1MNGA

Structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
203
structure length
198
Chain Sequence
b'PYPFKLPDLGYPYEALEPHIDAKTMEIHQKHHGAVTNLNAALEKYPYLHGVEVEVLLRHLAALPQDIQTAVRNNGGGHLNSLFWRLLTPGGAKEPVGELKKAIDEQFGGFQALKEKLTQAAMGRFGSGWAWLVKDPFGKLHVLSTPNQDNPVMEGFTPIVGIVWEAYYLKYQNRRADYLQAIWNVLNWDVAEEFFKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Structure-function in Escherichia coli iron superoxide dismutase: comparisons with the manganese enzyme from Thermus thermophilus.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase(superoxide acceptor)
total genus 73
structure length 198
sequence length 203
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1994-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1mngA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1mngA02
4FFKA 1P7GA 2P4KA 1GN4A 1BSMA 1D5NA 1VEWA 1ZTEA 3CEIA 1EN5A 3IC9A 1AP5A 4YIPA 1GN3A 1I08A 3AK2A 3LSUA 1MNGA 1Y67A 4X9QA 1LUVA 3DC5A 1BT8A 1IXBA 4F6EA 1LUWA 1I0HA 3MDSA 1JR9A 1MMMA 3RN4A 1GN2A 4JZGA 1AP6A 3C3TA 1PL4A 1JA8A 1MSDA 2QKAA 1ZLZA 4YIOA 3AK3A 1N0NA 1XUQA 1SZXA 5A9GA 3OT7A 3TJTA 1WB7A 1GN6A 1AR5A 1XILA 1IDSA 1VARA 3QVNA 3BFRA 1BS3A 1ZSPA 3KKYA 1EN6A 1XDCA 1AVMA 2GDSA 3DC6A 4GUNA 1MA1A 4JZ2A 3EVKA 2CDYA 1EM1A 2RCVA 2CE4A 2QKCA 5AG2A 4JYYA 3AK1A 1QNMA 4C7UA 3K9SA 3C3SA 4E4EA 1B06A 1KKCA 1N0JA 1ZUQA 2ADPA 1PM9A 2ADQB 1EN4A 1XREA 4BR6A 2AW9A 1WB8A 1IX9A 1AR4A
chains in the Genus database with same CATH superfamily
1R1BA 4LCUC 5KHGA 5KX5B 3SYPA 3FX7A 5IJ0A 3R66A 2VQEB 1HNXO 1ZAUA 1M56C 3FB8C 1N34O 3IC9A 3LNMB 1O9GA 4DV1O 2QEXV 2WLKA 1GN3A 1VQMV 2K9PA 3OAAG 3W7TA 1BE3H 1QR9A 1LUWA 4J11A 1VF5B 1SETA 4MVOA 2PY5A 2WLMA 1JR9A 5BY1A 2LFSA 3G4SV 4PDMA 1HR0O 3ABMC 3CRQA 3QO7A 2EIJB 1YIJV 5IT9N 4DV3O 3ABKC 4FM0A 3K59A 2IJHA 3RYCA 2A06H 3CS5A 2Q68A 4R8CA 4YY3O 1QR8A 2EX3A 3PN1A 2Y48A 5CA3A 5IJ9B 3OEHG 3BAAA 2JRIA 2AHZA 3SR2C 3ASNB 4YJ3B 1G1XB 4O2AA 3CRMA 1L0LH 1VQ9V 3G80A 1MA1A 3OMIB 3SPJA 3J81N 1KYOF 4JI3O 2WAMA 1VF6A 5EBWC 5CBHA 2QKCA 4NB5A 5AG2A 3AK1A 4JI8O 3FYIB 5LHHA 2PZSA 1HNXB 3CC2V 1TUBA 1YTFD 5EIBC 4DRXA 1N34B 1ZUQA 2JEUA 2ZDIC 1HNWB 2E74B 4DV1B 3IC7A 3JALA 1HDJA 2EULA 1DGSA 3SPCA 1NVPB 4JI5O 3SJQC 3F5TA 2FMLA 3OMNB 2FTKA 2BSKB 1EZJA 1HR0B 1H8HG 1EN5A 3GWOA 2GTSA 4UV9A 3UO2A 4UCSA 1AP5A 2W0XA 1N33O 5CMUA 3P30A 1Y67A 4F6RB 5IYCO 4XBFA 2YC0A 3HKEB 1I0HA 2P5OA 1MZEA 5B66Z 3HKBB 3A0BZ 2Q7GA 2Q6AA 4FLXA 1DTOA 1LR1A 4JZGA 1GM7A 2HVJC 5LOVB 4IHJB 1SQPH 2WA4A 4FFBB 3UT5B 2UXNA 4NXMO 3RGBA 5JVDA 1KBHA 3N2KA 4HBNA 4OX9O 2FB5A 3BRCA 5KHKA 4AQYB 4DR7O 1SZXA 3D3IA 3SJCC 1KD1W 3Q4HA 4J42A 3OW2U 1RM1B 3U11A 5BR8B 1NTKH 2ZM6O 2RDCA 1WP8A 4ZHQB 3U10A 5JJNB 4PDVA 2Z0AA 3BY6A 3K06A 1JJOA 3AG1B 4TSFG 2WPDG 2UXDB 1SS3A 2KB1A 3VQVA 4G2KA 3K3WA 2EZOA 2XAJA 2OYQA 1WPBA 4GX5A 3CCMV 4GKJB 4DR1O 1WNSA 5EZYB 4EB6B 4Z2WA 1QNMA 5GONA 4D7TA 5DM6V 2DW4A 4UV8A 1AJPA 2Q67A 3D36A 2JDIG 1YXBA 4RO2A 1D5AA 3K08A 1M57B 3JYCA 1VQKV 2BOBC 1N33B 2X6CA 1XREA 2AW9A 2L35A 4X1YA 5J9PC 3CCSV 4GCZA 3OGIB 1JJ2U 4CH4A 3CE2A 2DQ3A 2RQ6A 1R6KA 4GT1A 3FB5C 1GMGA 4LF9O 1Y74A 4NXMB 3KDRA 3K5OA 1PNMA 1XMQB 2Q8VA 1W2BU 4OX9B 3HKCB 1N32O 1GKFA 4DR7B 3ETEA 3RFRA 4Q20A 4WBNB 3DSQA 3IGAC 2HJDA 1BT8A 3HKDA 4JV5O 5LL6Y 2ZM6B 2P7TC 3QTCA 1DK1A 5B3SB 4O2BB 3LUTB 1WPXA 3ZIAG 5H6QA 2EINB 4DR1B 2B9ZA 3JASA 4MT8A 4UCOA 1B3QA 3M99B 1H2GA 3AG3C 2LW1A 4TWKA 2WLNA 3TXQA 1CEZA 2Z3YA 1M4UA 1YI2V 4MTFA 3HPLC 1DLBA 3LNNA 1M5IA 4P2ZA 1FJGO 3K9SA 5EK0A 1Q6UA 2GUZA 2QM4A 3ZHSA 2YS8A 5IY5C 1K4CC 1R6TA 2H3OA 3ZMUA 4WFFA 3CHXA 4FJCC 1E1RG 1PP9H 3JAWA 3VQYA 2ZKOA 2ZR3A 3T1HO 1IVSA 2JVDA 5EYPB 4JV5B 4G28B 3W7UA 4MSWC 4EFBA 4B7KA 3SPHA 3T1YO 1F23A 1V55B 1VEWA 3APOA 4UCRA 1QVFU 4K8XA 2AZ2A 4L87A 2A3QA 1JFFA 2HFEC 5F2VO 4X66B 1XHXA 4I9WA 3IJ4A 3OUFA 4I55B 3R65A 3AK2A 2DMXA 2Q7HA 1LUVA 3AG2B 5C8YB 5LP6A 4WCEV 2H94A 3CX5F 5BXZA 1TUEB 4JPRA 2HR3A 3NR7A 4ZI7B 5CB4B 4MVSA 2QTSA 5DEDA 1YVWA 4DV7O 4TV9A 1ZLZA 4DV5B 4N23A 4FLUA 2CAZC 5LXTA 4IIJB 3D3QA 4DR3O 2CGOA 1WJZA 4ABMA 4D7SA 1U96A 3JARB 1BHBA 4PDLA 4LH6A 1BS3A 2Y69B 2IJKA 4FM2A 1OZ0A 1YDXA 1OHHG 1XDCA 1MABG 5JQGB 1SQGA 2QM7A 2N74A 