1MNLA

High-resolution solution structure of a sweet protein single-chain monellin (scm) determined by nuclear magnetic resonance spectroscopy and dynamical simulated annealing calculations, 21 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
91
Chain Sequence
GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONELLIN
publication title Solution structure of a sweet protein single-chain monellin determined by nuclear magnetic resonance and dynamical simulated annealing calculations.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Sweet protein
total genus 14
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 1998-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1mnlA00
1WNHA 1A67A 1NB3I 1GD3A 3QRDA 2OCTA 1CYUA 4N6V0 5ELUA 3UL5A 1N9JA 1N5HA 5LC6A 1KWIA 5ELJA 5LC7A 2W9PA 1RN7A 3K9MC 1MOLA 3S67A 5EQLA 1NB5I 4N6LA 4IT7A 4TX4A 1GD4A 1FA3A 4EYCA 3Q2PA 4N6OB 3PYJA 1STFI 2KXGA 1EQKA 1A90A 3KSED 1IV7A 1DVDA 4N6UA 4CCVA 3UL6A 3IMAB 2W9QA 2O9UX 1FUWA 3SVAA 1MNLA 1M9GA 4N6MA 1YVBI 1ROAA 3L0RA 1R4CA 5A0OB 4LZIA 1IV9A 3PS8A 1TIJA 3PXMA 3MWZA 1N5PA 1LXEA 4N6TA 3LH4A 1CYVA 3KFQC 2CH9A 1G96A 2BO9B 4N6NB 1CEWI 3GAXA 3NX0A 4ZM8A 1PFPA 1DVCA
chains in the Genus database with same CATH superfamily
1GSPA 2CFLA 5AEWB 2GBWB 1A67A 3LTCA 4O2HA 1UCLA 1BNIA 1OUNA 1JBSA 3FG4A 1X1WA 3D9RA 3HX8A 1DYUA 1Q864 3MG1A 1W01A 4RZMA 5GSPA 1C54A 3FH1A 3K63A 2KAAA 3B4OA 5ELUA 3HK4A 1FGMA 4FMCA 1LNIA 2C11A 3A76A 1VQ63 3UL5A 1JB4A 1FUSA 4L8PA 4WFOA 2Q07A 3T8NA 3CMA3 1UCIA 4J5GA 2W6JH 1ZX2A 3I0YA 4RNTA 1TUHA 2BHMA 5ELJA 5LC7A 4O8SA 2XFTA 2Z76A 1FZUA 1TU5A 1GY5A 2WGOA 3MSOA 4GL6A 1M1K4 1YJW3 1PU4A 5STDA 3SYUA 1HZ1A 1K734 2OTL3 1LOWA 5CF2A 1W5ZA 1YIJ3 2L1SA 4L7KA 1J2BA 1WQLB 1IT8A 2HMMB 4Q53A 4XBXA 4CPKA 3GWRA 1D6ZA 2XR8B 3MKIA 3RNTA 1I2FA 1BRGA 1MGWA 1SQWA 7RNTA 1GD4A 3DH2A 3ER7A 3KN4A 3B7CA 8CHOA 4KFEA 3CNXA 4ORLA 1BU4A 1NJI4 1IVWA 5D83A 1KSIA 1X1YA 3LYGA 4HZBB 1BUQA 1RHLA 3EC9A 3V99A 2AADA 3WMDA 4ILFA 1BNFA 4K90B 1BSCA 4RBNA 2IUKA 3T0UA 1IQXA 1RGFA 3PCSA 3ZG0A 1GOVA 1RTUA 3V98A 3SOYA 1B2XA 1BRSA 4EW5A 1EQKA 1BNRA 2H0GA 1I0XA 2XSHB 3F8XA 1LNHA 3KSED 1DVDA 5CF1A 1FYSA 3G0KA 4GSPA 1X1UA 3NBBA 5KP3A 4CCVA 4HM0B 1WMNA 4IIAA 3SEDA 3NM2A 3IMAB 1LOXA 2CWTA 1EEJA 1JKGA 1OHSA 3EN1B 2IUJA 2YFIB 2CK3H 2HMOB 4KVHA 4I4KA 1QVG2 3STDA 1EKMA 4FR9A 5TGNA 5M18A 1MNLA 1PY3A 2LQVA 1YGEA 3D3LA 4K61A 2MC8A 3TDGA 2JDIH 1DMNA 1OPYA 1HU9A 3KCHA 1MWUA 4R9KA 1YVBI 1UI8A 5G1LA 1BVIA 2CX0A 2J8XB 4DKIA 2F4YA 1Q824 3S29A 3MG2A 4BTXA 1W6YA 1R4CA 3SX1A 4LZIA 2KRTA 1AR0A 1JKGB 4HM7B 1FUTA 3LMLA 1BRKA 5IERA 2XFSA 1S5AA 1IVXA 2HOHA 3DGOA 4FCMA 3PS8A 1TIJA 1IK3A 1BSBA 2K0MA 2QGUA 2OWPA 1RNTA 2Z7AA 1OGXA 3GSPA 2ZA4A 2F5MA 3KE7A 3EBYA 3H51A 1N5PA 2Y73A 6STDA 4N6TA 1I70A 1CYVA 4LGQA 3KFQC 1LQMB 3EHCA 3JVCA 1TP6A 2BMRB 3DGLA 4R9LA 1RRLA 1E97A 4N6NB 1CEWI 1E3RA 1I8VA 2BU4A 2HMNB 3HIGA 1OF5A 3K7CA 3N8BA 3PZWA 4ZM8A 2YX9A 4O02B 4MMYB 1JBRA 2W03A 4GHOA 4BTYA 4QWTA 3RGRA 5FGOA 4HBRA 3CPW2 3LTAA 1GD3A 1BSEA 2WOFA 3QRDA 1IVUA 2OCTA 2RCDA 4KFFA 1OHPA 3CNMA 3SOAA 1MGRA 1A2VA 3CCR3 3FKAA 4STDA 5AIFA 4HM1B 1BANA 3OX9A 1SARA 4N6V0 2P38A 1OF5B 2PZVA 3CU3A 3VF1A 2GEYA 1DE3A 5HOHA 4HM5B 3OWUA 3U97A 3X3YA 1RMSA 1ULJB 3HOHA 1RGHA 3DMCA 1KWIA 3N9HA 4WP5A 2OQEA 2RSXA 1VQN3 1W02A 1O7WB 3H3HA 2FGTA 1BNEA 2RGQA 2P05A 2FNQA 4KZ1A 1W6GA 1YNVX 4HM6B 5EQLA 3OV4A 5IF6A 3LZAA 2W56A 2AAEA 1T2IA 2WGQA 4J9AA 2IMJA 3BNDA 1FGRA 3X3ZA 2RNTA 2BMQB 1VQL3 1RGLA 1BNSA 2CFGA 3GZBA 5D82A 1B2UA 3NUVA 1DETA 4MJDA 4EYCA 1ULIB 2YFLB 4FCZA 1VZZA 2GXFA 3Q2PA 2OOVA 2HMLB 1VQ83 1I3FA 2CX1A 2FXTA 1ZGXA 2XGNA 3FGYA 3FG3A 2KXGA 2W56B 6GSPA 5BVBA 3EB8A 3ZFZA 1A90A 3NV0A 1LOVA 4EXRA 1DMMA 5M1AA 2YFJB 3FF2A 1N9EA 2LYXA 3CC43 1TFKA 4EC6A 1JBTA 2IY2A 3MHEA 4FCJA 2STDA 4FMAA 2KCDA 