1MNLA

High-resolution solution structure of a sweet protein single-chain monellin (scm) determined by nuclear magnetic resonance spectroscopy and dynamical simulated annealing calculations, 21 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
91
Chain Sequence
b'GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONELLIN
publication title Solution structure of a sweet protein single-chain monellin determined by nuclear magnetic resonance and dynamical simulated annealing calculations.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Sweet protein
total genus 14
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 1998-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1mnlA00
1ROAA 5A0OB 1STFI 1A90A 3QRDA 2W9QA 4TX4A 1MNLA 1FA3A 4ZM8A 1LXEA 5LC6A 4N6V0 4N6NB 2W9PA 1A67A 4N6UA 4EYCA 1RN7A 1TIJA 2OCTA 1NB5I 1M9GA 1CYUA 1N5PA 4N6LA 4N6MA 5LC7A 3PYJA 1GD3A 1IV7A 5ELJA 3LH4A 3L0RA 3UL5A 4IT7A 3PXMA 4CCVA 3SVAA 1FUWA 3GAXA 1MOLA 1IV9A 1KWIA 3Q2PA 2CH9A 1YVBI 3NX0A 1WNHA 4N6OB 1N9JA 5ELUA 1NB3I 5EQLA 1R4CA 1DVDA 3S67A 1GD4A 3PS8A 2O9UX 4N6TA 1N5HA 1EQKA 3KFQC 1G96A 3KSED 1CYVA 1DVCA 2KXGA 1PFPA 3MWZA 1CEWI 2BO9B 3UL6A 3K9MC 3IMAB 4LZIA
chains in the Genus database with same CATH superfamily
4HM4B 3LYGA 3A5EA 1IK3A 4WYKA 1IT8A 3KKGA 4HKVB 2D42A 3F40A 1UDII 1NJI4 1BNIA 1GY7A 2E2TA 2UGIA 1LNHA 2GU3A 1B2SA 2MF7A 1BSEA 3OWSA 5D83A 1BRNL 1UCIA 3VSYA 3MG1A 1AV4A 3BIRA 5BU4A 3G4S3 2BMQB 1TP6A 2CWTA 3NM7A 1O7MB 4FMDA 3HX8A 2IUKA 1BGSA 2CFLA 4N6NB 2YX9A 1LRAA 1GMRA 2RCDA 4N6UA 3FF2A 1JV2B 2F5MA 1RN7A 1BVIA 1WQLB 3ER7A 2CW9A 2SBLA 3S5CA 1Q824 1OF5B 4JF8A 2E2UA 2A15A 3G713 2CIUA 3GRDA 4N6MA 3X3ZA 1S723 2OOVA 1DYUA 3CC73 2XR8B 1UGIA 1Q864 3FF0A 3CC23 1AR0A 1GD3A 1IV7A 1V74A 3JUNA 3NHXA 4G1MB 4L8OA 3B8LA 5CF1A 3RGRA 2HMMB 2J8XB 1RN4A 2W56B 2KF3A 3JVCA 3MKIA 3Q1CA 5I97A 3D3LA 2XFSA 2XSHB 3PXMA 1LOVA 3DGYA 5DRVA 8RNTA 2HMLB 4IIAA 1LOYA 1RTUA 3DY5A 5DREA 4EC6A 1BRJA 5AIHA 2O3OA 2WOHA 1X1XA 1G02A 3TDGA 2H0IA 3T8UA 1BRSA 3HIGA 1TUHA 1DMNA 3E99A 4HVNA 1UCLA 3I553 2OTL3 1EG9B 2IYJA 4U13A 1SIIA 4KVHA 1W4NA 3KN4A 3FCSB 3S27A 1FGMA 1GOYA 3V98A 5IG3A 1YJ93 1N9JA 1HYFA 1FW7A 3ROBA 1RMSA 1OF5A 7GSPA 1WMPA 1KD14 1R4CA 3OX9A 3OWUA 1DVDA 1ROVA 1W6CA 3JUQA 1O7GB 1UUVB 3RDEA 3MSOA 3U97A 2YFIB 1W5ZA 1OGXA 3LMLA 3NM2A 1PU4A 1AVLA 3PS8A 2YFLB 2YFJB 3K63A 2P05A 6RNTA 1FGTA 1N5HA 2HMKB 3K7CA 2KF6A 2XSOB 3NQZA 5KP3A 5HGRA 1EQKA 1G96A 3MHEA 1B2XA 4MJDA 3SOYA 3LT8A 1RRHA 2CC3A 2XRXB 1PFPA 1BRHA 4I5QA 4QWTA 2OQEC 4HM1B 2B1XB 1BRIA 1ASKA 1CEWI 4K61A 1I2GA 4R9LA 4BTWA 1Q9EA 4FCMA 1LVNA 4FMBA 3BNEA 1RGHA 1X1YA 1NU3A 2GXFA 3EN1B 3G0KA 1JRQA 1IQ8A 4WYKB 2CG1A 4GHOA 8CHOA 3V92A 1VQL3 2BMOB 5IF6A 1OH0A 1BNFA 1US1A 3FGYA 1VQK3 1JB2A 1JB5A 3RNTA 1OUNA 3NXJA 4FCZA 2GU1A 3AHSA 1Q40B 1ROAA 5IG0A 2M7OA 1QVF2 1JBTA 1T3BA 2XEPA 1RGLA 3S29A 5KP1A 3CCM3 5GSPA 3N8BA 4HZ9B 1A90A 3CCR3 1GMQA 1RKYA 1U5OA 2OOVC 3QRDA 3WR2A 1OHSA 1W00A 2W9QA 3WA3A 1BANA 2XGLA 4TX4A 1I8VA 3UNLA 1IVVA 3Q3FA 1LNIA 4STDA 4NHFA 1X1UA 2IMJA 3Q90A 1W7CA 4HM0B 4R9KA 1LXEA 3WODG 3OV4A 4N6V0 4X2OA 5BVBA 4CJNA 1E3RA 3BU4A 2W9PA 3SEDA 1DE3A 4FR9A 3DM8A 3H51A 4EYCA 3X42A 4LEHA 2CWVA 1FGRA 1TIJA 5TGNA 2OCTA 3F9SA 1RLSA 2SARA 1M9GA 1FUTA 3U1WA 5IW9A 1JBRA 2ZA4A 3EQQB 1BSAA 1E3VA 4IPBA 3D5GA 1I70A 2F99A 1IQXA 1ULJB 4KT3B 1JZDA 3DMCA 1NNVA 4KZ1A 4O02B 3OXAA 1E97A 3DH2A 2KAAA 3FG4A 1SQWA 5RNTA 1Q40A 5ELJA 4HM3B 3LTCA 5FW5A 3UB1A 4EBGA 1IYYA 4IT7A 3I563 4RNTA 1SIHA 5BXQA 2XFTA 3M8CA 3T0UA 1DMMA 3LOYA 7RNTA 1R4YA 3MPHA 3EX9A 5HOHA 2XGNA 2FNQA 4RBNA 3OWYA 1QALA 2XH9A 3F14A 4HZBB 4R1KA 1MOLA 3MYTA 2W04A 3PCSA 3G6E3 1I0VA 1V57A 3VF1A 2RNTA 1TFOA 4HM5B 2OTJ3 3DGNA 3NX0A 1WNHA 3ZG5A 1WTHA 2ML5A 2HMOB 3ECFA 4XDVA 2KCDA 1BSBA 2Z7AA 1VZZA 9RNTA 2JQ5A 1UCJA 