1MNQA

Thioesterase domain of picromycin polyketide synthase (pics te), ph 8.4
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
281
structure length
275
Chain Sequence
AGMFRALFRQAVEDDRYGEFLDVLAEASAFRPQFASPEACSERLDPVLLAGGPTDRAEGRAVLVGCTGTAANGGPHEFLRLSTSFQEERDFLAVPLPGYGTALLPADLDTALDAQARAILRAAGDAPVVLLGHSGGALLAHELAFRLERAHGAPPAGIVLVDPYPPGHQEPIEVWSRQLGEGLFAGELEPMSDARLLAMGRYARFLAGPRPGRSSAPVLLVRASEPLGDWQEERGDWRAHWDLPHTVADVPGDHFTMMRDHAPAVAEAVLSWLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into channel architecture and substrate specificity from crystal structures of two macrocycle-forming thioesterases of modular polyketide synthases
pubmed doi rcsb
source organism Streptomyces venezuelae
molecule tags Transferase
molecule keywords polyketide synthase IV
total genus 86
structure length 275
sequence length 281
chains with identical sequence B
ec nomenclature ec 2.3.1.239: 10-deoxymethynolide syntase.
pdb deposition date 2002-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mnqA00
2JEYA 3WWEA 1VE6A 1W4LA 3WZMA 1VKHA 3RK4A 2WJ3A 4EB0A 5AM1A 1N8SA 5CH8A 5IVDA 1B6GA 3IUQA 1GGVA 5HK9A 2HFJA 1EB9A 5K3EA 4B84A 4MJ3A 4G5XA 5ALFA 3ED1A 1CUJA 3HRHA 5AM0A 4FNGA 4V2IA 3OPMA 5ALUA 2QJRA 3WMRA 2PPLA 1CQZA 3G0IA 2ZJ7A 4JH0A 1XZLA 1LPSA 2DSNA 4OU4A 4YASA 3FYUA 5T4EA 4X94A 1WOMA 5EIHA 4GWLA 3ICWA 3WKCA 1A88A 4UBOA 1FFBA 2PM8A 1EI9A 2QXTA 5ALZA 2CEKA 3LIPA 5E4TA 5CURA 5A7GA 5LZ2A 4J0JA 1C7JA 2HU7A 1KU0A 3EBLA 2XUAA 2GZRA 5A62A 4AN1A 1YR2A 1LZLA 3IA2A 4H7FA 3TRDA 1UOPA 4NVRA 3FBWA 2WM2A 2HHAA 1Q84A 2XMGA 4FKBA 3GZJA 3C6XA 4HRXA 1UZAA 3G9TA 2RHTA 2BJHA 1CUVA 3FVRA 2ZYRA 5DTIA 5JD6A 1DX6A 4A5SA 4TGLA 4EY4A 3IUJA 3G9ZA 1YSCA 1XFDA 2QS9A 1CLEA 3PE6A 3HYSA 3MGAA 2WIJA 2BAGA 1DWQA 1XRPA 4KAJA 4HZGA 1CEXA 2R8BA 2PU5A 3R3ZA 2J4FA 4U2FA 3BIWA 1QLWA 1BRTA 4DSZA 1PV1A 4KRYA 1MX5A 1ZD2P 5ALWA 2BCEA 1LBSA 4Q05A 5EIEA 2XUIA 4BCBA 3LCRA 1JJFA 2HFKA 2OXEA 1TCBA 4ZV9A 1LNSA 4DYHA 5AI0A 3GROA 5AKLA 3WA7A 1VA4A 5DNVA 2WUGA 5CT9A 2B4KA 1CUDA 2QKYA 5BV7A 3G02A 3C6ZA 1K5PA 1YAJA 5FPPA 4MYDA 4UBKA 1R3DA 4GI1A 1QIMA 1CFJA 2GZSA 4Q34A 3RKSA 1UKBA 4Q3KA 2YASA 5AK4A 1XLVA 4RPCA 2IIVA 1EINA 1QIIA 5CW2A 4UBLA 4WFKA 1ORVA 1XLWA 4QEKA 4X95A 1CUBA 2EEPA 2WFLB 4KJXA 5JAOA 3PFCA 4K6HA 3EQ9A 2D5LA 1ZI6A 3V1LA 2WU4A 1D07A 3FSGD 4UBIA 4AXBA 1CV2A 5ALYA 1F0NA 5ESRA 1VZ2A 5ALHA 3KWJA 5LKRA 4X97A 4AN0A 2PU7A 1ZI8A 4B9EA 3H04A 4H7EA 3AZOA 5AOAA 5JATA 2VF2A 5BOVA 1NU6A 2VT7A 4J0HA 5K3FA 1JU3A 2V9ZA 1USWA 1ETHA 4MWSA 4OCZA 3AZQA 4UBJA 2XUGA 4X85A 2AJBA 3R3XA 1YB6A 4P9NA 3BDVA 3F8SA 4IH1A 2WJ6A 1XZIA 1Q0RA 4D9JA 2HADA 3ILSA 3BXPA 5CMLA 4WY8A 1HLGA 1KU6A 2JGIA 4H35A 4KE6A 3L1HA 3B3QA 4I4CA 4BZWA 3G0BA 1ORWA 2C0QA 4DSAA 4I19A 5DJ5A 4K6GA 2C0PA 1MAAA 5JZSA 3F9CA 2Y2UA 4G4GA 3O4GA 3WWOA 1FFDA 1DX4A 4MXDA 2XMRA 5AOCA 3FYTA 4HRYA 3I2IA 4IO0A 4XIIA 5HKAA 2BKLA 3I28A 2XUFA 1CUCA 2XUQA 1BE0A 1O6GA 3IUMA 4Z49A 3KOOA 1HL7A 1ZD3A 2WIGA 2WG2A 1MO2A 3QITA 5EHQA 4H7DA 2WIDA 2C5GA 4J0IA 4Y9SA 4AZ0A 2CMFA 5ALQA 2G5TA 1HQDA 2XMZA 5I9IA 2O2HA 4UHBA 2PBLA 2ROQA 1RP1A 1UOOA 4BE9A 1ZGBA 1AGYA 2G5PA 1QTIA 3M81A 3MVEA 4I3FA 2VTVA 2C7BA 2C4HA 4U2GA 2RIPA 2OG1A 2J3QA 4W1QA 4BVJA 3Q0TA 4LYEA 4F21A 1CUGA 1XRQA 3C6BA 3V1NA 4DTCA 5AKYA 4O08A 4MWTA 2I3DA 4KACA 4YX9A 3OM8A 1ZIXA 3V1KA 2WHPA 4J0DA 4EUSA 1AURA 1LPMA 3JW8A 4IH9A 4ZRDA 2PL5A 3G0DA 2CB9A 5ALNA 5F4ZA 1GQSA 1OXMA 2WFLA 4M0EA 4Y2YA 1CUXA 3KDAA 3P2MA 3HLKA 1EVQA 5FXMA 1EB8A 4AO8A 4ITVA 4ZI5A 1J1IA 3D4LA 5DYWA 4H18A 4ZWNA 3AJAA 2GBFA 5SYNA 1EDBA 4X00A 3WK7A 4HVTA 4L3WA 1DT5A 2J3DA 5HF9A 1SCIA 1CUSA 3JYHA 4B0OA 4IH4A 2HA0A 5ALDA 1A8UA 5EHXA 1HKHA 1HBJA 4KE8A 4C4ZA 5JALA 3RLIA 4BAUA 2WUDA 1TCCA 5AOBA 4PNZA 1VXRA 3W04A 1BN7A 3V9AA 4BZZA 2VATA 4HXGA 5AK6A 4OU5A 5K3AA 3A2MA 5A6VA 5JIBA 2DHDA 1MNQA 3BF7A 5AKGA 1XZHA 1SOMA 3M82A 5AKJA 4LXGA 3DLTA 1C4XA 3NOXA 4P93A 3R3YA 1ZIYA 1SCKA 5IVHA 1TIBA 1H22A 3ANSA 5ALIA 4X90A 3BL8A 4AZ3A 2JEZA 2EDAA 1XZMA 1G4HA 4QLAA 4IHAA 2G63A 4Y2UA 3MUNA 1T2NA 1XZDA 5HZGA 2XMSA 1E8MA 4JYPA 1C7IA 1THGA 4AO6A 1J07A 5EIAA 1ZJ4A 4FNMA 1GZ7A 2OCLA 3JWEA 5AI4A 1U2EA 4CCWA 1H2YA 4GXNA 2WILA 3STUA 2XUHA 4PF1A 2WHRA 1EX9A 4L0CA 5K5EA 3WI7A 3IDAA 4X93A 4F0JA 3ESAA 4QDTA 2IX9A 5LLSA 4P08A 1WPXA 4FBLA 4J0CA 2K2QB 4ETWA 5FKJA 4GECA 1DQZA 1F0PA 2HA6A 3DJYA 5CT6A 5HCUA 1VZ3A 5KREA 4OSEA 3WK8A 3YASA 5E4YA 1E8DA 1Y37A 2OLEA 2FX5A 3QBJA 5ALGA 5ISMA 1K8QA 1LPBB 3A2NA 3M3DA 3EIOA 1CR6A 4PSUA 1JFRA 2OGZA 4Y2SA 3D2BA 2YH2A 3VJLA 2GYVA 4FLFA 7YASA 4BDTA 1P0PA 1MU0A 1SC9A 1U65A 4GDMA 4BCCA 2VJCA 4QZVA 3GFFA 4CIAA 1BCSA 2ZSHA 1GT6A 4AQDA 4WFIA 3VISA 4KE7A 2XQFA 3S2ZA 2XI4A 3KSRA 4PQEA 3F96A 2GYUA 1R9NA 3VJKA 2ACKA 3QM1A 5AKIA 4X6YA 3PFBA 3V1MA 1BEEA 2NW6A 2XB6A 1X2EA 4OB6A 2QT9A 4Q3LA 4UFNA 1DWPA 4JEIA 1EDEA 3I2KA 5AIBA 2WQZA 4U2DA 4BATA 5AK3A 3I6ZA 2PSJA 1W52X 3FYUC 2OGTA 2I78A 4H7IA 5LZ9A 1GPKA 3VVMA 3WK9A 4YPVA 4H7KA 4JYMA 4U2EA 4C01A 3DYVA 3STXA 2VSQA 3ZLTA 2B20A 4G8BA 4F60A 4KRXA 2V96A 1DT3A 5FPQA 1U4NA 1S8OA 3IURA 1BN6A 4ZREA 3FAKA 1CUYA 3ICVA 4CI9A 3PI6A 4BBZA 2CJPA 3BIXA 1CIJA 4K2AA 4E15A 4J0GA 2WKWA 5AI6A 