3AHSA 5AIHA 2O9UX 2QIYA 1TRQA 3DGNA 4MMZB 2KF6A 1VQO3 1BRIA 3E99A 5IEOA 1GMRA 2BMOB 1K9M4 2BIRA 2XGLA 3J7Yd 2OTJ3 4LSOA 2GU3A 2O3OA 1T5YA 1LOYA 3CCM3 4LYLB 1IT7A 2C10A 1V74A 3S27A 1JZDA 1GY6A 1BRJA 3NV0B 1RCKA 3CME3 4EV2A 3DGYA 3RGAA 5AYRB 4XB5A 3NBJA 2IYJA 3L0RA 3Q90A 5CK6A 3HI7A 5IG5A 3NM7A 1TJDA 1JB5A 1W2ZA 4AKZA 3CC73 4HYZA 4LMIA 3JUQA 5JPUA 3MG3A 1A2PA 1US1A 1LRAA 3CCL3 3S28A 3F40A 5IEPA 1BRNL 1JN5A 3CCV3 1YI23 1O7NB 1T3BA 1BUJA 1RRHA 2CKFB 2BT3A 1EUIC 1SIHA 1NO3A 1TRPA 1YVSA 2CW9A 3KSPA 4HM3B 2CWVA 1D6UA 1RN1A 1NDOB 1D6YA 1RCLA 1F8NA 2C4BA 2SBLA 3EJVA 3EX9A 3FCSB 1LXEA 1V57A 4OVMA 2KF4A 2IA7A 5CXOA 1YIT3 2GBXB 3T8UA 3WA2X 1RGAA 2BO9B 1UGHI 1UUGB 3G4S3 2B24B 3GAXA 1UDII 3I563 1IDPA 4K1VA 1OGZA 2B1XB 2XSOB 3G6E3 1GS3A 2JQ5A 1PFPA 2F86B 4J5KA 1JN5B 1VQM3 2ML5A 3UNLA 1WNHA 7GSPA 4HKVB 2GEXA 1GMPA 2INXA 1NB3I 3EE1A 2CWUA 2K54A 5IENA 3FSDA 4KT3B 1RGGA 5G1KA 3NQZA 1EG9B 3VSYA 5IG4A 1IQYA 1BRHA 3B8LA 3DXOA 1N9JA 2PNCA 3SXXA 3LT9A 1Q42A 1QMAA 3DZLA 1N5HA 3IPTA 3RDEA 2F98A 5EVHA 4OUQA 1B2MA 3JUOA 3SLUA 4BIRA 1JB2A 2CFDA 5LC6A 1CH0A 5FW5A 1TTOA 4NPBA 1GYBA 3BNEA 2W9PA 1C7HA 1GY7A 4FMDA 8RNTA 1TFOA 3AGNA 3A5EA 1LVNA 1JNQA 1OCVA 3K9MC 1I2GA 3S67A 3BU4A 3WODG 4JRFA 7STDA 1X1XA 1RN4A 4NHFA 3WOFB 2ZHXB 3CXC2 1NB5I 3JUPA 1U5OA 3BNBA 2XF3A 3V92A 4RNZA 4WYKA 1Q7HA 1FGQA 1KQS2 1U8CB 1A2KA 1B21A 2R4IA 3CD63 3FZWA 2HMKB 1FA3A 1IYYA 1ZS7A 3OWSA 4WWUC 1GOUA 2W04A 3G16A 1RGCA 4IPBA 5JBSA 4N6OB 1JV2B 2KF5A 4XDWA 4BTWA 1RNBA 3N54B 4R80A 3G713 3PYJA 1ISKA 3WR2A 2P0XA 3BNCA 3X40A 1BSDA 3OXAA 1ASKA 1IV7A 4WYKB 5IG3A 1W7CA 3FF0A 3JUNA 4HM2B 4N6UA 3O8YA 1CQSA 3NQYA 5DRVA 1VQP3 3UL6A 9RNTA 1UGIA 2MF7A 3WOEB 3DY5A 1MWSA 4H61A 1FW7A 4HZ9B 4HAAA 2ZL8A 5DREA 3AGOA 3SVAA 4AKYA 4J8TA 3D5IA 1PYLA 3MYTA 3NBRA 3CC23 1I3IA 5EEOA 1VQ53 2A15A 3UB1A 4RNYA 5BIRA 1ROAA 1B20A 1I0VA 1RGKA 3G8ZA 3EQQB 3K0ZA 4R4KA 2R41A 4HOHA 3I553 1BNJA 3GZRA 1E3VA 2H0IA 4NREA 3ROBA 4MMXB 3LT8A 1O7GB 1VQQA 3ZG5A 3X3XA 1IV9A 1FGTA 2XEPA 2SARA 1K41A 1GMQA 1UI7A 1IVVA 4LEHA 1KD14 4O3VA 2F56A 1K8A4 1AVLA 5AEUB 1MWTA 3PXMA 5AI1A 3LTDA 3X42A 4HJLB 1B2SA 5AIIA 1QVF2 2P0MA 2W0QA 5IG0A 3LH4A 1RGEA 1JJ22 1VQ43 4N3VA 1S723 1M904 1OHOA 1Q40A 1N8R4 1O7HB 4K1UA 1HKXA 3NX0A 3X41A 4PEJA 2H0HA 1SIIA 3ECFA 2CFWA 1W2B2 4WHAA 2UX0A 1RLSA 5RNTA 2ML6A 3F7XA 2Z77A 3OWYA 3VGNA 3U1WA 1YJ93 1R4YA 3HZPA 3B4PA 3F8HA 3F7SA 2UGIA 1CYUA 1Q40B 3NHXA 1W6CA 1T2HA 5G2GA 1MWRA 1IQ8A 4U13A 2WO0A 1IU7A 1NWWA 2W2CA 4XBYA 4CDLA 4BL3A 5IW9A 3IJEB 3M8CA 1N8QA 1YHQ3 3KKGA 1V58A 2P09A 4XM4A 4H3UA 1VQ73 3UJMA 1SJWA 1JZOA 2CC3A 1DMQA 1RN7A 1B27A 1QALA 1BGSA 2CFKA 2OQEC 2WOHA 3HIIA 3Q3FA 1MOLA 2RBIA 5D81A 1BOXA 3ALAA 3BB9A 3LOYA 4GB5A 4AEQA 4N6LA 3URPA 4IT7A 2CHCA 1OACA 4X2OA 2CIUA 4TX4A 3KIIA 5BU4A 1AQZA 1KC84 3NXJA 4EV5A 4EBGA 3AMOA 5JPPA 1WMPA 3F14A 1BIRA 1UW1A 2RFRA 3GZYB 1NNVA 2QA43 3FLJA 4HVNA 1RDSA 3FG1A 1QAFA 1SPUA 1B3SA 2GU1A 2M7OA 2OOVC 1B2ZA 1STFI 3MPHA 4XDVA 1UUVB 3OW22 3D5GA 1BSAA 1BNGA 2V1LA 1JRQA 4G1MB 2K3DA 1ROVA 2Z6BA 3BLZA 2D1WA 3DGMA 1L5GB 1AV4A 3PCRA 2UUGC 2XH9A 3DM8A 1W00A 1EA2A 2Y74A 3AMOB 1QJGA 3GRDA 3Q1CA 1UCJA 2E2UA 1LQGC 1BAOA 1Y4KA 2W9QA 1RJOA 4HM8B 3CCQ3 1AY7A 1Z1SA 3WA3A 3D79A 1HYFA 1FUWA 3JUMA 2HMJB 4CJNA 1G0TA 1FGOA 3EN8A 4MEIA 5KP4A 3K5TA 1RKYA 4HM4B 4XBTA 4BU4A 1M9GA 4N6MA 5KP1A 1Q7Y4 3QK9A 4BL2A 3CPOA 3D4AA 1GOYA 1Q9EA 1YGWA 2F99A 2E2TA 3CCE3 2I9WA 6RNTA 4L8OA 5HGRA 4OK0A 5CLKA 5A0OB 1O7PB 1G02A 2L4VA 1I2EA 2KF3A 3BIRA 3WDGB 1YJN3 3DUKA 1ZO2A 5BXQA 3EF8A 2ZDJA 3CCS3 1UCKA 4JF8A 3GZXB 3CCJ3 3S5CA 4FMBA 2CG0A 5AIGA 5I97A 3LTBA 1UUWB 2XRXB 3LXUX 3F9SA 1VQ93 2F5WA 1AVKA 3KZTA 5AYSC 1Q814 3MWZA 5M19A 2QEX3 3PGBA 1K28A 3WHOA 3EBTA 1VQK3 2CH9A 1NU3A 1O7MB 2E2VA 1G96A 1STDA 2GSPA 4I5QA 2CG1A 1WMOA 2BNGA 4KFDA 1M1XB 1RSNA 1QAKA 1WTHA 1W4NA 4X2HA 3CCU3 4R1KA 3AHWA 2D42A 1DVCA 1OH0A
