT5A 3K06A 2AZ2A 1THZA 2RNBA 4JF3A 5C8YB 3B77A 2X0LA 3E22A 1GN6A 1QQCA 1HNXO 2JDIG 3BA9A 4LF6O 5LOVA 3AG7A 1JMKC 1JNBA 1NBMG 3JD1A 3RYHB 4F6RA 3ZHRA 1JCHA 5LXTA 5C8YA 3BPZA 4AQYB 4NXNO 5CBHA 4DV4B 1J5EO 1SZXA 5BY1A 4UCVA 3CXCU 1B6QA 4WFBV 1LUVA 5CB4B 4MVZA 1MOFA 1P7GA 4I9WA 1M56B 3SJAC 2A3QA 2WLLB 2HFEC 1VF6A 4WBNB 5GW7A 1AJQA 4BIOA 3B8NA 1SC5B 2ARHA 2DW4A 4UVBA 3FAVA 2ZR3A 1NR1A 3Q4HB 4FVMA 4JI2O 3ZCCA 4AILC 2WLLA 1KKDA 1G6UA 3E89A 2WPDG 3CC2V 3ETEA 4I0XB 1H5WA 4EEQA 2CGNA 2ITCC 3THOA 1M93A 3JALA 2DMXA 3GWOA 4NTXA 3Q4HA 2VWJA 4I9QA 5LYJB 5IYZB 3RYIA 3HKEB 2YC0A 2E74B 1N8RW 3CHXA 4LF5O 3TXQA 5LHGA 4O4HA 4NTYA 2DYRC 2EJRA 5ITZB 3OEHG 4FZ1A 4FLWA 1QCEA 1ZTEA 1F4NA 4TT3G 2XTAA 3JARA 3HKDA 1WAZA 5HFMA 2OT5A 5J9PC 1AR4A 2LFRA 2ZNIA 2E76B 4MVMA 4GCZA 5ITZA 4JYAO 4AHCA 1EFRG 1SA0A 3CCUV 3RVZA 1XNRO 1TUBA 4UCTA 2M7WA 1R1BA 4R7CA 5LBQA 4TUYA 2BTOA 3UO2A 4DV3B 1L1FA 1GM8A 1R3IC 2LFSA 1H2SB 3VQWA 5CA0A 3U10A 1VQPV 4JASA 2PUSA 3OD4A 1GRJA 1DK1A 2WLMA 5JQGA 5DEDA 3JCZA 4CS4A 5LGNA 3P30A 1QNMA 3B8MA 4MVRA 2NLJC 1H8EG 1YIJV 3CJHA 1PP9H 4HAMA 4LH7A 3ABKB 1K9MW 3ABMC 1AB3A 1IXBA 1H2LA 2EINB 3QVNA 2EIJC 1COWG 1XMOB 2Q7HA 1I94B 4X62B 3LDDA 1K92A 2EZPA 2ZE8A 2PTMA 4JV5O 4IYHA 1Z2GA 2Y0IA 4QIWF 1IURA 3SPIA 2HVJC 3AG1C 2Q0OC 1AILA 4PI2A 4AQYO 4U7NA 3W7TA 5LHHA 5B1AB 5H6QA 4DV4O 1GTOA 3WG7B 2AHYA 4JI7B 5KMGA 4YJ2B 3CRAA 3SPGA 2GDSA 3ZN1A 3OR7C 3J80N 2QM7A 1YF2A 2F93B 3FKSG 3UM7A 1GMGA 2DE0X 1HP8A 1NKDA 1Y74B 4FLTA 3OW2U 4LWSA 5JVDA 3CRCA 4YHHO 1BHAA 3DC5A 4C7UA 4J9YB 4TOIA 1J95A 5IY5B 4FM1A 3BAAA 3MAQA 1MG1A 4X64B 1VQ5V 3DSQA 4R6ZA 5KAFZ 1JQ0A 1M5IA 5C93A 4DV6O 3ZN0A 1XBLA 4PA4A 3LNNA 1VP7A 1F51A 5CA3A 2LQTA 2DYSB 4CH4A 5BMVB 3JASB 4JI1B 1RPOA 1IBLB 1FJGB 1ZL8B 1VF7A 1XQ8A 3G80A 4TV9A 1IBMO 1AJPA 1F4MA 1V54B 1H2GA 3OMIB 1RP3B 3OFNG 1VQ8V 4K8ZA 4DV0B 4MVSA 4DR6O 4NB5A 4GX1A 4H44B 3ZS8C 1K4DC 4O4LA 2KB1A 2D3OW 1HW7A 5F2VO 4I55B 2EILC 5EYPB 1RSOB 4KHPO 2OTLV 5EIBC 4UCOA 3ASNB 2GTAA 1I5XA 2AHZA 2P7TC 2X6AA 1YJNV 4B3SO 4DV3O 5L3EA 4B3TB 1LNQA 3JCUZ 3K5LA 4U3JA 5BR8O 1EZVH 1PKXA 2XAJA 1Q8IA 4I50A 4J7KA 1G1XB 1ZLZA 1B3QA 2YIDA 4QPKA 5IY5C 4J7ZA 3CPWU 3T2MA 2WLJA 4OXSA 1OJHA 2ZE7A 3JD4A 5LP6B 2PI5A 2Z5UA 3CCSV 5KHJA 2A79B 1NVPD 2X6CA 3CB2A 2ZNJA 1B06A 1N0NA 5CA1A 1IXMA 2P5OA 1PM9A 2RQ6A 1V54C 4LFCB 3SYOA 4JI7O 3ASOC 3EHBB 4JYYA 1TAEA 4DR4B 2CTWA 1IBKB 4O2AA 4LBEC 3MD0A 1AROP 3ETDA 4LNUB 4JPRA 3CCEV 1HDJA 3K79A 1FFTB 2XAQA 3QG5A 1AI7A 2QJ1A 4PA3A 5K1PA 4FLZA 2OCCC 1JA8A 3LSSA 1JVMA 3SJCC 4X20A 2VWKA 3VBBA 4LNUA 4MTOA 5FPRA 3ZRXA 2QM4A 2LW7A 1L8DA 4UFZA 5KLVH 1KB9F 2EIMB 4O4IA 3QO7A 4RWUA 4UCRA 3JAKA 3N2KA 2DQ0A 2ZM6O 4JI1O 2HKOA 2YI8A 1IBLO 1FJGO 2ZE5A 3ZHVA 2QE7G 2W0XA 4L8JA 3WU2Z 1IVSA 2ZR2A 4NR1A 3BRCA 4IYIA 3B40A 4UVCA 1R73A 4LF7O 4DR3B 1FXVA 3ZMTA 4DV1B 4DR5O 2ZIOA 2UXBO 5J2TB 1AR5A 2UUBB 5AG2A 1N0JA 4GT1A 3OAAG 4ZOLA 4JI0B 3MHSC 1JPXA 4O4JB 4OPAA 3K9AA 1HR0B 2A7WA 2FYUH 2QDOA 4WFGA 1Q82W 1QU7A 2Z0AA 3K03A 3D3QA 2Q67A 1QLEC 1ZWIC 2P4KA 4TSFG 3X2QB 1XHZA 3E83A 5E1AC 1E1RG 5L3DA 2Q7GA 4H13B 1BE3H 2PY5A 2OWOA 2CE4A 1Y6XA 1BQZA 1NJIW 4JYCA 3H1LH 5LA6A 4TV8A 4DO2A 5B5EZ 4GLXA 1NVPB 1SERA 2NN4A 4MTFA 4N23A 5KAIZ 2BTQA 1URFA 2PF4E 2WSSG 2YXHA 1FXKC 3T1HB 4UB6Z 2BOCC 5EC1C 1K8AW 1M57C 3ABTA 1S76D 1NT2B 1NH2D 2P4VA 2HR3A 3IJ4A 5B1BC 4O2BB 3H01A 4JI5B 4JAUA 2Y4TA 4CS2A 1XDCA 3ICXA 3UO3A 1H2MA 2CDYA 3CS5A 3HKBA 5FPOA 2ZCEA 2Q7EA 4JTAB 4UVAA 1VARA 2F43G 1CP9A 4LFCO 3K08A 