3V99A 4EXRA 4HM8B 2F4YA 2F98A 2HMJB 1QVG2 3AHWA 3MG2A 3FLJA 3BNDA 2Y74A 4ILFA 3B7CA 4H3UA 2P09A 3KIIA 4K1VA 3CC43 2BMRB 1RRLA 1RGEA 2PNCA 1MWTA 1MWSA 3WOFB 4HOHA 1EKMA 1I0XA 3CU3A 3EJVA 4CDLA 2ZL8A 2BU4A 2HMNB 1RGAA 3D9RA 1TRQA 1Q42A 4J5GA 1C54A 4EV2A 3KSED 1DVCA 1BUJA 1T2IA 1YGEA 2RSXA 2KXGA 3HZPA 1QAFA 3CCS3 4MMZB 4HM7B 5G2GA 1S5AA 2MC8A 1K8A4 3B4OA 1I2FA 3GZYB 1B20A 4HAAA 3QK9A 1JNQA 2BO9B 1Q7Y4 3FZWA 2F56A 1UW1A 1CH0A 2RGQA 2H0GA 1JZOA 7STDA 3CCL3 3CNMA 3OW22 1IVWA 1BNRA 3IMAB 2V1LA 3BB9A 1LOWA 1M904 3N54B 4L7KA 3BNCA 2ML6A 1NO3A 2B24B 2ZDJA 4FMAA 3CME3 1STFI 1W2ZA 3DZLA 4O2HA 1BOXA 1TRPA 3ZG0A 1UCKA 1BAOA 1W6GA 2KF4A 1JBSA 1K28A 4RNYA 2CHCA 1OPYA 3DGOA 3DUKA 2H0HA 1O7HB 1TTOA 2IUJA 2W2CA 3LZAA 2K54A 5STDA 1YVSA 5LC6A 2E2VA 5AEUB 2P0XA 3EF8A 4RNZA 3HK4A 3J7Yd 1BNGA 3NV0B 4I4KA 4WHAA 1B2ZA 1A67A 1LQGC 3WA2X 1D6ZA 1ULIB 1Q814 3DGLA 1CQSA 1NB5I 2WOFA 1HU9A 1N5PA 5CXOA 1EUIC 2IY2A 1QMAA 1UGHI 1KC84 3NBJA 4N6LA 5IERA 1JN5A 3LXUX 1LQMB 2W6JH 3WOEB 3SOAA 3AMOA 4LGQA 5EEOA 2K3DA 4KFEA 1YJW3 3EB8A 3PYJA 4EV5A 1YIJ3 4BL3A 1GY6A 1RSNA 2W03A 4MMXB 4XDWA 4R80A 3UL5A 5BIRA 2BHMA 3NBBA 1AQZA 4CPKA 1WMOA 4CCVA 3CCE3 1I2EA 1L5GB 1YGWA 3HI7A 3PCRA 1VQM3 2GEYA 1PYLA 1FUWA 1U8CB 1PY3A 3IJEB 2RBIA 3URPA 4PEJA 3WHOA 3FSDA 2BIRA 3F7SA 1VQ73 1RGCA 1TU5A 1BRKA 3PGBA 3Q2PA 1BNJA 4ORLA 3X3YA 3KE7A 5EVHA 4LYLB 3KCHA 1EEJA 1RGGA 4WFOA 3NV0A 3H3HA 3GWRA 1HZ1A 1VQ43 3ZFZA 2CWUA 1ZO2A 3CD63 1O7WB 3O8YA 1D6YA 1B2UA 2KF5A 5M1AA 4OVMA 2P38A 3HOHA 1RDSA 1A2VA 2STDA 4GB5A 3S67A 4K1UA 4XB5A 2PZVA 1UUWB 5JPUA 2KRTA 1GY5A 2O9UX 5G1LA 4BIRA 1UUGB 3PZWA 3WMDA 1ZS7A 1NDOB 3IPTA 3KZTA 4Q53A 5IG5A 2FXTA 1VQO3 1K41A 2JDIH 4L8PA 1BU4A 1QJGA 3NUVA 1N9EA 4AKZA 1MWUA 5IEOA 3EBTA 1C7HA 2I9WA 2OQEA 3CNXA 1ZGXA 6STDA 1BNEA 1VQQA 3F7XA 1OACA 1OHOA 3D79A 4HYZA 1JJ22 1VQN3 2QIYA 1RN1A 5CK6A 1MGWA 4HJLB 3CPW2 3SLUA 3LTAA 1JB4A 2WGOA 1GYBA 1SJWA 3CPOA 4J9AA 5KP4A 4J5KA 3K5TA 3NBRA 1OHPA 1VQP3 1YI23 2F86B 3BLZA 1BUQA 1AVKA 2HOHA 5IEPA 3BNBA 6GSPA 4LZIA 1YHQ3 4N3VA 1LOXA 1A2KA 3F8HA 3SYUA 3CCU3 3K0ZA 3CCJ3 5A0OB 3GSPA 1J2BA 1O7NB 1TJDA 4LSOA 4O3VA 3X3XA 1MGRA 3DGMA 5M19A 3FH1A 1YIT3 2R4IA 1UI8A 4XBXA 1IVXA 1O7PB 2L4VA 1ZX2A 3EC9A 4XM4A 4O8SA 1GOVA 3SX1A 3CXC2 5IG4A 1RHLA 3X40A 1B3SA 3UJMA 3EBYA 1SPUA 1MNLA 1FA3A 1IQYA 4ZM8A 2C4BA 4RZMA 3SXXA 1QAKA 4FCJA 4BTXA 4J8TA 2CFKA 1JN5B 2GBWB 1MWRA 1M1K4 1GOUA 3AMOB 3G16A 1T2HA 1X1WA 3ALAA 3EHCA 2R41A 2IA7A 2CX0A 4HBRA 5CLKA 4NPBA 1CYUA 1DETA 1F8NA 1OGZA 2Z77A 1FUSA 3N9HA 1B27A 2AAEA 1M1XB 2UUGC 4R4KA 4H61A 1FZUA 4MEIA 2AADA 1TFKA 1RNBA 5LC7A 5G1KA 5AIIA 1EA2A 5M18A 2INXA 4MMYB 2CG0A 1BRGA 1RGFA 3JUPA 3MG3A 4GL6A 3VGNA 1RCLA 1YNVX 4EW5A 2ZHXB 3CMA3 5D81A 4LMIA 3AGNA 4AEQA 3JUOA 4OK0A 1Q7HA 3LH4A 3L0RA 1K9M4 1HKXA 3GZXB 4KFFA 2C10A 3D4AA 5IENA 1K734 1I3FA 1Y4KA 3DXOA 3FKAA 1RJOA 4XBTA 3SVAA 2CFDA 1STDA 3LTDA 2QA43 1OCVA 3GZRA 3GAXA 1IV9A 2CFGA 3F8XA 1BSCA 1KWIA 2XF3A 3EN8A 1N8QA 3D5IA 5AI1A 5JBSA 1GSPA 3S28A 2CH9A 2W56A 1N8R4 1YVBI 2LYXA 1VQ53 2QGUA 1AY7A 1T5YA 1D6UA 3AGOA 2Z76A 4AKYA 2GSPA 1W2B2 1W02A 1KSIA 3X41A 4N6OB 4K90B 3FG1A 3CCV3 1B21A 3T8NA 3WDGB 1VQ93 3NQYA 4KFDA 4OUQA 2F5WA 1JKGB 1NB3I 2CKFB 1WMNA 5ELUA 4BTYA 1G0TA 5AEWB 1I3IA 3GZBA 5AIGA 2CK3H 5EQLA 2CFWA 2Z6BA 1GMPA 3KSPA 2UX0A 1W01A 2Y73A 1Z1SA 2GBXB 1RCKA 2W0QA 2RFRA 4HM2B 3HIIA 4XBYA 4WP5A 3FG3A 5FGOA 2Q07A 1ISKA 1GD4A 2L1SA 2D1WA 3CCQ3 5JPPA 4BU4A 5CF2A 1IT7A 4N6TA 1B2MA 1UI7A 4BL2A 1IU7A 3I0YA 2BNGA 5D82A 1A2PA 3KFQC 3G8ZA 2FGTA 1BSDA 1IVUA 5AYRB 1KQS2 1CYVA 3A76A 4X2HA 2BT3A 4GSPA 3RGAA 2WO0A 2OWPA 1RNTA 3LT9A 1NWWA 1FGOA 4WWUC 2GEXA 3MWZA 1FGQA 1VQ83 1BNSA 1FYSA 3LTBA 3B4PA 5AYSC 2LQVA 2CX1A 3EE1A 2WGQA 2K0MA 4JRFA 4DKIA 5AIFA 3STDA 3UL6A 1IDPA 4FMCA 1SARA 1GS3A 3K9MC 2P0MA 1RGKA 2C11A 4NREA 1VQ63 2QEX3 1V58A 1W6YA 1DMQA 1BIRA 1YJN3 3JUMA 4HM6B 1JKGA