chains in the Genus database with same CATH topology
2CFLA 5AEWB 2GBWB 1A67A 3LTCA 4O2HA 1OUNA 3FG4A 3HX8A 3D9RA 1DYUA 1Q864 3MG1A 1W01A 4RZMA 3FH1A 3K63A 3B4OA 5ELUA 3HK4A 1FGMA 4FMCA 1VQ63 2C11A 3A76A 3UL5A 1JB4A 4L8PA 4WFOA 2Q07A 3T8NA 3CMA3 2W6JH 1ZX2A 3I0YA 1TUHA 2BHMA 5ELJA 5LC7A 4O8SA 2XFTA 2Z76A 1TU5A 1GY5A 2WGOA 3MSOA 4GL6A 1M1K4 1YJW3 1PU4A 5STDA 1K734 2OTL3 5CF2A 1W5ZA 1YIJ3 1J2BA 4L7KA 1WQLB 1IT8A 2HMMB 4Q53A 4XBXA 3GWRA 1D6ZA 2XR8B 3MKIA 1SQWA 1GD4A 3ER7A 3KN4A 3B7CA 8CHOA 4KFEA 3CNXA 4ORLA 1NJI4 1IVWA 5D83A 1KSIA 3LYGA 4HZBB 1BUQA 3EC9A 3V99A 3WMDA 4K90B 4RBNA 3T0UA 2IUKA 1IQXA 3PCSA 3V98A 3SOYA 1EQKA 2XSHB 3F8XA 1LNHA 3KSED 1DVDA 5CF1A 3G0KA 5KP3A 4CCVA 3NBBA 4HM0B 1WMNA 4IIAA 3SEDA 3NM2A 3IMAB 1LOXA 2CWTA 3EN1B 1JKGA 1OHSA 2IUJA 2YFIB 2CK3H 2HMOB 4KVHA 4I4KA 1QVG2 3STDA 1EKMA 4FR9A 5TGNA 1MNLA 2LQVA 4K61A 1YGEA 3D3LA 2MC8A 3TDGA 2JDIH 1DMNA 1OPYA 1HU9A 1YVBI 1UI8A 1Q824 3S29A 3MG2A 4BTXA 1W6YA 1R4CA 3SX1A 4LZIA 2KRTA 1AR0A 1JKGB 4HM7B 3LMLA 5IERA 2XFSA 1S5AA 1IVXA 3DGOA 4FCMA 3PS8A 1TIJA 1IK3A 2K0MA 2QGUA 2OWPA 2Z7AA 1OGXA 3KE7A 3EBYA 3H51A 1N5PA 2Y73A 6STDA 4N6TA 1CYVA 4LGQA 3KFQC 3EHCA 3JVCA 1TP6A 2BMRB 3DGLA 4R9LA 1RRLA 1E97A 4N6NB 1CEWI 1E3RA 2HMNB 3HIGA 3K7CA 4ZM8A 1OF5A 3CME3 3N8BA 3PZWA 2YX9A 4O02B 4MMYB 2W03A 4BTYA 4QWTA 3RGRA 5FGOA 4HBRA 3CPW2 3LTAA 1GD3A 2WOFA 3QRDA 1IVUA 2OCTA 2RCDA 4KFFA 1OHPA 3CNMA 3SOAA 3CCR3 1A2VA 3FKAA 4STDA 5AIFA 4HM1B 3OX9A 4N6V0 2P38A 1OF5B 2PZVA 3CU3A 3VF1A 2GEYA 4HM5B 3OWUA 3U97A 3X3YA 1ULJB 3N9HA 4WP5A 3DMCA 1KWIA 2OQEA 2RSXA 1VQN3 1W02A 1O7WB 3H3HA 2FGTA 2RGQA 2P05A 2FNQA 4KZ1A 1W6GA 4HM6B 5EQLA 3OV4A 5IF6A 3LZAA 2W56A 4J9AA 2WGQA 3X3ZA 2IMJA 3BNDA 1FGRA 2BMQB 1VQL3 2CFGA 3GZBA 5D82A 4MJDA 3NUVA 4EYCA 1ULIB 2YFLB 4FCZA 1VZZA 2GXFA 3Q2PA 2OOVA 2HMLB 1VQ83 2FXTA 2XGNA 3FGYA 3FG3A 2KXGA 2W56B 5BVBA 3EB8A 1A90A 3NV0A 4EXRA 1DMMA 2YFJB 3FF2A 1N9EA 2LYXA 3CC43 1TFKA 4EC6A 3MHEA 4FCJA 4FMAA 2STDA 2KCDA 5AIHA 2O9UX 2QIYA 3DGNA 4MMZB 1VQO3 3E99A 5IEOA 2BMOB 1K9M4 2XGLA 3J7Yd 2OTJ3 4LSOA 2GU3A 2O3OA 1T5YA 3CCM3 1IT7A 2C10A 1V74A 3S27A 1GY6A 3NV0B 4EV2A 3RGAA 5AYRB 4XB5A 3NBJA 3L0RA 3Q90A 5CK6A 3HI7A 5IG5A 3NM7A 4AKZA 1JB5A 1W2ZA 3CC73 4HYZA 4LMIA 3JUQA 5JPUA 3MG3A 1US1A 3CCL3 3S28A 3F40A 5IEPA 1JN5A 3CCV3 1YI23 1O7NB 1RRHA 2CKFB 2BT3A 1SIHA 1NO3A 2CW9A 3KSPA 4HM3B 2CWVA 1D6UA 3EX9A 1NDOB 1D6YA 2SBLA 1F8NA 3EJVA 3FCSB 1LXEA 4OVMA 2IA7A 5CXOA 1YIT3 2GBXB 3T8UA 3WA2X 2BO9B 3G4S3 2B24B 3GAXA 3I563 1IDPA 4K1VA 1OGZA 2B1XB 2XSOB 3G6E3 1GS3A 2JQ5A 1PFPA 2F86B 1JN5B 1VQM3 2ML5A 3UNLA 1WNHA 4HKVB 2GEXA 2INXA 1NB3I 3EE1A 2CWUA 2K54A 5IENA 3FSDA 5IG4A 3VSYA 1EG9B 1IQYA 3B8LA 3DXOA 1N9JA 2PNCA 3SXXA 3LT9A 1Q42A 1QMAA 3DZLA 1N5HA 3IPTA 3RDEA 2F98A 5EVHA 4OUQA 3JUOA 3SLUA 1JB2A 2CFDA 5LC6A 5FW5A 1GYBA 3BNEA 2W9PA 1GY7A 1C7HA 4FMDA 1TFOA 1LVNA 1JNQA 1OCVA 3K9MC 3S67A 3WODG 4JRFA 7STDA 4NHFA 3WOFB 3CXC2 1NB5I 3JUPA 1U5OA 3BNBA 2XF3A 3V92A 4RNZA 4WYKA 1FGQA 1KQS2 1U8CB 1A2KA 3CD63 2R4IA 3FZWA 2HMKB 1FA3A 3OWSA 4WWUC 2W04A 3G16A 4IPBA 5JBSA 4N6OB 1JV2B 4XDWA 4BTWA 3N54B 4R80A 3G713 3PYJA 1ISKA 2P0XA 3BNCA 3X40A 3OXAA 1ASKA 1IV7A 4WYKB 5IG3A 1W7CA 3FF0A 3JUNA 4HM2B 4N6UA 3O8YA 1CQSA 3NQYA 5DRVA 1VQP3 3UL6A 2MF7A 3WOEB 3DY5A 4H61A 4HZ9B 2ZL8A 5DREA 3SVAA 4AKYA 4J8TA 3MYTA 3NBRA 3CC23 5EEOA 1VQ53 2A15A 3UB1A 4RNYA 1ROAA 3G8ZA 3EQQB 3K0ZA 4R4KA 3I553 3GZRA 1E3VA 4NREA 3ROBA 4MMXB 3LT8A 1O7GB 3X3XA 1IV9A 1FGTA 2XEPA 1K41A 1UI7A 1IVVA 4LEHA 1KD14 4O3VA 1K8A4 1AVLA 5AEUB 3PXMA 5AI1A 3LTDA 3X42A 4HJLB 5AIIA 1QVF2 2P0MA 2W0QA 5IG0A 3LH4A 1JJ22 1VQ43 4N3VA 1S723 1M904 1OHOA 1Q40A 1N8R4 1O7HB 4K1UA 1HKXA 3NX0A 3X41A 4PEJA 1SIIA 3ECFA 2CFWA 1W2B2 4WHAA 2UX0A 2ML6A 3F7XA 2Z77A 3OWYA 3VGNA 3U1WA 1YJ93 