1WPBA 2ZIMA 1CEZA 2GSMB 5FNVB 4DR4O 1XOUA 3CXHF 1WB8A 3UT5B 1FOUA 1N4CA 2VRZA 3K3WA 2KSDA 3E22B 4FZ0A 4EKWA 4GKKB 4FM0A 4GKJO 3SJQC 4Z1MG 2E5LO 1VQLV 1JOYA 4PHZA 3X2QC 3FB5C 5LOVB 3ZRSA 1DTOA 3JAMN 1TUEB 1EM1A 4F6RB 1IZ3A 2PZSA 3OUFA 5LXTB 3E86A 4DR7O 1Q81W 4MVQA 4JAAA 4JZGA 1QBZA 2ZT9B 3KCXA 4UV8A 4DV5O 4B3RB 2G38A 2YI9A 2Q6AA 4LF9O 3TK1A 1ZX3A 1XMQB 5E79Z 4LF4O 2ZD9A 2X6BA 3R66A 4X1YA 1XUQA 4WFEA 1Q6IA 1PNKA 4KFMA 1SQBH 2RJZA 3C90A 1K7DA 3RWRD 1AP6A 1NU1H 4Q6GA 2M6YA 3FAVB 5LHIA 1U96A 1YJWV 1JJ2U 3LNMB 4B3MO 3A0BZ 4CH5A 2VQEB 1Y67A 3OEEG 4J10A 2JEUA 2WLIA 2HJFC 5L3FA 4DV7B 2CTPA 3W7WA 4OGQB 1HR0O 3EFFK 1MZFA 5J2UA 4FFKA 3M8AA 4J7JA 2L6LA 4JAVA 3JALB 2ZXWC 4QJFB 1T5EA 2YUAA 3SJBC 3RYIB 4BAYA 5H9CA 3H1JH 1AVMA 2QM8A 1QHTA 3H1IH 4G28B 1NH2B 4O4HB 4IHJA 1P49A 1FYJA 4EB6A 2XAHA 4X88A 4PDMA 1KQSU 1EN6A 1K3EA 1G4YB 1W0KG 1SZTA 3JARB 3HKDB 3AG3B 3AK3A 2KKWA 5IWAO 4JGSA 3CC7V 3TXSA 1SA0B 1DLBA 4ZHQA 1TUBB 4J80A 4JI3O 4DW0A 1XEQA 2MW2B 4TUYB 2EIKB 3F7VC 3CSXA 4HZ3A 3ZMUA 1L0NH 4MW8A 3SGIA 3STLC 2A06H 5CA0B 3OGIB 4DR2B 2AW9A 1KD1W 4FMTA 3JAWA 4LFBO 4WFHA 1EZJA 2WA3A 5JQGB 1M9NA 2MK3A 1WJZA 1M56C 5KX5A 2ZKOA 1NQTA 1WN7A 3AK2A 3S3WA 3CJHB 5EZYA 1M1KW 3D36A 2N05A 2Q9LA 4NXMO 1S0VA 1FD9A 1GN4A 4Z1VA 3G4SV 1AP5A 4G27B 1SQPH 1AJNA 1VIBA 5EK0A 1NTMH 2CAZC 4PDLA 4UCSA 4MSWC 4YY3O 4J42A 2YIBA 1UFIA 4P2ZA 4X66B 4DW1A 4FM2A 3U11A 3LSQA 2GTSA 2OIEA 1Y4MA 2IW5A 3STZC 3TETA 3VQXA 5JCOC 3CYOA 3ZJZA 2XAFA 1XI1A 4RQFA 1I7FA 1SQGA 3DXRB 2H3OA 5KMGB 2F1MA 1XMQO 4HYOA 3B09A 4JI6B 3CCMV 1WNSA 1SKVA 4CH6A 2HVKC 1S5LZ 1YHQV 4DR1B 1GO3F 1Q5OA 4LWSB 5JVDB 1VQOV 3DXRA 1ZUQA 1MSDA 3BHPA 3JSLA 4LFAB 3CC4V 4EFEA 2PYJA 2WLHA 4L87A 4H33A 1BT8A 1I0HA 1N36B 4HNAB 1HWYA 1W59A 5IYBO 2VQEO 1QVGU 2Q4PA 2HHHB 1S5HC 2B1GA 2IM9A 5EBLC 4MS2A 2Q5ZA 4DV7O 4LF8B 1YDXA 5B3SB 1BSMA 3BVOA 2IH1C 1DF4A 2N74A 4OX9B 1MMMA 4CC6A 5LMNB 5KHKA 1OCRB 3SDLA 4WF9V 4HNAA 1A32A 4LP8A 4TV9B 2P22C 1OCCB 1W0JG 4FLXA 2ATKC 1KECA 2CH7A 2ADPA 4H37A 2QKSA 1WP7A 3ABKC 2EINC 2NR5A 3L74H 4O4LB 3LUTB 3ZRWA 2CUGA 2UXXA 2HJDA 2DN9A 3W7XA 1US6A 3JYCA 2YXLA 4R8CA 1S72V 2UXDB 3TCUA 3OE7G 4ZIBA 4ZKIA 1WA8B 3IAYA 2Y69B 2UXCB 5B1AC 3ABUA 4U3JB 3WG7C 2LO1A 4P9PA 2QGNA 4I50B 4FFBA 3HKCA 3L70H 1WA8A 3ML0A 2Y4UA 2YEVA 4X89A 2ZQMA 4NYKA 2P6JA 3TGUH 1NI8A 5KHHA 3VQVA 3ZHSA 3J81N 3K0DA 5IYCO 1IX9A 4A5UB 1GAXA 4Z2WA 3K04A 3MDSA 2QWRB 3ABLB 4QGPA 1YEWA 3JATB 5KHGA 4DRXA 1YI2V 3OGCC 5CA1B 4TWKA 5EBWC 4QNHB 2DQ3A 3JSNA 3P32A 4JTDB 1XMOO 3CCRV 1I94O 2WLNA 4X62O 2QKCA 3SYCA 4K0KB 1HNZB 2V1DA 5EBMC 2IJKA 2DYSC 2LJ2A 4BR6A 1VQ7V 3FB6C 4N21A 4JI6O 3JATA 1RM1B 2YXYA 3AG2B 2R70A 4O2AB 2GUZA 2ZE6A 3H1KH 1YVWA 4PDRA 4DUYB 1TVKA 1KYOF 3E8BA 1MZEA 1MA1A 4JYBA 4PV1B 1BZKA 1ROPA 4NTWA 1E1QG 4MVUA 2JGUA 3IC9A 4ZBMA 4DK0A 2P06A 1HNWB 1N36O 1F23A 3E8FA 3PN1A 2RCVA 1N33B 2QTOA 4X20B 3ASNC 3BY6A 4LF8O 4OPHA 1IJGA 3GWKC 2HP8A 3VQYA 3QF7A 3BA8A 2N04A 4O4IB 3T1YB 3OTOB 1KUQA 2UUCB 4FK5C 3JAKB 3N2KB 1YCIA 2VS0A 2ZDIA 2EZOA 4LCUC 5IJ0A 2IJIA 4DUZB 2FKXA 4X64O 5L3BA 1MABG 1YTFD 5GONA 1R3LC 1K34A 1SQFA 2JGDA 1S5JA 1SQXH 3KZIZ 1P4RA 5GTIZ 2A0LA 1GM9A 1FFXA 5GTHZ 3LDEA 3EVKA 3A0HZ 5TISZ 4B7EA 3ETQA 1Q90D 5LP6C 4ZOLB 3RN4A 3FYIB 2BCCH 2JRIA 1SQVH 1GN3A 4B7KA 4DV0O 4I7ZB 1HNXB 1P7BA 2ILMA 4LF6B 1RM1C 3AG2C 4RUEA 3QTCA 1XILA 1Y76B 2QWPB 2UXCO 4CS3A 1VQ9V 3JD3A 1FXKA 2A9HA 3QO5A 3RW0A 3G71V 1J5EB 3NXSA 1Y66A 4FIPC 2XUMA 5LA6B 4TV8B 1JFFA 3CWBH 4BWAA 2UXNA 3RBZA 