4OGQB 2DN9A 4QPKA 1NKDA 5KAIZ 1F4MA 1KQSU 4W4LA 4BWAA 5LYJA 3OTFA 3E83A 1M9NA 3H9VA 4IL6Z 3B77A 1AILA 4JTDB 1ZWIC 5JJJB 4P9PA 4JI2B 1ENVA 4DR4O 1YSCA 1FXKC 4GLXA 1V54B 2NLJC 3FKSG 1QQCA 3JAMN 4MVUA 1QLEB 4D6TH 2JEXA 3ZRWA 2BE3A 5A2QN 3RYCB 4UFZA 3RYIB 3JD2A 2ZCEA 5KHIA 1YZBA 1IBKO 1I08A 4DR3B 1K73W 1XQ8A 2XTAA 2F4VB 4NKGB 4DR2O 3BHPA 1B04A 3QO8A 1IXMA 2ZNIA 4IYIA 2E5LB 4TV8B 3SYQA 2HG5C 3W7WA 2ODMA 2YI8A 2KQXA 1N0NA 4HNAB 4PA3A 4CS2A 1CP9A 1XL6A 1COWG 3E8GA 4I7ZB 4F4LA 4FM1A 5LGNA 2HHHO 2ZR2A 5JCOA 4UB8Z 1ZSPA 4X62O 4JAAA 1L0NH 5IYDO 1PV0A 4DUZB 2GHYA 1R3LC 4DR4B 2UXCO 1X4TA 1RPRA 1I94B 2IU0A 3X2QB 2JGDB 4TT3G 5IE9A 3C3SA 1VQOV 2LQTA 3ZN1A 2QGNA 1MZFA 2IH3C 3T4DA 1K92A 1U97A 3HB3B 2X6BA 3ABLB 4U3FH 3RYHA 1PD3A 4DR6B 1UFIA 2ZE7A 2R70A 1N4CA 4FZ1A 1PM9A 1IBKB 2V7QG 2ARHA 2YEVA 5JVDB 3OGCC 1WAZA 3ZHTA 1L8DA 1VQPV 2UU9B 4JI1O 4K0KO 2CTQA 1FD9A 1F4NA 3FD9A 5B1OA 4J7ZA 1EFRG 4B3SO 4UUJC 1NTZH 1ORQC 3STLC 3LSUA 1Q81W 4HZ3A 4H0LB 2LGWA 1H8EG 4QNHB 1CXZB 2XAFA 3ASOB 4TUYB 4QE7A 3B2EE 4NYKA 3CYOA 4H44B 4JYBA 4X62B 1TA8A 1YHQV 4LNUB 3ZHUA 4YJ2A 1GK9A 1TVKB 5LA6A 3ETDA 1V55C 2UXCB 3BABA 4LFBB 4O4IA 5CBGA 2QSAA 5GONB 1RP3B 3G67A 1BQ0A 3JSNA 1IDSA 3OTOO 1VARA 4WFAV 4YXWG 5LMUB 1JQ0A 4UB6Z 5B1NA 2ZE6A 1VQ4V 1KB9F 2ZDIA 1YITV 4B3RO 3TGUH 2BCCH 5FL7G 1EBOA 1PNKA 2QWNB 2EIKC 4YHHB 4X1YB 2HEPA 1XNQO 3G6BA 2Y0PA 5J2UA 1S76D 4MTGA 4X64B 1QBZA 4Q6GA 3WB1A 1Y74B 2DYRB 4LF4B 4JI1B 4AI8A 3ML0A 2IU3A 3CWBH 3ZRXA 2ADPA 4JAVA 5B1BC 4RAIA 1OCOB 3MD0A 3H1LH 4BR6A 1WB8A 4DV4O 4JI7O 1YJ9V 2PYJA 1QVGU 2YXHA 2ZINA 4KUMA 3ETGA 2P4KA 2F23A 2ZXWC 3FFQA 3OMAB 4P30A 5TISZ 4H33A 2CH7A 3JATA 1URFA 2VQFO 3BA9A 4I50A 4MW3A 5KMGA 2DWDC 4GX1A 1EZVH 3RVYA 2B1IA 3WG7C 5CA0B 4JI0O 2Y4TA 4DUYO 4NR1A 3CC7V 1DF5A 2YI9A 3K0GA 1OCCC 3E86A 1CPYA 1PPJH 1MMMA 2CUGA 2JJ1G 3OTOB 2P90A 3HR0A 4PA9A 1FAFA 5EBMC 1M1KW 3CSXA 1PL4A 3E89A 1Y66A 4DV3B 3H1KH 4B3RB 1NZ6A 1Q6HA 4JTAB 1BL8A 1VQNV 3B8NA 3OT7A 4HAMA 3E8HA 1XNQB 4MVQA 4YY3B 5BMVA 1NR1A 1XILA 2C2AA 4IT5A 1TGOA 3ABUA 4B7EA 5L3FA 1NQTA 4PDRA 5ITZA 2PI5A 2Q0AA 3SGIA 1VF7A 4QGPA 3LDDA 2E75B 1EN6A 3E22A 1NVPD 5LGUA 3CC4V 1G4YB 4ZKIA 4PA6A 1H2MA 1R3JC 2CDYA 4R6ZA 4DV4B 2ZNJA 3VOUA 4JI7B 2CTWA 4JI3B 2E3CA 1BQZA 3CP1A 2A79B 5KHHA 1JFFB 4JI8B 1VP7A 5E79Z 4W4KA 2B5UA 1A32A 4KL1A 3ZJZA 4J9ZB 2UUAO 2M6YA 2NR5A 2OCCB 3A2FA 2P4VA 3JAKA 1Y6XA 5LP6B 3I56V 3CD6V 1YEWA 3DGEA 4JI5B 2EIMB 3K9AA 1GN4A 1ZTEA 5GW7A 3DTUB 5KX5A 2XHBA 1HNZO 2JIZG 1AI5A 1KECA 2DOSA 4R50A 2ZD9A 3X2QC 2GTAA 1QHTA 3CRCA 5CA1B 4X1IA 4UCUA 4CS4A 1US6A 2QE7G 3RN4A 2XUMA 1WA8B 3PJSK 1K9MW 5D5QA 1WN7A 4I4TA 2EZPA 2XT9A 3FAVB 2AGAA 4GX2A 2WLIA 5E1AC 2PI4A 3VBBA 4RWUA 1WLEA 4J41A 5EC1C 1QLNA 1K97A 2Q9LA 2DYSB 1VQ6V 1K34A 1NR7A 2LO1A 2EILB 2QR4A 4X8AA 4N21A 1Y76A 3ZEDA 5HFLA 4CC5A 3A8TA 4L8JA 2OIGA 1ROPA 5IJ9A 5KAFZ 1PNLA 4LF8O 4LF6O 1SQFA 3F5WC 5L3DA 2LFRA 2UUAB 4YJ3A 2QWPB 3EVKA 2Q73A 2AZ0A 2RCVA 4LWSB 4MTXA 5J2TB 4B3TO 2ILMA 3O65A 4NTXA 3SYOA 3K79A 3P3NA 3QF7A 5EC2C 5DN6G 2OTJV 3L72H 2R72A 2ZIOA 3CCQV 4CS3A 2MK3A 1PKXA 2HLDG 2EIJC 4KHPO 4PV1B 1AR4A 4K35A 4CZZA 1UPGA 3VQWA 4X1KB 1R73A 3THOA 2W6IG 3DXRB 4Z1MG 2YXYA 1F7YA 2BSKA 3ABTA 1LNQA 2VWKA 4OPHA 5KA6A 4FPPA 4ICGA 4ZBMA 3CCRV 1H2NA 2YIBD 1IBMO 4LF9B 3ZMSA 1SQVH 3K58A 4U3JA 1GM8A 4X88A 3RW0A 1R3KC 1XMOO 4B3MO 4NXNO 1N32B 1SA0A 4J80A 4F6EA 5JJEB 2CTRA 2OTLV 2UUBO 3ASNC 1KC8W 4F6RA 1S3JA 4J7KA 5L3EA 3LSSA 2PGGA 1THZA 5LOVA 1H2KA 1FFXA 4FFBA 3UT5A 2Y0IA 1SRYA 2WLHA 3H1HH 1BGYH 2A0LA 3N2GA 3UQ8A 3IAYA 1M56B 5LGTA 2L6LA 1GN6A 3ZBHA 3QVNA 4CH6A 2NN4A 1Q43A 3B4SA 4ZHQA 4JI4O 1FXKA 1IZ3A 1G6UA 2EJ7A 4IYHA 3P3PA 1SC5B 4CBCA 4JI6O 4DV6O 3RYFA 4J7JA 2LP7A 4LFAO 2WWWA 3ABMB 3L74H 1ZL8A 1QCEA 3SDLA 3T2MA 3ABKB 1VQ8V 2IJIA 1IBLO 4MS2A 3APQA 1FYJA 2IH1C 3QO5A 1FJGB 3CJHB 5IYZB 3OE7G 5JH7A 1AB3A 5EZYA 4E4EA 4G27B 3UM7A 4XDJA 2Z5UA 4ZOLA 3UKMA 2JGUA 4U7OA 1IBMB 3TK1A 1SERA 2M7WA 2KKWA 1IX9A 4NXNB 3CMEV 5IJ0B 3T1HB 5IYBO 3P32A 1FKAO 1XI1A 4JYAO 4YJ2B 3T1YB 3ZHQA 1RM1C 3TXSA 3MHSC 4BW9A 4YIPA 5B1AB 3K5NA 4JF3A 2R9AA 2QWQB 2JS5A 1YJNV 4X9QA 3HKCA 4UCTA 3DC5A 3ZMZA 1KMIZ 3AG1C 4CH3A 4WBNA 3L75H 2OCCC 3LSQA 