3HZPA 3B4PA 3F8HA 3F7SA 1CYUA 1Q40B 3NHXA 1W6CA 5G2GA 1IQ8A 4U13A 2WO0A 1IU7A 1NWWA 2W2CA 4XBYA 4CDLA 5IW9A 3IJEB 3M8CA 1N8QA 1YHQ3 3KKGA 2P09A 4XM4A 4H3UA 1VQ73 3UJMA 1SJWA 2CC3A 2WOHA 1DMQA 1RN7A 1QALA 2CFKA 2OQEC 3HIIA 3NQZA 4R9KA 1MOLA 5D81A 3ALAA 3BB9A 3LOYA 4GB5A 4AEQA 4N6LA 4IT7A 2CHCA 1OACA 4X2OA 2CIUA 4TX4A 3KIIA 1KC84 3NXJA 4EV5A 4EBGA 3AMOA 5JPPA 1WMPA 3F14A 1UW1A 2RFRA 3GZYB 2QA43 3FLJA 4HVNA 3FG1A 1QAFA 1SPUA 2GU1A 2M7OA 2OOVC 3MPHA 1STFI 4XDVA 1UUVB 3OW22 2V1LA 1JRQA 4G1MB 1ROVA 2Z6BA 3BLZA 2D1WA 3DGMA 1L5GB 1AV4A 3PCRA 2XH9A 3DM8A 1W00A 1EA2A 2Y74A 3AMOB 1QJGA 3GRDA 3Q1CA 2E2UA 4HM8B 1Y4KA 3CCQ3 2W9QA 1RJOA 1Z1SA 3WA3A 1FUWA 3JUMA 2HMJB 1FGOA 3EN8A 4MEIA 5KP4A 3K5TA 1RKYA 4HM4B 4XBTA 1M9GA 4N6MA 5KP1A 1Q7Y4 3QK9A 3CPOA 2F99A 2E2TA 3CCE3 2I9WA 4L8OA 5HGRA 4OK0A 5CLKA 5A0OB 1O7PB 2L4VA 3WDGB 1YJN3 3DUKA 1ZO2A 5BXQA 3EF8A 2ZDJA 3CCS3 4JF8A 3GZXB 3CCJ3 3S5CA 4FMBA 2CG0A 5AIGA 5I97A 3LTBA 1UUWB 2XRXB 3LXUX 3F9SA 1VQ93 1AVKA 3KZTA 5AYSC 1Q814 3MWZA 2QEX3 3PGBA 1K28A 3EBTA 1VQK3 2CH9A 1NU3A 1O7MB 2E2VA 1G96A 1STDA 2CG1A 1WMOA 2BNGA 4KFDA 1M1XB 1QAKA 1WTHA 1W4NA 4X2HA 3CCU3 4R1KA 2D42A 1DVCA 1OH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WNH A;  1A67 A;  1NB3 I;  1GD3 A;  3QRD A;  2OCT A;  1CYU A;  4N6V 0;  5ELU A;  3UL5 A;  1N9J A;  1N5H A;  5LC6 A;  1KWI A;  5ELJ A;  5LC7 A;  2W9P A;  1RN7 A;  3K9M C;  1MOL A;  3S67 A;  5EQL A;  1NB5 I;  4N6L A;  4IT7 A;  4TX4 A;  1GD4 A;  1FA3 A;  4EYC A;  3Q2P A;  4N6O B;  3PYJ A;  1STF I;  2KXG A;  1EQK A;  1A90 A;  3KSE D;  1IV7 A;  1DVD A;  4N6U A;  4CCV A;  3UL6 A;  3IMA B;  2W9Q A;  2O9U X;  1FUW A;  3SVA A;  1MNL A;  1M9G A;  4N6M A;  1YVB I;  1ROA A;  3L0R A;  1R4C A;  5A0O B;  4LZI A;  1IV9 A;  3PS8 A;  1TIJ A;  3PXM A;  3MWZ A;  1N5P A;  1LXE A;  4N6T A;  3LH4 A;  1CYV A;  3KFQ C;  2CH9 A;  1G96 A;  2BO9 B;  4N6N B;  1CEW I;  3GAX A;  3NX0 A;  4ZM8 A;  1PFP A;  1DVC A; 
#chains in the Genus database with same CATH topology
 1GSP A;  2CFL A;  5AEW B;  2GBW B;  1A67 A;  3LTC A;  4O2H A;  1UCL A;  1BNI A;  1OUN A;  1JBS A;  3FG4 A;  1X1W A;  3D9R A;  3HX8 A;  1DYU A;  1Q86 4;  3MG1 A;  1W01 A;  4RZM A;  5GSP A;  1C54 A;  3FH1 A;  3K63 A;  2KAA A;  3B4O A;  5ELU A;  3HK4 A;  1FGM A;  4FMC A;  1LNI A;  2C11 A;  3A76 A;  1VQ6 3;  3UL5 A;  1JB4 A;  1FUS A;  4L8P A;  4WFO A;  2Q07 A;  3T8N A;  3CMA 3;  1UCI A;  4J5G A;  2W6J H;  1ZX2 A;  3I0Y A;  4RNT A;  1TUH A;  2BHM A;  5ELJ A;  5LC7 A;  4O8S A;  2XFT A;  2Z76 A;  1FZU A;  1TU5 A;  1GY5 A;  2WGO A;  3MSO A;  4GL6 A;  1M1K 4;  1YJW 3;  1PU4 A;  5STD A;  3SYU A;  1HZ1 A;  1K73 4;  2OTL 3;  1LOW A;  5CF2 A;  1W5Z A;  1YIJ 3;  2L1S A;  4L7K A;  1J2B A;  1WQL B;  1IT8 A;  2HMM B;  4Q53 A;  4XBX A;  4CPK A;  3GWR A;  1D6Z A;  2XR8 B;  3MKI A;  3RNT A;  1I2F A;  1BRG A;  1MGW A;  1SQW A;  7RNT A;  1GD4 A;  3DH2 A;  3ER7 A;  3KN4 A;  3B7C A;  8CHO A;  4KFE A;  3CNX A;  4ORL A;  1BU4 A;  1NJI 4;  1IVW A;  5D83 A;  1KSI A;  1X1Y A;  3LYG A;  4HZB B;  1BUQ A;  1RHL A;  3EC9 A;  3V99 A;  2AAD A;  3WMD A;  4ILF A;  1BNF A;  4K90 B;  1BSC A;  4RBN A;  2IUK A;  3T0U A;  1IQX A;  1RGF A;  3PCS A;  3ZG0 A;  1GOV A;  1RTU A;  3V98 A;  3SOY A;  1B2X A;  1BRS A;  4EW5 A;  1EQK A;  1BNR A;  2H0G A;  1I0X A;  2XSH B;  3F8X A;  1LNH A;  3KSE D;  1DVD A;  5CF1 A;  1FYS A;  3G0K A;  4GSP A;  1X1U A;  3NBB A;  5KP3 A;  4CCV A;  4HM0 B;  1WMN A;  4IIA A;  3SED A;  3NM2 A;  3IMA B;  1LOX A;  2CWT A;  1EEJ A;  1JKG A;  1OHS A;  3EN1 B;  2IUJ A;  2YFI B;  2CK3 H;  2HMO B;  4KVH A;  4I4K A;  1QVG 2;  3STD A;  1EKM A;  4FR9 A;  5TGN A;  5M18 A;  1MNL A;  1PY3 A;  2LQV A;  1YGE A;  3D3L A;  4K61 A;  2MC8 A;  3TDG A;  2JDI H;  1DMN A;  1OPY A;  1HU9 A;  3KCH A;  1MWU A;  4R9K A;  