3CXUA 2ZYIA 3D5EA 2PKYX 1E5TA 2J4CA 4MEAA 1AZWA 3C43A 4C87A 4QDOA 3H1AA 3FLAA 3WLAA 2HL6A 2C5FA 4K5QA 4OB8A 2JF0A 3C6YA 1Q0ZA 3DDUA 1YS2X 1QO7A 5IH7A 2DQZA 5D3ZA 2WSLA 5LZ8A 1XQWA 4LIPD 2JIDA 5K3CA 3GBSA 2X76A 1XZGA 3QMVA 1WPRA 4EZIA 3D7RA 1VE7A 3SX4A 4DIUA 2OPHA 2WHQA 2OGSA 3BWXA 1MX1A 5K3DA 3NWOA 6YASA 2PUHA 3W9BA 2ORYA 3ZV7A 3C8HA 2VA9A 3VXKA 2ZVDA 3QZUA 1Q83A 1X2BA 5HKBA 4DMKA 2X5XA 3O9VA 1XZAA 1CUAA 3B12A 2RGUA 4UHFA 1L7AA 5EHNA 4BYMA 2ECFA 3KD2A 1ZICA 1SCQA 2QRUA 4PW0A 1MNAA 4W63A 5IVIA 1OILA 2AXEA 5K3BA 1QIHA 5AK5A 1R9MA 1XZCA 3DYIA 5ALTA 1UK7A 4CG2A 1NX9A 3KXPA 1IUPA 3DS8A 5JZ9A 3E1GA 1BROA 5C8VA 1Y7HA 3DOHA 4OB7A 3O4IA 4OUKX 4PO3X 3AINA 3CCCA 2B9VA 3F98A 3LIIA 2HA3A 3DEAA 3O0DA 4WY5A 3BF8A 3ZI7A 4DNFA 2Z3ZA 1GXSA 3IB3A 1YB7A 1K63A 2BGNA 2GBCA 5ALPA 4INZA 4ZV7A 4CCYB 2DCMA 2IITA 3T52A 1ZD4A 5DYTA 2WG0A 1BCRA 4EY7A 3C87A 3UUEA 5HF6A 2XE4A 1YAHA 2OCKA 3K9BA 3L1IA 2ZYHA 3DCNA 2O7RA 2XUJA 4DNOA 4QDUA 3O9MA 1TRHA 1YCDA 5CT8A 3PUIA 1GPNA 2OQVA 4EY5A 2DHEA 4MQLA 4AMYA 2XQJA 2HA2A 3R3VA 4WFJA 4L9AA 4LXHA 1XZKA 3D2AA 2VEOA 4FMPA 1XRRA 2WJ4A 4N5IX 4KYVA 1RWQA 4WDQA 1QFSA 5JAPA 4L72A 4U2CA 2H7CA 3R3WA 3HEAA 4GW3A 1Z68A 2JGLA 3WWDA 3STVA 3WZLA 1UFOA 3FYUB 4Q3OA 4X92A 3TJMA 4C6HA 3DL4A 5JADA 4X71A 1UK8A 4G8DA 2HIHA 1FFEA 1UWCA 4FBMA 3PICA 5AI9A 3N0TA 1MTZA 3STTA 3WJ2A 3AZPA 2OQIA 3IVMA 5ALSA 3HXKA 1WCYA 5AM2A 1F8UA 3PF8A 5I7UA 4A16A 1CUIA 4Q82A 1E66A 1WB4A 1THTA 5D7BA 5CRIA 3ESBA 4C89A 4C4XA 2H1IA 3R41A 5HFAA 5LIPA 5ALRA 1ACJA 1TAHA 2XQGA 3W06A 4UHDA 3F67A 4N8DA 2QMQA 4J0KA 3LS2A 1LGYA 5E4JA 4WDRA 3I1IA 3G9UA 1DINA 1WB6A 4EHBA 1LLFA 2HRQA 3BJRA 3W2TA 3B5EA 1NU8A 1VXOA 2HDWA 1XZBA 5EHZA 2V97A 1UXOA 2YXPX 3FWHA 5JYCA 4UUQA 4OD0A 5DYYA 1SFRA 1XROA 1VLQA 4N5HX 4TVKA 5JAHA 3WKAA 2B61A 3FOBA 1EK2A 3AILA 1MX9A 5YASA 5A7HA 1YASA 4B82A 3U1TA 3WK5A 3H17A 1EH5A 2OAEA 3D0KA 3U0VA 1CUFA 1P0MA 1H23A 4UFPA 4BRZA 4KAAA 3ESCA 2JGEA 5BWCA 5HQ3B 3IIIA 2FJ0A 4HS9A 5LZ7A 5K3FB 1BU8A 2XMCA 2Y2VA 1IZ8A 2RAUA 4RE6A 1VA5A 5A71A 2JGKA 4CFSA 3NUZA 4JUIA 4DM7A 4UPDA 5FRDA 3DNMA 5AM4A 4LKOA 3EF3A 1UOQA 1LPPA 2Z8XA 3C45A 2ZSIA 1FSSA 5FP0A 1ZI9A 2QM0A 1H2WA 3H19A 4XWGA 3ZLVA 1N5MA 1W1IA 1XZFA 4BP8A 3H18A 4AO7A 4FHZA 1CUEA 5AICA 3HI4A 1EHYA 5DTJA 5AKKA 2FJPA 1YA4A 1QIKA 5LZ5A 4BTVA 4B81A 3W9UA 3FVTA 4G1FA 5C81A 3R3UA 2BUCA 1WM1A 4NZZA 2ES4A 3FLBA 4CG3A 3IBTA 5C8XA 5AI5A 4B6GA 4WCVA 3EQ8A 3HABA 3G7NA 5D6OA 2Z8ZA 1CQWA 3VVLA 5LKAA 3DKKA 4Y2JA 3HSSA 2R11A 3OOSA 4BP9A 4FWBA 1GQRA 5FDFA 5T4HA 5CT5A 5AJHA 1XRMA 2FUKA 1LBTA 1EA5A 5JANA 3IUNA 3HZOA 2H7XA 2RONA 4J03A 3OC0A 3SK0A 1N1MA 3KWFA 4CIBA 3M83A 5LP1A 3H2GA 3WIOA 2XQIA 1XKTA 1PJAA 4BB0A 1BEZA 1UK6A 4ZXFA 4H0CA 5JARA 4E14A 4E46A 4Y7DA 1IZ7A 4KAFA 2WTNA 3O4HA 4GHWA 1P0IA 1CUUA 2BFNA 2WU3A 3AUKA 4Y2RA 3K2IA 4DMCA 4EY8A 2WIFA 2QJWA 3I2FA 2PSEA 3AFIA 1TK3A 4XVCA 3T4UA 4H7JA 2UZ0A 1QONA 2QR5A 3FNBA 1EVEA 3Q8WA 2XLCA 1J2EA 3BDIA 1XQYA 1TKRA 1IUNA 2VQ6A 1VJ5A 3WL8A 3WYDA 3DQZA 4DMHA 2PVSA 4FFWA 3WL7A 1RYYA 5AIAA 4Y2XA 1QIJA 1CUZA 1L7RA 5HFNA 4QA9A 3I6MA 1FFAA 5JD5A 1QOZA 4J7AA 2OCIA 4MEBA 2O2GA 2VAXA 1DU4A 1JKMA 5KBYA 1EDDA 5J3JA 2VAVA 4ARAA 3FCYA 1YA8A 3WWCA 1EXWA 3G8YA 2WHPB 4UBMA 3CN9A 4X6XA 4M0FA 5ALMA 3STWA 1GKLA 5AI8A 4B0PA 3GA7A 4GBGA 2QUBA 3PUHA 4DNQA 3LP5A 3C8DA 4W9RA 2CBGA 3ANTA 4KR0A 5C7YA 3RM3A 1QIDA 4FLEA 5ALVA 2ZYSA 2JGMA 1E89A 3CCBA 3R0VA 1J06A 1MJ5A 4RNCA 3QH4A 5C8ZA 5CH5A 1JJIA 2G4LA 2I03A 1ZGCA 2X8BA 1TCAA 4EY6A 3UMJA 1W76A 3H0CA 4OYYA 4DGQA 1AC5A 4BC1A 2HM7A 5AHXA 2XMQA 2YYSA 3R40A 1QTRA 3G0CA 5CTAA 4B85A 4CG1A 1QIGA 1GPLA 1M33A 1MPXA 2XT0A 2Z3WA 5H3HA 1UK9A 2VT6A 3E3AA 2HA5A 5DNWA 4QLOA 3VKFA 1W75A 2VJBA 4J3JA 2OCGA 4MQMA 3VDXA 4M0MA 4H7HA 2AJCA 3X3HA 3DD5A 4XX1A 4Y2PA 2WFMA 3H1BA 2CUTA 5D3KA 4BRSA 4X7BA 1QIEA 3E4DA 1ODTC 2Q0XA 3FLEA 2QVBA 1IMJA 1QJ4A 4G4JA 4OPMA 2LIPA 5LYYA 1A8SA 1MAHA 3AIOA 2P8SA 1BS9A 2D0DA 4NS4A 4BCDA 2WUFA 3I1YA 4Y2VA 1EK1A 4QDZA 3SWWA 1PFQA 2W6CX 1N5RA 5FOQA 4A23A 1ZOIA 3D3NA 4HXEB 1MT3A 3EQ7A 4BE4A 1MN6A 2I3ZA 2XQKA 1WHTA 5AO9A 1F6WA 3DOIA 3W05A 2DFPA 1TQHA 1CUHA 3I2HA 1K4YA 3QPCA 4FOLA 3ZPXA 5IKXA 1VOTA 1Y7IA 1DQYA 3TEJA 4UBNA 1CRLA 3WKDA 2PUJA 2WIKA 5CBKA 4BAZA 1JMYA 3HJUA 1AQLA 2HU8A 2XUOA 2PSDA 5EFZA 5HK8A 4LHEA 3WKBA 4BDSA 4H77A 4ROTA 2WG1A 4W1SA 2JGJA 4B9AA 2HA7A 5CT4A 1ODSA 3F97A 3ESDA 2Y6VA 3G9XA 2AJLI 2AJ8A 4CCYA 4BVKA 2C58A 3G0GA 1W6RA 1K6EA 3H2IA 1LZKA 2BUBA 4GLBA 3AIMA 5JD4A 2H9YA 3FSGA 5JASA 1YS1X 1JT2A 3LLCA 3H2HA 3UUFA 2XMBA 4NMWA 2RI6A 1FFCA 2ACEA 2OAGA 4HTAA 3WA6A 4LYDA 3MUOA 3QPAA 2DHCA 5EGNA 1CVLA 2PSFA 1QGED 4OYLA 4W1PA 3WK4A 1XLUA 3HACA 2EDCA 3C5VA 4C4YA 2CZQA 4KEAA 4N8SA 3GELA 1HDEA 1OCEA 3E0XA 3N2ZB 2XMDA 1IUOA 3C70A 4DLNA 1P0QA 3AIKA 4FDMA 1QIFA 5T4BA 2PSHA 2DQYA 4X6UA 3QVMA 4XJVA 4PSCA 3WQHA 3WIBA 2CKMA 4IQ4A 2AJDA 5DWDA 1GKKA 3QPDA 5E2IA 3D59A 1L7QA 2BGRA 4X3CA 1R1DA 4UHHA 1JJBA 1HPLA 2ZJFA 2QUAA 4B7ZA 3WJ1A 5SYMA 3NGMA 4UFOA 1R50A 4HAIA 4G8CA 4GEGA 3SC2A 4U2BA 1AX9A 5A2GA 1UKAA 2E3JA 5AP9A 2HU5A 3I2GA 1A8QA 3BE8A 5FUMA 3A2LA 4RGYA 5AM3A 4UHCA 1UKCA 4HXFB 3ZWQA 3S8YA 2O2IA 3PDCA 1ISPA 5IVKA 4MYSA 4KE9A 4QNNA 