chains in the Genus database with same CATH topology
4HM4B 3LYGA 1IK3A 4WYKA 1IT8A 3KKGA 4HKVB 2D42A 3F40A 1NJI4 1GY7A 2E2TA 1LNHA 2GU3A 2MF7A 3OWSA 5D83A 3VSYA 3MG1A 1AV4A 3G4S3 2BMQB 1TP6A 2CWTA 3NM7A 1O7MB 4FMDA 3HX8A 2IUKA 2CFLA 4N6NB 2YX9A 2RCDA 4N6UA 3FF2A 1JV2B 1RN7A 1WQLB 3ER7A 2CW9A 2SBLA 3S5CA 1Q824 1OF5B 4JF8A 2E2UA 2A15A 3G713 2CIUA 3GRDA 4N6MA 3X3ZA 1S723 2OOVA 1DYUA 3CC73 2XR8B 1Q864 3FF0A 3CC23 1AR0A 1GD3A 1IV7A 1V74A 3JUNA 3NHXA 4G1MB 4L8OA 3B8LA 5CF1A 3RGRA 2HMMB 2W56B 3MKIA 3JVCA 3Q1CA 5I97A 3D3LA 2XFSA 2XSHB 3PXMA 5DRVA 2HMLB 4IIAA 3DY5A 5DREA 4EC6A 5AIHA 2O3OA 2WOHA 3TDGA 3T8UA 3HIGA 1TUHA 1DMNA 3E99A 4HVNA 2OTL3 3I553 1EG9B 4U13A 1SIIA 4KVHA 1W4NA 3KN4A 3FCSB 3S27A 1FGMA 3V98A 5IG3A 1YJ93 1N9JA 3ROBA 1OF5A 1WMPA 1KD14 1R4CA 3OX9A 3OWUA 1DVDA 1ROVA 1W6CA 3JUQA 1O7GB 1UUVB 3RDEA 3MSOA 3U97A 2YFIB 1W5ZA 1OGXA 3LMLA 3NM2A 1PU4A 1AVLA 3PS8A 2YFLB 2YFJB 3K63A 2P05A 1N5HA 1FGTA 2HMKB 3K7CA 2XSOB 3NQZA 5KP3A 5HGRA 1EQKA 1G96A 3MHEA 4MJDA 3SOYA 3LT8A 1RRHA 2XRXB 2CC3A 1PFPA 4QWTA 2OQEC 4HM1B 2B1XB 4BTWA 1ASKA 1CEWI 4K61A 4R9LA 4FCMA 1LVNA 4FMBA 3BNEA 1NU3A 2GXFA 3EN1B 3G0KA 1JRQA 1IQ8A 4WYKB 2CG1A 8CHOA 3V92A 1VQL3 2BMOB 5IF6A 1OH0A 1US1A 3FGYA 1VQK3 1JB2A 1JB5A 1OUNA 3NXJA 4FCZA 2GU1A 5IG0A 1Q40B 1ROAA 2M7OA 1QVF2 2XEPA 3S29A 5KP1A 3CCM3 3N8BA 4HZ9B 1A90A 3CCR3 1RKYA 1U5OA 2OOVC 3QRDA 1OHSA 1W00A 2W9QA 3WA3A 4TX4A 2XGLA 3UNLA 1IVVA 4STDA 4NHFA 3Q90A 2IMJA 1W7CA 4HM0B 4R9KA 1LXEA 3WODG 3OV4A 4N6V0 4X2OA 5BVBA 1E3RA 2W9PA 3SEDA 4FR9A 3DM8A 3H51A 4EYCA 3X42A 4LEHA 2CWVA 1FGRA 1TIJA 5TGNA 2OCTA 3F9SA 3U1WA 1M9GA 5IW9A 3EQQB 1E3VA 4IPBA 2F99A 1IQXA 1ULJB 3DMCA 4KZ1A 4O02B 3OXAA 1E97A 3FG4A 1SQWA 1Q40A 5ELJA 4HM3B 3LTCA 5FW5A 3UB1A 4EBGA 4IT7A 3I563 5BXQA 1SIHA 2XFTA 3M8CA 3T0UA 1DMMA 3LOYA 3MPHA 3EX9A 2XGNA 2FNQA 4RBNA 3OWYA 1QALA 2XH9A 3F14A 4HZBB 4R1KA 1MOLA 3MYTA 2W04A 3PCSA 3G6E3 3VF1A 1TFOA 4HM5B 2OTJ3 3DGNA 3NX0A 1WNHA 1WTHA 2ML5A 2HMOB 3ECFA 4XDVA 2KCDA 2Z7AA 1VZZA 2JQ5A 3V99A 4EXRA 4HM8B 2F98A 2HMJB 1QVG2 3MG2A 3FLJA 3BNDA 2Y74A 3B7CA 4H3UA 2P09A 3KIIA 4K1VA 3CC43 2BMRB 1RRLA 2PNCA 3WOFB 1EKMA 3EJVA 3CU3A 4CDLA 2ZL8A 2HMNB 3D9RA 1Q42A 4EV2A 3KSED 1DVCA 1YGEA 2RSXA 2KXGA 3HZPA 1QAFA 3CCS3 4MMZB 4HM7B 5G2GA 1S5AA 2MC8A 1K8A4 3B4OA 3GZYB 3QK9A 1JNQA 2BO9B 1Q7Y4 3FZWA 1UW1A 2RGQA 7STDA 3CCL3 3CNMA 3OW22 1IVWA 3IMAB 2V1LA 3BB9A 1M904 3N54B 4L7KA 3BNCA 2ML6A 1NO3A 2B24B 2ZDJA 4FMAA 3CME3 1STFI 1W2ZA 3DZLA 4O2HA 1W6GA 1K28A 4RNYA 2CHCA 1OPYA 3DGOA 3DUKA 1O7HB 2IUJA 2W2CA 3LZAA 2K54A 5STDA 5LC6A 2E2VA 5AEUB 2P0XA 3EF8A 4RNZA 3HK4A 3J7Yd 3NV0B 4I4KA 4WHAA 1A67A 3WA2X 1D6ZA 1ULIB 1Q814 3DGLA 1CQSA 1NB5I 2WOFA 1HU9A 1N5PA 5CXOA 1KQS2 1KC84 1QMAA 3NBJA 4N6LA 5IERA 1JN5A 3LXUX 2W6JH 3WOEB 3SOAA 3AMOA 4LGQA 5EEOA 4KFEA 1YJW3 3EB8A 3PYJA 4EV5A 1YIJ3 1GY6A 2W03A 4MMXB 4XDWA 4R80A 3UL5A 2BHMA 3NBBA 1WMOA 4CCVA 3CCE3 1L5GB 3HI7A 3PCRA 1VQM3 2GEYA 1FUWA 1U8CB 3IJEB 4PEJA 3FSDA 3F7SA 1VQ73 1TU5A 3PGBA 3Q2PA 4ORLA 3X3YA 3KE7A 5EVHA 4WFOA 3NV0A 3H3HA 3GWRA 1VQ43 2CWUA 1ZO2A 3CD63 1O7WB 3O8YA 1D6YA 4OVMA 2P38A 1A2VA 2STDA 4GB5A 3S67A 4K1UA 4XB5A 2PZVA 1UUWB 5JPUA 2KRTA 1GY5A 2O9UX 3PZWA 3WMDA 1NDOB 3IPTA 3KZTA 4Q53A 5IG5A 2FXTA 1VQO3 1K41A 2JDIH 4L8PA 3NUVA 1QJGA 1N9EA 4AKZA 5IEOA 3EBTA 1C7HA 2I9WA 2OQEA 3CNXA 6STDA 3F7XA 1OACA 1OHOA 1JJ22 4HYZA 1VQN3 2QIYA 5CK6A 4HJLB 3CPW2 3SLUA 3LTAA 1JB4A 2WGOA 1GYBA 1SJWA 3CPOA 4J9AA 5KP4A 1VQP3 3K5TA 3NBRA 1OHPA 1YI23 1BUQA 2F86B 3BLZA 1AVKA 5IEPA 3BNBA 4LZIA 1YHQ3 4N3VA 1A2KA 1LOXA 3F8HA 3CCU3 3K0ZA 3CCJ3 5A0OB 1J2BA 1O7NB 4LSOA 4O3VA 3X3XA 3DGMA 3FH1A 1YIT3 2R4IA 1UI8A 4XBXA 1IVXA 1O7PB 2L4VA 1ZX2A 3EC9A 4XM4A 4O8SA 3SX1A 3CXC2 5IG4A 3X40A 3UJMA 3EBYA 1SPUA 1MNLA 1FA3A 1IQYA 