1YVB I;  1UI8 A;  5G1L A;  1BVI A;  2CX0 A;  2J8X B;  4DKI A;  2F4Y A;  1Q82 4;  3S29 A;  3MG2 A;  4BTX A;  1W6Y A;  1R4C A;  3SX1 A;  4LZI A;  2KRT A;  1AR0 A;  1JKG B;  4HM7 B;  1FUT A;  3LML A;  1BRK A;  5IER A;  2XFS A;  1S5A A;  1IVX A;  2HOH A;  3DGO A;  4FCM A;  3PS8 A;  1TIJ A;  1IK3 A;  1BSB A;  2K0M A;  2QGU A;  2OWP A;  1RNT A;  2Z7A A;  1OGX A;  3GSP A;  2ZA4 A;  2F5M A;  3KE7 A;  3EBY A;  3H51 A;  1N5P A;  2Y73 A;  6STD A;  4N6T A;  1I70 A;  1CYV A;  4LGQ A;  3KFQ C;  1LQM B;  3EHC A;  3JVC A;  1TP6 A;  2BMR B;  3DGL A;  4R9L A;  1RRL A;  1E97 A;  4N6N B;  1CEW I;  1E3R A;  1I8V A;  2BU4 A;  2HMN B;  3HIG A;  1OF5 A;  3K7C A;  3N8B A;  3PZW A;  4ZM8 A;  2YX9 A;  4O02 B;  4MMY B;  1JBR A;  2W03 A;  4GHO A;  4BTY A;  4QWT A;  3RGR A;  5FGO A;  4HBR A;  3CPW 2;  3LTA A;  1GD3 A;  1BSE A;  2WOF A;  3QRD A;  1IVU A;  2OCT A;  2RCD A;  4KFF A;  1OHP A;  3CNM A;  3SOA A;  1MGR A;  1A2V A;  3CCR 3;  3FKA A;  4STD A;  5AIF A;  4HM1 B;  1BAN A;  3OX9 A;  1SAR A;  4N6V 0;  2P38 A;  1OF5 B;  2PZV A;  3CU3 A;  3VF1 A;  2GEY A;  1DE3 A;  5HOH A;  4HM5 B;  3OWU A;  3U97 A;  3X3Y A;  1RMS A;  1ULJ B;  3HOH A;  1RGH A;  3DMC A;  1KWI A;  3N9H A;  4WP5 A;  2OQE A;  2RSX A;  1VQN 3;  1W02 A;  1O7W B;  3H3H A;  2FGT A;  1BNE A;  2RGQ A;  2P05 A;  2FNQ A;  4KZ1 A;  1W6G A;  1YNV X;  4HM6 B;  5EQL A;  3OV4 A;  5IF6 A;  3LZA A;  2W56 A;  2AAE A;  1T2I A;  2WGQ A;  4J9A A;  2IMJ A;  3BND A;  1FGR A;  3X3Z A;  2RNT A;  2BMQ B;  1VQL 3;  1RGL A;  1BNS A;  2CFG A;  3GZB A;  5D82 A;  1B2U A;  3NUV A;  1DET A;  4MJD A;  4EYC A;  1ULI B;  2YFL B;  4FCZ A;  1VZZ A;  2GXF A;  3Q2P A;  2OOV A;  2HML B;  1VQ8 3;  1I3F A;  2CX1 A;  2FXT A;  1ZGX A;  2XGN A;  3FGY A;  3FG3 A;  2KXG A;  2W56 B;  6GSP A;  5BVB A;  3EB8 A;  3ZFZ A;  1A90 A;  3NV0 A;  1LOV A;  4EXR A;  1DMM A;  5M1A A;  2YFJ B;  3FF2 A;  1N9E A;  2LYX A;  3CC4 3;  1TFK A;  4EC6 A;  1JBT A;  2IY2 A;  3MHE A;  4FCJ A;  2STD A;  4FMA A;  2KCD A;  3AHS A;  5AIH A;  2O9U X;  2QIY A;  1TRQ A;  3DGN A;  4MMZ B;  2KF6 A;  1VQO 3;  1BRI A;  3E99 A;  5IEO A;  1GMR A;  2BMO B;  1K9M 4;  2BIR A;  2XGL A;  3J7Y d;  2OTJ 3;  4LSO A;  2GU3 A;  2O3O A;  1T5Y A;  1LOY A;  3CCM 3;  4LYL B;  1IT7 A;  2C10 A;  1V74 A;  3S27 A;  1JZD A;  1GY6 A;  1BRJ A;  3NV0 B;  1RCK A;  3CME 3;  4EV2 A;  3DGY A;  3RGA A;  5AYR B;  4XB5 A;  3NBJ A;  2IYJ A;  3L0R A;  3Q90 A;  5CK6 A;  3HI7 A;  5IG5 A;  3NM7 A;  1TJD A;  1JB5 A;  1W2Z A;  4AKZ A;  3CC7 3;  4HYZ A;  4LMI A;  3JUQ A;  5JPU A;  3MG3 A;  1A2P A;  1US1 A;  1LRA A;  3CCL 3;  3S28 A;  3F40 A;  5IEP A;  1BRN L;  1JN5 A;  3CCV 3;  1YI2 3;  1O7N B;  1T3B A;  1BUJ A;  1RRH A;  2CKF B;  2BT3 A;  1EUI C;  1SIH A;  1NO3 A;  1TRP A;  1YVS A;  2CW9 A;  3KSP A;  4HM3 B;  2CWV A;  1D6U A;  1RN1 A;  1NDO B;  1D6Y A;  1RCL A;  1F8N A;  2C4B A;  2SBL A;  3EJV A;  3EX9 A;  3FCS B;  1LXE A;  1V57 A;  4OVM A;  2KF4 A;  2IA7 A;  5CXO A;  1YIT 3;  2GBX B;  3T8U A;  3WA2 X;  1RGA A;  2BO9 B;  1UGH I;  1UUG B;  3G4S 3;  2B24 B;  3GAX A;  1UDI I;  3I56 3;  1IDP A;  4K1V A;  1OGZ A;  2B1X B;  2XSO B;  3G6E 3;  1GS3 A;  2JQ5 A;  1PFP A;  2F86 B;  4J5K A;  1JN5 B;  1VQM 3;  2ML5 A;  3UNL A;  1WNH A;  7GSP A;  4HKV B;  2GEX A;  1GMP A;  2INX A;  1NB3 I;  3EE1 A;  2CWU A;  2K54 A;  5IEN A;  3FSD A;  4KT3 B;  1RGG A;  5G1K A;  3NQZ A;  1EG9 B;  3VSY A;  5IG4 A;  1IQY A;  1BRH A;  3B8L A;  3DXO A;  1N9J A;  2PNC A;  3SXX A;  3LT9 A;  1Q42 A;  1QMA A;  3DZL A;  1N5H A;  3IPT A;  3RDE A;  2F98 A;  5EVH A;  4OUQ A;  1B2M A;  3JUO A;  3SLU A;  4BIR A;  1JB2 A;  2CFD A;  5LC6 A;  1CH0 A;  5FW5 A;  1TTO A;  4NPB A;  1GYB A;  3BNE A;  2W9P A;  1C7H A;  1GY7 A;  4FMD A;  8RNT A;  1TFO A;  3AGN A;  3A5E A;  1LVN A;  1JNQ A;  1OCV A;  