2QKAA 1D5AA 2BTQB 2CK3G 4D6TH 4DXWA 1Y76A 4LH6A 1QR9A 4B3TO 5DECA 1K5QA 4GUNA 5KUMA 1D2DA 2C2AA 3L9DA 3APOA 4MW3A 4X1IA 1Z5VA 1K33A 1YZBA 4KXRA 3ZEDA 4X65B 5B1NA 1VMGA 5IT9N 2ETNA 1GKFA 4D7SA 1GM7A 1S3JA 4JZ2A 2WLKA 1FXHA 1I5YA 4JI2B 3P3PA 3KDRA 1SETA 2IJHA 2FB5A 3BEHA 3HKBB 2KG7A 3KG2A 4QE7A 5KA6A 1BCCH 4H0LB 1OCOB 2YIAA 1OHHG 3C3TA 2JVDA 3CD6V 3K9SA 4MTGA 1WLEA 1HNZO 2HEPA 2EIMC 1R3KC 3RYCA 2QR4A 1PD3A 3ZBHA 4JI4B 4LF5B 4CZZA 2ZINA 3CEIA 4GYCB 3RYFA 1BL8A 2XNDG 2B5UA 5L3CA 1P84F 1H38A 1SS3A 1BMFG 4KUMA 2CTQA 5LMUB 5D5PA 3ZMZA 4IGGA 3CRRA 3I55V 1IBKO 1HNWO 1RPRA 2IJJA 4ZI7A 1CPYA 2IU0A 2FTKA 1YTFB 3L72H 3F5WC 1V55B
chains in the Genus database with same CATH topology
2QKCA 4JYYA 2CE4A 1QNMA 4YIPA 1XUQA 4BR6A 3AK2A 1AP6A 1IXBA 4YIOA 3QVNA 3LSUA 2QKAA 1IDSA 2ADPA 1MA1A 1JR9A 4GUNA 1KKCA 3BFRA 1GN4A 1AP5A 3KKYA 3IC9A 1PL4A 1JA8A 1Y67A 1MNGA 3DC6A 4JZ2A 4E4EA 1XDCA 3TJTA 2RCVA 4FFKA 2CDYA 3KDRA 1VARA 2GDSA 1EN5A 1GN2A 3C3TA 3K9SA 1AVMA 3AK1A 1WB7A 5A9GA 1ZTEA 3C3SA 1WB8A 1ZLZA 1EN6A 1GN6A 1AR4A 3AK3A 3DC5A 4C7UA 3CEIA 1AR5A 1BS3A 1ZSPA 1ZUQA 5AG2A 1N0JA 1IX9A 1MSDA 3EVKA 3MDSA 1BT8A 4F6EA 1I0HA 3OT7A 1I08A 1D5NA 1EM1A 3RN4A 1B06A 1GN3A 1EN4A 1N0NA 1SZXA 4X9QA 1PM9A 2P4KA 1LUWA 2ADQB 4JZGA 1BSMA 1LUVA 1XILA 1XREA 1VEWA 1MMMA 2AW9A 1P7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QKC A;  4JYY A;  2CE4 A;  1QNM A;  4YIP A;  1XUQ A;  4BR6 A;  3AK2 A;  1AP6 A;  1IXB A;  4YIO A;  3QVN A;  3LSU A;  2QKA A;  1IDS A;  2ADP A;  1MA1 A;  1JR9 A;  4GUN A;  1KKC A;  3BFR A;  1GN4 A;  1AP5 A;  3KKY A;  3IC9 A;  1PL4 A;  1JA8 A;  1Y67 A;  1MNG A;  3DC6 A;  4JZ2 A;  4E4E A;  1XDC A;  3TJT A;  2RCV A;  4FFK A;  2CDY A;  1VAR A;  2GDS A;  1EN5 A;  1GN2 A;  3C3T A;  3K9S A;  1AVM A;  3AK1 A;  1WB7 A;  5A9G A;  1ZTE A;  3C3S A;  1WB8 A;  1ZLZ A;  1EN6 A;  1GN6 A;  1AR4 A;  3AK3 A;  3DC5 A;  4C7U A;  3CEI A;  1AR5 A;  1BS3 A;  1ZSP A;  1ZUQ A;  5AG2 A;  1N0J A;  1IX9 A;  1MSD A;  3EVK A;  3MDS A;  1BT8 A;  4F6E A;  1I0H A;  3OT7 A;  1I08 A;  1D5N A;  1EM1 A;  3RN4 A;  1B06 A;  1GN3 A;  1EN4 A;  1N0N A;  1SZX A;  4X9Q A;  1PM9 A;  2P4K A;  1LUW A;  2ADQ B;  4JZG A;  1BSM A;  1LUV A;  1XIL A;  1XRE A;  1VEW A;  1MMM A;  2AW9 A;  1P7G A; 
#chains in the Genus database with same CATH topology
 1BGY H;  3L75 H;  2YDE A;  4PA9 A;  3IFX A;  4YIP A;  2QWQ B;  3FD9 A;  4DK1 A;  2UUC O;  4FJC C;  4X1Y B;  2YIB D;  3SR2 C;  1FPO A;  2EUL A;  1QR8 A;  4DUZ O;  3W7U A;  3ZRV A;  4DYL A;  1VQN V;  4PEL A;  2XT9 A;  1RFY A;  2BOB C;  3FFQ A;  2LGW A;  3MHH C;  3E35 A;  4YJ3 A;  4W4K A;  5JJN B;  3B2E E;  1K97 A;  1OCO C;  3T1C A;  4GX0 A;  3O9O A;  4I4T A;  1BQ0 A;  3TJT A;  2WLI B;  2WWW A;  2W6I G;  3K0G A;  2BE3 A;  2DYR B;  5J2U B;  3HB3 B;  4DR3 O;  1FAF A;  4JV5 B;  4DV1 O;  5A2Q N;  3VOU A;  3WB2 A;  2UUB O;  2LGQ A;  5CN0 A;  3CME V;  2JJ2 G;  5D5Q A;  4QE9 A;  5A9G A;  2YIC A;  4LR3 A;  4JI0 O;  3C3S A;  1X59 A;  4IHJ B;  3D3I A;  1PPJ H;  4EB6 B;  3CX5 F;  5LGT A;  1Q7Y W;  3GVM A;  1KP2 A;  1GH6 A;  1QLN A;  3RYH A;  4CH3 A;  4IL6 Z;  2YS8 A;  2BSK B;  3A8T A;  2KQX A;  3OMA B;  2R9R B;  3SYQ A;  3G6B A;  3IC7 A;  3P3N A;  1V55 C;  4X65 O;  5JH7 B;  4ZHQ B;  3OMN B;  4NKG B;  1M90 W;  1Q6H A;  2JS5 A;  3I5D A;  2GHY A;  3M99 B;  3S3X A;  3CP1 A;  4YHH B;  4FLU A;  2ADQ B;  5CB4 A;  4UCU A;  5EIB D;  3DTU B;  2WA4 A;  4CBC A;  3K58 A;  1XRE A;  3T1H O;  4WBN