1CUWA 1R88A 3V48A 2WFZA 4K6KA 1JMKC 5DLPA 2JBWA 5FV4A 2H7YA 2GBGA 3H2KA 4N8EA 1H2XA 1E8NA 1QZ3A 4W1RA 4QDXA 4QWWA 1AKNA 2ONCA 5AH0A 5T4FA 4WJLA 2BUAA 2Y1KA 3H2JA 3FCXA 4AX4A 5HF5A 1IVYA 4RE5A 5A7FA 2XLBA 4F5ZA 2V98A 2XDWA 3WYNA 1DWOA 4C88A 3QMMA 1CPYA 3I6YA 3VJMA 5FLKA 1FJ2A 2HA4A 4PSDA 3QMWA 1LPNA 3GUUA 2WUEA 3PF9A 4Q1VA 4FLMA 3HC7A 3O95A 3WKEA 1JI3A 3TGLA 1LPOA 2XUPA 2HRRA 1G66A 1DTEA 5AKZA 1T4MA 1O6FA 5KWIA 1XZEA 3DKRA 1X70A 2GYWA 2QZPA 5HQ3A 4EBBA 4DNPA 1AUOA 1XQXA 1G42A 1QFMA 4LXIA 1A7UA 4YK7A 1JU4A 2VJAA 3WWPA 5JZBA 2O7VA 1UT6A 4AMZA 5ALLA 3BJMA 1XKLA 3L1JA 4Y2QA 5ALXA 2WTMA 5AKHA 2ZJ6A 5DNUA 5EI5A 4P92A 2XUDA 5KWJA 2JGFA 3OTQA 1I6WA 1KEZA 3WK6A 4QE3A 3WL6A 3RARA 2QOEA 1ZD5A 2Y6UA 5HF8A 4Y2TA 5ALOA 4FFVA 2W22A 4UHEA 3QYJA 4FTWA 4E11A 1ACLA 1QE3A 4ZGBA 4G9EA 4BC0A 3A70A 3I2JA 2GBIA 4QWMA 5I8PA 4BVLA 4B83A 1G5FA 2XUKA 3DL7A 4PV7A 2DR0A 1R4ZA 1U8EA 5ALJA 1WHSA 3WL5A 3C5WP 2Z5GA 1AMNA 2RHWA 4G9GA 4EA6A 4X91A 4G4IA 5AM5A 3OG9A 3IULA 4BAGA 1ZJ5A 2WLSA 3CN7A 1B41A 5CXUA 4AB1A 1XRLA 1WB5A 4BTLA 5AKXA 3A6ZA 1E3QA 4TPKA 3K6KA 2VJDA 3O4JA 2QTBA 3OURA 4JNCA 4DMFA 3D2CA 5CH3A 1XQVA 3ZLUA 2QXUA 1ODCA 1H2ZA 1XZJA 4S0XA 4B80A 3STYA 1QO9A 1XRNA 5ALKA 2PX6A 5LZ4A 5ALEA 5CXXA 4ARBA 1LPAB 5BWBA 5JAUA 5AKEA
chains in the Genus database with same CATH superfamily
4U9IS 2JEYA 3CRW1 4I3GA 3KJFA 5EZQA 3QFTA 1SVWA 2IDKA 1E69A 2JW5A 2OB2A 3JR7A 4K28A 3W6OA 3BIFA 4ENPA 1W4LA 4L4ZA 4L8VA 3MJTA 4RZXA 3WRYA 3C14C 3K5HA 1V16A 2WU1A 1PZEA 4V0LA 2DJ5A 5AM1A 1XVVA 3FGOA 1N8SA 1P39A 2JVIA 5CCXA 2AW3A 3F9IA 3EIHA 3UY4A 2DUWA 2A6PA 3RFFA 2QK4A 4OMFG 1QMPA 4OHMA 3CRVA 5HJ2A 1R0CA 1FBNA 4YFVA 2ERYA 1E9RA 2IXBA 3GRZA 4TXLA 3KYDB 5FBHA 4D5EA 3DM5A 1V16B 2O1EA 3ETEA 4NFSA 2HFJA 4EO4A 4Z9BA 3KTFA 3VPXA 4MJ3A 1QOPB 1A27A 3QLVC 2CGEA 4G5XA 1OXVA 5ALFA 4DLVA 1PFVA 3LLUA 2H5IA 4D8UA 4WACA 5B2ZA 3EGOA 4L6AA 3GAFA 2GZ1A 3CS3A 3G2LA 1TUEA 1WWKA 4WZZA 3CVWA 4FCVA 5AM0A 5JHHB 2ZJ8A 3A36A 1QS0A 1E6KA 2CXUA 3I1JA 4I1OA 4QOHA 4ZYYA 3EE6A 4QOFA 1PCXA 3SFVA 4V2IA 1QU3A 1CFZA 3OJOA 5ALUA 2H0RA 4YDQA 3WMRA 1CQZA 3SR4A 1WNTA 1NYLA 4I4LA 1TU4A 3UGJA 4JH0A 4QGFA 2P90A 2QX4A 1LPSA 3HGQA 2YZ7A 4N12A 4OU4A 1T3TA 3ZG6A 2PSSA 5I7RA 5HDQA 4ILKA 4ZAWA 1E9AA 3C4JA 2W9XA 3JWJA 2NM0A 5EIHA 1E6MA 2BFWA 3GQBA 1T36B 3BIOA 4W5OA 5B5SA 2EWVA 1ZFNA 2FOIA 2XWPA 1JNYA 2QLFA 3CRMA 2J07A 2CLFB 1FFBA 3AEKA 3R20A 3V33A 3IPYA 2CFRA 1TMGE 3UGKA 4TN1A 2Z04A 3RVKA 5ALZA 2CEKA 3FBTA 1MC1A 4CHGA 4F7DA 4HGQA 1TFUA 3ZGXA 5LZ2A 5DOZA 4J0JA 3D3KA 3W5IA 1L5WA 3MCZA 4CCAA 3NM4A 2HU7A 3SNHA 4XIJA 2NNWB 4KITB 1A8IA 5CB4A 1QGOA 5F1KA 2XUAA 2H4FA 3E9EA 1IY8A 2PE5A 4U1RA 1P5HA 5E3JA 1OQAA 1JHUA 3QVLA 4YQFA 4BZPA 1GA4A 3ZV3A 4IDDA 4U7TB 1OGYA 5D3MA 4AY4A 4TYNA 2VP3A 3CWCA 4H7FA 2I7XA 4RJTA 2YBEA 4U9UA 2ZJBA 3GFRA 3PNLA 3TRDA 2AWNA 1YV9A 3FBWA 2YN0A 3UMFA 1U6KA 2HEGA 2QPLA 2HHAA 5LVAA 1M2GA 1FVOA 2XMGA 4GRDA 2Y77A 3D1JA 4PZYA 4PLTA 3KRTA 4NEQA 5KSYA 1ZMRA 2CFCA 2R6GA 3TE7A 3ZZUA 5BN1A 4V03A 4DKXA 2SCUA 3JQDA 1RCUA 2IOYA 3JQBC 1KK1A 4GC5A 2RHTA 1M6EX 2A5FA 3GVPA 3L8EA 3RFCA 4QICA 3VBEA 1ZOPA 3K8ZA 4EAQA 3JAKB 5ECGC 4BNMA 3FVRA 2CF6A 2VBIA 3KB6A 1P31A 3SR0A 2ZYRA 4AUEA 4DANA 3ANYB 1L7MA 1OI4A 1RXVA 4DWJA 4MW1A 1RKUA 3LO5A 3U7HB 3NC1C 1Q22A 4HOYA 1YH3A 3WHKA 3D8RA 1TD1A 3TBFA 3VC7A 4EY4A 4I50F 4IDBA 4CM4B 1YSCA 1RRVA 3R3HA 4JFRA 4A9AA 4FB5A 3GH3A 1UJBA 1AQUA 1AKWA 1JVSA 1LRJA 1T1SA 2NADA 2YJ4A 4WI1A 2XITA 3RRYA 4EI2A 3OQNA 2R6AA 4NFLA 3R7NA 3ISTA 2M1XA 2WIJA 1Z35A 4HLNA 4MKHA 3MM4A 2OFOA 1SQFA 1KK0A 4HKTA 4RK1A 3MWFA 7REQA 1LY1A 1WQ3A 2B2XA 5C37A 3BRCA 4ENWA 3PGA1 4ZTZB 1DWQA 3NC0C 2WUVA 4LZAA 4UVGA 1PR0A 3TOVA 5DLQC 3D2LA 5DK4A 4W8GA 4CIVA 2Z9DA 1C29B 5JMWA 4EVSA 3SQOA 2FR8A 1CEXA 2R8BA 1G2QA 1O95C 4JZKA 3RROA 2XNKA 3DDZX 3LSYA 3CMMA 4QVKA 5TMDA 3UT5B 1MO5A 3R3ZA 2A9OA 5J5VA 4LMRA 2J4FA 1DDOA 3WNQA 3I1FA 3U48A 1EGMB 2POQX 3GEDA 3RSOA 1NQAO 1Y0BA 4RVFA 3Q7IA 1UANA 1XJQA 3TJRA 4JI2B 2H31A 2G9QA 2R79A 2X4DA 3MA0A 5D86A 5BPFA 1QLWA 4N01A 2BY4A 1YWGO 3ET4A 4P34A 1E1NA 1TOAA 2VP0A 3PIIA 4YAWA 2J0VA 4Y6QA 4A8PA 3I5UA 4DC1A 1X3LA 3CG0A 2QN6A 4KFUA 4QGHA 5HUQA 4QECA 1SU6A 1O58A 2PX0A 2WKSA 4AJ9A 1ZNWA 2UZ1B 5G1NA 4BGDA 1JJFA 2HFKA 2DZDA 2W2XA 1I5EA 1UPCA 2JJYA 3UC9A 3QIAA 3R5XA 4HG2A 3PC8A 5C53B 1IM5A 2E89A 1NQWA 4OIFA 1HG0A 1Y81A 5IT4A 3RYIA 4BU0A 5DBGA 1C41A 1JNXX 4MIKA 4TOIA 4B75A 2DFKB 3UFXA 1GAQA 2WUGA 4YRSA 4QUIA 3BA6A 5AHKA 2IXDA 5CT9A 3G88A 4R3UC 2XCSB 5KQPA 4TUYA 2YY7A 1BO6A 2QKYA 3EVGA 4KQFA 4FYXA 3UW3A 5JZMA 1K5PA 2FWAA 1YAJA 2C7QA 4O5OA 4MYDA 2P91A 4BO7A 2YWRA 3TD6A 3M70A 4ZFNA 2BELA 2QL9A 4R1OA 3WIEA 3WP0A 3DQPA 2XYHA 4GI1A 4I1VA 2HZBA 1QIMA 3FETA 3HCNA 1TZBA 3JQ7A 4C7KA 1CJSA 4PZUA 4FN5A 2VPWA 1K97A 4Z4EA 1H2AS 1MQ8B 2B8TA 2YASA 4HX5A 2H3EA 1SXJD 1CDOA 5AK4A 2AI2A 3FOCA 5LDDC 5B1DA 1RI1A 2C04A 2BKEA 4L0MA 5FUBA 4BLUA 4FINA 2AB0A 1EINA 1QIIA 2E7ZA 2IIVA 2XADA 1VG0B 4X1IA 2WJAA 2R8RA 3DOEA 3C85A 1XLWA 3QF4B 4ZMSA 3GUZA 5C1BA 2AYYA 1E9BA 1CUBA 5C18A 2PGLA 1T3LA 3TTXA 3H6GA 2X0JA 5EHIA 3QPVA 3ELYA 1RYHA 1XALA 2NYUA 1ZISA 5C7IO 3S99A 2PIDA 1BW9A 4MQ4A 4NQRA 1V3UA 4KR3A 2MWMA 4PYRA 