4I5SA 2D2CB 2FKXA 4DK1A 2A9HA 2JK5C 2QKAA 3ZS8C 4LC1A 4DV7B 4WFHA 2EIMC 4DV6B 2P6JA 2UUCO 3LDCA 2QKSA 4O2BA 5J2UB 1KUQA 1ZX3A 4KP4A 4O4LA 1IBLB 1W59A 1NH2B 4DYLA 1JX9A 4RUFA 4DV2O 1XOUA 4O4HA 3ZN0A 1M57C 1MSWD 1JOYA 4O2AB 3KKYA 2ITDC 3GWKC 2QDOA 3D8CA 1S5JA 5GTHZ 4AHCA 1GO3F 2ZE5A 3RWRD 2BTQA 5LMNO 1N36O 2CH7B 3JATB 3JD3A 2Q7EA 1TUBB 2WLLA 5C93A 4DRXB 4I50B 1UJWB 3G71V 3OR6C 4JYAB 1NH2D 3JALB 2V4DA 1OCRB 1S5HC 1S72V 2P22C 1HWYA 2W6JG 1SQQH 3CCJV 3N27A 3E35A 2VQEO 3RVZA 4QPJA 2OWOA 1P84F 4DK0A 2AXTZ 5B3SC 1DF4A 3ETQA 2XAQA 2OT5A 3SYAA 1BSMA 1OCZB 4R7CA 1FS0G 1MOFA 2Q4PA 2YIAA 4PHZA 2EINC 3W7SA 2GSMB 3M7MX 4FLZA 3B8MA 3IFXA 2QA4V 1B6QA 3ZHVA 5BMVB 4FLYA 2UUCB 2WA3A 4I55A 4BAYA 1IXBA 5ITZB 3OM3B 3MDSA 3CMAV 5C8YA 3K5MA 2R9IA 4DR2B 1H2LA 3N2KB 1KP2A 3OD4A 2ZT9B 3EHBB 4MVZA 3SYCA 1JA8A 4E2LA 3T4ZA 2Q0OC 2IW5A 4YIOA 3AK3A 2RNBA 3Q4HB 2EBOA 5A9GA 2BTOA 4DW0A 4JAUA 4X65O 1RSOA 5LMNB 3JARA 3G6EV 2HHHB 1N8RW 3C90A 3UO3A 4X20A 1RPOA 2F43G 1J95A 3SPGA 4XDKA 2GDSA 3ZX6A 4BIZA 3ZHRA 5KUKA 4I0XA 4EEQA 4MW8A 1Y4MA 4LBEC 5JQGA 3BVOA 3CCEV 5FNVA 1JNBA 2P06A 2JJ2G 3WU2Z 1JMKC 4TQFA 3JSLA 5LHGA 3AG2C 3CB2A 1HNWO 4CH5A 4ZIBA 2PTMA 4JYCA 1SF9A 4TOIA 4RQEA 2YDEA 4X1IB 2PYLA 1H38A 3ZMVA 3H01A 1NJIW 1FOUA 4I4TB 4FFKA 1P7GA 3AG3B 4PI0A 1P4RA 2WLIB 4K0KB 2X6AA 3RYIA 2WLJA 1OJHA 2DQ0A 4AILC 3CXCU 1AI6A 2KG7A 4B3SB 4WFGA 4NTWA 3HKDB 2F95B 5IY5B 1YTFB 1KU9A 1Y76B 2Q5ZA 2Y69C 1K4DC 4HYOA 4IGGA 4O4JA 4PELA 1AJNA 4X65B 5H9CA 5FLXN 1G8MA 4QE9A 1V9PA 4TV8A 4AQYO 4KFMA 4LF7O 3QG5A 3A0RA 2DWEC 1X59A 3B40A 3E8FA 1R6NA 2XOKG 3TJTA 5BR8O 4HNAA 4NTYA 3JASB 4BIOA 4B08A 4MVRA 1P7BA 5KLVH 5B1AC 4TQDA 1FPOA 3KG2A 1V54C 2UXDO 1S77D 2QWOB 1R3IC 1QLEC 4DV0O 4PD4F 2HJFC 1PL0A 1Z2GA 2JS3A 1Q82W 5KA5A 1AVMA 3S3WA 4GKJO 4FIPC 3BCCH 4J10A 3ZRVA 4UCVA 2GUZB 3K0DA 3BPZA 2HP8A 5DECA 1BZKA 4MVMA 4QJFB 2HVKC 2JGDA 5FPOA 2V1DA 1B06A 2H8PC 5IWAO 4U3JB 5L3CA 3SJAC 1SA0B 3JAWB 4GX0A 3KCYA 3F7YC 2FYUH 1SQXH 3UCSC 5BZBA 3VQXA 1K3EA 4LFCO 1VF6C 1XHZA 1FFXB 4FLTA 1L1FA 3T1CA 5D5PA 1SQBH 4DR5O 1XMQO 3N2GB 2D3OW 5LHIA 4LF7B 1NI8A 2GV9A 2VQFB 3I55V 5H6RA 4A5UB 1GH6A 4K3AA 4JI0B 4DUYB 1K5SA 1K33A 4DO2A 1HW7A 1FXKB 4BW5A 1OCRC 3CCUV 2HKOA 2E76B 2YICA 1AP6A 1MG1A 4TV9B 2R9RB 3RYFB 4TUYA 3SPIA 4WF9V 1MSDA 3BEHA 4XDLA 1ZL8B 2W0FC 1VQ7V 5LXTB 2YSUB 4DV0B 3RT3C 1OCZC 3LDEA 4LNUA 4BIUA 1TVKA 2DJVA 2UXXA 1I7FA 3ABLC 5JH7B 3TCUA 4RQFA 1OV9A 2RMKB 4EFEA 4JGSA 4ZOLB 1T5EA 2ATKC 3WFVA 3FYEB 5IWAB 1NS1A 5K1XA 3DC6A 4K8ZA 2ZIMA 3WB2A 5LYJB 4GYCB 3JCUZ 1BHAA 2A7WA 2XAHA 1Q7YW 4LH7A 1K5QA 4C7UA 4LFCB 3H1JH 1NT2B 2QJ1A 4DR5B 3J80N 4UVCA 4Z1VA 1YF2A 4QIWF 1Q8IA 3ASOC 2QM8A 3AG7A 1XEQA 3KCXA 3FB7C 4FMTA 3ZRWB 1H2SB 2IBZH 3U0ZA 1F51A 2ZE8A 5H2FZ 1D5NA 3I5DA 4U7NA 4X66O 3JD4A 4LF5O 2XASA 1HNZB 1GAXA 2LGQA 3KZIZ 2KSDA 1E79G 4FLWA 4RUEA 2QTOA 1AR1B 2IJJA 4O4LB 3CRRA 2XNDG 1MNGA 3D36C 2IM9A 4I9QA 2NNUA 4O4HB 5CA0A 1GN2A 1E1QG 1BMFG 3C3TA 1M93A 4OPAA 4EKWA 4WFBV 1GM9A 1VMGA 2LW7A 5FPRA 5GTIZ 4DV5O 3AG4B 1XBLA 3ZMTA 3WB0A 3L73H 3OFNG 2BTQB 4KXRA 2DYRC 4H13B 1WB7A 2WLLB 1K7DA 4DW1A 4PA4A 2GBOA 3HKEA 3HKBA 1OCOC 2ETNA 4LF8B 4LF6B 4IHJA 4ASUG 3CXHF 2Q69A 1XNRO 4PI2A 2YIDA 4MTOA 3S3XA 2OCHA 3MAQA 3ZRSA 5CN0A 1EM1A 4UXNA 2CE4A 3GVMA 1GRJA 4J9YB 3OR7C 4B3TB 3RYHB 2CTPA 4UVAA 1Q86W 5B5EZ 4JI2O 1D2DA 2O57A 4LF5B 1GTOA 1N0JA 3JD0A 1XL4A 2F66C 2AHYA 2YEVB 1AJQA 3NXSA 4KHPB 1I5XA 1IJGA 2VRZA 2EIKB 1NBMG 1RFYA 3GB7C 1YJWV 3E2EA 3CEIA 3CCLV 4EB6A 1IURA 5KHJA 4X89A 1Q6IA 1HP8A 2G38A 1AROP 3E8BA 2UXBO 1NU1H 4WFEA 1RSOB 2F4VO 1XMOB 4B3MB 4FLVA 1W0KG 5CA1A 2UUBB 5B1BB 2E5LO 3ZCCA 4X20B 3JD1A 1O9HA 1WA8A 2BOCC 4I0XB 3FAVA 5LA6B 2QWRB 5FNVB 4O4IB 1XNRB 2ZXWB 3CPWU 4JTCB 2OIEA 3K04A 1AR5A 4JASA 1WP7A 5LP6C 3WG7B 3FB6C 3K57A 1FXVA 2P67A 3SJBC 5L3BA 2FL4A 1Q90D 4JI4B 1OCCB 4DUZO 5K1PA 1W0JG 4JI6B 3EXAA 3OEEG 1I94O 4LFAB 2ZQMA 1SESA 4DXWA 2WSSG 3L70H 1J5EO 5KUMA 5H5NA 2ITCC 3A0HZ 2N05A 2VWJA 1S5LZ 3L71H 1VQLV 1K8AW 4LWSA 2YIBA 5J2TA 2VS0A 4NVPA 2PF4E 3B09A 2KG7B 4DR6O 1KKCA 3J7AU 1Z5WA 5EIBD 2X7RB 4O4JB 1BCCH 1EN4A 1AI4A 2YUAA 2UXBB 4GKKO 4P9OA 1QU7A 2UU9O 5CBFA 1VQ5V 2B1GA 4X1KA 2RN9A 3DXRA 2DYSC 