4ZM8A 4RZMA 3SXXA 4BTXA 1QAKA 4FCJA 4J8TA 2CFKA 1JN5B 2GBWB 1M1K4 3AMOB 3G16A 3ALAA 3EHCA 4HBRA 2IA7A 5CLKA 1CYUA 1F8NA 1OGZA 2Z77A 3N9HA 1M1XB 4R4KA 4H61A 4MEIA 1TFKA 5LC7A 5AIIA 1EA2A 2INXA 4MMYB 2CG0A 3MG3A 3JUPA 4GL6A 3VGNA 3CMA3 5D81A 4LMIA 4AEQA 3JUOA 4OK0A 3LH4A 3L0RA 1K9M4 1HKXA 3GZXB 4KFFA 2C10A 5IENA 1K734 3DXOA 1Y4KA 3FKAA 1RJOA 4XBTA 3SVAA 2CFDA 1STDA 3LTDA 2QA43 1OCVA 3GZRA 3GAXA 1IV9A 2CFGA 3F8XA 3EN8A 1KWIA 2XF3A 5AI1A 1N8QA 5JBSA 3S28A 2CH9A 2W56A 1N8R4 1YVBI 2LYXA 1VQ53 2QGUA 1T5YA 1D6UA 2Z76A 4AKYA 1W2B2 1W02A 1KSIA 3X41A 4N6OB 4K90B 3FG1A 3CCV3 3T8NA 3WDGB 1VQ93 3NQYA 4KFDA 4OUQA 5ELUA 1JKGB 1NB3I 2CKFB 1WMNA 4BTYA 5AEWB 5AIGA 3GZBA 2CK3H 5EQLA 2CFWA 2Z6BA 3KSPA 2UX0A 1W01A 2Y73A 2W0QA 1Z1SA 2GBXB 4HM2B 2RFRA 4XBYA 3HIIA 4WP5A 3FG3A 5FGOA 2Q07A 1ISKA 1GD4A 2D1WA 3CCQ3 5JPPA 5CF2A 1IT7A 4N6TA 1UI7A 1IU7A 3I0YA 2BNGA 5D82A 3KFQC 3G8ZA 2FGTA 1IVUA 5AYRB 1CYVA 3A76A 4X2HA 2BT3A 3RGAA 2WO0A 2OWPA 3LT9A 1NWWA 1FGOA 4WWUC 2GEXA 3MWZA 1FGQA 1VQ83 3LTBA 3B4PA 5AYSC 2LQVA 3EE1A 2WGQA 2K0MA 4JRFA 5AIFA 3STDA 3UL6A 1IDPA 4FMCA 1GS3A 3K9MC 2P0MA 2C11A 4NREA 1VQ63 2QEX3 1W6YA 1DMQA 1YJN3 3JUMA 4HM6B 1JKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROA A;  5A0O B;  1STF I;  1A90 A;  3QRD A;  2W9Q A;  4TX4 A;  1MNL A;  1FA3 A;  4ZM8 A;  1LXE A;  5LC6 A;  4N6V 0;  4N6N B;  2W9P A;  1A67 A;  4N6U A;  4EYC A;  1RN7 A;  1TIJ A;  2OCT A;  1NB5 I;  1M9G A;  1CYU A;  1N5P A;  4N6L A;  4N6M A;  5LC7 A;  3PYJ A;  1GD3 A;  1IV7 A;  5ELJ A;  3LH4 A;  3L0R A;  3UL5 A;  4IT7 A;  3PXM A;  4CCV A;  3SVA A;  1FUW A;  3GAX A;  1MOL A;  1IV9 A;  1KWI A;  3Q2P A;  2CH9 A;  1YVB I;  3NX0 A;  1WNH A;  4N6O B;  1N9J A;  5ELU A;  1NB3 I;  5EQL A;  1R4C A;  1DVD A;  3S67 A;  1GD4 A;  3PS8 A;  2O9U X;  4N6T A;  1N5H A;  1EQK A;  3KFQ C;  1G96 A;  3KSE D;  1CYV A;  1DVC A;  2KXG A;  1PFP A;  3MWZ A;  1CEW I;  2BO9 B;  3UL6 A;  3K9M C;  3IMA B;  4LZI A; 
#chains in the Genus database with same CATH topology
 4HM4 B;  3LYG A;  3A5E A;  1IK3 A;  4WYK A;  1IT8 A;  3KKG A;  4HKV B;  2D42 A;  3F40 A;  1UDI I;  1NJI 4;  1BNI A;  1GY7 A;  2E2T A;  2UGI A;  1LNH A;  2GU3 A;  1B2S A;  2MF7 A;  1BSE A;  3OWS A;  5D83 A;  1BRN L;  1UCI A;  3VSY A;  3MG1 A;  1AV4 A;  3BIR A;  5BU4 A;  3G4S 3;  2BMQ B;  1TP6 A;  2CWT A;  3NM7 A;  1O7M B;  4FMD A;  3HX8 A;  2IUK A;  1BGS A;  2CFL A;  4N6N B;  2YX9 A;  1LRA A;  1GMR A;  2RCD A;  4N6U A;  3FF2 A;  1JV2 B;  2F5M A;  1RN7 A;  1BVI A;  1WQL B;  3ER7 A;  2CW9 A;  2SBL A;  3S5C A;  1Q82 4;  1OF5 B;  4JF8 A;  2E2U A;  2A15 A;  3G71 3;  2CIU A;  3GRD A;  4N6M A;  3X3Z A;  1S72 3;  2OOV A;  1DYU A;  3CC7 3;  2XR8 B;  1UGI A;  1Q86 4;  3FF0 A;  3CC2 3;  1AR0 A;  1GD3 A;  1IV7 A;  1V74 A;  3JUN A;  3NHX A;  4G1M B;  4L8O A;  3B8L A;  5CF1 A;  3RGR A;  2HMM B;  2J8X B;  1RN4 A;  2W56 B;  2KF3 A;  3JVC A;  3MKI A;  3Q1C A;  5I97 A;  3D3L A;  2XFS A;  2XSH B;  3PXM A;  1LOV A;  3DGY A;  5DRV A;  8RNT A;  2HML B;  4IIA A;  1LOY A;  1RTU A;  3DY5 A;  5DRE A;  4EC6 A;  1BRJ A;  5AIH A;  2O3O A;  2WOH A;  1X1X A;  1G02 A;  3TDG A;  2H0I A;  3T8U A;  1BRS A;  3HIG A;  1TUH A;  1DMN A;  3E99 A;  4HVN A;  1UCL A;  3I55 3;  2OTL 3;  1EG9 B;  2IYJ A;  4U13 A;  1SII A;  4KVH A;  1W4N A;  3KN4 A;  3FCS B;  3S27 A;  1FGM A;  1GOY A;  3V98 A;  5IG3 A;  1YJ9 3;  1N9J A;  1HYF A;  1FW7 A;  3ROB A;  1RMS A;  1OF5 A;  7GSP A;  1WMP A;  1KD1 4;  1R4C A;  3OX9 A;  3OWU A;  1DVD A;  1ROV A;  1W6C A;  3JUQ A;  1O7G B;  1UUV B;  3RDE A;  3MSO A;  3U97 A;  2YFI B;  1W5Z A;  1OGX A;  3LML A;  3NM2 A;  1PU4 A;  1AVL A;  3PS8 A;  2YFL B;  2YFJ B;  3K63 A;  2P05 A;  6RNT A;  1FGT A;  1N5H A;  2HMK B;  3K7C A;  2KF6 A;  2XSO B;  3NQZ A;  5KP3 A;  5HGR A;  1EQK A;  1G96 A;  3MHE A;  