3K9M C;  1I2G A;  3S67 A;  3BU4 A;  3WOD G;  4JRF A;  7STD A;  1X1X A;  1RN4 A;  4NHF A;  3WOF B;  2ZHX B;  3CXC 2;  1NB5 I;  3JUP A;  1U5O A;  3BNB A;  2XF3 A;  3V92 A;  4RNZ A;  4WYK A;  1Q7H A;  1FGQ A;  1KQS 2;  1U8C B;  1A2K A;  1B21 A;  2R4I A;  3CD6 3;  3FZW A;  2HMK B;  1FA3 A;  1IYY A;  1ZS7 A;  3OWS A;  4WWU C;  1GOU A;  2W04 A;  3G16 A;  1RGC A;  4IPB A;  5JBS A;  4N6O B;  1JV2 B;  2KF5 A;  4XDW A;  4BTW A;  1RNB A;  3N54 B;  4R80 A;  3G71 3;  3PYJ A;  1ISK A;  3WR2 A;  2P0X A;  3BNC A;  3X40 A;  1BSD A;  3OXA A;  1ASK A;  1IV7 A;  4WYK B;  5IG3 A;  1W7C A;  3FF0 A;  3JUN A;  4HM2 B;  4N6U A;  3O8Y A;  1CQS A;  3NQY A;  5DRV A;  1VQP 3;  3UL6 A;  9RNT A;  1UGI A;  2MF7 A;  3WOE B;  3DY5 A;  1MWS A;  4H61 A;  1FW7 A;  4HZ9 B;  4HAA A;  2ZL8 A;  5DRE A;  3AGO A;  3SVA A;  4AKY A;  4J8T A;  3D5I A;  1PYL A;  3MYT A;  3NBR A;  3CC2 3;  1I3I A;  5EEO A;  1VQ5 3;  2A15 A;  3UB1 A;  4RNY A;  5BIR A;  1ROA A;  1B20 A;  1I0V A;  1RGK A;  3G8Z A;  3EQQ B;  3K0Z A;  4R4K A;  2R41 A;  4HOH A;  3I55 3;  1BNJ A;  3GZR A;  1E3V A;  2H0I A;  4NRE A;  3ROB A;  4MMX B;  3LT8 A;  1O7G B;  1VQQ A;  3ZG5 A;  3X3X A;  1IV9 A;  1FGT A;  2XEP A;  2SAR A;  1K41 A;  1GMQ A;  1UI7 A;  1IVV A;  4LEH A;  1KD1 4;  4O3V A;  2F56 A;  1K8A 4;  1AVL A;  5AEU B;  1MWT A;  3PXM A;  5AI1 A;  3LTD A;  3X42 A;  4HJL B;  1B2S A;  5AII A;  1QVF 2;  2P0M A;  2W0Q A;  5IG0 A;  3LH4 A;  1RGE A;  1JJ2 2;  1VQ4 3;  4N3V A;  1S72 3;  1M90 4;  1OHO A;  1Q40 A;  1N8R 4;  1O7H B;  4K1U A;  1HKX A;  3NX0 A;  3X41 A;  4PEJ A;  2H0H A;  1SII A;  3ECF A;  2CFW A;  1W2B 2;  4WHA A;  2UX0 A;  1RLS A;  5RNT A;  2ML6 A;  3F7X A;  2Z77 A;  3OWY A;  3VGN A;  3U1W A;  1YJ9 3;  1R4Y A;  3HZP A;  3B4P A;  3F8H A;  3F7S A;  2UGI A;  1CYU A;  1Q40 B;  3NHX A;  1W6C A;  1T2H A;  5G2G A;  1MWR A;  1IQ8 A;  4U13 A;  2WO0 A;  1IU7 A;  1NWW A;  2W2C A;  4XBY A;  4CDL A;  4BL3 A;  5IW9 A;  3IJE B;  3M8C A;  1N8Q A;  1YHQ 3;  3KKG A;  1V58 A;  2P09 A;  4XM4 A;  4H3U A;  1VQ7 3;  3UJM A;  1SJW A;  1JZO A;  2CC3 A;  1DMQ A;  1RN7 A;  1B27 A;  1QAL A;  1BGS A;  2CFK A;  2OQE C;  2WOH A;  3HII A;  3Q3F A;  1MOL A;  2RBI A;  5D81 A;  1BOX A;  3ALA A;  3BB9 A;  3LOY A;  4GB5 A;  4AEQ A;  4N6L A;  3URP A;  4IT7 A;  2CHC A;  1OAC A;  4X2O A;  2CIU A;  4TX4 A;  3KII A;  5BU4 A;  1AQZ A;  1KC8 4;  3NXJ A;  4EV5 A;  4EBG A;  3AMO A;  5JPP A;  1WMP A;  3F14 A;  1BIR A;  1UW1 A;  2RFR A;  3GZY B;  1NNV A;  2QA4 3;  3FLJ A;  4HVN A;  1RDS A;  3FG1 A;  1QAF A;  1SPU A;  1B3S A;  2GU1 A;  2M7O A;  2OOV C;  1B2Z A;  1STF I;  3MPH A;  4XDV A;  1UUV B;  3OW2 2;  3D5G A;  1BSA A;  1BNG A;  2V1L A;  1JRQ A;  4G1M B;  2K3D A;  1ROV A;  2Z6B A;  3BLZ A;  2D1W A;  3DGM A;  1L5G B;  1AV4 A;  3PCR A;  2UUG C;  2XH9 A;  3DM8 A;  1W00 A;  1EA2 A;  2Y74 A;  3AMO B;  1QJG A;  3GRD A;  3Q1C A;  1UCJ A;  2E2U A;  1LQG C;  1BAO A;  1Y4K A;  2W9Q A;  1RJO A;  4HM8 B;  3CCQ 3;  1AY7 A;  1Z1S A;  3WA3 A;  3D79 A;  1HYF A;  1FUW A;  3JUM A;  2HMJ B;  4CJN A;  1G0T A;  1FGO A;  3EN8 A;  4MEI A;  5KP4 A;  3K5T A;  1RKY A;  4HM4 B;  4XBT A;  4BU4 A;  1M9G A;  4N6M A;  5KP1 A;  1Q7Y 4;  3QK9 A;  4BL2 A;  3CPO A;  3D4A A;  1GOY A;  1Q9E A;  1YGW A;  2F99 A;  2E2T A;  3CCE 3;  2I9W A;  6RNT A;  4L8O A;  5HGR A;  4OK0 A;  5CLK A;  5A0O B;  1O7P B;  1G02 A;  2L4V A;  1I2E A;  2KF3 A;  3BIR A;  3WDG B;  1YJN 3;  3DUK A;  1ZO2 A;  5BXQ A;  3EF8 A;  2ZDJ A;  3CCS 3;  1UCK A;  4JF8 A;  3GZX B;  3CCJ 3;  3S5C A;  4FMB A;  2CG0 A;  5AIG A;  5I97 A;  3LTB A;  1UUW B;  2XRX B;  3LXU X;  3F9S A;  1VQ9 3;  2F5W A;  1AVK A;  3KZT A;  5AYS C;  1Q81 4;  3MWZ A;  5M19 A;  2QEX 3;  3PGB A;  1K28 A;  3WHO A;  3EBT A;  1VQK 3;  2CH9 A;  1NU3 A;  1O7M B;  2E2V A;  1G96 A;  1STD A;  2GSP A;  4I5Q A;  2CG1 A;  1WMO A;  2BNG A;  4KFD A;  1M1X B;  1RSN A;  1QAK A;  1WTH A;  1W4N A;  4X2H A;  3CCU 3;  4R1K A;  3AHW A;  2D42 A;  1DVC A;  1OH0 A; 