4AXBA 1CV2A 4A8HA 4AMUA 5ALYA 4OYRA 4B7UA 3BOSA 3V1UA 4PYMA 1BIFA 4QJBA 4TSKA 2HNBA 4DR2B 2PU7A 3OZCA 1FDWA 2X41A 3HYNA 2V7TA 1I7QB 1S3SA 4ZAGA 3CLRC 3GRFA 5LDHA 3NQ41 4C7MA 4B3MB 3TW6A 2FEMA 2OCBA 3W8NA 2DSTA 4DA8A 3IERA 4HUQB 5EMMA 1PLJA 4BFSA 2WSIA 3V8BA 2ZITA 2QUJA 4CHTA 1XA3A 2QVGA 2X8LA 3J80A 1KJ8A 1L5ZA 1W1WA 2NZ8A 3AZQA 3BGDA 3HA3A 3HNRA 4GQBA 3JX9A 2G06A 4TKUA 1JIVA 3CU5A 3R5FA 5AJTA 4GKAA 2FTKE 4M1TA 4R9RA 3U60B 4FEGA 1ZUNA 5KWSA 1P4SA 2Z09A 4FFDA 1XCJA 3OU2A 2WJ6A 3KJIA 2YWJA 3P8ZA 4BMZA 4C2AA 1SKMA 4GP7A 4NMLA 5EQJB 1HFEL 1K68A 4DV6B 2EHDA 3FTNA 2Y66A 1GU7A 4RORA 3TFWA 4CM6A 4YT2A 1NN1A 1V1RA 5TRTA 4OJKA 4XH9B 3MCUA 3KTAB 2NO5A 3L1HA 1H1TA 4I4CA 1MDFA 2QQFA 2PGNA 2C5SA 4HTFA 3G0BA 1TA9A 5E4FA 1ORWA 2C0QA 2VPTA 5TB5A 4AM8A 4E6EA 3T3MB 1NSYA 1LS1A 1UWVA 3CTMA 4PE5B 5IAJA 3LMKA 1XD2A 4I19A 4DSAA 3NVKI 3I9KA 2QB5A 1EFPA 3GUYA 2IHKA 4K6GA 3RF6A 3KD3A 5JZSA 2ZT5A 3MHTA 4P3PA 4MLDA 2OD9A 3H4MA 4B3FX 1QQTA 5F52A 1FFYA 3AEUA 2R97A 1CSEE 3WRVA 4F93B 1WF6A 3GEMA 5BMVB 3BXZA 4ZTBA 3WWOA 3ZD9A 4AW9A 4DREA 1DX4A 1KEPA 1ZIDA 4DCCA 4EG7A 1N7JA 2UXCB 5KVCA 3GJ3A 4GBMA 4DC0A 1LF5A 3SJZA 5FBKA 4DBLE 1B00A 4HRYA 4YP6A 3S3TA 5JJIA 1E2IA 2I2BA 1SRRA 5CDFE 3VR4H 3PGMA 1ENZA 3W34A 3GL9A 5BWNA 3TRHA 2FH5B 3QV2A 1H5UA 3G8BA 4XIIA 3KTDA 3QX8A 3DZFA 3JQ9C 4CUJA 5CFOA 5KCMA 1O6CA 3CE9A 1IIRA 3GHHA 3MJDA 4D9KA 5LP6A 2CL5A 3I0ZA 4TS4A 1CUCA 2BJWA 4L2IB 4OXQA 2XUQA 3T41A 1Z74A 5JSQA 2OHGA 2NSLA 1J9ZA 3W3AD 4TTJA 3KOOA 2YOHA 2W2KA 4O59O 2QRMA 3KOXA 3AESB 1OHHD 5EHQA 2NTYC 2FN9A 3QKRA 4EFLA 4HZUB 5BSTA 4OXKA 2A92A 2VTKA 4W4TA 1NY5A 4H7DA 4E5VA 3QBVA 3R24A 2WIDA 2C5GA 4WKOA 4TV8B 3VR4D 1HYEA 5TGTA 3F6YA 4Y9SA 4AZ0A 2GHQA 4X7RA 2Q1YA 5ANRB 5AVXA 3DE7X 3AGQA 1DPGA 2WVGA 3SM3A 5F9FA 2V5AA 4YPFA 4GE3A 1ECCA 2O2HA 5HRCA 1YK0A 4UHBA 4J43A 1OU0A 4BB5A 3UATA 3ZBPA 4C5CA 1CIPA 1E2NA 1YJ5A 3EDYA 4ABYA 1L2TA 4TV8A 3B1YA 3CKYA 1DOHA 4TLAA 2G8LA 2ALJA 3I72A 4M1WA 2Q9AA 3AYZB 3EUEA 1IWOA 2G5PA 1HQKA 4OUDB 4YJFB 1TGYA 2P2NA 1FX0A 3M81A 3MVEA 4MV1A 1V47A 2WZCA 4NIMA 1KJ9A 3THYA 1L1QA 5FA6A 3MUEA 3GFVA 4L51A 1GN8A 3E3LA 3NFRA 1NV9A 2RHOA 4XFKA 3ZJ4A 5KS2A 4CMEC 1NRWA 2C4HA 1ZKDA 3ABOB 4XRGA 1KGSA 1UDCA 3LQFA 4U2GA 4Y3UA 4FDTA 3ZHVA 2RIPA 2IOHA 1THMA 2IPAB 1KFJB 4R16A 4F85A 4RMNA 1GKYA 1H9BA 5TMPA 1E2KA 2ZAMA 3HZHA 3IJEB 5C1IA 5C1PA 2O23A 4BVJA 4RD6A 2PGAA 3Q0TA 3VOSA 4YUYA 1S3GA 5H8WA 1RWOA 1T34A 1ISGA 5AVKA 3NR2A 4HMQA 1WUTA 2AFHA 3HM9A 1NJ2A 1IM2A 4KV9A 4XJTA 2DETA 1SC3A 1I32A 2AS0A 4NPCA 3KQLA 4MWTA 5E1DA 1YQXA 4IJVA 1WAMA 1UJNA 3BGWA 1V26A 3ZY5A 3K9NA 3V1KA 2G88A 4E5DA 1LI4A 3THWB 3SD7A 1QQAA 1N5OX 3JW8A 4J1NA 1MT0A 2R7NA 5DFAA 3D8NA 3LOQA 1WLSA 5AW4A 4UE2A 1UPBA 5FFNA 4B34A 5TS3A 5AWFC 4MPTA 4O3FA 3VNQA 1TQ4A 2CNKA 2YNMD 1TYAE 4CLDA 4V1CB 2R6DA 3KEGA 4GSKA 4NJOA 1FDOA 3FOWA 3QXXA 4I5IA 5ENZA 4ZI7A 1X1QA 3NM6B 2BDTA 2WSSA 2ZTUA 3WMWA 5FXMA 2QBYA 3SZRA 3Q3VA 2VQSA 4JYBA 4AO8A 1ZSYA 3MGGA 4DG9A 4ZGWA 4PG5A 3UAOA 1I0ZA 2XVZA 4GI5A 1JKFA 2H0AA 1DJLA 3SS8A 1W88B 5KTYA 1Z5OA 3PFGA 4GX5A 4NKRA 5IANA 3QUSA 5JTTA 3I92A 1J1IA 1X86B 3FCSB 1NFFA 3D4LA 1X1TA 2P6NA 2QG4A 1RJDA 2EZUA 4JYZA 3INGA 4MWDA 2FX2A 3REGA 3FVWA 2AXQA 1B6TA 1C9DB 1KZ9A 2HPVA 2Y0BA 4IX1A 1SOWA 4N1AA 4ZWNA 1KK2A 1NLUA 4KXNA 1X7WA 3UVEA 5B37A 3JWHA 3WK7A 4PLCA 3HCAA 3OD5A 5AQ1A 3QVUA 3EB9A 4L3WA 1YZTA 5GZ6A 4OGGA 2DOKA 3T1NA 2YQ5A 3AI2A 2XGGA 3JYHA 2ECOA 4B0OA 3Q85A 4IH4A 1LSJA 3P9XA 1L5KA 3PJGA 5JXGA 5ALDA 4XEUA 4L8WB 3NV9A 5H7XA 1H8EA 4LRYA 1HBJA 2G76A 4QT4A 3A7DA 3HE3A 3PJDA 4KE8A 5BT9A 3RC3A 3N2LA 1JEYB 1DKMA 1Z7YA 4B32A 4KLAA 4JLNA 1LKZA 1R2QA 4M22A 3PU6A 2XH8A 5EPUA 3T1QA 4WD3A 1TQ2A 1YULA 4N5DA 5CPBA 2OXFA 3JTEA 3AFHA 3SZ3A 2DE0X 2I29A 4BEVA 3HP7A 2CL0X 1SVUA 1VXRA 2RHCA 2WAXA 3D1LA 4L6CA 5CITA 2J9ZB 3DF9A 1P7VA 2ENUA 4HXGA 3DMTA 2E1RA 3HSYA 1OPXA 5JSYA 4HLDA 3NHFA 2JRCA 4JQOA 3Q8LA 1HDYA 1T13A 2D06A 2WOOA 3MPUA 3OPVA 2C1EA 4IIBA 4MQ5A 3ESRA 4IPTA 5A6VA 1Z5WA 5CA0F 4IRXA 1L5SA 3BXXA 3O1IC 1J8DA 1Z6XA 1RP7A 1FDTA 3VR1A 1NG9A 2XCRB 4HBGA 4JUAA 4CN9A 5AKJA 5DYNA 3RTBA 3GLGA 2FAXA 3FA2A 2ZRDA 1H85A 2A0XA 2R65A 4YR9A 5ADVA 1QP0A 2AE2A 1MC4A 2GAJA 3GX1A 3R3YA 1KY5A 3LPAA 5ELXA 1YGYA 2AVNA 1KWKA 2AK2A 2HH9A 3IV9A 2XNSA 1Q1GA 1H22A 3AK4A 3ICCA 1WCIB 5FWYA 1FX0B 1XVIA 3OI7A 4IG4A 1L7OA 2JEZA 4CODB 5CA0A 3BCSA 4WL0A 1T4GA 4JLMA 1V2HE 1XZMA 3FHJA 2XY4A 1VRWA 2FFJA 3C74A 1IEWA 4IHAA 5EWJA 3ZCRA 3I5YA 1KRWA 4YMWA 3RTCA 1EE1A 4E70A 3U1BA 4RPJA 5BPHA 3ZX4A 3ESYA 1SQ5A 3JS5A 1UMBA 5CFNA 1Q7CA 1Z2AA 1N4DA 1WA5A 1XMJA 1LWOA 2BEVB 4M8NE 3OIUA 3S1AA 3CTPA 1NVTA 4TSRA 3E7WA 4JYPA 4IRUB 1Y63A 3OFKA 4LDZA 1AS2A 1T43A 5DVZA 2ZQZA 2RKBA 4O2AF 1P2DA 3ISJA 1VHLA 1TJ3A 1ZJ4A 3AM4A 4A6EA 1GZ7A 1KYIA 5DTRA 4RKFA 1PDWA 3AR5A 1U2EA 4WESB 2O07A 3OICA 3HA5A 5AR1A 4GM0A 4QOGA 3ZWXA 4Z99A 5KYWB 4XB1A 5CFLA 2AEJA 2WILA 2JFUA 3G1TA 1M76A 2JHPA 4B7CA 1NMEA 2XUHA 2YHAA 1ID1A 4PF1A 1YTLA 5CW1A 2G9NA 1JPVA 4BMDA 3NHJA 3ZJVA 4C30A 3IXMA 2GETA 1KKMA 2QSJA 2J1LA 4HYQA 1F8YA 3LM8A 3IDAA 3OWOA 3Q7TA 1JEEA 3SHTA 3RSHA 5JWOA 1JBEA 4M1YA 1U6IA 3FB4A 1T1GA 4X93A 2J31A 3WISA 4B8YA 3PXUA 3ESAA 3HYTA 3P2JA 3IOEA 