1B2X A;  4MJD A;  3SOY A;  3LT8 A;  1RRH A;  2CC3 A;  2XRX B;  1PFP A;  1BRH A;  4I5Q A;  4QWT A;  2OQE C;  4HM1 B;  2B1X B;  1BRI A;  1ASK A;  1CEW I;  4K61 A;  1I2G A;  4R9L A;  4BTW A;  1Q9E A;  4FCM A;  1LVN A;  4FMB A;  3BNE A;  1RGH A;  1X1Y A;  1NU3 A;  2GXF A;  3EN1 B;  3G0K A;  1JRQ A;  1IQ8 A;  4WYK B;  2CG1 A;  4GHO A;  8CHO A;  3V92 A;  1VQL 3;  2BMO B;  5IF6 A;  1OH0 A;  1BNF A;  1US1 A;  3FGY A;  1VQK 3;  1JB2 A;  1JB5 A;  3RNT A;  1OUN A;  3NXJ A;  4FCZ A;  2GU1 A;  3AHS A;  1Q40 B;  1ROA A;  5IG0 A;  2M7O A;  1QVF 2;  1JBT A;  1T3B A;  2XEP A;  1RGL A;  3S29 A;  5KP1 A;  3CCM 3;  5GSP A;  3N8B A;  4HZ9 B;  1A90 A;  3CCR 3;  1GMQ A;  1RKY A;  1U5O A;  2OOV C;  3QRD A;  3WR2 A;  1OHS A;  1W00 A;  2W9Q A;  3WA3 A;  1BAN A;  2XGL A;  4TX4 A;  1I8V A;  3UNL A;  1IVV A;  3Q3F A;  1LNI A;  4STD A;  4NHF A;  1X1U A;  2IMJ A;  3Q90 A;  1W7C A;  4HM0 B;  4R9K A;  1LXE A;  3WOD G;  3OV4 A;  4N6V 0;  4X2O A;  5BVB A;  4CJN A;  1E3R A;  3BU4 A;  2W9P A;  3SED A;  1DE3 A;  4FR9 A;  3DM8 A;  3H51 A;  4EYC A;  3X42 A;  4LEH A;  2CWV A;  1FGR A;  1TIJ A;  5TGN A;  2OCT A;  3F9S A;  1RLS A;  2SAR A;  1M9G A;  1FUT A;  3U1W A;  5IW9 A;  1JBR A;  2ZA4 A;  3EQQ B;  1BSA A;  1E3V A;  4IPB A;  3D5G A;  1I70 A;  2F99 A;  1IQX A;  1ULJ B;  4KT3 B;  1JZD A;  3DMC A;  1NNV A;  4KZ1 A;  4O02 B;  3OXA A;  1E97 A;  3DH2 A;  2KAA A;  3FG4 A;  1SQW A;  5RNT A;  1Q40 A;  5ELJ A;  4HM3 B;  3LTC A;  5FW5 A;  3UB1 A;  4EBG A;  1IYY A;  4IT7 A;  3I56 3;  4RNT A;  1SIH A;  5BXQ A;  2XFT A;  3M8C A;  3T0U A;  1DMM A;  3LOY A;  7RNT A;  1R4Y A;  3MPH A;  3EX9 A;  5HOH A;  2XGN A;  2FNQ A;  4RBN A;  3OWY A;  1QAL A;  2XH9 A;  3F14 A;  4HZB B;  4R1K A;  1MOL A;  3MYT A;  2W04 A;  3PCS A;  3G6E 3;  1I0V A;  1V57 A;  3VF1 A;  2RNT A;  1TFO A;  4HM5 B;  2OTJ 3;  3DGN A;  3NX0 A;  1WNH A;  3ZG5 A;  1WTH A;  2ML5 A;  2HMO B;  3ECF A;  4XDV A;  2KCD A;  1BSB A;  2Z7A A;  1VZZ A;  9RNT A;  2JQ5 A;  1UCJ A;  3V99 A;  4EXR A;  4HM8 B;  2F4Y A;  2F98 A;  2HMJ B;  1QVG 2;  3AHW A;  3MG2 A;  3FLJ A;  3BND A;  2Y74 A;  4ILF A;  3B7C A;  4H3U A;  2P09 A;  3KII A;  4K1V A;  3CC4 3;  2BMR B;  1RRL A;  1RGE A;  2PNC A;  1MWT A;  1MWS A;  3WOF B;  4HOH A;  1EKM A;  1I0X A;  3CU3 A;  3EJV A;  4CDL A;  2ZL8 A;  2BU4 A;  2HMN B;  1RGA A;  3D9R A;  1TRQ A;  1Q42 A;  4J5G A;  1C54 A;  4EV2 A;  3KSE D;  1DVC A;  1BUJ A;  1T2I A;  1YGE A;  2RSX A;  2KXG A;  3HZP A;  1QAF A;  3CCS 3;  4MMZ B;  4HM7 B;  5G2G A;  1S5A A;  2MC8 A;  1K8A 4;  3B4O A;  1I2F A;  3GZY B;  1B20 A;  4HAA A;  3QK9 A;  1JNQ A;  2BO9 B;  1Q7Y 4;  3FZW A;  2F56 A;  1UW1 A;  1CH0 A;  2RGQ A;  2H0G A;  1JZO A;  7STD A;  3CCL 3;  3CNM A;  3OW2 2;  1IVW A;  1BNR A;  3IMA B;  2V1L A;  3BB9 A;  1LOW A;  1M90 4;  3N54 B;  4L7K A;  3BNC A;  2ML6 A;  1NO3 A;  2B24 B;  2ZDJ A;  4FMA A;  3CME 3;  1STF I;  1W2Z A;  3DZL A;  4O2H A;  1BOX A;  1TRP A;  3ZG0 A;  1UCK A;  1BAO A;  1W6G A;  2KF4 A;  1JBS A;  1K28 A;  4RNY A;  2CHC A;  1OPY A;  3DGO A;  3DUK A;  2H0H A;  1O7H B;  1TTO A;  2IUJ A;  2W2C A;  3LZA A;  2K54 A;  5STD A;  1YVS A;  5LC6 A;  2E2V A;  5AEU B;  2P0X A;  3EF8 A;  4RNZ A;  3HK4 A;  3J7Y d;  1BNG A;  3NV0 B;  4I4K A;  4WHA A;  1B2Z A;  1A67 A;  1LQG C;  3WA2 X;  1D6Z A;  1ULI B;  1Q81 4;  3DGL A;  1CQS A;  1NB5 I;  2WOF A;  1HU9 A;  1N5P A;  5CXO A;  1EUI C;  2IY2 A;  1QMA A;  1UGH I;  1KC8 4;  3NBJ A;  4N6L A;  5IER A;  1JN5 A;  3LXU X;  1LQM B;  2W6J H;  3WOE B;  3SOA A;  3AMO A;  4LGQ A;  5EEO A;  2K3D A;  4KFE A;  1YJW 3;  3EB8 A;  3PYJ A;  4EV5 A;  1YIJ 3;  4BL3 A;  1GY6 A;  1RSN A;  2W03 A;  4MMX B;  4XDW A;  4R80 A;  3UL5 A;  5BIR A;  2BHM A;  3NBB A;  1AQZ A;  4CPK A;  1WMO A;  4CCV A;  3CCE 3;  1I2E A;  1L5G B;  1YGW A;  3HI7 