A;  2BSK A;  5KUK A;  3ABM B;  4K3A A;  3ZHT A;  1ORQ C;  2JJ1 G;  3K57 A;  3JAW B;  4DV6 B;  3ZHQ A;  2EIJ B;  4B08 A;  4QPJ A;  5JH7 A;  2RDC A;  3IGA C;  3OUS A;  1N34 B;  1X4T A;  5KX5 B;  4JI5 O;  2LP7 A;  1VF6 C;  4JI4 O;  1JJO A;  5EZY B;  1JR9 A;  4I0X A;  5IDJ A;  3AG1 B;  3BFR A;  2K1E A;  1IBM B;  1KBH A;  1NTZ H;  4UV9 A;  5JCO A;  4IT5 A;  2PYL A;  2EJ7 A;  4HBN A;  5LMU O;  3ZMS A;  1E79 G;  4BW5 A;  1XL4 A;  2OIG A;  4DR6 B;  3ZX6 A;  1R3J C;  5LYJ A;  5IYZ A;  3HKE A;  2DJV A;  3KCY A;  4G2K A;  1OCZ B;  1VQM V;  4GKK O;  4KHP B;  1SRY A;  2R72 A;  3K5O A;  4K8X A;  3AK1 A;  1M4U A;  1NTK H;  4WCE V;  1BHB A;  5EC2 C;  4B3S B;  3W7S A;  1NR7 A;  1N32 B;  1TA8 A;  1H2N A;  5BR8 B;  1KP3 A;  2IH3 C;  3B4S A;  3FX7 A;  2L35 A;  4XBF A;  4X1K B;  1ZSP A;  4B3R O;  2UU9 B;  2JEX A;  2R9I A;  1OV9 A;  3G67 A;  1LR1 A;  4XDL A;  1AI4 A;  3AG3 C;  2FL4 A;  2NNU A;  1I08 A;  3CMA V;  3H9V A;  4GX2 A;  2Z3Y A;  3CE2 A;  1V9P A;  3AEI A;  4X1K A;  3E8G A;  3HR0 A;  4DV2 B;  3WFV A;  4UUJ C;  2HLD G;  4U7O A;  2EIK C;  1G8M A;  1WP8 A;  2XHB A;  1YJ9 V;  2CGO A;  4WFA V;  3DGE A;  4LC1 A;  1GK9 A;  4U3F H;  1R6K A;  3RFR A;  1VQ4 V;  5CMU A;  2QSA A;  3G6E V;  3D36 C;  3I56 V;  3K5M A;  3BAB A;  4ICG A;  1S77 D;  5FL7 G;  4BIU A;  2EIL B;  5FLX N;  2Y0P A;  5H5N A;  4BW9 A;  4MVO A;  3L73 H;  2CH7 B;  4Q20 A;  2D2C B;  2W0F C;  4PD4 F;  2V7Q G;  2ODM A;  1R6N A;  5BXZ A;  2H8P C;  4CC5 A;  1OCZ C;  2RN9 A;  2XOK G;  3ZRW B;  1MNG A;  2QTS A;  3DC6 A;  3OTF A;  3ZHU A;  2IU3 A;  2EBO A;  4YJ2 A;  3QNE A;  5IJ9 B;  5IE9 A;  3CCQ V;  1VF5 B;  4MTX A;  2DOS A;  3RT3 C;  4FLY A;  1MSW D;  3CCJ V;  2P67 A;  4GZR B;  1Y74 A;  1H2K A;  2GV9 A;  1Q86 W;  4FFB B;  5IJ9 A;  3HKC B;  1N34 O;  3PJS K;  2YEV B;  2ZM6 B;  1BS3 A;  2Q0A A;  3AG4 B;  3D8C A;  4DR2 O;  5DM6 V;  3RVY A;  1PNM A;  4AI8 A;  1TGO A;  4F6E A;  1W2B U;  5KHI A;  2Q8V A;  4UXN A;  2JIZ G;  4LF7 B;  1EN4 A;  4EFB A;  5H2F Z;  4DR5 B;  3ASO B;  5CBG A;  2UXB B;  1LUW A;  2F23 A;  3EXA A;  4TQF A;  4E2L A;  4IIJ B;  5BMV A;  5BZB A;  4UB8 Z;  3JAS A;  4DRX B;  1DF5 A;  3CCL V;  1VEW A;  1ZL8 A;  3J7A U;  4KP4 A;  2O57 A;  2K9P A;  5B3S C;  1KU9 A;  4XDJ A;  1NZ6 A;  1OZ0 A;  2OTJ V;  1XNQ B;  1OCR C;  4FLV A;  4IIJ A;  4X66 O;  1N32 O;  3N2G B;  1EBO A;  2F4V B;  1AI6 A;  2OCC B;  2GUZ B;  1OCC C;  1KKC A;  4I55 A;  3O65 A;  5EYP A;  1RSO A;  1TVK B;  5B66 Z;  4XDK A;  3A0R A;  3KKY A;  1FS0 G;  4X8A A;  2UU9 O;  4PJ0 Z;  3T4Z A;  2VQF B;  3L71 H;  2Q73 A;  1CXZ B;  4PI0 A;  3H1H H;  1JX9 A;  1YIT V;  3N2G A;  3RGB A;  1B04 A;  1SF9 A;  3CRM A;  4DR1 O;  1ENV A;  5JJJ B;  5H6R A;  4JI8 B;  4DV2 O;  1H8H G;  1K73 W;  2Y69 C;  4WFF A;  2QA4 V;  1YSC A;  3OM3 B;  4LFA O;  1F7Y A;  2UUA B;  1Z5W A;  3AG4 C;  3WB0 A;  5K1X A;  1VQK V;  2V4D A;  1U97 A;  5IJ0 B;  4FPP A;  5LP6 A;  2P90 A;  2LW1 A;  2HHH O;  1UJW B;  5GON B;  3K5N A;  2JGD B;  4F4L A;  2Q68 A;  3HPL C;  4OX9 O;  1FFX B;  5LMN O;  4D7T A;  1QLE B;  4R50 A;  3OT7 A;  1D5N A;  3SPH A;  4PA6 A;  3GB7 C;  2CTR A;  4X9Q A;  1WPX A;  4NVP A;  5JJE B;  4GKJ B;  3ABL C;  5JWP A;  4I5S A;  2E5L B;  2HG5 C;  3F7Y C;  1FXK B;  4DR7 B;  4P9O A;  2OCH A;  1QVF U;  5HFL A;  3OR6 C;  1M57 B;  2XAG A;  2B9Z A;  4DV5 B;  4YIO A;  2F66 C;  3LSU A;  2JS3 A;  4LF9 B;  1JFF B;  4J41 A;  5B1B B;  2UXD O;  4MT8 A;  3SYA A;  4RO2 A;  1PNL