1MO2A

Thioesterase domain from 6-deoxyerythronolide synthase (debs te), ph 8.5
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
255
structure length
251
Chain Sequence
GVSGRVRSYLDLLAGLSDFREHFDGSDGFSLDLVDMADGPGEVTVICCAGTAAISGPHEFTRLAGALRGIAPVRAVPQPGYEEGEPLPSSMAAVAAVQADAVIRTQGDKPFVVAGHSAGALMAYALATELLDRGHPPRGVVLIDVYPPGHQDAMNAWLEELTATLFVRMDDTRLTALGAYDRLTGQWRPRETGLPTLLVSAGEPMGPWPDDSWKPTWPFEHDTVAVPGDHFTMVQEHADAIARHIDAWLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into channel architecture and substrate specificity from crystal structures of two macrocycle-forming thioesterases of modular polyketide synthases
pubmed doi rcsb
source organism Saccharopolyspora erythraea
molecule tags Transferase
molecule keywords Erythronolide synthase, modules 5 and 6
total genus 76
structure length 251
sequence length 255
chains with identical sequence B
ec nomenclature ec 2.3.1.94: 6-deoxyerythronolide-B synthase.
pdb deposition date 2002-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mo2A00
2DSNA 4QDUA 1WHSA 3ED1A 3GROA 1EINA 1Y37A 1WB5A 3W9BA 4B6GA 3BDIA 4BZZA 2XLCA 4BATA 3Q8WA 2CBGA 4Y9SA 4B9AA 1XQVA 5IVIA 3L1IA 4X92A 2XE4A 4ARAA 2C58A 4Y2XA 5ALJA 4EA6A 1AC5A 5J3JA 5FUMA 3Q0TA 3V1LA 2V9ZA 3IDAA 5C7YA 4QWMA 3F8SA 3WKCA 5HKAA 1LBTA 1F0PA 4BDTA 3WJ2A 4J0HA 1MAHA 2XB6A 5AI8A 2BUAA 3WZMA 2ACKA 2XQJA 1DT5A 2Y2UA 4M0MA 4BCCA 4WFJA 2I3DA 1QZ3A 4X00A 3O4HA 3QYJA 3I2FA 3WKDA 4B84A 5JAPA 1CUXA 3WL8A 3ICWA 1H2XA 4AZ3A 3HC7A 3STVA 4QE3A 4UBLA 4B0OA 1A8UA 3HYSA 5EIAA 4N5HX 3C6ZA 2H7CA 1B41A 1K6EA 4UHFA 1MPXA 1KU0A 2OPHA 3E3AA 3H2JA 1CUEA 3LIIA 2VTVA 5CT5A 5E4JA 1QTIA 3R3WA 1EDDA 5ESRA 1N1MA 1UXOA 3VDXA 1XFDA 4H18A 5AI0A 1QO9A 3MUNA 2ECFA 3V1MA 5FXMA 5EHXA 1XQXA 4DLNA 1E8DA 2XUKA 4YX9A 3CN9A 5A2GA 1EB8A 3QPDA 1SOMA 4N8EA 2JGJA 3HI4A 4LYEA 3ZLUA 2VATA 3C45A 4DNQA 4G4GA 4BCBA 1VXRA 1JJFA 5C8XA 5LKAA 2FX5A 3D7RA 1FFEA 3WI7A 3R3YA 1EVEA 3ZPXA 2I3ZA 2CUTA 3H2KA 1GPKA 2GYWA 1VKHA 5D3ZA 4YPVA 5JADA 3IB3A 2BUBA 5JAUA 5AOBA 1JMKC 1QLWA 2PU7A 4B0PA 1CUHA 4HVTA 4BB0A 1WHTA 2AJLI 2QJWA 