5KMGB 2EILC 2LJ2A 1KP3A 4GZRB 3STZC 3F7VC 2F1MA 3K03A 1H5WA 1SZTA 1SKVA 3W7XA 1P49A 2RJZA 5EYPA 3L9DA 1JVMA 3JCZA 3EFFK 2F93B 1NTMH 2DE0X 1Q5OA 3BA8A 5L3GA 3O9OA 1KKDA 3CCVV 4H37A 3OUSA 1XUQA 4LFBO 2N04A 1FFTB 1TAEA 1I5YA 2MW2B 4PA7A 1J5EB 2K1EA 5LMUO 4OXSA 4UVBA 5LBQA 3BFRA 1M90W 4DV2B 3E22B 3H1IH 5EBLC 4FZ0A 1S0VA 4FK5C 4YHHO 4ZI7A 5CB4A 3RBZA 2YXLA 5IDJA 4GUNA 1JCHA 3TETA 2XAGA 4JZ2A 4LP8A 4IIJA 4X64O 3AG4C 4GKKB 4JYYA 1AI7A 4LF4O 1YCIA 1JPXA 1Z5VA 1Q3EA 1VIBA 4FVMA 1FXHA 4CC6A 1N36B 2EJRA 3QNEA 3MHHC 3CJHA 5HFMA 5JWPA 5IYZA 2PUSA 3JAKB 3K5LA 2Y4UA 3M8AA 4PJ0Z 2CGNA 2X0LA 5JCOC 3CRAA 4LR3A 2ADQB 3ICXA 2CK3G 3AEIA
chains in the Genus database with same CATH topology
4FFKA 1P7GA 2P4KA 1GN4A 1BSMA 1D5NA 1VEWA 1ZTEA 3CEIA 1EN5A 3KDRA 3IC9A 1AP5A 4YIPA 1GN3A 1I08A 3AK2A 3LSUA 1MNGA 1Y67A 4X9QA 1LUVA 3DC5A 1BT8A 1IXBA 4F6EA 1LUWA 1I0HA 3MDSA 1JR9A 1MMMA 3RN4A 1GN2A 4JZGA 1AP6A 3C3TA 1PL4A 1JA8A 1MSDA 2QKAA 1ZLZA 4YIOA 3AK3A 1N0NA 1XUQA 1SZXA 5A9GA 3OT7A 3TJTA 1WB7A 1GN6A 1AR5A 1XILA 1IDSA 1VARA 3QVNA 3BFRA 1BS3A 1ZSPA 3KKYA 1EN6A 1XDCA 1AVMA 2GDSA 3DC6A 4GUNA 1MA1A 4JZ2A 3EVKA 2CDYA 1EM1A 2RCVA 2CE4A 2QKCA 5AG2A 4JYYA 3AK1A 1QNMA 4C7UA 3K9SA 3C3SA 4E4EA 1B06A 1KKCA 1N0JA 1ZUQA 2ADPA 1PM9A 2ADQB 1EN4A 1XREA 4BR6A 2AW9A 1WB8A 1IX9A 1AR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FFK A;  1P7G A;  2P4K A;  1GN4 A;  1BSM A;  1D5N A;  1VEW A;  1ZTE A;  3CEI A;  1EN5 A;  3IC9 A;  1AP5 A;  4YIP A;  1GN3 A;  1I08 A;  3AK2 A;  3LSU A;  1MNG A;  1Y67 A;  4X9Q A;  1LUV A;  3DC5 A;  1BT8 A;  1IXB A;  4F6E A;  1LUW A;  1I0H A;  3MDS A;  1JR9 A;  1MMM A;  3RN4 A;  1GN2 A;  4JZG A;  1AP6 A;  3C3T A;  1PL4 A;  1JA8 A;  1MSD A;  2QKA A;  1ZLZ A;  4YIO A;  3AK3 A;  1N0N A;  1XUQ A;  1SZX A;  5A9G A;  3OT7 A;  3TJT A;  1WB7 A;  1GN6 A;  1AR5 A;  1XIL A;  1IDS A;  1VAR A;  3QVN A;  3BFR A;  1BS3 A;  1ZSP A;  3KKY A;  1EN6 A;  1XDC A;  1AVM A;  2GDS A;  3DC6 A;  4GUN A;  1MA1 A;  4JZ2 A;  3EVK A;  2CDY A;  1EM1 A;  2RCV A;  2CE4 A;  2QKC A;  5AG2 A;  4JYY A;  3AK1 A;  1QNM A;  4C7U A;  3K9S A;  3C3S A;  4E4E A;  1B06 A;  1KKC A;  1N0J A;  1ZUQ A;  2ADP A;  1PM9 A;  2ADQ B;  1EN4 A;  1XRE A;  4BR6 A;  2AW9 A;  1WB8 A;  1IX9 A;  1AR4 A; 
#chains in the Genus database with same CATH topology
 1R1B A;  4LCU C;  5KHG A;  5KX5 B;  3SYP A;  3FX7 A;  5IJ0 A;  3R66 A;  2VQE B;  1HNX O;  1ZAU A;  1M56 C;  3FB8 C;  1N34 O;  3IC9 A;  3LNM B;  1O9G A;  4DV1 O;  2QEX V;  2WLK A;  1GN3 A;  1VQM V;  2K9P A;  3OAA G;  3W7T A;  1BE3 H;  1QR9 A;  1LUW A;  4J11 A;  1VF5 B;  1SET A;  4MVO A;  2PY5 A;  2WLM A;  1JR9 A;  5BY1 A;  2LFS A;  3G4S V;  4PDM A;  1HR0 O;  3ABM C;  3CRQ A;  3QO7 A;  2EIJ B;  1YIJ V;  5IT9 N;  4DV3 O;  3ABK C;  4FM0 A;  3K59 A;  2IJH A;  3RYC A;  2A06 H;  3CS5 A;  2Q68 A;  4R8C A;  4YY3 O;  1QR8 A;  2EX3 A;  3PN1 A;  2Y48 A;  5CA3 A;  5IJ9 B;  3OEH G;  3BAA A;  2JRI A;  2AHZ A;  3SR2 C;  3ASN B;  4YJ3 B;  1G1X B;  4O2A A;  3CRM A;  1L0L H;  1VQ9 V;  3G80 A;  1MA1 A;  3OMI B;  3SPJ A;  3J81 N;  1KYO F;  4JI3 O;  2WAM A;  1VF6 A;  5EBW C;  5CBH A;  2QKC A;  4NB5 A;  5AG2 A;  3AK1 A;  4JI8 O;  3FYI B;  5LHH A;  2PZS A;  1HNX B;  3CC2 V;  1TUB A;  1YTF D;  5EIB C;  4DRX A;  1N34 B;  1ZUQ A;  2JEU A;  2ZDI C;  1HNW B;  2E74 B;  4DV1 B;  3IC7 A;  3JAL A;  1HDJ A;  2EUL A;  1DGS A;  3SPC A;  1NVP B;  4JI5 O;  3SJQ C;  3F5T A;  2FML A;  3OMN B;  2FTK A;  2BSK B;  1EZJ A;  1HR0 B;  1H8H G;  1EN5 A;  3GWO A;  2GTS A;  4UV9 A;  3UO2 A;  4UCS A;  1AP5 A;  2W0X A;  1N33 O;  5CMU A;  3P30 A;  1Y67 A;  4F6R B;  5IYC O;  4XBF A;  2YC0 A;  3HKE B;  1I0H A;  2P5O A;  1MZE A;  5B66 Z;  3HKB B;  3A0B Z;  2Q7G A;  2Q6A A;  4FLX A;  1DTO A;  1LR1 A;  4JZG A;  1GM7 A;  2HVJ C;  5LOV B;  4IHJ B;  1SQP H;  2WA4 A;  4FFB B;  3UT5 B;  2UXN A;  4NXM O;  3RGB A;  5JVD A;  1KBH A;  3N2K A;  4HBN A;  4OX9 O;  2FB5 A;  3BRC A;  5KHK A;  4AQY B;  4DR7 O;  1SZX A;  3D3I A;  3SJC C;  1KD1 W;  3Q4H A;  4J42 A;  3OW2 U;  1RM1 B;  3U11 A;  5BR8 B;  1NTK H;  2ZM6 O;  2RDC A;  1WP8 A;  4ZHQ B;  3U10 A;  5JJN B;  4PDV A;  2Z0A A;  3BY6 