A;  4LF4 B;  3QO8 A;  4RQE A;  1O9G A;  3UKM A;  2W6J G;  2PI4 A;  3UQ8 A;  3SPJ A;  4X1I B;  1K5S A;  3WB1 A;  4RUF A;  4NXN B;  3FYE B;  1NS1 A;  4K35 A;  1Q6U A;  3ZIA G;  4RAI A;  4E4E A;  4KL1 A;  2E75 B;  2X7R B;  4J9Z B;  4PA7 A;  3BCC H;  2ZDI C;  2H94 A;  4B3M B;  2FML A;  5IYD O;  2AXT Z;  3ETG A;  3E2E A;  2KG7 B;  2QWO B;  3JD0 A;  3E8H A;  2E3C A;  2ITD C;  3RYC B;  3R65 A;  1FKA O;  2WAM A;  5L3G A;  3NR7 A;  1XNQ O;  4ABM A;  5J2T A;  3FB8 C;  3SPC A;  2F4V O;  3CRQ A;  3U0Z A;  4O4J A;  2QWN B;  4PDV A;  3RYF B;  4JTC B;  4K0K O;  3K59 A;  3A2F A;  2OYQ A;  3JD2 A;  1UPG A;  3LDC A;  2DWE C;  2F95 B;  2VQF O;  1AI5 A;  2IBZ H;  2B1I A;  3FB7 C;  5B1O A;  3SYP A;  5IWA B;  5KA5 A;  1DGS A;  4YXW G;  4J11 A;  2JK5 C;  4ZI7 B;  1AR1 B;  3T4D A;  3CCV V;  4DUY O;  2R9A A;  1PL0 A;  1Q3E A;  1O9H A;  3M7M X;  1XL6 A;  4JI8 O;  4JI3 B;  2Y48 A;  2YSU B;  4W4L A;  2PGG A;  2UUA O;  4P30 A;  1KMI Z;  1ZAU A;  3N27 A;  4BIZ A;  1PV0 A;  1VQ6 V;  1L0L H;  1IDS A;  3UCS C;  1N33 O;  4JYA B;  4LFB B;  1R6T A;  1XNR B;  1YXB A;  2Q69 A;  3APQ A;  4O2B A;  3ZMV A;  5LL6 Y;  2RMK B;  2XAS A;  1PL4 A;  2ZXW B;  4GX5 A;  4ASU G;  3T1Y O;  3OTO O;  4YJ3 B;  2DWD C;  5DN6 G;  1KC8 W;  1XHX A;  2QEX V;  2AZ0 A;  1Q43 A;  4I4T B;  4TQD A;  4NXM B;  2AGA A;  1SES A;  1EN5 A;  1GN2 A;  2EX3 A;  1K4C C;  3F5T A;  5FNV A;  5LGU A;  2GBO A;  4YY3 B;  1WB7 A;  5CBF A;  1SQQ H;  3UT5 A;  3K06 A;  2AZ2 A;  1THZ A;  2RNB A;  4JF3 A;  5C8Y B;  3B77 A;  2X0L A;  3E22 A;  1GN6 A;  1QQC A;  1HNX O;  2JDI G;  3BA9 A;  4LF6 O;  5LOV A;  3AG7 A;  1JMK C;  1JNB A;  1NBM G;  3JD1 A;  3RYH B;  4F6R A;  3ZHR A;  1JCH A;  5LXT A;  5C8Y A;  3BPZ A;  4AQY B;  4NXN O;  5CBH A;  4DV4 B;  1J5E O;  1SZX A;  5BY1 A;  4UCV A;  3CXC U;  1B6Q A;  4WFB V;  1LUV A;  5CB4 B;  4MVZ A;  1MOF A;  1P7G A;  4I9W A;  1M56 B;  3SJA C;  2A3Q A;  2WLL B;  2HFE C;  1VF6 A;  4WBN B;  5GW7 A;  1AJQ A;  4BIO A;  3B8N A;  1SC5 B;  2ARH A;  2DW4 A;  4UVB A;  3FAV A;  2ZR3 A;  1NR1 A;  3Q4H B;  4FVM A;  4JI2 O;  3ZCC A;  4AIL C;  2WLL A;  1KKD A;  1G6U A;  3E89 A;  2WPD G;  3CC2 V;  3ETE A;  4I0X B;  1H5W A;  4EEQ A;  2CGN A;  2ITC C;  3THO A;  1M93 A;  3JAL A;  2DMX A;  3GWO A;  4NTX A;  3Q4H A;  2VWJ A;  4I9Q A;  5LYJ B;  5IYZ B;  3RYI A;  3HKE B;  2YC0 A;  2E74 B;  1N8R W;  3CHX A;  4LF5 O;  3TXQ A;  5LHG A;  4O4H A;  4NTY A;  2DYR C;  2EJR A;  5ITZ B;  3OEH G;  4FZ1 A;  4FLW A;  1QCE A;  1ZTE A;  1F4N A;  4TT3 G;  2XTA A;  3JAR A;  3HKD A;  1WAZ A;  5HFM A;  2OT5 A;  5J9P C;  1AR4 A;  2LFR A;  2ZNI A;  2E76 B;  4MVM A;  4GCZ A;  5ITZ A;  4JYA O;  4AHC A;  1EFR G;  1SA0 A;  3CCU V;  3RVZ A;  1XNR O;  1TUB A;  4UCT A;  2M7W A;  1R1B A;  4R7C A;  5LBQ A;  4TUY A;  2BTO A;  3UO2 A;  4DV3 B;  1L1F A;  1GM8 A;  1R3I C;  2LFS A;  1H2S B;  3VQW A;  5CA0 A;  3U10 A;  1VQP V;  4JAS A;  2PUS A;  3OD4 A;  1GRJ A;  1DK1 A;  2WLM A;  5JQG A;  5DED A;  3JCZ A;  4CS4 A;  5LGN A;  3P30 A;  1QNM A;  3B8M A;  4MVR A;  2NLJ C;  1H8E G;  1YIJ V;  3CJH A;  1PP9 H;  4HAM A;  4LH7 A;  3ABK B;  1K9M W;  3ABM C;  1AB3 A;  1IXB A;  1H2L A;  2EIN B;  3QVN A;  2EIJ C;  1COW G;  1XMO B;  2Q7H A;  1I94 B;  4X62 B;  3LDD A;  1K92 A;  2EZP A;  2ZE8 A;  2PTM A;  4JV5 O;  4IYH A;  1Z2G A;  2Y0I A;  4QIW F;  1IUR A;  3SPI A;  2HVJ C;  3AG1 C;  2Q0O C;  1AIL A;  4PI2 A;  4AQY O;  4U7N A;  3W7T A;  5LHH A;  5B1A B;  5H6Q