#chains in the Genus database with same CATH homology
 2CFL A;  5AEW B;  2GBW B;  1A67 A;  3LTC A;  4O2H A;  1OUN A;  3FG4 A;  3HX8 A;  3D9R A;  1DYU A;  1Q86 4;  3MG1 A;  1W01 A;  4RZM A;  3FH1 A;  3K63 A;  3B4O A;  5ELU A;  3HK4 A;  1FGM A;  4FMC A;  1VQ6 3;  2C11 A;  3A76 A;  3UL5 A;  1JB4 A;  4L8P A;  4WFO A;  2Q07 A;  3T8N A;  3CMA 3;  2W6J H;  1ZX2 A;  3I0Y A;  1TUH A;  2BHM A;  5ELJ A;  5LC7 A;  4O8S A;  2XFT A;  2Z76 A;  1TU5 A;  1GY5 A;  2WGO A;  3MSO A;  4GL6 A;  1M1K 4;  1YJW 3;  1PU4 A;  5STD A;  1K73 4;  2OTL 3;  5CF2 A;  1W5Z A;  1YIJ 3;  1J2B A;  4L7K A;  1WQL B;  1IT8 A;  2HMM B;  4Q53 A;  4XBX A;  3GWR A;  1D6Z A;  2XR8 B;  3MKI A;  1SQW A;  1GD4 A;  3ER7 A;  3KN4 A;  3B7C A;  8CHO A;  4KFE A;  3CNX A;  4ORL A;  1NJI 4;  1IVW A;  5D83 A;  1KSI A;  3LYG A;  4HZB B;  1BUQ A;  3EC9 A;  3V99 A;  3WMD A;  4K90 B;  4RBN A;  3T0U A;  2IUK A;  1IQX A;  3PCS A;  3V98 A;  3SOY A;  1EQK A;  2XSH B;  3F8X A;  1LNH A;  3KSE D;  1DVD A;  5CF1 A;  3G0K A;  5KP3 A;  4CCV A;  3NBB A;  4HM0 B;  1WMN A;  4IIA A;  3SED A;  3NM2 A;  3IMA B;  1LOX A;  2CWT A;  3EN1 B;  1JKG A;  1OHS A;  2IUJ A;  2YFI B;  2CK3 H;  2HMO B;  4KVH A;  4I4K A;  1QVG 2;  3STD A;  1EKM A;  4FR9 A;  5TGN A;  1MNL A;  2LQV A;  4K61 A;  1YGE A;  3D3L A;  2MC8 A;  3TDG A;  2JDI H;  1DMN A;  1OPY A;  1HU9 A;  1YVB I;  1UI8 A;  1Q82 4;  3S29 A;  3MG2 A;  4BTX A;  1W6Y A;  1R4C A;  3SX1 A;  4LZI A;  2KRT A;  1AR0 A;  1JKG B;  4HM7 B;  3LML A;  5IER A;  2XFS A;  1S5A A;  1IVX A;  3DGO A;  4FCM A;  3PS8 A;  1TIJ A;  1IK3 A;  2K0M A;  2QGU A;  2OWP A;  2Z7A A;  1OGX A;  3KE7 A;  3EBY A;  3H51 A;  1N5P A;  2Y73 A;  6STD A;  4N6T A;  1CYV A;  4LGQ A;  3KFQ C;  3EHC A;  3JVC A;  1TP6 A;  2BMR B;  3DGL A;  4R9L A;  1RRL A;  1E97 A;  4N6N B;  1CEW I;  1E3R A;  2HMN B;  3HIG A;  3K7C A;  4ZM8 A;  1OF5 A;  3CME 3;  3N8B A;  3PZW A;  2YX9 A;  4O02 B;  4MMY B;  2W03 A;  4BTY A;  4QWT A;  3RGR A;  5FGO A;  4HBR A;  3CPW 2;  3LTA A;  1GD3 A;  2WOF A;  3QRD A;  1IVU A;  2OCT A;  2RCD A;  4KFF A;  1OHP A;  3CNM A;  3SOA A;  3CCR 3;  1A2V A;  3FKA A;  4STD A;  5AIF A;  4HM1 B;  3OX9 A;  4N6V 0;  2P38 A;  1OF5 B;  2PZV A;  3CU3 A;  3VF1 A;  2GEY A;  4HM5 B;  3OWU A;  3U97 A;  3X3Y A;  1ULJ B;  3N9H A;  4WP5 A;  3DMC A;  1KWI A;  2OQE A;  2RSX A;  1VQN 3;  1W02 A;  1O7W B;  3H3H A;  2FGT A;  2RGQ A;  2P05 A;  2FNQ A;  4KZ1 A;  1W6G A;  4HM6 B;  5EQL A;  3OV4 A;  5IF6 A;  3LZA A;  2W56 A;  4J9A A;  2WGQ A;  3X3Z A;  2IMJ A;  3BND A;  1FGR A;  2BMQ B;  1VQL 3;  2CFG A;  3GZB A;  5D82 A;  4MJD A;  3NUV A;  4EYC A;  1ULI B;  2YFL B;  4FCZ A;  1VZZ A;  2GXF A;  3Q2P A;  2OOV A;  2HML B;  1VQ8 3;  2FXT A;  2XGN A;  3FGY A;  3FG3 A;  2KXG A;  2W56 B;  5BVB A;  3EB8 A;  1A90 A;  3NV0 A;  4EXR A;  1DMM A;  2YFJ B;  3FF2 A;  1N9E A;  2LYX A;  3CC4 3;  1TFK A;  4EC6 A;  3MHE A;  4FCJ A;  4FMA A;  2STD A;  2KCD A;  5AIH A;  2O9U X;  2QIY A;  3DGN A;  4MMZ B;  1VQO 3;  3E99 A;  5IEO A;  2BMO B;  1K9M 4;  2XGL A;  3J7Y d;  2OTJ 3;  4LSO A;  2GU3 A;  2O3O A;  1T5Y A;  3CCM 3;  1IT7 A;  2C10 A;  1V74 A;  3S27 A;  1GY6 A;  3NV0 B;  4EV2 A;  3RGA A;  5AYR B;  4XB5 A;  3NBJ A;  3L0R A;  3Q90 A;  5CK6 A;  3HI7 A;  5IG5 A;  3NM7 A;  4AKZ A;  1JB5 A;  1W2Z A;  3CC7 3;  4HYZ A;  4LMI A;  3JUQ A;  5JPU A;  3MG3 A;  1US1 A;  3CCL 3;  3S28 A;  3F40 A;  5IEP A;  1JN5 A;  3CCV 3;  1YI2 3;  1O7N B;  1RRH A;  2CKF B;  2BT3 A;  1SIH A;  1NO3 A;  2CW9 A;  3KSP A;  4HM3 B;  2CWV A;  1D6U A;  3EX9 A;  1NDO B;  1D6Y A;  2SBL A;  1F8N A;  3EJV A;  3FCS B;  1LXE A;  4OVM A;  2IA7 A;  