A;  3K06 A;  1JJO A;  3AG1 B;  4TSF G;  2WPD G;  2UXD B;  1SS3 A;  2KB1 A;  3VQV A;  4G2K A;  3K3W A;  2EZO A;  2XAJ A;  2OYQ A;  1WPB A;  4GX5 A;  3CCM V;  4GKJ B;  4DR1 O;  1WNS A;  5EZY B;  4EB6 B;  4Z2W A;  1QNM A;  5GON A;  4D7T A;  5DM6 V;  2DW4 A;  4UV8 A;  1AJP A;  2Q67 A;  3D36 A;  2JDI G;  1YXB A;  4RO2 A;  1D5A A;  3K08 A;  1M57 B;  3JYC A;  1VQK V;  2BOB C;  1N33 B;  2X6C A;  1XRE A;  2AW9 A;  2L35 A;  4X1Y A;  5J9P C;  3CCS V;  4GCZ A;  3OGI B;  1JJ2 U;  4CH4 A;  3CE2 A;  2DQ3 A;  2RQ6 A;  1R6K A;  4GT1 A;  3FB5 C;  1GMG A;  4LF9 O;  1Y74 A;  4NXM B;  3KDR A;  3K5O A;  1PNM A;  1XMQ B;  2Q8V A;  1W2B U;  4OX9 B;  3HKC B;  1N32 O;  1GKF A;  4DR7 B;  3ETE A;  3RFR A;  4Q20 A;  4WBN B;  3DSQ A;  3IGA C;  2HJD A;  1BT8 A;  3HKD A;  4JV5 O;  5LL6 Y;  2ZM6 B;  2P7T C;  3QTC A;  1DK1 A;  5B3S B;  4O2B B;  3LUT B;  1WPX A;  3ZIA G;  5H6Q A;  2EIN B;  4DR1 B;  2B9Z A;  3JAS A;  4MT8 A;  4UCO A;  1B3Q A;  3M99 B;  1H2G A;  3AG3 C;  2LW1 A;  4TWK A;  2WLN A;  3TXQ A;  1CEZ A;  2Z3Y A;  1M4U A;  1YI2 V;  4MTF A;  3HPL C;  1DLB A;  3LNN A;  1M5I A;  4P2Z A;  1FJG O;  3K9S A;  5EK0 A;  1Q6U A;  2GUZ A;  2QM4 A;  3ZHS A;  2YS8 A;  5IY5 C;  1K4C C;  1R6T A;  2H3O A;  3ZMU A;  4WFF A;  3CHX A;  4FJC C;  1E1R G;  1PP9 H;  3JAW A;  3VQY A;  2ZKO A;  2ZR3 A;  3T1H O;  1IVS A;  2JVD A;  5EYP B;  4JV5 B;  4G28 B;  3W7U A;  4MSW C;  4EFB A;  4B7K A;  3SPH A;  3T1Y O;  1F23 A;  1V55 B;  1VEW A;  3APO A;  4UCR A;  1QVF U;  4K8X A;  2AZ2 A;  4L87 A;  2A3Q A;  1JFF A;  2HFE C;  5F2V O;  4X66 B;  1XHX A;  4I9W A;  3IJ4 A;  3OUF A;  4I55 B;  3R65 A;  3AK2 A;  2DMX A;  2Q7H A;  1LUV A;  3AG2 B;  5C8Y B;  5LP6 A;  4WCE V;  2H94 A;  3CX5 F;  5BXZ A;  1TUE B;  4JPR A;  2HR3 A;  3NR7 A;  4ZI7 B;  5CB4 B;  4MVS A;  2QTS A;  5DED A;  1YVW A;  4DV7 O;  4TV9 A;  1ZLZ A;  4DV5 B;  4N23 A;  4FLU A;  2CAZ C;  5LXT A;  4IIJ B;  3D3Q A;  4DR3 O;  2CGO A;  1WJZ A;  4ABM A;  4D7S A;  1U96 A;  3JAR B;  1BHB A;  4PDL A;  4LH6 A;  1BS3 A;  2Y69 B;  2IJK A;  4FM2 A;  1OZ0 A;  1YDX A;  1OHH G;  1XDC A;  1MAB G;  5JQG B;  1SQG A;  2QM7 A;  2N74 A;  4OGQ B;  2DN9 A;  4QPK A;  1NKD A;  5KAI Z;  1F4M A;  1KQS U;  4W4L A;  4BWA A;  5LYJ A;  3OTF A;  3E83 A;  1M9N A;  3H9V A;  4IL6 Z;  3B77 A;  1AIL A;  4JTD B;  1ZWI C;  5JJJ B;  4P9P A;  4JI2 B;  1ENV A;  4DR4 O;  1YSC A;  1FXK C;  4GLX A;  1V54 B;  2NLJ C;  3FKS G;  1QQC A;  3JAM N;  4MVU A;  1QLE B;  4D6T H;  2JEX A;  3ZRW A;  2BE3 A;  5A2Q N;  3RYC B;  4UFZ A;  3RYI B;  3JD2 A;  2ZCE A;  5KHI A;  1YZB A;  1IBK O;  1I08 A;  4DR3 B;  1K73 W;  1XQ8 A;  2XTA A;  2F4V B;  4NKG B;  4DR2 O;  3BHP A;  1B04 A;  3QO8 A;  1IXM A;  2ZNI A;  4IYI A;  2E5L B;  4TV8 B;  3SYQ A;  2HG5 C;  3W7W A;  2ODM A;  2YI8 A;  2KQX A;  1N0N A;  4HNA B;  4PA3 A;  4CS2 A;  1CP9 A;  1XL6 A;  1COW G;  3E8G A;  4I7Z B;  4F4L A;  4FM1 A;  5LGN A;  2HHH O;  2ZR2 A;  5JCO A;  4UB8 Z;  1ZSP A;  4X62 O;  4JAA A;  1L0N H;  5IYD O;  1PV0 A;  4DUZ B;  2GHY A;  1R3L C;  4DR4 B;  2UXC O;  1X4T A;  1RPR A;  1I94 B;  2IU0 A;  3X2Q B;  2JGD B;  4TT3 G;  5IE9 A;  3C3S A;  1VQO V;  2LQT A;  3ZN1 A;  2QGN A;  1MZF A;  2IH3 C;  3T4D A;  1K92 A;  1U97 A;  3HB3 B;  2X6B A;  3ABL B;  4U3F H;  3RYH A;  1PD3 A;  4DR6 B;  1UFI A;  2ZE7 A;  2R70 A;  1N4C A;  4FZ1 A;  1PM9 A;  1IBK B;  2V7Q G;  2ARH A;  2YEV A;  5JVD B;  3OGC C;  1WAZ A;  3ZHT A;  1L8D A;  1VQP V;  2UU9 B;  4JI1 O;  4K0K O;  2CTQ A;  1FD9 A;  1F4N A;  3FD9 A;  5B1O A;  4J7Z A;  1EFR G;  4B3S O;  4UUJ C;  1NTZ H;  1ORQ C;  3STL C;  3LSU A;  1Q81 W;  4HZ3 A;  4H0L B;  2LGW A;  1H8E G;  4QNH B;  1CXZ B;  2XAF A;  3ASO B;  4TUY B;  4QE7 A;  3B2E E;  4NYK A;  3CYO A;  4H44 B;  4JYB A;  4X62 B;  1TA8 A;  1YHQ V;  4LNU B;  3ZHU A;  4YJ2 A;  1GK9 A;  1TVK B;  5LA6 A;  3ETD A;  1V55 C;  2UXC B;  3BAB A;  4LFB B;  4O4I A;  5CBG A;  2QSA A;  5GON B;  1RP3 B;  3G67 A;  1BQ0 A;  3JSN A;  1IDS A;  3OTO O;  1VAR A;  4WFA V;  4YXW G;  5LMU B;  1JQ0 A;  4UB6 Z;  5B1N A;  2ZE6 A;  1VQ4 V;  1KB9 F;  2ZDI A;  1YIT V;  4B3R O;  3TGU H;  2BCC H;  5FL7 G;  1EBO A;  1PNK A;  2QWN B;  