A;  3PCR A;  1VQM 3;  2GEY A;  1PYL A;  1FUW A;  1U8C B;  1PY3 A;  3IJE B;  2RBI A;  3URP A;  4PEJ A;  3WHO A;  3FSD A;  2BIR A;  3F7S A;  1VQ7 3;  1RGC A;  1TU5 A;  1BRK A;  3PGB A;  3Q2P A;  1BNJ A;  4ORL A;  3X3Y A;  3KE7 A;  5EVH A;  4LYL B;  3KCH A;  1EEJ A;  1RGG A;  4WFO A;  3NV0 A;  3H3H A;  3GWR A;  1HZ1 A;  1VQ4 3;  3ZFZ A;  2CWU A;  1ZO2 A;  3CD6 3;  1O7W B;  3O8Y A;  1D6Y A;  1B2U A;  2KF5 A;  5M1A A;  4OVM A;  2P38 A;  3HOH A;  1RDS A;  1A2V A;  2STD A;  4GB5 A;  3S67 A;  4K1U A;  4XB5 A;  2PZV A;  1UUW B;  5JPU A;  2KRT A;  1GY5 A;  2O9U X;  5G1L A;  4BIR A;  1UUG B;  3PZW A;  3WMD A;  1ZS7 A;  1NDO B;  3IPT A;  3KZT A;  4Q53 A;  5IG5 A;  2FXT A;  1VQO 3;  1K41 A;  2JDI H;  4L8P A;  1BU4 A;  1QJG A;  3NUV A;  1N9E A;  4AKZ A;  1MWU A;  5IEO A;  3EBT A;  1C7H A;  2I9W A;  2OQE A;  3CNX A;  1ZGX A;  6STD A;  1BNE A;  1VQQ A;  3F7X A;  1OAC A;  1OHO A;  3D79 A;  4HYZ A;  1JJ2 2;  1VQN 3;  2QIY A;  1RN1 A;  5CK6 A;  1MGW A;  4HJL B;  3CPW 2;  3SLU A;  3LTA A;  1JB4 A;  2WGO A;  1GYB A;  1SJW A;  3CPO A;  4J9A A;  5KP4 A;  4J5K A;  3K5T A;  3NBR A;  1OHP A;  1VQP 3;  1YI2 3;  2F86 B;  3BLZ A;  1BUQ A;  1AVK A;  2HOH A;  5IEP A;  3BNB A;  6GSP A;  4LZI A;  1YHQ 3;  4N3V A;  1LOX A;  1A2K A;  3F8H A;  3SYU A;  3CCU 3;  3K0Z A;  3CCJ 3;  5A0O B;  3GSP A;  1J2B A;  1O7N B;  1TJD A;  4LSO A;  4O3V A;  3X3X A;  1MGR A;  3DGM A;  5M19 A;  3FH1 A;  1YIT 3;  2R4I A;  1UI8 A;  4XBX A;  1IVX A;  1O7P B;  2L4V A;  1ZX2 A;  3EC9 A;  4XM4 A;  4O8S A;  1GOV A;  3SX1 A;  3CXC 2;  5IG4 A;  1RHL A;  3X40 A;  1B3S A;  3UJM A;  3EBY A;  1SPU A;  1MNL A;  1FA3 A;  1IQY A;  4ZM8 A;  2C4B A;  4RZM A;  3SXX A;  1QAK A;  4FCJ A;  4BTX A;  4J8T A;  2CFK A;  1JN5 B;  2GBW B;  1MWR A;  1M1K 4;  1GOU A;  3AMO B;  3G16 A;  1T2H A;  1X1W A;  3ALA A;  3EHC A;  2R41 A;  2IA7 A;  2CX0 A;  4HBR A;  5CLK A;  4NPB A;  1CYU A;  1DET A;  1F8N A;  1OGZ A;  2Z77 A;  1FUS A;  3N9H A;  1B27 A;  2AAE A;  1M1X B;  2UUG C;  4R4K A;  4H61 A;  1FZU A;  4MEI A;  2AAD A;  1TFK A;  1RNB A;  5LC7 A;  5G1K A;  5AII A;  1EA2 A;  5M18 A;  2INX A;  4MMY B;  2CG0 A;  1BRG A;  1RGF A;  3JUP A;  3MG3 A;  4GL6 A;  3VGN A;  1RCL A;  1YNV X;  4EW5 A;  2ZHX B;  3CMA 3;  5D81 A;  4LMI A;  3AGN A;  4AEQ A;  3JUO A;  4OK0 A;  1Q7H A;  3LH4 A;  3L0R A;  1K9M 4;  1HKX A;  3GZX B;  4KFF A;  2C10 A;  3D4A A;  5IEN A;  1K73 4;  1I3F A;  1Y4K A;  3DXO A;  3FKA A;  1RJO A;  4XBT A;  3SVA A;  2CFD A;  1STD A;  3LTD A;  2QA4 3;  1OCV A;  3GZR A;  3GAX A;  1IV9 A;  2CFG A;  3F8X A;  1BSC A;  1KWI A;  2XF3 A;  3EN8 A;  1N8Q A;  3D5I A;  5AI1 A;  5JBS A;  1GSP A;  3S28 A;  2CH9 A;  2W56 A;  1N8R 4;  1YVB I;  2LYX A;  1VQ5 3;  2QGU A;  1AY7 A;  1T5Y A;  1D6U A;  3AGO A;  2Z76 A;  4AKY A;  2GSP A;  1W2B 2;  1W02 A;  1KSI A;  3X41 A;  4N6O B;  4K90 B;  3FG1 A;  3CCV 3;  1B21 A;  3T8N A;  3WDG B;  1VQ9 3;  3NQY A;  4KFD A;  4OUQ A;  2F5W A;  1JKG B;  1NB3 I;  2CKF B;  1WMN A;  5ELU A;  4BTY A;  1G0T A;  5AEW B;  1I3I A;  3GZB A;  5AIG A;  2CK3 H;  5EQL A;  2CFW A;  2Z6B A;  1GMP A;  3KSP A;  2UX0 A;  1W01 A;  2Y73 A;  1Z1S A;  2GBX B;  1RCK A;  2W0Q A;  2RFR A;  4HM2 B;  3HII A;  4XBY A;  4WP5 A;  3FG3 A;  5FGO A;  2Q07 A;  1ISK A;  1GD4 A;  2L1S A;  2D1W A;  3CCQ 3;  5JPP A;  4BU4 A;  5CF2 A;  1IT7 A;  4N6T A;  1B2M A;  1UI7 A;  4BL2 A;  1IU7 A;  3I0Y A;  2BNG A;  5D82 A;  1A2P A;  3KFQ C;  3G8Z A;  2FGT A;  1BSD A;  1IVU A;  5AYR B;  1KQS 2;  1CYV A;  3A76 A;  4X2H A;  2BT3 A;  4GSP A;  3RGA A;  2WO0 A;  2OWP A;  1RNT A;  3LT9 A;  1NWW A;  1FGO A;  4WWU C;  2GEX A;  3MWZ A;  1FGQ A;  1VQ8 3;  1BNS A;  1FYS A;  3LTB A;  3B4P A;  5AYS C;  2LQV A;  2CX1 A;  3EE1 A;  2WGQ A;  2K0M A;  4JRF A;  4DKI A;  5AIF A;  3STD A;  3UL6 A;  1IDP A;  4FMC A;  1SAR A;  1GS3 A;  3K9M C;  2P0M A;  1RGK A;  2C11 A;  4NRE A;  1VQ6 3;  2QEX 3;  1V58 A;  1W6Y A;  1DMQ A;  1BIR A;  1YJN 3;  3JUM A;  4HM6 B;  1JKG A; 