5CXO A;  1YIT 3;  2GBX B;  3T8U A;  3WA2 X;  2BO9 B;  3G4S 3;  2B24 B;  3GAX A;  3I56 3;  1IDP A;  4K1V A;  1OGZ A;  2B1X B;  2XSO B;  3G6E 3;  1GS3 A;  2JQ5 A;  1PFP A;  2F86 B;  1JN5 B;  1VQM 3;  2ML5 A;  3UNL A;  1WNH A;  4HKV B;  2GEX A;  2INX A;  1NB3 I;  3EE1 A;  2CWU A;  2K54 A;  5IEN A;  3FSD A;  5IG4 A;  3VSY A;  1EG9 B;  1IQY A;  3B8L A;  3DXO A;  1N9J A;  2PNC A;  3SXX A;  3LT9 A;  1Q42 A;  1QMA A;  3DZL A;  1N5H A;  3IPT A;  3RDE A;  2F98 A;  5EVH A;  4OUQ A;  3JUO A;  3SLU A;  1JB2 A;  2CFD A;  5LC6 A;  5FW5 A;  1GYB A;  3BNE A;  2W9P A;  1GY7 A;  1C7H A;  4FMD A;  1TFO A;  1LVN A;  1JNQ A;  1OCV A;  3K9M C;  3S67 A;  3WOD G;  4JRF A;  7STD A;  4NHF A;  3WOF B;  3CXC 2;  1NB5 I;  3JUP A;  1U5O A;  3BNB A;  2XF3 A;  3V92 A;  4RNZ A;  4WYK A;  1FGQ A;  1KQS 2;  1U8C B;  1A2K A;  3CD6 3;  2R4I A;  3FZW A;  2HMK B;  1FA3 A;  3OWS A;  4WWU C;  2W04 A;  3G16 A;  4IPB A;  5JBS A;  4N6O B;  1JV2 B;  4XDW A;  4BTW A;  3N54 B;  4R80 A;  3G71 3;  3PYJ A;  1ISK A;  2P0X A;  3BNC A;  3X40 A;  3OXA A;  1ASK A;  1IV7 A;  4WYK B;  5IG3 A;  1W7C A;  3FF0 A;  3JUN A;  4HM2 B;  4N6U A;  3O8Y A;  1CQS A;  3NQY A;  5DRV A;  1VQP 3;  3UL6 A;  2MF7 A;  3WOE B;  3DY5 A;  4H61 A;  4HZ9 B;  2ZL8 A;  5DRE A;  3SVA A;  4AKY A;  4J8T A;  3MYT A;  3NBR A;  3CC2 3;  5EEO A;  1VQ5 3;  2A15 A;  3UB1 A;  4RNY A;  1ROA A;  3G8Z A;  3EQQ B;  3K0Z A;  4R4K A;  3I55 3;  3GZR A;  1E3V A;  4NRE A;  3ROB A;  4MMX B;  3LT8 A;  1O7G B;  3X3X A;  1IV9 A;  1FGT A;  2XEP A;  1K41 A;  1UI7 A;  1IVV A;  4LEH A;  1KD1 4;  4O3V A;  1K8A 4;  1AVL A;  5AEU B;  3PXM A;  5AI1 A;  3LTD A;  3X42 A;  4HJL B;  5AII A;  1QVF 2;  2P0M A;  2W0Q A;  5IG0 A;  3LH4 A;  1JJ2 2;  1VQ4 3;  4N3V A;  1S72 3;  1M90 4;  1OHO A;  1Q40 A;  1N8R 4;  1O7H B;  4K1U A;  1HKX A;  3NX0 A;  3X41 A;  4PEJ A;  1SII A;  3ECF A;  2CFW A;  1W2B 2;  4WHA A;  2UX0 A;  2ML6 A;  3F7X A;  2Z77 A;  3OWY A;  3VGN A;  3U1W A;  1YJ9 3;  3HZP A;  3B4P A;  3F8H A;  3F7S A;  1CYU A;  1Q40 B;  3NHX A;  1W6C A;  5G2G A;  1IQ8 A;  4U13 A;  2WO0 A;  1IU7 A;  1NWW A;  2W2C A;  4XBY A;  4CDL A;  5IW9 A;  3IJE B;  3M8C A;  1N8Q A;  1YHQ 3;  3KKG A;  2P09 A;  4XM4 A;  4H3U A;  1VQ7 3;  3UJM A;  1SJW A;  2CC3 A;  2WOH A;  1DMQ A;  1RN7 A;  1QAL A;  2CFK A;  2OQE C;  3HII A;  3NQZ A;  4R9K A;  1MOL A;  5D81 A;  3ALA A;  3BB9 A;  3LOY A;  4GB5 A;  4AEQ A;  4N6L A;  4IT7 A;  2CHC A;  1OAC A;  4X2O A;  2CIU A;  4TX4 A;  3KII A;  1KC8 4;  3NXJ A;  4EV5 A;  4EBG A;  3AMO A;  5JPP A;  1WMP A;  3F14 A;  1UW1 A;  2RFR A;  3GZY B;  2QA4 3;  3FLJ A;  4HVN A;  3FG1 A;  1QAF A;  1SPU A;  2GU1 A;  2M7O A;  2OOV C;  3MPH A;  1STF I;  4XDV A;  1UUV B;  3OW2 2;  2V1L A;  1JRQ A;  4G1M B;  1ROV A;  2Z6B A;  3BLZ A;  2D1W A;  3DGM A;  1L5G B;  1AV4 A;  3PCR A;  2XH9 A;  3DM8 A;  1W00 A;  1EA2 A;  2Y74 A;  3AMO B;  1QJG A;  3GRD A;  3Q1C A;  2E2U A;  4HM8 B;  1Y4K A;  3CCQ 3;  2W9Q A;  1RJO A;  1Z1S A;  3WA3 A;  1FUW A;  3JUM A;  2HMJ B;  1FGO A;  3EN8 A;  4MEI A;  5KP4 A;  3K5T A;  1RKY A;  4HM4 B;  4XBT A;  1M9G A;  4N6M A;  5KP1 A;  1Q7Y 4;  3QK9 A;  3CPO A;  2F99 A;  2E2T A;  3CCE 3;  2I9W A;  4L8O A;  5HGR A;  4OK0 A;  5CLK A;  5A0O B;  1O7P B;  2L4V A;  3WDG B;  1YJN 3;  3DUK A;  1ZO2 A;  5BXQ A;  3EF8 A;  2ZDJ A;  3CCS 3;  4JF8 A;  3GZX B;  3CCJ 3;  3S5C A;  4FMB A;  2CG0 A;  5AIG A;  5I97 A;  3LTB A;  1UUW B;  2XRX B;  3LXU X;  3F9S A;  1VQ9 3;  1AVK A;  3KZT A;  5AYS C;  1Q81 4;  3MWZ A;  2QEX 3;  3PGB A;  1K28 A;  3EBT A;  1VQK 3;  2CH9 A;  1NU3 A;  1O7M B;  2E2V A;  1G96 A;  1STD A;  2CG1 A;  1WMO A;  2BNG A;  4KFD A;  1M1X B;  1QAK A;  1WTH A;  1W4N A;  4X2H A;  3CCU 3;  4R1K A;  2D42 A;  1DVC A;  1OH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...