2EIK C;  4YHH B;  4X1Y B;  2HEP A;  1XNQ O;  3G6B A;  2Y0P A;  5J2U A;  1S76 D;  4MTG A;  4X64 B;  1QBZ A;  4Q6G A;  3WB1 A;  1Y74 B;  2DYR B;  4LF4 B;  4JI1 B;  4AI8 A;  3ML0 A;  2IU3 A;  3CWB H;  3ZRX A;  2ADP A;  4JAV A;  5B1B C;  4RAI A;  1OCO B;  3MD0 A;  3H1L H;  4BR6 A;  1WB8 A;  4DV4 O;  4JI7 O;  1YJ9 V;  2PYJ A;  1QVG U;  2YXH A;  2ZIN A;  4KUM A;  3ETG A;  2P4K A;  2F23 A;  2ZXW C;  3FFQ A;  3OMA B;  4P30 A;  5TIS Z;  4H33 A;  2CH7 A;  3JAT A;  1URF A;  2VQF O;  3BA9 A;  4I50 A;  4MW3 A;  5KMG A;  2DWD C;  4GX1 A;  1EZV H;  3RVY A;  2B1I A;  3WG7 C;  5CA0 B;  4JI0 O;  2Y4T A;  4DUY O;  4NR1 A;  3CC7 V;  1DF5 A;  2YI9 A;  3K0G A;  1OCC C;  3E86 A;  1CPY A;  1PPJ H;  1MMM A;  2CUG A;  2JJ1 G;  3OTO B;  2P90 A;  3HR0 A;  4PA9 A;  1FAF A;  5EBM C;  1M1K W;  3CSX A;  1PL4 A;  3E89 A;  1Y66 A;  4DV3 B;  3H1K H;  4B3R B;  1NZ6 A;  1Q6H A;  4JTA B;  1BL8 A;  1VQN V;  3B8N A;  3OT7 A;  4HAM A;  3E8H A;  1XNQ B;  4MVQ A;  4YY3 B;  5BMV A;  1NR1 A;  1XIL A;  2C2A A;  4IT5 A;  1TGO A;  3ABU A;  4B7E A;  5L3F A;  1NQT A;  4PDR A;  5ITZ A;  2PI5 A;  2Q0A A;  3SGI A;  1VF7 A;  4QGP A;  3LDD A;  2E75 B;  1EN6 A;  3E22 A;  1NVP D;  5LGU A;  3CC4 V;  1G4Y B;  4ZKI A;  4PA6 A;  1H2M A;  1R3J C;  2CDY A;  4R6Z A;  4DV4 B;  2ZNJ A;  3VOU A;  4JI7 B;  2CTW A;  4JI3 B;  2E3C A;  1BQZ A;  3CP1 A;  2A79 B;  5KHH A;  1JFF B;  4JI8 B;  1VP7 A;  5E79 Z;  4W4K A;  2B5U A;  1A32 A;  4KL1 A;  3ZJZ A;  4J9Z B;  2UUA O;  2M6Y A;  2NR5 A;  2OCC B;  3A2F A;  2P4V A;  3JAK A;  1Y6X A;  5LP6 B;  3I56 V;  3CD6 V;  1YEW A;  3DGE A;  4JI5 B;  2EIM B;  3K9A A;  1GN4 A;  1ZTE A;  5GW7 A;  3DTU B;  5KX5 A;  2XHB A;  1HNZ O;  2JIZ G;  1AI5 A;  1KEC A;  2DOS A;  4R50 A;  2ZD9 A;  3X2Q C;  2GTA A;  1QHT A;  3CRC A;  5CA1 B;  4X1I A;  4UCU A;  4CS4 A;  1US6 A;  2QE7 G;  3RN4 A;  2XUM A;  1WA8 B;  3PJS K;  1K9M W;  5D5Q A;  1WN7 A;  4I4T A;  2EZP A;  2XT9 A;  3FAV B;  2AGA A;  4GX2 A;  2WLI A;  5E1A C;  2PI4 A;  3VBB A;  4RWU A;  1WLE A;  4J41 A;  5EC1 C;  1QLN A;  1K97 A;  2Q9L A;  2DYS B;  1VQ6 V;  1K34 A;  1NR7 A;  2LO1 A;  2EIL B;  2QR4 A;  4X8A A;  4N21 A;  1Y76 A;  3ZED A;  5HFL A;  4CC5 A;  3A8T A;  4L8J A;  2OIG A;  1ROP A;  5IJ9 A;  5KAF Z;  1PNL A;  4LF8 O;  4LF6 O;  1SQF A;  3F5W C;  5L3D A;  2LFR A;  2UUA B;  4YJ3 A;  2QWP B;  3EVK A;  2Q73 A;  2AZ0 A;  2RCV A;  4LWS B;  4MTX A;  5J2T B;  4B3T O;  2ILM A;  3O65 A;  4NTX A;  3SYO A;  3K79 A;  3P3N A;  3QF7 A;  5EC2 C;  5DN6 G;  2OTJ V;  3L72 H;  2R72 A;  2ZIO A;  3CCQ V;  4CS3 A;  2MK3 A;  1PKX A;  2HLD G;  2EIJ C;  4KHP O;  4PV1 B;  1AR4 A;  4K35 A;  4CZZ A;  1UPG A;  3VQW A;  4X1K B;  1R73 A;  3THO A;  2W6I G;  3DXR B;  4Z1M G;  2YXY A;  1F7Y A;  2BSK A;  3ABT A;  1LNQ A;  2VWK A;  4OPH A;  5KA6 A;  4FPP A;  4ICG A;  4ZBM A;  3CCR V;  1H2N A;  2YIB D;  1IBM O;  4LF9 B;  3ZMS A;  1SQV H;  3K58 A;  4U3J A;  1GM8 A;  4X88 A;  3RW0 A;  1R3K C;  1XMO O;  4B3M O;  4NXN O;  1N32 B;  1SA0 A;  4J80 A;  4F6E A;  5JJE B;  2CTR A;  2OTL V;  2UUB O;  3ASN C;  1KC8 W;  4F6R A;  1S3J A;  4J7K A;  5L3E A;  3LSS A;  2PGG A;  1THZ A;  5LOV A;  1H2K A;  1FFX A;  4FFB A;  3UT5 A;  2Y0I A;  1SRY A;  2WLH A;  3H1H H;  1BGY H;  2A0L A;  3N2G A;  3UQ8 A;  3IAY A;  1M56 B;  5LGT A;  2L6L A;  1GN6 A;  3ZBH A;  3QVN A;  4CH6 A;  2NN4 A;  1Q43 A;  3B4S A;  4ZHQ A;  4JI4 O;  1FXK A;  1IZ3 A;  1G6U A;  2EJ7 A;  4IYH A;  3P3P A;  1SC5 B;  4CBC A;  4JI6 O;  4DV6 O;  3RYF A;  4J7J A;  2LP7 A;  4LFA O;  2WWW A;  3ABM B;  3L74 H;  1ZL8 A;  1QCE A;  3SDL A;  3T2M A;  3ABK B;  1VQ8 V;  2IJI A;  1IBL O;  4MS2 A;  3APQ A;  1FYJ A;  2IH1 C;  3QO5 A;  1FJG B;  3CJH B;  5IYZ B;  3OE7 G;  5JH7 A;  1AB3 A;  5EZY A;  4E4E A;  4G27 B;  3UM7 A;  4XDJ A;  2Z5U A;  4ZOL A;  3UKM A;  2JGU A;  4U7O A;  1IBM B;  3TK1 A;  1SER A;  2M7W A;  2KKW A;  1IX9 A;  4NXN B;  3CME V;  5IJ0 B;  3T1H B;  5IYB O;  3P32 A;  1FKA O;  1XI1 A;  4JYA O;  4YJ2 B;  3T1Y B;  3ZHQ A;  1RM1 C;  3TXS A;  3MHS C;  4BW9 A;  4YIP A;  5B1A B;  3K5N A;  4JF3 A;  2R9A A;  2QWQ B;  2JS5 A;  1YJN V;  4X9Q A;  3HKC A;  4UCT A;  3DC5 A;  