5H81A 3FNEA 4LEIA 3W1WA 2V0GA 4P08A 4AP9A 3T61A 4EGSA 5IJAA 1DFIA 1JE1A 1XTJA 3RYTC 4EB8A 4PLFA 5JROA 3M8KA 1JR2A 1E2UA 3A6LA 1CR0A 3KHTA 3EY9A 3L92A 4XYGA 2O2DA 1WBDA 1AK2A 1RQNA 2IP1A 1EJ6A 3E2MA 2ZP1A 3PVSA 5IBPA 1YVUA 4EJ0A 3TZLA 3E18A 1P4RA 4WASA 2VZEA 3A1WA 3MSCA 4RNDB 4OAQA 5DBEX 3C1AA 1Z4NA 4D4MA 2H1CA 2PWPA 5ES4B 1GLVA 1ZRMA 1RNLA 1EK0A 4DXDA 5KREA 3HJRA 2CN1A 5ABPA 3FNIA 2O0KA 2LRHA 2NUTB 1Y4UA 4Y8VA 2OLEA 4TMFA 3QBJA 1P1FA 2P30A 4IL5A 4OQ4A 3A9SA 2PX3A 1PNRA 3UK6A 1NURA 5GZ3A 2W2NA 3BBPA 3DAGA 4RDIA 1GUDA 4IHQA 3U3KA 1VLLA 2NSDA 1CZOA 2HJGA 4J2TA 2R86A 2WZDA 1I5OA 4A8TA 2GAAA 3ANMA 2P2YA 2HX1A 4PSUA 2Q5EA 4F8JA 3L77A 4XWOA 4D26A 4LY9A 1JFRA 3E7XA 5JY6A 1RRPA 2OGZA 3K8QA 2HQSA 1CQXA 4Y2SA 4FFPA 2V7QA 4NJMA 2PPVA 2YH2A 2GYVA 2FWNA 4IFIA 4FLFA 4WZ6A 1JQBA 2XRZA 4EF6A 1UL1X 3CEMA 3EW9A 1KORA 4F4FA 1TO1E 2VG8A 2YHIA 1SC9A 1SKAA 4FC7A 1SKUA 3I62A 1XCMA 3TNDA 1QF6A 3BB1A 3X1YA 4QZVA 1HYGA 4GL4A 2ZSJA 4CIAA 3S6JA 3UA3A 1YCFA 2LKCA 3OZTA 1CZRA 1IBSA 2G7ZA 2D1SA 4LQCA 1FS4A 2RHLA 4UM7A 1DIRA 2ZSHA 3HU3A 5JBQA 5DI3B 4PFKA 1GG8A 1N1DA 4JSRA 1TEZA 2ZSFA 2PH1A 3ZWWA 1XZNA 2I7VA 3VISA 3ZZ1A 8AT1A 4L08A 4G81A 2P78A 3OQ1A 1XYYA 4YCDA 5A05A 1XDSA 1Z82A 3KSRA 4PVCA 3USES 4O4IA 4TL6A 2Y1EA 3MOSA 3AR9A 4KQ1A 4QOSA 1Y7PA 3U4DA 1EG7A 2GYUA 1FFGA 3RYHA 3VJKA 1P17A 1QWSA 3A7EA 3FKQA 1RXSA 1XWIA 4JK3A 5ETJA 3QM1A 3SJCA 4Z4CA 5DNYB 4GU5A 2V8BA 3O7MA 2H2IA 4X6YA 4ZVTA 3DPUA 4GGOA 1GIAA 4L28A 4CTOA 4CQNA 3V1MA 4RSMA 2QQ5A 3S4YA 3ASUA 4MH0R 3PITA 1NOJA 3QVGB 2IIQA 1IAVA 3AHDA 2G5CA 4EMUA 1B0UA 1ZWLA 2JAOA 4BY9E 2GAIA 4PPNA 1NQOA 4Q3LA 3PHIA 4OJQA 2JPDA 2WYWA 3NYQA 1GRQA 1LTKA 2Z8YM 4HGYA 4BVHA 1R27A 2QTRA 3HRKA 4ZT5A 4J8PA 2VNKA 5AK3A 3RJTA 3TPZA 3W8DA 4BATA 3COYA 2WF7A 4Z2AA 3EQZA 1JEOA 3DLPX 5CU7A 2Q7OE 2F3UA 3FYUC 1NI4B 3S7TA 1H6AA 1GR0A 4YAIA 5LZ9A 2OXIA 2BRUC 3VPSA 3IEIA 4PCUA 3ROZA 5IUJC 1BQ3A 1E1RD 1XGKA 2QM3A 1Y8RB 4OA8A 1AKMA 1PDVA 2GXAA 1U0BB 1LA2A 5LXTB 3RHFA 3LWDA 4RS3A 5G4KA 4U2EA 3ZUPA 3W1EA 2BTEA 1QUFA 1NDHA 4R9UC 1SIOA 3FDJA 4MOWA 2RH5A 4PVDA 4UNRA 1FUYB 4JLWA 3T7IA 4RPGA 1P62B 3ZLTA 3DP7A 3VR3D 4G8BA 2C9ZA 5AVTA 2OD2A 2GHIA 3IP3A 1NG1A 3GZTB 4WGGA 5CGZA 2IBMA 4PLWA 1U4NA 2BM8A 2Q4BA 3KEMA 1LDGA 3ZN2A 5J9FA 4PNEA 1UJCA 3OLXA 4DT1B 2HAEA 3U81A 4ZREA 4F3CA 1QPGA 3MCWA 3WBFA 1PG0A 3H5RA 3AMVA 4NU6A 3F71A 3K96A 4XLTA 4WKCA 5KNDD 3SPXA 1TIKA 2PS9A 2X8WA 3ICVA 1XNHA 5GONA 1WP4A 2WWHA 1Z4OA 5G0VA 2H57A 2O1SA 2Q2VA 2PZMA 1IN4A 2X9LA 3PD7A 4P86A 4ZVLA 2O8NA 4DDUA 3TVYA 1TVEA 1EUDA 3KZNA 4CLXA 3M0EA 4N47A 4NYIR 1S1CA 5B3AA 1Z5PA 1OC2A 3ZGOA 1U2GA 3KVYA 2GJSA 5JC1A 4OL0A 3V8MA 4F4JA 3DZBA 4F6RA 5A3QA 5IYZB 1FXWA 1UXKA 1MG0A 4NONA 4YACA 5CHEA 1J20A 5CVCA 1QG0A 3W8EA 1NW4A 1Z0JA 3AR2A 2AQIA 3I83A 4QGAA 2H9AA 2QTAA 3UYLA 4BXOB 2R4TA 5I4KA 1KP3A 1G2IA 4RK6A 2XBMA 4WXPA 4DCUA 3L7CA 2CDNA 4UUOA 1ZL2A 1NUUA 2FQYA 2BBSA 5HYVA 4K5QA 2R96A 4KXLA 2G9VA 4OB8A 5CXSA 2XA2A 3PC7A 4GMHA 4LKRA 1Z47A 4YCJA 2XXAB 4XWYA 3K32A 5HE9A 1RZVA 1Q0ZA 2V7QD 4KX5A 5I7SA 1PNVA 1EEHA 3EEFA 3PE3A 1OH5A 3PTLA 3P4YA 4DDTA 1YS2X 4E7OA 1M7BA 1M1NB 1SKYE 3EGDA 3IT2A 4O1IA 4UHJA 3ZS8A 1A9ZA 4YREA 1RLUA 2DQZA 1E0SA 1NFQA 4LWZA 3GLIB 3LOPA 4C43A 4DWWA 1RPAA 2AI1A 4BBAA 1K6IA 5C1DA 1QRTA 1M6VA 3AVVA 4RF2A 5D1NA 3H65A 3FWYA 1GFZA 1N9GA 3U16A 1I94B 4RWEA 2IYOA 4CR7A 1N2ZA 5CDHA 4TRMA 2QROA 4AJLA 3LUAA 3PQ2A 4MV8A 1MCZA 2X76A 2VN8A 2V9CA 2OC4A 2AN9A 4X8LA 2W2OA 5F7XA 2A0WA 2OSBA 2JH3A 4Y9RA 1PZGA 2W6JA 3HUEA 3IC5A 1LLQA 2OPHA 4EYOA 1TKBA 4IKEA 2A7XA 2ZETA 1II8B 5EWMA 2EHJA 2PS3A 3N2KA 4DCSA 1IRXA 4E31A 5EE0A 3IESA 3RVBA 2QE7A 1KE1A 1GITA 1T24A 3DC2A 3HQ4O 4J94A 4ALLA 5CJ2A 4Q7LA 3ZDCA 1RLOA 2PUHA 4UDOA 1FFXB 2HRZA 1PKXA 1ZM4A 4P8RA 2G70A 2HKIA 1B0PA 3IAAA 2Z3VA 1JHRA 3M1AA 3FMPB 3TR0A 1FDVA 5BN4A 3TZCA 5BV0A 3HWX1 3ZV7A 1JKXA 4U02A 1KSGA 3K09A 1UKVY 2VA9A 5CB8A 1O94A 1G6HA 5CNMA 1YVDA 2A4KA 1LNQA 4YAOA 5FR2A 1Q83A 4NCKA 1X2BA 5HKBA 1VL5A 2P6OA 1AUPA 1KPIA 1MOZA 1ONNA 1VLJA 3UWKA 3LQQA 1ODJA 3OZGA 4OHKA 2P0EA 1JG3A 1JQLB 4L7QA 4ZIRB 3OJCA 4S35A 2B6NA 3GJTA 1L7AA 3O8QB 3ZDQA 2GSDA 3ETDA 3N28A 1ILWA 1R6VA 4FHGA 3DMGA 4KIFA 1Y9ZA 5FHRA 3PD0A 2HPAA 3E35A 5IAKA 3WGUA 1U0SY 4MW0A 3VR3A 2Q3FA 2Q5QA 3DFKA 3DM9B 4JBLA 4XX0B 1F9EA 1MNAA 3DVAB 4WLEA 1ML3A 2IE0A 3WADA 3ZBQA 4N3GA 2VHCA 4MJLA 1Q20A 1T4CA 2OHJA 1R9MA 3DYIA 1ZU5A 2CXQA 2P79A 1CRZA 1EFVB 5FORA 3ZHBA 3ULKA 1GAWA 3MIZA 4IICA 1NUSA 1B16A 5KVVA 3A1UA 3CX7A 2V5UA 1G5RA 5KQMA 3KVVA 1YQDA 1IUPA 3DS8A 4X84A 5JWRA 1XZ8A 5KINB 3OA2A 4IHKA 3WNVA 3G5TA 1ZJ6A 1BROA 2PGXA 4JBHA 3A27A 4LVUA 3WBJA 3M5WA 4OB7A 1B0AA 5ICCA 4FK8A 4PEVA 3CLUC 2JIQA 3O4IA 4E03A 3L9XA 1H2FA 3MK31 1KY3A 1KRHA 3AF5A 3CCCA 4LHVA 3SYNA 4DR1B 1KR5A 3KLNA 5C1OA 2Q4TA 3LIIA 5DCLA 5EXPA 2R48A 1RKXA 3U1VA 3F47A 3H0KA 3W5HA 2A9JA 1GT91 2DBQA 3KBOA 3PQ5A 4OVKA 5J59A 4DNFA 1YONA 1GXSA 3WGJA 2AJTA 3HBJA 3KQOA 2BGNA 2XMPA 4P22A 4URHA 4YH1A 1MFZA 5CVVA 4E88A 4G0YA 2OE2A 4G09A 3NBXX 3W3ZB 4CCYB 5KX5F 2DCMA 4ZOLB 4MS1B 4LZZA 1VJGA 4PHCA 4QFDA 4U00A 3WMFA 5HOQA 3TNYA 3WYGA 3BSWA 2Z9BA 4MS4B 2V7BA 3QKWA 2BEWA 3H42B 4PX9A 2SKCA 4ZJYA 1F4PA 1NF9A 