A;  4DV4 O;  1GTO A;  3WG7 B;  2AHY A;  4JI7 B;  5KMG A;  4YJ2 B;  3CRA A;  3SPG A;  2GDS A;  3ZN1 A;  3OR7 C;  3J80 N;  2QM7 A;  1YF2 A;  2F93 B;  3FKS G;  3UM7 A;  1GMG A;  2DE0 X;  1HP8 A;  1NKD A;  1Y74 B;  4FLT A;  3OW2 U;  4LWS A;  5JVD A;  3CRC A;  4YHH O;  1BHA A;  3DC5 A;  4C7U A;  4J9Y B;  4TOI A;  1J95 A;  5IY5 B;  4FM1 A;  3BAA A;  3MAQ A;  1MG1 A;  4X64 B;  1VQ5 V;  3DSQ A;  4R6Z A;  5KAF Z;  1JQ0 A;  1M5I A;  5C93 A;  4DV6 O;  3ZN0 A;  1XBL A;  4PA4 A;  3LNN A;  1VP7 A;  1F51 A;  5CA3 A;  2LQT A;  2DYS B;  4CH4 A;  5BMV B;  3JAS B;  4JI1 B;  1RPO A;  1IBL B;  1FJG B;  1ZL8 B;  1VF7 A;  1XQ8 A;  3G80 A;  4TV9 A;  1IBM O;  1AJP A;  1F4M A;  1V54 B;  1H2G A;  3OMI B;  1RP3 B;  3OFN G;  1VQ8 V;  4K8Z A;  4DV0 B;  4MVS A;  4DR6 O;  4NB5 A;  4GX1 A;  4H44 B;  3ZS8 C;  1K4D C;  4O4L A;  2KB1 A;  2D3O W;  1HW7 A;  5F2V O;  4I55 B;  2EIL C;  5EYP B;  1RSO B;  4KHP O;  2OTL V;  5EIB C;  4UCO A;  3ASN B;  2GTA A;  1I5X A;  2AHZ A;  2P7T C;  2X6A A;  1YJN V;  4B3S O;  4DV3 O;  5L3E A;  4B3T B;  1LNQ A;  3JCU Z;  3K5L A;  4U3J A;  5BR8 O;  1EZV H;  1PKX A;  2XAJ A;  1Q8I A;  4I50 A;  4J7K A;  1G1X B;  1ZLZ A;  1B3Q A;  2YID A;  4QPK A;  5IY5 C;  4J7Z A;  3CPW U;  3T2M A;  2WLJ A;  4OXS A;  1OJH A;  2ZE7 A;  3JD4 A;  5LP6 B;  2PI5 A;  2Z5U A;  3CCS V;  5KHJ A;  2A79 B;  1NVP D;  2X6C A;  3CB2 A;  2ZNJ A;  1B06 A;  1N0N A;  5CA1 A;  1IXM A;  2P5O A;  1PM9 A;  2RQ6 A;  1V54 C;  4LFC B;  3SYO A;  4JI7 O;  3ASO C;  3EHB B;  4JYY A;  1TAE A;  4DR4 B;  2CTW A;  1IBK B;  4O2A A;  4LBE C;  3MD0 A;  1ARO P;  3ETD A;  4LNU B;  4JPR A;  3CCE V;  1HDJ A;  3K79 A;  1FFT B;  2XAQ A;  3QG5 A;  1AI7 A;  2QJ1 A;  4PA3 A;  5K1P A;  4FLZ A;  2OCC C;  1JA8 A;  3LSS A;  1JVM A;  3SJC C;  4X20 A;  2VWK A;  3VBB A;  4LNU A;  4MTO A;  5FPR A;  3ZRX A;  2QM4 A;  2LW7 A;  1L8D A;  4UFZ A;  5KLV H;  1KB9 F;  2EIM B;  4O4I A;  3QO7 A;  4RWU A;  4UCR A;  3JAK A;  3N2K A;  2DQ0 A;  2ZM6 O;  4JI1 O;  2HKO A;  2YI8 A;  1IBL O;  1FJG O;  2ZE5 A;  3ZHV A;  2QE7 G;  2W0X A;  4L8J A;  3WU2 Z;  1IVS A;  2ZR2 A;  4NR1 A;  3BRC A;  4IYI A;  3B40 A;  4UVC A;  1R73 A;  4LF7 O;  4DR3 B;  1FXV A;  3ZMT A;  4DV1 B;  4DR5 O;  2ZIO A;  2UXB O;  5J2T B;  1AR5 A;  2UUB B;  5AG2 A;  1N0J A;  4GT1 A;  3OAA G;  4ZOL A;  4JI0 B;  3MHS C;  1JPX A;  4O4J B;  4OPA A;  3K9A A;  1HR0 B;  2A7W A;  2FYU H;  2QDO A;  4WFG A;  1Q82 W;  1QU7 A;  2Z0A A;  3K03 A;  3D3Q A;  2Q67 A;  1QLE C;  1ZWI C;  2P4K A;  4TSF G;  3X2Q B;  1XHZ A;  3E83 A;  5E1A C;  1E1R G;  5L3D A;  2Q7G A;  4H13 B;  1BE3 H;  2PY5 A;  2OWO A;  2CE4 A;  1Y6X A;  1BQZ A;  1NJI W;  4JYC A;  3H1L H;  5LA6 A;  4TV8 A;  4DO2 A;  5B5E Z;  4GLX A;  1NVP B;  1SER A;  2NN4 A;  4MTF A;  4N23 A;  5KAI Z;  2BTQ A;  1URF A;  2PF4 E;  2WSS G;  2YXH A;  1FXK C;  3T1H B;  4UB6 Z;  2BOC C;  5EC1 C;  1K8A W;  1M57 C;  3ABT A;  1S76 D;  1NT2 B;  1NH2 D;  2P4V A;  2HR3 A;  3IJ4 A;  5B1B C;  4O2B B;  3H01 A;  4JI5 B;  4JAU A;  2Y4T A;  4CS2 A;  1XDC A;  3ICX A;  3UO3 A;  1H2M A;  2CDY A;  3CS5 A;  3HKB A;  5FPO A;  2ZCE A;  2Q7E A;  4JTA B;  4UVA A;  1VAR A;  2F43 G;  1CP9 A;  4LFC O;  3K08 A;  1WPB A;  2ZIM A;  1CEZ A;  2GSM B;  5FNV B;  4DR4 O;  1XOU A;  3CXH F;  1WB8 A;  3UT5 B;  1FOU A;  1N4C A;  2VRZ A;  3K3W A;  2KSD A;  3E22 B;  4FZ0 A;  4EKW A;  4GKK B;  4FM0 A;  4GKJ O;  3SJQ C;  4Z1M G;  2E5L O;  1VQL V;  1JOY A;  4PHZ A;  3X2Q C;  3FB5 