3ZMZ A;  1KMI Z;  3AG1 C;  4CH3 A;  4WBN A;  3L75 H;  2OCC C;  3LSQ A;  4I5S A;  2D2C B;  2FKX A;  4DK1 A;  2A9H A;  2JK5 C;  2QKA A;  3ZS8 C;  4LC1 A;  4DV7 B;  4WFH A;  2EIM C;  4DV6 B;  2P6J A;  2UUC O;  3LDC A;  2QKS A;  4O2B A;  5J2U B;  1KUQ A;  1ZX3 A;  4KP4 A;  4O4L A;  1IBL B;  1W59 A;  1NH2 B;  4DYL A;  1JX9 A;  4RUF A;  4DV2 O;  1XOU A;  4O4H A;  3ZN0 A;  1M57 C;  1MSW D;  1JOY A;  4O2A B;  3KKY A;  2ITD C;  3GWK C;  2QDO A;  3D8C A;  1S5J A;  5GTH Z;  4AHC A;  1GO3 F;  2ZE5 A;  3RWR D;  2BTQ A;  5LMN O;  1N36 O;  2CH7 B;  3JAT B;  3JD3 A;  2Q7E A;  1TUB B;  2WLL A;  5C93 A;  4DRX B;  4I50 B;  1UJW B;  3G71 V;  3OR6 C;  4JYA B;  1NH2 D;  3JAL B;  2V4D A;  1OCR B;  1S5H C;  1S72 V;  2P22 C;  1HWY A;  2W6J G;  1SQQ H;  3CCJ V;  3N27 A;  3E35 A;  2VQE O;  3RVZ A;  4QPJ A;  2OWO A;  1P84 F;  4DK0 A;  2AXT Z;  5B3S C;  1DF4 A;  3ETQ A;  2XAQ A;  2OT5 A;  3SYA A;  1BSM A;  1OCZ B;  4R7C A;  1FS0 G;  1MOF A;  2Q4P A;  2YIA A;  4PHZ A;  2EIN C;  3W7S A;  2GSM B;  3M7M X;  4FLZ A;  3B8M A;  3IFX A;  2QA4 V;  1B6Q A;  3ZHV A;  5BMV B;  4FLY A;  2UUC B;  2WA3 A;  4I55 A;  4BAY A;  1IXB A;  5ITZ B;  3OM3 B;  3MDS A;  3CMA V;  5C8Y A;  3K5M A;  2R9I A;  4DR2 B;  1H2L A;  3N2K B;  1KP2 A;  3OD4 A;  2ZT9 B;  3EHB B;  4MVZ A;  3SYC A;  1JA8 A;  4E2L A;  3T4Z A;  2Q0O C;  2IW5 A;  4YIO A;  3AK3 A;  2RNB A;  3Q4H B;  2EBO A;  5A9G A;  2BTO A;  4DW0 A;  4JAU A;  4X65 O;  1RSO A;  5LMN B;  3JAR A;  3G6E V;  2HHH B;  1N8R W;  3C90 A;  3UO3 A;  4X20 A;  1RPO A;  2F43 G;  1J95 A;  3SPG A;  4XDK A;  2GDS A;  3ZX6 A;  4BIZ A;  3ZHR A;  5KUK A;  4I0X A;  4EEQ A;  4MW8 A;  1Y4M A;  4LBE C;  5JQG A;  3BVO A;  3CCE V;  5FNV A;  1JNB A;  2P06 A;  2JJ2 G;  3WU2 Z;  1JMK C;  4TQF A;  3JSL A;  5LHG A;  3AG2 C;  3CB2 A;  1HNW O;  4CH5 A;  4ZIB A;  2PTM A;  4JYC A;  1SF9 A;  4TOI A;  4RQE A;  2YDE A;  4X1I B;  2PYL A;  1H38 A;  3ZMV A;  3H01 A;  1NJI W;  1FOU A;  4I4T B;  4FFK A;  1P7G A;  3AG3 B;  4PI0 A;  1P4R A;  2WLI B;  4K0K B;  2X6A A;  3RYI A;  2WLJ A;  1OJH A;  2DQ0 A;  4AIL C;  3CXC U;  1AI6 A;  2KG7 A;  4B3S B;  4WFG A;  4NTW A;  3HKD B;  2F95 B;  5IY5 B;  1YTF B;  1KU9 A;  1Y76 B;  2Q5Z A;  2Y69 C;  1K4D C;  4HYO A;  4IGG A;  4O4J A;  4PEL A;  1AJN A;  4X65 B;  5H9C A;  5FLX N;  1G8M A;  4QE9 A;  1V9P A;  4TV8 A;  4AQY O;  4KFM A;  4LF7 O;  3QG5 A;  3A0R A;  2DWE C;  1X59 A;  3B40 A;  3E8F A;  1R6N A;  2XOK G;  3TJT A;  5BR8 O;  4HNA A;  4NTY A;  3JAS B;  4BIO A;  4B08 A;  4MVR A;  1P7B A;  5KLV H;  5B1A C;  4TQD A;  1FPO A;  3KG2 A;  1V54 C;  2UXD O;  1S77 D;  2QWO B;  1R3I C;  1QLE C;  4DV0 O;  4PD4 F;  2HJF C;  1PL0 A;  1Z2G A;  2JS3 A;  1Q82 W;  5KA5 A;  1AVM A;  3S3W A;  4GKJ O;  4FIP C;  3BCC H;  4J10 A;  3ZRV A;  4UCV A;  2GUZ B;  3K0D A;  3BPZ A;  2HP8 A;  5DEC A;  1BZK A;  4MVM A;  4QJF B;  2HVK C;  2JGD A;  5FPO A;  2V1D A;  1B06 A;  2H8P C;  5IWA O;  4U3J B;  5L3C A;  3SJA C;  1SA0 B;  3JAW B;  4GX0 A;  3KCY A;  3F7Y C;  2FYU H;  1SQX H;  3UCS C;  5BZB A;  3VQX A;  1K3E A;  4LFC O;  1VF6 C;  1XHZ A;  1FFX B;  4FLT A;  1L1F A;  3T1C A;  5D5P A;  1SQB H;  4DR5 O;  1XMQ O;  3N2G B;  2D3O W;  5LHI A;  4LF7 B;  1NI8 A;  2GV9 A;  2VQF B;  3I55 V;  5H6R A;  4A5U B;  1GH6 A;  4K3A A;  4JI0 B;  4DUY B;  1K5S A;  1K33 A;  4DO2 A;  1HW7 A;  1FXK B;  4BW5 A;  1OCR C;  3CCU V;  2HKO A;  2E76 B;  2YIC A;  1AP6 A;  1MG1 A;  4TV9 B;  2R9R B;  3RYF B;  4TUY A;  3SPI A;  4WF9 V;  1MSD A;  3BEH A;  4XDL A;  1ZL8 B;  2W0F C;  1VQ7 V;  5LXT B;  2YSU B;  4DV0 B;  3RT3 C;  1OCZ C;  3LDE A;  4LNU A;  4BIU A;  1TVK A;  2DJV A;  2UXX A;  1I7F A;  3ABL C;  5JH7 B;  3TCU A;  4RQF A;  1OV9 A;  2RMK B;  4EFE A;  4JGS A;  4ZOL B;  1T5E A;  2ATK C;  3WFV A;  3FYE B;  5IWA B;  1NS1 A;  5K1X A;  3DC6 A;  4K8Z A;  2ZIM A;  3WB2 A;  5LYJ B;  4GYC B;  3JCU Z;  1BHA A;  2A7W A;  2XAH A;  1Q7Y W;  4LH7 A;  1K5Q A;  4C7U A;  4LFC B;  3H1J H;  1NT2 B;  2QJ1 A;  4DR5 B;  3J80 N;  4UVC A;  4Z1V A;  1YF2 A;  4QIW F;  1Q8I A;  3ASO C;  2QM8 A;  3AG7 A;  1XEQ A;  3KCX A;  3FB7 C;  4FMT A;  3ZRW B;  1H2S B;  2IBZ H;  3U0Z A;  1F51 