1BCRA 4RCZA 4RETA 4KPFC 1FNNA 1E1QA 5D5HA 5BRNA 2G71A 2VYQA 2H5LA 1ZGJA 4UTZA 1E32A 2C57A 4EW2A 1SEVA 2GWRA 3UUEA 4GKJB 3RTGA 5I7FA 1HF3A 2H1RA 2PT9A 5HEKA 4BFCA 1XN4A 3H2YA 1H5QA 2EWWA 3MT0A 1K2VN 1V39A 3FCEA 1ZX1A 3I39X 2HEIA 3O9MA 4BO3A 1T26A 1UXHA 4C0SA 3RT9A 1G7RA 3WL3A 4CLHA 4P2GA 3T95A 2OQVA 1QRSA 1GPNA 2H9IA 4HEHA 4PG6A 1I6KA 3K30A 3P9KA 5DTMA 5EWLB 2GF9A 4QDJA 1UJ4A 1P81A 4JC5A 4DPKA 2AOUB 2XECA 2ZB2A 3LRPA 5H83A 5CBPB 4PHFA 3L01A 1U2ZA 3GN2A 4NZPA 1LQUA 2XQJA 3ZU3A 5LQRA 2HA2A 2JAUA 2OYSA 3VZCA 2VCHA 3QLEA 4P38A 2IDMA 4PRZA 1L0BA 3LLSA 1PGNA 4UQOA 3X1WA 2RGWA 4LXHA 1IN5A 1B1AA 3OPNA 4WLOA 2I4MA 4JYCA 4V0QA 3K0CA 3K1JA 3OA0A 5K7SA 1EX7A 2X5NA 1Z73A 3UXYA 4FMPA 4NG4A 1XDGA 2XTZA 1X3SA 1QFJA 1XRRA 2WJ4A 1W0JA 3LRXA 3C7DB 2CMKA 2QT0A 1DIAA 1OAOC 1YR8A 1QYCA 1FX1A 2ZBFA 1RWQA 2VRCA 2ONZA 4ONEA 3PXAA 5CJPA 4L72A 4JDPA 4FU0A 3UH1A 6REQA 3FOZA 3KPVA 1TW2A 1O9HA 3KKNA 2WJYA 3H1EA 1RIFA 2J3MA 2O57A 4K3UA 4R8KA 2VO1A 3ZCQA 3HEAA 3F7OA 4DE5A 1VP9A 1VKNA 4D6YA 2P9ZA 3OIDA 4FDUA 4DCJA 1IBKB 4FZ3A 1QDLB 1GA1A 3FYUB 4WNAA 1XXLA 4DJDC 3GB9A 3OECA 4C21A 1T3SA 2NPFA 1KGDA 5SY4A 4FNOA 4O4IB 1MAUA 1EHIA 3L0DA 2NU8A 1YZNA 5JO0A 6GPBA 3EGXA 4V0NA 1U8FO 1YRLA 4Q93A 4D81A 5JJBA 3AB3A 3ZK7A 3TIVA 4HFRA 2NNLD 4QPCA 3DL4A 4RZHA 2Z08A 4IHJB 1YS4A 2OM6A 1P9OA 2FMFA 3CEPB 3L1KA 2ISCA 3LQ4A 5DGDA 1AKEA 1DCFA 3HCEA 1ADCA 1HOXA 3KQPA 4I5GA 3ORYA 4M7OA 4C0AC 4UTRA 2JGNA 1DE0A 2YW9A 3PICA 2R25B 3N0TA 1QP7A 1WXHA 3FTFA 1P9RA 4Y6SA 2YCBA 3LNCA 2C2XA 4G0VA 3K35A 4ZVKA 1RD4A 1MB9A 1C0KA 2HHJA 4F4IA 5ILQA 5C7LO 3OU6A 3ZHSA 1GNVA 1Q14A 4TN5A 1EX1A 1NULA 1MZPA 2FJUA 2YR0A 5B30A 3A9RA 3GOQA 5FPTA 1UDAA 4WK4B 1IY1A 4MJXA 2C78A 4RELA 5I7UA 4JS0A 4C0WA 1EXNA 2O0LA 3VSCA 1JG1A 2AG0A 5KOJB 1V96A 3IBSA 3IQXA 4A16A 3DLAA 4R68A 5D7BA 3RK0A 3BKXA 4BV8A 2AZXA 1MO6A 2Q1XA 4QATA 1VYVA 4ARCA 1H9AA 3ESBA 4K9OA 4MV5A 5K8JB 4N5NA 3D4IA 4JNKA 1F2TA 4C4XA 4YMHA 1Y8QA 3WV4A 1LDBA 1QHGA 2PVPA 3ZQUA 3P20A 3R41A 1RI5A 3D3EA 1XVTA 2HZ7A 1VL1A 1ZM7A 4GG1A 1MGOA 4CV1A 3QWIA 4TZ6A 5P21A 5LIPA 1DXYA 2JA2A 1QZXA 2C3PA 1XOIA 4HQFA 2W6NA 1LLDA 1TAHA 2VI5A 1RM4A 2XQGA 4YHHB 3INTA 2ACVA 4F84A 2B98A 2AV6A 3ER6A 4BNUA 3F67A 4EMBA 1JXMA 1Y9AA 1NTRA 1NXTA 2IU0A 3VPDA 2XE7A 3GLUA 5DT9A 4NDNE 4MWGA 3PWSA 3AJEA 5I7EA 4ABTA 3NH6A 2GA8A 1FOEB 4PHGA 3MJHA 4UUNA 2YN4A 3I9JA 3T1HB 2F8TA 2QMQA 2W8BA 2E37A 1YF3A 1T1IA 2ZYUX 3OQJA 5DHFA 4RHEA 1KMNA 4UAGA 5DMHA 3UJHA 4AUKA 3B9RA 4JR0A 5E4JA 3I1IA 5TQJA 1WB6A 1OROA 4YB8A 2HRQA 3AHCA 1IK6A 3CF4G 5FPSA 3VO2A 1V95A 1L6IA 2AOVA 1XVLA 4XXHA 3IUSA 5GINE 1UAYA 3B5EA 1XVUA 2IXGA 4NSNA 2ERCA 1VXOA 5DNEA 3F8WA 5EHZA 2I2AA 5A02A 1VLMA 1TEVA 2YXPX 5DCWA 4AMBA 1XAGA 3GEPA 3O4RA 4X1KB 5JYCA 4UUQA 3IDQA 4YJ2A 1QE0A 4GKBA 1XROA 4K1XA 4Q7JB 1JWLA 3EXHC 3KJEA 3GRKA 3NASA 2VK1A 5BQPA 1UP4A 3EPRA 1TMOA 1NNLA 3SVTA 2IYUA 2WVAA 1G6KA 3THOA 1MHPA 3EOAI 3MWKA 2MSWA 4RMIA 1R4MB 2H8GA 2I0FA 4UJ5A 1SG9A 1RAFA 3AILA 3D3QA 3QP9A 1TKCA 5FI5A 3E5HA 3RI3A 5YASA 2ICAA 1JEJA 3P0FA 5EKUA 1UFRA 5EVJA 3RT1A 4DLPA 1VG1A 4RESA 5EZYB 5CCEA 4B82A 2ZYDA 4PYKA 2NTEA 1GSIA 3PXBA 3M6FA 1NC3A 1PWXA 2NIPA 3D7NA 3MMPA 1SVKA 3PT9A 4Q18A 2OAEA 4RVGA 4AKSA 3R5KA 1T8RA 2XYQA 2IBSA 3R0XA 1P0MA 3RABA 4MIOA 3WGLA 4KHPB 4Z9AA 4BRZA 4KAAA 3PLRA 3KP1A 4CEHA 1MC8A 1SUFA 1AK1A 3G1WA 1PJ2A 2JGEA 2BMVA 3NBUA 3MBIA 3C3WA 2FSVA 3PEUA 4IMIB 2ZWOA 3SLGA 2WAOA 3U44A 2ZYGA 1D4OA 3T1YB 3X2FA 4H0FA 1PWEA 1HGXA 2SECE 2MR5A 4GSYA 1O5OA 5FFFA 5IDQA 3IOBA 3IIIA 3NS7A 4BHTA 1JI0A 4LNUA 3LA8A 2F1HA 4ZHQA 4LRTB 4AD8A 3MERA 2DX7A 2N75A 4NE2A 2W83A 1FVHA 5K3FB 3L0ZA 4QX6A 5GJVC 5DZSA 5KYVA 4PTYA 3FUCA 1KEWA 1JLRA 3WJAA 2IYQA 5A71A 3F49S 2O8BB 4B4OA 2CLIB 1N8KA 3Q8KA 2QTMA 1XMSA 3E0QA 4NCIA 4CFSA 4NE7A 1GFSA 4WK6A 5T67A 3NUZA 4IOJA 1NZDA 5TT0A 5CJJA 4WKGA 1M83A 1XJ5A 5HUJA 1CQJA 4AMGA 3GP8A 3TM5A 1UEIA 3DE3X 3MW8A 2C29D 4FMDF 3HB4X 5F12A 3CJQA 5KMGA 1UWKA 4FYHA 1ZEJA 4M86A 5BQXA 1XNRB 4OJNA 1Q1QA 3PX2A 1ORTA 3EF3A 4OOFA 4WFQA 5CCBA 4C0JA 2CUNA 3C45A 5JZVA 5LP6C 1O08A 4A0SA 4TS9A 5I9SA 1NXVA 1JALA 2H06A 1JDNA 3U3RA 4C07A 1C8BA 1SZDA 2RG1A 1QQ7A 2O0HA 1NI5A 4B5LA 1ZI9A 3RWBA 4PFQA 4HO1X 3MS2A 1V8FA 4XA8A 1KIAA 4UDYX 2ZWIA 3HHPA 5E3IA 3WZ2A 4LG1A 4XWGA 2II6A 4NXNB 3SBEA 4RXUA 4JJEA 1SCNE 1H4VB 3AU8A 5EUCA 2QSUA 4EB6B 5LP6B 3QKTA 3SIWA 3VKWA 3IKJA 4D5GA 5KUTA 4E7PA 3CVOA 4R1QA 3I32A 3KE8A 3O93A 1YACA 2FRVA 2X3UA 3D54D 1B2LA 3MJVA 1P6UA 3B7WA 3OD1A 3LSTA 3ONNA 5AICA 4RC9A 2AG1A 2IZ1A 2XDYA 1IBLB 2IEBA 2CD9A 2HGSA 521PA 3UJ9A 4R98A 4KGZA 4UEQA 4RY0A 1A7AA 5AKKA 1EBBA 2BI4A 3EOZA 5T6BA 2NZ2A 2W6ID 3K73O 4XCXA 5LZ5A 5KI6A 4EPRA 3V3KA 4B81A 3FVTA 2Q5FA 2ZIUB 3KWMA 2IW1A 3LVRE 3R3UA 2FMIA 4GWKA 4JEHA 4WLNA 4WLVA 1OFTA 5EE1A 3ZVLA 3KS9A 3IQDB 1T5OA 3BAZA 2QTNA 3L9WA 2ES4A 3SDSA 2F1OA 3CLRD 1P4JA 1DCMA 3WYCA 2ACWA 2C9BA 2ZYWX 2TS1A 3JYLA 5KEIA 1Q21A 2BFFB 1I1NA 3EQ8A 4IAOA 4K0KB 2ZE8A 5B53A 5JVDA 3CF0A 2JK1A 5D6OA 2Z8ZA 3KZOA 1SBQA 1PV2A 2XTMA 1MJGA 2AFIA 3OOSA 4W6QA 1YHNA 5FL3A 3CZCA 1DBRA 2CNOA 3BZUA 3HJBA 4ROSA 4R71A 5F76A 2P6RA 3LBHA 3D43A 2FPUA 2HV8A 1C0LA 5ERXA 1VMDA 5C5DA 1BWRA 4W8OA 5A0TA 1ZGGA 