#chains in the Genus database with same CATH homology
 4HM4 B;  3LYG A;  1IK3 A;  4WYK A;  1IT8 A;  3KKG A;  4HKV B;  2D42 A;  3F40 A;  1NJI 4;  1GY7 A;  2E2T A;  1LNH A;  2GU3 A;  2MF7 A;  3OWS A;  5D83 A;  3VSY A;  3MG1 A;  1AV4 A;  3G4S 3;  2BMQ B;  1TP6 A;  2CWT A;  3NM7 A;  1O7M B;  4FMD A;  3HX8 A;  2IUK A;  2CFL A;  4N6N B;  2YX9 A;  2RCD A;  4N6U A;  3FF2 A;  1JV2 B;  1RN7 A;  1WQL B;  3ER7 A;  2CW9 A;  2SBL A;  3S5C A;  1Q82 4;  1OF5 B;  4JF8 A;  2E2U A;  2A15 A;  3G71 3;  2CIU A;  3GRD A;  4N6M A;  3X3Z A;  1S72 3;  2OOV A;  1DYU A;  3CC7 3;  2XR8 B;  1Q86 4;  3FF0 A;  3CC2 3;  1AR0 A;  1GD3 A;  1IV7 A;  1V74 A;  3JUN A;  3NHX A;  4G1M B;  4L8O A;  3B8L A;  5CF1 A;  3RGR A;  2HMM B;  2W56 B;  3MKI A;  3JVC A;  3Q1C A;  5I97 A;  3D3L A;  2XFS A;  2XSH B;  3PXM A;  5DRV A;  2HML B;  4IIA A;  3DY5 A;  5DRE A;  4EC6 A;  5AIH A;  2O3O A;  2WOH A;  3TDG A;  3T8U A;  3HIG A;  1TUH A;  1DMN A;  3E99 A;  4HVN A;  2OTL 3;  3I55 3;  1EG9 B;  4U13 A;  1SII A;  4KVH A;  1W4N A;  3KN4 A;  3FCS B;  3S27 A;  1FGM A;  3V98 A;  5IG3 A;  1YJ9 3;  1N9J A;  3ROB A;  1OF5 A;  1WMP A;  1KD1 4;  1R4C A;  3OX9 A;  3OWU A;  1DVD A;  1ROV A;  1W6C A;  3JUQ A;  1O7G B;  1UUV B;  3RDE A;  3MSO A;  3U97 A;  2YFI B;  1W5Z A;  1OGX A;  3LML A;  3NM2 A;  1PU4 A;  1AVL A;  3PS8 A;  2YFL B;  2YFJ B;  3K63 A;  2P05 A;  1N5H A;  1FGT A;  2HMK B;  3K7C A;  2XSO B;  3NQZ A;  5KP3 A;  5HGR A;  1EQK A;  1G96 A;  3MHE A;  4MJD A;  3SOY A;  3LT8 A;  1RRH A;  2XRX B;  2CC3 A;  1PFP A;  4QWT A;  2OQE C;  4HM1 B;  2B1X B;  4BTW A;  1ASK A;  1CEW I;  4K61 A;  4R9L A;  4FCM A;  1LVN A;  4FMB A;  3BNE A;  1NU3 A;  2GXF A;  3EN1 B;  3G0K A;  1JRQ A;  1IQ8 A;  4WYK B;  2CG1 A;  8CHO A;  3V92 A;  1VQL 3;  2BMO B;  5IF6 A;  1OH0 A;  1US1 A;  3FGY A;  1VQK 3;  1JB2 A;  1JB5 A;  1OUN A;  3NXJ A;  4FCZ A;  2GU1 A;  5IG0 A;  1Q40 B;  1ROA A;  2M7O A;  1QVF 2;  2XEP A;  3S29 A;  5KP1 A;  3CCM 3;  3N8B A;  4HZ9 B;  1A90 A;  3CCR 3;  1RKY A;  1U5O A;  2OOV C;  3QRD A;  1OHS A;  1W00 A;  2W9Q A;  3WA3 A;  4TX4 A;  2XGL A;  3UNL A;  1IVV A;  4STD A;  4NHF A;  3Q90 A;  2IMJ A;  1W7C A;  4HM0 B;  4R9K A;  1LXE A;  3WOD G;  3OV4 A;  4N6V 0;  4X2O A;  5BVB A;  1E3R A;  2W9P A;  3SED A;  4FR9 A;  3DM8 A;  3H51 A;  4EYC A;  3X42 A;  4LEH A;  2CWV A;  1FGR A;  1TIJ A;  5TGN A;  2OCT A;  3F9S A;  3U1W A;  1M9G A;  5IW9 A;  3EQQ B;  1E3V A;  4IPB A;  2F99 A;  1IQX A;  1ULJ B;  3DMC A;  4KZ1 A;  4O02 B;  3OXA A;  1E97 A;  3FG4 A;  1SQW A;  1Q40 A;  5ELJ A;  4HM3 B;  3LTC A;  5FW5 A;  3UB1 A;  4EBG A;  4IT7 A;  3I56 3;  5BXQ A;  1SIH A;  2XFT A;  3M8C A;  3T0U A;  1DMM A;  3LOY A;  3MPH A;  3EX9 A;  2XGN A;  2FNQ A;  4RBN A;  3OWY A;  1QAL A;  2XH9 A;  3F14 A;  4HZB B;  4R1K A;  1MOL A;  3MYT A;  2W04 A;  3PCS A;  3G6E 3;  3VF1 A;  1TFO A;  4HM5 B;  2OTJ 3;  3DGN A;  3NX0 A;  1WNH A;  1WTH A;  2ML5 A;  2HMO B;  3ECF A;  4XDV A;  2KCD A;  2Z7A A;  1VZZ A;  2JQ5 A;  3V99 A;  4EXR A;  4HM8 B;  2F98 A;  2HMJ B;  1QVG 2;  3MG2 A;  3FLJ A;  3BND A;  2Y74 A;  3B7C A;  4H3U A;  2P09 A;  3KII A;  4K1V A;  3CC4 3;  2BMR B;  1RRL A;  2PNC A;  3WOF B;  1EKM A;  3EJV A;  3CU3 A;  4CDL A;  2ZL8 A;  2HMN B;  3D9R A;  1Q42 A;  4EV2 A;  3KSE D;  1DVC A;  1YGE A;  2RSX A;  2KXG A;  3HZP A;  1QAF A;  3CCS 3;  4MMZ B;  4HM7 B;  5G2G A;  1S5A A;  2MC8 A;  1K8A 4;  3B4O A;  3GZY B;  3QK9 A;  1JNQ A;  2BO9 B;  1Q7Y 4;  3FZW A;  1UW1 A;  2RGQ A;  7STD A;  3CCL 3;  3CNM A;  3OW2 2;  1IVW A;  3IMA B;  2V1L A;  3BB9 A;  1M90 4;  3N54 B;  4L7K A;  3BNC A;  2ML6 A;  1NO3 A;  2B24 B;  