C;  5LOV B;  3ZRS A;  1DTO A;  3JAM N;  1TUE B;  1EM1 A;  4F6R B;  1IZ3 A;  2PZS A;  3OUF A;  5LXT B;  3E86 A;  4DR7 O;  1Q81 W;  4MVQ A;  4JAA A;  4JZG A;  1QBZ A;  2ZT9 B;  3KCX A;  4UV8 A;  4DV5 O;  4B3R B;  2G38 A;  2YI9 A;  2Q6A A;  4LF9 O;  3TK1 A;  1ZX3 A;  1XMQ B;  5E79 Z;  4LF4 O;  2ZD9 A;  2X6B A;  3R66 A;  4X1Y A;  1XUQ A;  4WFE A;  1Q6I A;  1PNK A;  4KFM A;  1SQB H;  2RJZ A;  3C90 A;  1K7D A;  3RWR D;  1AP6 A;  1NU1 H;  4Q6G A;  2M6Y A;  3FAV B;  5LHI A;  1U96 A;  1YJW V;  1JJ2 U;  3LNM B;  4B3M O;  3A0B Z;  4CH5 A;  2VQE B;  1Y67 A;  3OEE G;  4J10 A;  2JEU A;  2WLI A;  2HJF C;  5L3F A;  4DV7 B;  2CTP A;  3W7W A;  4OGQ B;  1HR0 O;  3EFF K;  1MZF A;  5J2U A;  4FFK A;  3M8A A;  4J7J A;  2L6L A;  4JAV A;  3JAL B;  2ZXW C;  4QJF B;  1T5E A;  2YUA A;  3SJB C;  3RYI B;  4BAY A;  5H9C A;  3H1J H;  1AVM A;  2QM8 A;  1QHT A;  3H1I H;  4G28 B;  1NH2 B;  4O4H B;  4IHJ A;  1P49 A;  1FYJ A;  4EB6 A;  2XAH A;  4X88 A;  4PDM A;  1KQS U;  1EN6 A;  1K3E A;  1G4Y B;  1W0K G;  1SZT A;  3JAR B;  3HKD B;  3AG3 B;  3AK3 A;  2KKW A;  5IWA O;  4JGS A;  3CC7 V;  3TXS A;  1SA0 B;  1DLB A;  4ZHQ A;  1TUB B;  4J80 A;  4JI3 O;  4DW0 A;  1XEQ A;  2MW2 B;  4TUY B;  2EIK B;  3F7V C;  3CSX A;  4HZ3 A;  3ZMU A;  1L0N H;  4MW8 A;  3SGI A;  3STL C;  2A06 H;  5CA0 B;  3OGI B;  4DR2 B;  2AW9 A;  1KD1 W;  4FMT A;  3JAW A;  4LFB O;  4WFH A;  1EZJ A;  2WA3 A;  5JQG B;  1M9N A;  2MK3 A;  1WJZ A;  1M56 C;  5KX5 A;  2ZKO A;  1NQT A;  1WN7 A;  3AK2 A;  3S3W A;  3CJH B;  5EZY A;  1M1K W;  3D36 A;  2N05 A;  2Q9L A;  4NXM O;  1S0V A;  1FD9 A;  1GN4 A;  4Z1V A;  3G4S V;  1AP5 A;  4G27 B;  1SQP H;  1AJN A;  1VIB A;  5EK0 A;  1NTM H;  2CAZ C;  4PDL A;  4UCS A;  4MSW C;  4YY3 O;  4J42 A;  2YIB A;  1UFI A;  4P2Z A;  4X66 B;  4DW1 A;  4FM2 A;  3U11 A;  3LSQ A;  2GTS A;  2OIE A;  1Y4M A;  2IW5 A;  3STZ C;  3TET A;  3VQX A;  5JCO C;  3CYO A;  3ZJZ A;  2XAF A;  1XI1 A;  4RQF A;  1I7F A;  1SQG A;  3DXR B;  2H3O A;  5KMG B;  2F1M A;  1XMQ O;  4HYO A;  3B09 A;  4JI6 B;  3CCM V;  1WNS A;  1SKV A;  4CH6 A;  2HVK C;  1S5L Z;  1YHQ V;  4DR1 B;  1GO3 F;  1Q5O A;  4LWS B;  5JVD B;  1VQO V;  3DXR A;  1ZUQ A;  1MSD A;  3BHP A;  3JSL A;  4LFA B;  3CC4 V;  4EFE A;  2PYJ A;  2WLH A;  4L87 A;  4H33 A;  1BT8 A;  1I0H A;  1N36 B;  4HNA B;  1HWY A;  1W59 A;  5IYB O;  2VQE O;  1QVG U;  2Q4P A;  2HHH B;  1S5H C;  2B1G A;  2IM9 A;  5EBL C;  4MS2 A;  2Q5Z A;  4DV7 O;  4LF8 B;  1YDX A;  5B3S B;  1BSM A;  3BVO A;  2IH1 C;  1DF4 A;  2N74 A;  4OX9 B;  1MMM A;  4CC6 A;  5LMN B;  5KHK A;  1OCR B;  3SDL A;  4WF9 V;  4HNA A;  1A32 A;  4LP8 A;  4TV9 B;  2P22 C;  1OCC B;  1W0J G;  4FLX A;  2ATK C;  1KEC A;  2CH7 A;  2ADP A;  4H37 A;  2QKS A;  1WP7 A;  3ABK C;  2EIN C;  2NR5 A;  3L74 H;  4O4L B;  3LUT B;  3ZRW A;  2CUG A;  2UXX A;  2HJD A;  2DN9 A;  3W7X A;  1US6 A;  3JYC A;  2YXL A;  4R8C A;  1S72 V;  2UXD B;  3TCU A;  3OE7 G;  4ZIB A;  4ZKI A;  1WA8 B;  3IAY A;  2Y69 B;  2UXC B;  5B1A C;  3ABU A;  4U3J B;  3WG7 C;  2LO1 A;  4P9P A;  2QGN A;  4I50 B;  4FFB A;  3HKC A;  3L70 H;  1WA8 A;  3ML0 A;  2Y4U A;  2YEV A;  4X89 A;  2ZQM A;  4NYK A;  2P6J A;  3TGU H;  1NI8 A;  5KHH A;  3VQV A;  3ZHS A;  3J81 N;  3K0D A;  5IYC O;  1IX9 A;  4A5U B;  1GAX A;  4Z2W A;  3K04 A;  3MDS A;  2QWR B;  3ABL B;  4QGP A;  1YEW A;  3JAT B;  5KHG A;  4DRX A;  1YI2 V;  3OGC C;  5CA1 B;  4TWK A;  5EBW C;  4QNH B;  2DQ3 A;  3JSN A;  3P32 