A;  2ZE8 A;  5H2F Z;  1D5N A;  3I5D A;  4U7N A;  4X66 O;  3JD4 A;  4LF5 O;  2XAS A;  1HNZ B;  1GAX A;  2LGQ A;  3KZI Z;  2KSD A;  1E79 G;  4FLW A;  4RUE A;  2QTO A;  1AR1 B;  2IJJ A;  4O4L B;  3CRR A;  2XND G;  1MNG A;  3D36 C;  2IM9 A;  4I9Q A;  2NNU A;  4O4H B;  5CA0 A;  1GN2 A;  1E1Q G;  1BMF G;  3C3T A;  1M93 A;  4OPA A;  4EKW A;  4WFB V;  1GM9 A;  1VMG A;  2LW7 A;  5FPR A;  5GTI Z;  4DV5 O;  3AG4 B;  1XBL A;  3ZMT A;  3WB0 A;  3L73 H;  3OFN G;  2BTQ B;  4KXR A;  2DYR C;  4H13 B;  1WB7 A;  2WLL B;  1K7D A;  4DW1 A;  4PA4 A;  2GBO A;  3HKE A;  3HKB A;  1OCO C;  2ETN A;  4LF8 B;  4LF6 B;  4IHJ A;  4ASU G;  3CXH F;  2Q69 A;  1XNR O;  4PI2 A;  2YID A;  4MTO A;  3S3X A;  2OCH A;  3MAQ A;  3ZRS A;  5CN0 A;  1EM1 A;  4UXN A;  2CE4 A;  3GVM A;  1GRJ A;  4J9Y B;  3OR7 C;  4B3T B;  3RYH B;  2CTP A;  4UVA A;  1Q86 W;  5B5E Z;  4JI2 O;  1D2D A;  2O57 A;  4LF5 B;  1GTO A;  1N0J A;  3JD0 A;  1XL4 A;  2F66 C;  2AHY A;  2YEV B;  1AJQ A;  3NXS A;  4KHP B;  1I5X A;  1IJG A;  2VRZ A;  2EIK B;  1NBM G;  1RFY A;  3GB7 C;  1YJW V;  3E2E A;  3CEI A;  3CCL V;  4EB6 A;  1IUR A;  5KHJ A;  4X89 A;  1Q6I A;  1HP8 A;  2G38 A;  1ARO P;  3E8B A;  2UXB O;  1NU1 H;  4WFE A;  1RSO B;  2F4V O;  1XMO B;  4B3M B;  4FLV A;  1W0K G;  5CA1 A;  2UUB B;  5B1B B;  2E5L O;  3ZCC A;  4X20 B;  3JD1 A;  1O9H A;  1WA8 A;  2BOC C;  4I0X B;  3FAV A;  5LA6 B;  2QWR B;  5FNV B;  4O4I B;  1XNR B;  2ZXW B;  3CPW U;  4JTC B;  2OIE A;  3K04 A;  1AR5 A;  4JAS A;  1WP7 A;  5LP6 C;  3WG7 B;  3FB6 C;  3K57 A;  1FXV A;  2P67 A;  3SJB C;  5L3B A;  2FL4 A;  1Q90 D;  4JI4 B;  1OCC B;  4DUZ O;  5K1P A;  1W0J G;  4JI6 B;  3EXA A;  3OEE G;  1I94 O;  4LFA B;  2ZQM A;  1SES A;  4DXW A;  2WSS G;  3L70 H;  1J5E O;  5KUM A;  5H5N A;  2ITC C;  3A0H Z;  2N05 A;  2VWJ A;  1S5L Z;  3L71 H;  1VQL V;  1K8A W;  4LWS A;  2YIB A;  5J2T A;  2VS0 A;  4NVP A;  2PF4 E;  3B09 A;  2KG7 B;  4DR6 O;  1KKC A;  3J7A U;  1Z5W A;  5EIB D;  2X7R B;  4O4J B;  1BCC H;  1EN4 A;  1AI4 A;  2YUA A;  2UXB B;  4GKK O;  4P9O A;  1QU7 A;  2UU9 O;  5CBF A;  1VQ5 V;  2B1G A;  4X1K A;  2RN9 A;  3DXR A;  2DYS C;  5KMG B;  2EIL C;  2LJ2 A;  1KP3 A;  4GZR B;  3STZ C;  3F7V C;  2F1M A;  3K03 A;  1H5W A;  1SZT A;  1SKV A;  3W7X A;  1P49 A;  2RJZ A;  5EYP A;  3L9D A;  1JVM A;  3JCZ A;  3EFF K;  2F93 B;  1NTM H;  2DE0 X;  1Q5O A;  3BA8 A;  5L3G A;  3O9O A;  1KKD A;  3CCV V;  4H37 A;  3OUS A;  1XUQ A;  4LFB O;  2N04 A;  1FFT B;  1TAE A;  1I5Y A;  2MW2 B;  4PA7 A;  1J5E B;  2K1E A;  5LMU O;  4OXS A;  4UVB A;  5LBQ A;  3BFR A;  1M90 W;  4DV2 B;  3E22 B;  3H1I H;  5EBL C;  4FZ0 A;  1S0V A;  4FK5 C;  4YHH O;  4ZI7 A;  5CB4 A;  3RBZ A;  2YXL A;  5IDJ A;  4GUN A;  1JCH A;  3TET A;  2XAG A;  4JZ2 A;  4LP8 A;  4IIJ A;  4X64 O;  3AG4 C;  4GKK B;  4JYY A;  1AI7 A;  4LF4 O;  1YCI A;  1JPX A;  1Z5V A;  1Q3E A;  1VIB A;  4FVM A;  1FXH A;  4CC6 A;  1N36 B;  2EJR A;  3QNE A;  3MHH C;  3CJH A;  5HFM A;  5JWP A;  5IYZ A;  2PUS A;  3JAK B;  3K5L A;  2Y4U A;  3M8A A;  4PJ0 Z;  2CGN A;  2X0L A;  5JCO C;  3CRA A;  4LR3 A;  2ADQ B;  3ICX A;  2CK3 G;  3AEI A; 
#chains in the Genus database with same CATH homology
 4FFK A;  1P7G A;  2P4K A;  1GN4 A;  1BSM A;  1D5N A;  1VEW A;  1ZTE A;  3CEI A;  1EN5 A;  3KDR A;  3IC9 A;  1AP5 A;  4YIP A;  1GN3 A;  1I08 A;  3AK2 A;  3LSU A;  1MNG A;  1Y67 A;  4X9Q A;  1LUV A;  3DC5 A;  1BT8 A;  1IXB A;  4F6E A;  1LUW A;  1I0H A;  3MDS A;  1JR9 A;  1MMM A;  3RN4 A;  1GN2 A;  4JZG A;  1AP6 A;  3C3T A;  1PL4 A;  1JA8 A;  1MSD A;  2QKA A;  1ZLZ A;  4YIO A;  3AK3 A;  1N0N A;  1XUQ A;  1SZX A;  5A9G A;  3OT7 A;  3TJT A;  1WB7 A;  1GN6 A;  1AR5 A;  1XIL A;  1IDS A;  1VAR A;  3QVN A;  3BFR A;  1BS3 A;  1ZSP A;  3KKY A;  1EN6 A;  1XDC A;  1AVM A;  2GDS A;  3DC6 A;  4GUN A;  1MA1 A;  4JZ2 A;  3EVK A;  2CDY A;  1EM1 A;  2RCV A;  2CE4 A;  2QKC A;  5AG2 A;  4JYY A;  3AK1 A;  1QNM A;  4C7U A;  3K9S A;  3C3S A;  4E4E A;  1B06 A;  1KKC A;  1N0J A;  1ZUQ A;  2ADP A;  1PM9 A;  2ADQ B;  1EN4 A;  1XRE A;  4BR6 A;  2AW9 A;  1WB8 A;  1IX9 A;  1AR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...