3EGIA 2LP4Y 4BVAA 3IUNA 3HZOA 2EC5A 3ZV5A 4PBTA 1QH8A 1C9EA 2PQ2A 3Q2IA 3OCXA 2GDJA 1PBTA 1PX2A 3JV7A 3KWFA 3KZXA 5G0WA 2RKWA 2WD9A 3WIOA 2X2EA 1NPTO 1GOTA 1WXQA 2HK8A 4H4DA 3GJRA 2PZEA 4DABA 1JAZA 1T5DX 1AHIA 1C7ZA 4I14A 1PJAA 4UE3S 1BEZA 2MSNA 4FGZA 3ZGVA 3NVAA 4GP6A 5CUQA 3BXGA 5AYVA 4FMBB 4Z7OB 1V5EA 2AW5A 5JS7A 5LFAA 2POCA 4KO3S 3UYKA 2OYRA 3Q2KA 1IZ7A 4CTJA 3K5PA 4RK7A 1P0IA 2AOUA 1CUUA 4FEAA 4K88A 3T7EA 1VYTA 5CBPA 4R1SA 2WU3A 1UDXA 3QNMA 1F2UB 3BM5A 1Q1EA 1UJMA 2BH9A 2RBEA 4EY8A 1PYDA 2WIFA 1JQJC 1OYWA 2DP4E 4JA0A 4KFSA 4JVMA 3UTDA 4GX2A 3EFOB 1WDTA 5HSGA 3WIUA 3TG8A 1WD5A 1CLUA 2JLBA 4XVCA 5BWOA 1FTWA 4NBVA 2C7VA 3LQYA 3I8XA 5FULA 5IT0A 1XCGB 4H7JA 5I4CA 3C6QA 1USUA 2IPMA 2UZ0A 4LZNA 4CF6A 4DBVO 4YJ2B 1Z5GA 3PHGA 2QR5A 2BKVA 2ZG6A 5K4HA 2ZK7A 3CUVA 1J09A 1ZNYA 5I7OA 3O1JC 2JLWA 1EVEA 1IM8A 1H6CA 1P3Y1 4B43A 3Q8WA 1IRIA 1ZN9A 1Y3HA 3I6BA 4Y98A 3IL2A 2OXTA 5IWAB 1R7RA 1ZNZA 5FL7D 1JEAA 2HF7A 3S81A 1IUNA 3GMDA 5KJFA 3P2KA 3TI9A 3WL8A 1HE2A 3FAZA 4C3OB 4CLRB 5FB3A 3DQZA 4BZXA 1SXJE 4IWYA 2R6CA 4LV5B 4PLHA 4CTNA 1Y4DE 5E0KB 3Q8MA 1D09A 2P35A 1PTJC 2P5TB 5CX1A 2VUIB 2PVSA 3S1LA 1OASA 1RJFA 1T3HA 3EW7A 3M2TA 1J8YF 3JQ7B 5JNVA 4NCBA 5GZ1A 3IVRA 3QE2A 5EQDA 4QXRA 2CLKB 2JLRA 1ZVJA 3A1NA 2PX5A 2FUCA 3DMDA 3QU4A 2XHZA 2QDXA 1QIJA 5J2UA 3BB3A 2G08A 1L7RA 1B8OA 1HY3A 3DULA 3NHLA 4OL9A 4PAWA 5HFNA 2Q4DA 5C80A 4AICA 4BFUA 1QOZA 2EFYA 3Q98A 4O4HB 5B7QA 3HTXA 1VLZA 3AYXB 1EFPB 3QPWA 2WP0A 2O2GA 1TUBA 1X0XA 3TCKA 3DVQX 5KBYA 4Q1BA 3ADDA 2VDRB 3SX0A 2NVUB 1YTUA 4FPXA 4ND4A 1EP3B 1YA8A 2O2XA 4PQYA 1EXWA 1D2HA 1FMJA 2LCIA 2XV1A 4UBMA 1FLDA 5FTJA 4PWZA 1RZRD 1RYMA 5ALMA 1IB0A 1VJRA 1Y1KE 1LW6E 4YWJA 1J0DA 1VSUA 3STWA 1QCCA 5AI8A 3JARA 4IJKA 4TTVA 1QC5B 5COBA 2OCYC 4D8TA 2QX9A 1U0OC 1FXWF 3GLFE 5IKOA 5CX1B 2ZBPA 1XG5A 4TYQA 1JHOA 2BISA 5A9TA 3ND9A 1YVEI 1PEDA 4TKLA 1YE5A 3C8DA 5JAQA 2W0SA 5IM4A 5J1SB 3KAKA 4RFSA 1I1HA 3U4QB 4FXOA 5C7YA 1J00A 4ZEWA 3D6AA 3T12A 1CF4A 1E3TA 1K4MA 2ZYSA 3ASVA 2C88A 3IFSA 1RACA 2VDUE 3QJYA 4Q7KA 3DTVB 2KBEA 3ND7A 4WJKB 1FP2A 2C4WA 1ML4A 2D8MA 2ZUCA 2ZWPA 3MJ4A 4L3VA 3U7IA 4RQTA 3IE1A 4Q1AA 4HNHA 1TX4B 2ZSEA 4QGBA 4HDAA 4IGFA 1D2CA 2B8WA 2O6LA 3QELA 4XVHA 2BCGY 5JBNA 1V71A 4KIGA 2BSQA 2A1TS 2C5BA 3GUCA 4KZKA 4HDSA 4PX3A 5FUWA 1OLXB 4UVIA 5G41A 4QRDA 4RNCA 2A0YA 3I45A 1GGEA 4K46A 5HE8A 1FTQA 3GFSA 3U62A 4HGOA 5C8ZA 1C1DA 3HHEA 3PXEA 1UEXC 1XU4A 2BEUA 1C3EA 2J5RA 4YV2A 3DGFC 3FPGA 2QTHA 1G8YA 2ASVA 2GK6A 4RTQA 2O19A 1DC4A 3TE6A 3NWBA 4X20B 1N8TA 2B8EA 4XUDA 2VL7A 1A5AB 2I4NA 3LF1A 4OYYA 3IQHX 5E1MA 3TQQA 2XWJI 5DIFA 3T7TA 4OH7A 2WWWA 1W4CA 2E4XA 3FFWA 3UUGA 5IMBA 1NXPA 2ISSD 3II6X 2R6FA 3PBKA 4AUNA 4HVLA 1RKQA 1WOYA 3O90A 4RXTA 3HXTA 4I4TA 1O96B 1XHLA 2IRWA 1HYQA 2XMQA 3DEFA 3R40A 2PXHA 4BLOA 1H5NA 2QZJA 2ID8A 1SHJA 1QTRA 3UA4A 2P1ZA 1F20A 4M1OA 1AQJA 2XHEA 4PIPA 4KUEA 1GPLA 1A3CA 4REMA 1JA9A 3QY0A 3O8OA 2LUOA 1BKYA 1LQTA 5JDCA 3ZYZA 5KOIA 3ZDAA 1H2HA 2FZ4A 2HCRA 1Y42X 1DKNA 2AZDA 4IDOA 4EM6A 1HNWB 1FQJA 3FNRA 1WZCA 1DCKA 2Z3WA 1P1KA 1G3MA 2P2CA 2EW1A 1P0FA 1UDWA 1UK9A 1W5FA 3R0IA 4FQ8A 4I99A 3MCTA 3WTBA 5JYEA 4Q48A 1YCGA 3PKJA 1Y5RA 3FYSA 2EJBA 2I55A 3UJ8A 1RXWA 2BVNA 3ZD7A 4C7OB 1QHNA 2XGMA 4QLOA 3VKFA 1LK7A 4QYIB 2JARA 1W9HA 2GZ2A 3O84A 2Y71A 2K2WA 2RMKA 4RVUA 3TLBA 1E96A 3VDXA 2ZRQA 1RWXA 3A05A 4ZDWA 2AJCA 4CFZA 5M34A 1ATZA 2UZ3A 1DNPA 4CQLA 1BOOA 2X8JA 4KR2A 1SUAA 3JVVA 4Y2PA 1QV7A 3VPHA 2CDAA 2HXYA 3HU2A 3SHWA 2PZKA 4TMTA 4D0GA 2PZLA 4NCHA 1AQIA 2CUTA 4K3VA 5D3KA 3U5ZB 1E5XA 5H3CA 3ABQB 4PC7A 4X7BA 3EXAA 2B6HA 3QUTA 3O2QB 3PDHA 3CXRA 4F1JA 1B14A 4CF7A 4PPYA 3SDZA 2QVBA 2W0MA 4B48A 4K40A 5EJMA 1AXEA 3W2EA 4H6XA 3T6KA 2ZRNA 5KDLA 3OHPA 4IV8A 1FDRA 3X1MA 1E7WA 2LIPA 5T3YA 4M9QA 5BUQA 1XEWX 4YHBA 3RVDA 3AIOA 3TIFA 1TM3E 1BS9A 1YR7A 2P8SA 3WOVA 4WBNA 3H5OA 5IYZA 4NS4A 1QJCA 3JZDA 1SOVA 3P4XA 5F51A 3PDWA 1E59A 3HH8A 4YUXA 3EPLA 5KKAA 1SC4A 1TTPB 2D0OB 3U7RA 3ANXA 4BNHA 1IEXA 1Q7GA 3DBLA 4CDGA 2MSKA 4HADA 1XTSA 5DCYA 4LYGA 2OBYA 1VSQA 4KN5A 1Q7TA 3SKYA 4HRVA 5CVEA 1VPDA 2YDXA 1JZSA 1XYVA 2ZLBA 5HDBB 3UMBA 4AIIA 1N5RA 1UODA 2ADOA 3FY4A 1QH1A 3RJZA 5F4BA 3LVFO 4LXUA 4ZCTA 1E0DA 2CD7A 1Z0DA 1X1EA 1MT3A 1L7NA 1QOQB 2Q99A 2Z1DA 4CM3A 1R0KA 1TM4E 4D3DA 2R47A 3KQMA 1OB2A 2E5LB 3G0HA 4AY2A 1Z0AA 4M76B 4BO8A 1S96A 1BU5A 2FVYA 2J9XB 3QTBA 1NBAA 1Y1LA 4PAOA 1Z0KA 2GD6A 1J9GA 1V7QA 2FP4B 4JOQA 1RM5A 3O5AA 4CM4A 2BHSA 1XHFA 4X6LA 1VE9A 3ITEA 1WHTA 1W0KD 2JCYA 3WQSB 1N0WA 1VPVA 4DZRA 2DLDA 1SO8A 2NU6B 1TIPA 3U0BA 5K8TA 3RPEA 3DOIA 2DFPA 3FE2A 3KXIA 4KQEA 3RC2A 2XXBA 2B82A 3PC8C 4G0UA 3QPCA 4RIEA 2SBTA 4LRWA 3ILXA 1NKSA 5EIOA 2R8YA 1R66A 1IU9A 1EDZA 3V55A 5L3SB 1T8WA 5J23A 1DQYA 1RAIA 3QEJA 4D9CA 2YY6A 3TEJA 1BYUA 4NEHB 4PR3A 3HI6A 3L7DA 4DB2A 1F17A 4IS2A 3RIEA 4EATA 3TLZA 1IULA 2PNJA 1PEYA 1CRLA 1MEOA 4CGYA 1T4DA 4PSKA 3D3WB 1XMVA 3DZKA 2P1RA 1KZ7B 3Q7EA 4O6VA 5DWVA 5CBKA 1FFWA 1WB9A 1X77A 3NXSA 1JMYA 4DLXA 1U0RA 3T5MA 4EITA 1NBOA 4M49A 4GI7A 3IIEA 4DLZA 1PQPA 1AQLA 1BMFD 1R5BA 2DFTA 2HSWA 2PAAA 2X1HA 3CLKA 3EZGA 3KKZA 4ZQCB 3OFVA 5UKDA 3TFQA 2WABA 4RVDA 4BGEA 5HTKA 2VP5A 1FXUA 4GWGA 