A;  4JTD B;  1XMO O;  3CCR V;  1I94 O;  2WLN A;  4X62 O;  2QKC A;  3SYC A;  4K0K B;  1HNZ B;  2V1D A;  5EBM C;  2IJK A;  2DYS C;  2LJ2 A;  4BR6 A;  1VQ7 V;  3FB6 C;  4N21 A;  4JI6 O;  3JAT A;  1RM1 B;  2YXY A;  3AG2 B;  2R70 A;  4O2A B;  2GUZ A;  2ZE6 A;  3H1K H;  1YVW A;  4PDR A;  4DUY B;  1TVK A;  1KYO F;  3E8B A;  1MZE A;  1MA1 A;  4JYB A;  4PV1 B;  1BZK A;  1ROP A;  4NTW A;  1E1Q G;  4MVU A;  2JGU A;  3IC9 A;  4ZBM A;  4DK0 A;  2P06 A;  1HNW B;  1N36 O;  1F23 A;  3E8F A;  3PN1 A;  2RCV A;  1N33 B;  2QTO A;  4X20 B;  3ASN C;  3BY6 A;  4LF8 O;  4OPH A;  1IJG A;  3GWK C;  2HP8 A;  3VQY A;  3QF7 A;  3BA8 A;  2N04 A;  4O4I B;  3T1Y B;  3OTO B;  1KUQ A;  2UUC B;  4FK5 C;  3JAK B;  3N2K B;  1YCI A;  2VS0 A;  2ZDI A;  2EZO A;  4LCU C;  5IJ0 A;  2IJI A;  4DUZ B;  2FKX A;  4X64 O;  5L3B A;  1MAB G;  1YTF D;  5GON A;  1R3L C;  1K34 A;  1SQF A;  2JGD A;  1S5J A;  1SQX H;  3KZI Z;  1P4R A;  5GTI Z;  2A0L A;  1GM9 A;  1FFX A;  5GTH Z;  3LDE A;  3EVK A;  3A0H Z;  5TIS Z;  4B7E A;  3ETQ A;  1Q90 D;  5LP6 C;  4ZOL B;  3RN4 A;  3FYI B;  2BCC H;  2JRI A;  1SQV H;  1GN3 A;  4B7K A;  4DV0 O;  4I7Z B;  1HNX B;  1P7B A;  2ILM A;  4LF6 B;  1RM1 C;  3AG2 C;  4RUE A;  3QTC A;  1XIL A;  1Y76 B;  2QWP B;  2UXC O;  4CS3 A;  1VQ9 V;  3JD3 A;  1FXK A;  2A9H A;  3QO5 A;  3RW0 A;  3G71 V;  1J5E B;  3NXS A;  1Y66 A;  4FIP C;  2XUM A;  5LA6 B;  4TV8 B;  1JFF A;  3CWB H;  4BWA A;  2UXN A;  3RBZ A;  2QKA A;  1D5A A;  2BTQ B;  2CK3 G;  4D6T H;  4DXW A;  1Y76 A;  4LH6 A;  1QR9 A;  4B3T O;  5DEC A;  1K5Q A;  4GUN A;  5KUM A;  1D2D A;  2C2A A;  3L9D A;  3APO A;  4MW3 A;  4X1I A;  1Z5V A;  1K33 A;  1YZB A;  4KXR A;  3ZED A;  4X65 B;  5B1N A;  1VMG A;  5IT9 N;  2ETN A;  1GKF A;  4D7S A;  1GM7 A;  1S3J A;  4JZ2 A;  2WLK A;  1FXH A;  1I5Y A;  4JI2 B;  3P3P A;  3KDR A;  1SET A;  2IJH A;  2FB5 A;  3BEH A;  3HKB B;  2KG7 A;  3KG2 A;  4QE7 A;  5KA6 A;  1BCC H;  4H0L B;  1OCO B;  2YIA A;  1OHH G;  3C3T A;  2JVD A;  3CD6 V;  3K9S A;  4MTG A;  1WLE A;  1HNZ O;  2HEP A;  2EIM C;  1R3K C;  3RYC A;  2QR4 A;  1PD3 A;  3ZBH A;  4JI4 B;  4LF5 B;  4CZZ A;  2ZIN A;  3CEI A;  4GYC B;  3RYF A;  1BL8 A;  2XND G;  2B5U A;  5L3C A;  1P84 F;  1H38 A;  1SS3 A;  1BMF G;  4KUM A;  2CTQ A;  5LMU B;  5D5P A;  3ZMZ A;  4IGG A;  3CRR A;  3I55 V;  1IBK O;  1HNW O;  1RPR A;  2IJJ A;  4ZI7 A;  1CPY A;  2IU0 A;  2FTK A;  1YTF B;  3L72 H;  3F5W C;  1V55 B; 
#chains in the Genus database with same CATH homology
 2QKC A;  4JYY A;  2CE4 A;  1QNM A;  4YIP A;  1XUQ A;  4BR6 A;  3AK2 A;  1AP6 A;  1IXB A;  4YIO A;  3QVN A;  3LSU A;  2QKA A;  1IDS A;  2ADP A;  1MA1 A;  1JR9 A;  4GUN A;  1KKC A;  3BFR A;  1GN4 A;  1AP5 A;  3KKY A;  3IC9 A;  1PL4 A;  1JA8 A;  1Y67 A;  1MNG A;  3DC6 A;  4JZ2 A;  4E4E A;  1XDC A;  3TJT A;  2RCV A;  4FFK A;  2CDY A;  3KDR A;  1VAR A;  2GDS A;  1EN5 A;  1GN2 A;  3C3T A;  3K9S A;  1AVM A;  3AK1 A;  1WB7 A;  5A9G A;  1ZTE A;  3C3S A;  1WB8 A;  1ZLZ A;  1EN6 A;  1GN6 A;  1AR4 A;  3AK3 A;  3DC5 A;  4C7U A;  3CEI A;  1AR5 A;  1BS3 A;  1ZSP A;  1ZUQ A;  5AG2 A;  1N0J A;  1IX9 A;  1MSD A;  3EVK A;  3MDS A;  1BT8 A;  4F6E A;  1I0H A;  3OT7 A;  1I08 A;  1D5N A;  1EM1 A;  3RN4 A;  1B06 A;  1GN3 A;  1EN4 A;  1N0N A;  1SZX A;  4X9Q A;  1PM9 A;  2P4K A;  1LUW A;  2ADQ B;  4JZG A;  1BSM A;  1LUV A;  1XIL A;  1XRE A;  1VEW A;  1MMM A;  2AW9 A;  1P7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...