2ZDJ A;  4FMA A;  3CME 3;  1STF I;  1W2Z A;  3DZL A;  4O2H A;  1W6G A;  1K28 A;  4RNY A;  2CHC A;  1OPY A;  3DGO A;  3DUK A;  1O7H B;  2IUJ A;  2W2C A;  3LZA A;  2K54 A;  5STD A;  5LC6 A;  2E2V A;  5AEU B;  2P0X A;  3EF8 A;  4RNZ A;  3HK4 A;  3J7Y d;  3NV0 B;  4I4K A;  4WHA A;  1A67 A;  3WA2 X;  1D6Z A;  1ULI B;  1Q81 4;  3DGL A;  1CQS A;  1NB5 I;  2WOF A;  1HU9 A;  1N5P A;  5CXO A;  1KQS 2;  1KC8 4;  1QMA A;  3NBJ A;  4N6L A;  5IER A;  1JN5 A;  3LXU X;  2W6J H;  3WOE B;  3SOA A;  3AMO A;  4LGQ A;  5EEO A;  4KFE A;  1YJW 3;  3EB8 A;  3PYJ A;  4EV5 A;  1YIJ 3;  1GY6 A;  2W03 A;  4MMX B;  4XDW A;  4R80 A;  3UL5 A;  2BHM A;  3NBB A;  1WMO A;  4CCV A;  3CCE 3;  1L5G B;  3HI7 A;  3PCR A;  1VQM 3;  2GEY A;  1FUW A;  1U8C B;  3IJE B;  4PEJ A;  3FSD A;  3F7S A;  1VQ7 3;  1TU5 A;  3PGB A;  3Q2P A;  4ORL A;  3X3Y A;  3KE7 A;  5EVH A;  4WFO A;  3NV0 A;  3H3H A;  3GWR A;  1VQ4 3;  2CWU A;  1ZO2 A;  3CD6 3;  1O7W B;  3O8Y A;  1D6Y A;  4OVM A;  2P38 A;  1A2V A;  2STD A;  4GB5 A;  3S67 A;  4K1U A;  4XB5 A;  2PZV A;  1UUW B;  5JPU A;  2KRT A;  1GY5 A;  2O9U X;  3PZW A;  3WMD A;  1NDO B;  3IPT A;  3KZT A;  4Q53 A;  5IG5 A;  2FXT A;  1VQO 3;  1K41 A;  2JDI H;  4L8P A;  3NUV A;  1QJG A;  1N9E A;  4AKZ A;  5IEO A;  3EBT A;  1C7H A;  2I9W A;  2OQE A;  3CNX A;  6STD A;  3F7X A;  1OAC A;  1OHO A;  1JJ2 2;  4HYZ A;  1VQN 3;  2QIY A;  5CK6 A;  4HJL B;  3CPW 2;  3SLU A;  3LTA A;  1JB4 A;  2WGO A;  1GYB A;  1SJW A;  3CPO A;  4J9A A;  5KP4 A;  1VQP 3;  3K5T A;  3NBR A;  1OHP A;  1YI2 3;  1BUQ A;  2F86 B;  3BLZ A;  1AVK A;  5IEP A;  3BNB A;  4LZI A;  1YHQ 3;  4N3V A;  1A2K A;  1LOX A;  3F8H A;  3CCU 3;  3K0Z A;  3CCJ 3;  5A0O B;  1J2B A;  1O7N B;  4LSO A;  4O3V A;  3X3X A;  3DGM A;  3FH1 A;  1YIT 3;  2R4I A;  1UI8 A;  4XBX A;  1IVX A;  1O7P B;  2L4V A;  1ZX2 A;  3EC9 A;  4XM4 A;  4O8S A;  3SX1 A;  3CXC 2;  5IG4 A;  3X40 A;  3UJM A;  3EBY A;  1SPU A;  1MNL A;  1FA3 A;  1IQY A;  4ZM8 A;  4RZM A;  3SXX A;  4BTX A;  1QAK A;  4FCJ A;  4J8T A;  2CFK A;  1JN5 B;  2GBW B;  1M1K 4;  3AMO B;  3G16 A;  3ALA A;  3EHC A;  4HBR A;  2IA7 A;  5CLK A;  1CYU A;  1F8N A;  1OGZ A;  2Z77 A;  3N9H A;  1M1X B;  4R4K A;  4H61 A;  4MEI A;  1TFK A;  5LC7 A;  5AII A;  1EA2 A;  2INX A;  4MMY B;  2CG0 A;  3MG3 A;  3JUP A;  4GL6 A;  3VGN A;  3CMA 3;  5D81 A;  4LMI A;  4AEQ A;  3JUO A;  4OK0 A;  3LH4 A;  3L0R A;  1K9M 4;  1HKX A;  3GZX B;  4KFF A;  2C10 A;  5IEN A;  1K73 4;  3DXO A;  1Y4K A;  3FKA A;  1RJO A;  4XBT A;  3SVA A;  2CFD A;  1STD A;  3LTD A;  2QA4 3;  1OCV A;  3GZR A;  3GAX A;  1IV9 A;  2CFG A;  3F8X A;  3EN8 A;  1KWI A;  2XF3 A;  5AI1 A;  1N8Q A;  5JBS A;  3S28 A;  2CH9 A;  2W56 A;  1N8R 4;  1YVB I;  2LYX A;  1VQ5 3;  2QGU A;  1T5Y A;  1D6U A;  2Z76 A;  4AKY A;  1W2B 2;  1W02 A;  1KSI A;  3X41 A;  4N6O B;  4K90 B;  3FG1 A;  3CCV 3;  3T8N A;  3WDG B;  1VQ9 3;  3NQY A;  4KFD A;  4OUQ A;  5ELU A;  1JKG B;  1NB3 I;  2CKF B;  1WMN A;  4BTY A;  5AEW B;  5AIG A;  3GZB A;  2CK3 H;  5EQL A;  2CFW A;  2Z6B A;  3KSP A;  2UX0 A;  1W01 A;  2Y73 A;  2W0Q A;  1Z1S A;  2GBX B;  4HM2 B;  2RFR A;  4XBY A;  3HII A;  4WP5 A;  3FG3 A;  5FGO A;  2Q07 A;  1ISK A;  1GD4 A;  2D1W A;  3CCQ 3;  5JPP A;  5CF2 A;  1IT7 A;  4N6T A;  1UI7 A;  1IU7 A;  3I0Y A;  2BNG A;  5D82 A;  3KFQ C;  3G8Z A;  2FGT A;  1IVU A;  5AYR B;  1CYV A;  3A76 A;  4X2H A;  2BT3 A;  3RGA A;  2WO0 A;  2OWP A;  3LT9 A;  1NWW A;  1FGO A;  4WWU C;  2GEX A;  3MWZ A;  1FGQ A;  1VQ8 3;  3LTB A;  3B4P A;  5AYS C;  2LQV A;  3EE1 A;  2WGQ A;  2K0M A;  4JRF A;  5AIF A;  3STD A;  3UL6 A;  1IDP A;  4FMC A;  1GS3 A;  3K9M C;  2P0M A;  2C11 A;  4NRE A;  1VQ6 3;  2QEX 3;  1W6Y A;  1DMQ A;  1YJN 3;  3JUM A;  4HM6 B;  1JKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...