4ZOCA 5BN5A 3TDMA 4BQEA 1EWKA 2HTFA 5KU1A 4IJMA 4ROTA 4C5BA 1AKYA 3FGZA 4HQOA 2BFEA 2JH9A 2B1JA 1E4VA 1T9ZA 2UYGA 1Q0TA 1EFKA 4DGSA 3IIMA 1BVHA 3VUFA 3WWZA 3F97A 3S0JA 3KQVA 4YUZA 4MVJE 2NTNA 3T9DA 1GFIA 4B6JA 3QQ5A 3G9XA 1N9GB 2XWSA 2M6SA 2XTJA 2P9CA 4H6WA 1GZHB 2FPSA 2FF7A 5DO9A 5D2CA 4P0QB 2NSYA 2O14A 2AG8A 1VP3A 2I6TA 4TMVA 2HCTA 4BMVA 1X7DA 1K98A 3C5EA 4PO1A 4H7PA 2DTDA 5CYPA 2ZKIA 3CT6A 1V7PC 1G17A 2RI0A 1TAQA 5THQA 5JD4A 2H9YA 1QHYA 3T0FA 5JASA 1YS1X 3C3EA 1QFZA 1IYZA 1T35A 5HBGA 1ZVMA 1HYBA 1U0JA 2BF4A 1GUFA 2C3UA 3H2HA 4I9NA 4TKUB 5TJHA 3R7WA 5L7TA 4NMWA 1ZCAA 3FDXA 1S4MA 4BNLA 4TQ9A 1EWQA 4DR4B 1I3MA 1G6OA 5H16A 2WVJA 1JN0A 1KAOA 1L5MA 2ACEA 3ML1A 4HTAA 2KS6A 4LY0A 1XDWA 4LYDA 3RHZA 1VCHA 4QQRA 3TZKA 4C08A 1U9YA 1U8XX 1IXRC 2Y1CA 2JFZA 2Z30A 1U5BA 2A9PA 3MPOA 3PFFA 2C59A 1EVIA 1QGED 1G98A 3CA8A 3ITNA 2ZRHA 1M10A 5BW4A 3W6UA 2D1TA 3LT1A 4IDNA 2CNNA 2PMFA 5KYGA 4NULA 1W49A 5FQNA 3N7AA 3H4IA 3E0XA 3AEYA 2WMOB 4TL9A 4OHZA 1DEKA 4G2NA 1NMZA 3D0RA 4DLNA 3H3XA 2FOXA 1UQTA 4FJ1A 4RA9B 4XOIA 3JALB 3NUQA 1QIFA 3JZAA 3FFTA 4QDKA 5T4BA 3ELDA 3T06B 5ICMA 3ESZA 4YPOA 1GD1O 1FRQA 3VR6H 2WMNB 2ZRJA 4DEYA 5HR5A 4FKZA 4Y6RA 2RC6A 2XVXA 3AUTA 3K6JA 3WB0A 4U4AA 1GP2A 2A1IA 3VPCA 4E1BA 2AEMA 4NG5A 4BJ5A 1Z0SA 1RYFA 5L3QB 3LD9A 3QPDA 1L7QA 4EKNB 4BLVA 1V4VA 4Q03A 2OUKA 3U19A 3ZDRA 2WWRA 1HWYA 1R1DA 2YUIA 3P5SA 1A8PA 1XP8A 4UHHA 1X9IA 1NYTA 1DAKA 1X80B 4CQMD 2ISQA 2GPAA 2ZJFA 2I91A 2WI8A 4LNAA 1KJWA 2G7MC 1U2QA 4LDAA 3JU3A 2OBNA 4LJKA 3D1VA 1UBKS 4N65A 2Q5JA 4RD1A 4LGCA 3REQA 1E6WA 3SC2A 2FDRA 3BVPA 4S1WA 5CFQA 3RWOA 3NTQA 5KTNA 1U04A 1MRNA 4M0PA 4FD2A 2W6OA 4MVJH 4MICA 1W35A 4GXTA 4LSGA 1BE8A 3QOFA 1PQ4A 5WRFA 4HNUA 4MKIA 2FW6A 2HU5A 2I1QA 3I2GA 5KVQA 3SBXA 4B3SB 4OQEA 3QBTA 3DR5A 1NBMD 2VAPA 5B1SA 4ADSG 2ODPA 4C0HA 5JAIA 1NSFA 2O5CA 4EARA 5AM3A 3DE2X 1K89A 3AWDA 4O4JB 4ZPXA 1M0EA 2QGZA 1Q7BA 4S12A 5JQGA 1BDIA 2RHMA 4JMPA 1OLOA 2NYRA 1R8XA 2GN1A 1RYDA 3KQHA 4U9HS 3BULA 3KZVA 3UWSA 3AFOA 3VMMA 1XAJA 1NW8A 4BEWA 1RVV1 3DEYX 1JA1A 2I2CA 4IDGA 5DX0A 1CJCA 4PG4A 1UBSB 4WZAB 3FUWA 4KE9A 2HMAA 2HREA 3JQEA 1CUWA 1UJ2A 3V48A 4YNBA 1KY4A 2IZ0A 1L1EA 3RHSA 3S2FA 5KQSA 2WFZA 5LXTA 3VR4A 1CB0A 1GU0A 1JMKC 2H1SA 3ONEA 3BWVA 2C3MA 3MD0A 4MIYA 2GVZC 5AJVB 1BG6A 5L9AA 4XJXA 3HPQA 1OIVA 1E99A 3F90A 3PNPA 1DQPA 4YCCA 3BFVA 3NIGB 4F45A 3RNLA 1TJ5A 1G4UR 1WKCA 1X0VA 2ODQA 3LKZA 4LXQA 4N8EA 4RSRA 3INNA 4YAKA 1U3TA 2PWZA 2ZE7A 1E8NA 3FCUB 5JT1A 2HSEA 3K0CC 1GQ2A 1XD2B 3PYLA 3AHFA 1VE3A 3OCWA 1VI2A 1E2HA 1ZOOA 4BNDB 1YZ3A 2I9KA 2EQ5A 3IP8A 4HZUA 2EQBA 1G9SA 1DZIA 1R18A 2W93A 4MR8A 4MKRA 3M34A 1YDEA 4MW4A 3TW4A 4RM2A 2RAVA 2YYYA 2XDAA 5T4FA 4D92A 2R0QC 2Y1KA 4NESA 5EEGA 3TZEA 4F2GA 4Z4IA 4QUKA 5I7VA 2PR7A 2VDKB 3JPWA 2O8DB 5I4BA 2BP7A 1M2OA 1N6OA 4OFBA 3WBKA 1JLMA 2H63A 3RYHB 2EV9A 3KVOA 3GPCA 4ZIRA 3Q7SA 3ZY6A 4XX0A 2BR3A 4M9RA 2WE8A 4ESEA 1H6DA 2VHWA 5EY5B 3VPGA 1GKIA 1Y8QB 4LHXA 1DWOA 2EFHB 3FDZA 4UVHA 1XI2A 1NUHA 2ZJ0A 3CF6R 1GZDA 4IFTA 4C88A 1UP6A 4R05A 1FJ2A 3HV2A 2REBA 4KU4A 1HQYE 3SF8A 1LPNA 3PC4A 2GM4A 4FYVA 3NTRA 4AYWA 4Q1VA 1TRKA 4FLMA 1C3OA 2IK8A 1WHSB 3HC7A 2PEYA 4G0MA 4B2PA 3PUZA 1JI3A 4I9GA 5FTKA 3JASB 3VYSB 2CXXA 3U13A 4QKQA 2P2GA 4MUIA 4DRYA 5BV8A 3LK6A 2NTJA 2YNMA 1YXMA 2VF7A 1G66A 1DTEA 2AD5A 4AKEA 1RWNA 4E5KA 3OIVA 2FMXA 1T4MA 2QGNA 1RYEA 3IRVA 1O9BA 4F9GA 2C7RA 4MTCA 4MI3A 1A0OA 1Z2DA 2O8DA 5EJ9A 1GPYA 2C3OA 1XZEA 1X70A 2XCOA 1E3WB 4IIXA 5SICE 2WTEA 5A9SB 1IY9A 4ILEA 5J2UF 4DBLC 1MW8X 1EIZA 3QKSB 2G1PA 1WP9A 4HQNA 4M37A 2XCIA 3EEOA 1QFMA 5LBUA 1NJSA 2I4OA 3THRA 5KC8A 1WR8A 1WUHS 3CKMA 2GF2A 3PXCX 4KTTE 3S2YA 2WB2A 4AY6A 4DQVA 5AXBA 5B4VA 3WWPA 5JZBA 3CRRA 1VMIA 1NPYA 2JI4A 2O7VA 3PL5A 4M83A 4BJ1A 5ALLA 5EAIA 3OSUA 3AY0A 3VR6A 1VKJA 3EY4A 4J07A 1PJLA 3FBGA 2I22A 3KM0A 3PT5A 2OA0A 1TJYA 5FWXB 1QYVA 2OD7A 1KMIY 1LV8A 2ZUDA 4D6XA 4JUCA 2GARA 1E4YA 3WHLA 5A03A 5DNUA 1ECPA 3H9QA 3GUHA 4JBIA 2H4WA 1UZLA 2JBAA 4UZSA 2JGFA 3TUZC 1I1QB 2N1BA 1C80A 3EFHA 4TQGA 3HO8A 3VR2D 2PG3A 1XAHA 3WK6A 3L6OO 3P0RA 4OH1A 1IQ0A 1Y34E 3RARA 4K7JA 2Y6UA 1KZ4A 2HF8A 4AY3A 5ALOA 3FCOA 4QRIA 5DV9A 3U4MA 1NBME 2ZAIA 4YAJA 5LC1A 1Z63A 4MA5A 2PX8A 1FIUA 5JCZA 1V43A 5LJLA 1PG5A 3PD1A 3GRAA 2QZ9A 4ALIA 3GK3A 3KPJA 3NWPA 4KL8S 5JISA 5JHGB 2CFIA 1MEEA 3WQRA 2WHXA 2PXXA 3K0KA 4IUBS 5TEVA 1V4BA 3BH0A 4XRRA 3U61B 2OUIA 1DAHA 1G5FA 1G6Q1 2C0CA 1CP2A 4B83A 1X1BA 4DDWA 4OTZA 5CCDA 1DEHA 2R1VB 2XUKA 3DL7A 5FCDA 3SGLA 4ZJPA 4E5YA 2WWYA 1OH8A 1KK3A 4PZ0A 3ADKA 4HLUC 5PGMA 1IZ0A 2XEXA 4PTLA 1KPGA 5ALJA 1WHSA 2NU9A 4HNAA 3CNQS 1AMNA 3NKFA 4Z0NA 1PF7E 2IHJA 3B9PA 5C0OE 3FUVA 4EA6A 1ZK2A 1SK8A 2B2NA 3EEQA 3DMHA 3HN2A 3JY6A 5GONB 1MKYA 2HY7A 2CHVA 1VBFA 4FFOA 1QTQA 1Q3HA 1OZGA 3OG9A 1ISRA 3HR4A 2DFVA 2IFTA 4BAGA 5LXTF 3TMAA 4MTLA 4BNYA 4DV0B 3W5BA 2AQ8A 3KCQA 3MQ4A 4N6NA 3AVXA 3KDPA 3G2NA 1O0BA 4HB0A 4LAFA 5BR8B 2C31A 3QHPA 3N3AC 1U5AA 1YS7A 2Y1OA 3HVJA 3RVNA 4DLKA 2EX0A 3A6ZA 1FEZA 1JLSA 1LEHA 2G67A 2P0YA 2A1UA 4OEHA 4B31A 2AMYA 4ED9A 3KQUA 3KOZA 1XDBA 2C9OA 1BE1A 4ERNA 3RRFA 4JBXA 1TECE 4FD3A 1NVXQ 3OURA 4D45A 1QVVA 2PGDA 4CI0B 2D5CA 2V7WA 3D7KA 4UAJ