1CUIA 1EH5A 4I19A 1YB7A 1A7UA 5C81A 4U2FA 4NVRA 1ZI6A 4WY5A 3FAKA 4PF1A 2XUDA 2C4HA 3BIWA 1YA4A 3G9UA 5KREA 4EUSA 1XZLA 5T4FA 4MWSA 3L1HA 3FYUA 4LXGA 3WL7A 1S8OA 1L7RA 5ALVA 2CZQA 1XLUA 2ZSHA 1R3DA 4BAGA 2DFPA 1HQDA 4JNCA 1LPPA 4RE6A 2XDWA 4UHHA 2WUEA 2VAVA 3DNMA 5IVHA 1QGED 1W4LA 2XMDA 2Z3WA 1CUBA 3BF8A 3D3NA 3FLEA 4S0XA 4A23A 3VJLA 2QUAA 1ETHA 5ALIA 3F98A 3DOIA 3F67A 1WPXA 3TRDA 4N8DA 4BCDA 1WM1A 1JT2A 3ANTA 2I03A 1HL7A 5CXUA 5D6OA 1FFCA 3HRHA 3DD5A 3R0VA 1ODTC 2QR5A 3BF7A 5HQ3B 1UK6A 3WWPA 3GFFA 5AKJA 1CUAA 3SC2A 3O0DA 3G0IA 4P93A 1H22A 2PSHA 4H7FA 1EX9A 5ALOA 3F96A 2RHWA 2X5XA 2GBFA 4BC1A 4LKOA 1YAHA 4Y2JA 1CUYA 1XROA 2WHRA 3AIOA 1SCIA 4BZWA 4I4CA 1W76A 4KR0A 1KEZA 3P2MA 4X91A 2QKYA 1XRQA 4ZWNA 1QFSA 3C6XA 3G7NA 3WQHA 2XUAA 2XQGA 1TRHA 1ODSA 5ALFA 4BTVA 3DCNA 3STUA 2Z8ZA 4GHWA 1SCQA 2V98A 4KRYA 2QRUA 2WG2A 3FLBA 4B80A 4U2GA 2Y6VA 4BVJA 1UK9A 4DM7A 5ALGA 1R50A 2ZYHA 2X76A 4O08A 4QNNA 5JARA 1CPYA 1BROA 1NX9A 3H1AA 4OB6A 5E2IA 2WHQA 1W52X 1VA5A 2XLBA 2OCLA 2RIPA 5DYYA 3R40A 2PX6A 5AOCA 5AP9A 1W6RA 3WWDA 5CH3A 3M3DA 2VEOA 3D2AA 4TPKA 4CI9A 1BCSA 5EHZA 3O4GA 2JBWA 5DNVA 3D5EA 1H23A 3CXUA 5HFNA 3GBSA 1TIBA 4OB7A 2CB9A 3GA7A 4B81A 3AIMA 5CH8A 5CXXA 4D9JA 4H35A 4EZIA 3S2ZA 1F0NA 4F60A 4GW3A 2XMRA 1GT6A 4LXHA 3D4LA 2PUHA 1C4XA 3PFCA 2XT0A 2D0DA 4OSEA 3OTQA 5ALSA 5C8ZA 5SYNA 3WYDA 3QMMA 4BAUA 1IUNA 5HK8A 3GELA 2WIDA 3DS8A 3I6YA 1UZAA 5K3AA 5DNWA 1QIMA 4C01A 2H7YA 3WKAA 2PSEA 3IUMA 1UK8A 4X95A 3B3QA 3WIBA 3WYNA 1IZ7A 3E0XA 3M83A 1U8EA 4DMFA 4BE9A 1ZD3A 5FKJA 1MU0A 3STYA 3D59A 2WSLA 3VVLA 3MVEA 1AKNA 4KAJA 3YASA 3AINA 1C7JA 1CRLA 5LZ8A 5AHXA 2BGRA 1AGYA 4AN0A 3H0CA 1K5PA 5AI9A 3DJYA 1B6GA 2G4LA 4UHEA 2WHPA 1LLFA 4OCZA 4F5ZA 4G5XA 1EK1A 4DSAA 1LZKA 1XRNA 1XZJA 2I78A 4ITVA 1XKLA 2XUJA 2PSJA 3G8YA 1Q0RA 1ISPA 2J3DA 3IA2A 4AQDA 1GQSA 5ALHA 5FP0A 1QIJA 2IIVA 4UBNA 1BN6A 3O4JA 1F8UA 1XZKA 5JD5A 5LZ2A 5EGNA 1YS1X 4CFSA 4G9EA 3KXPA 4YASA 1J2EA 5ALXA 3ZLTA 5LYYA 2ACEA 1VXOA 3EQ7A 4UBKA 3I6MA 4U2CA 1HKHA 3O4IA 4UHBA 1XZCA 4CCYA 2PVSA 1CV2A 1XRRA 3HZOA 5T4HA 2HA2A 3H2GA 5ALPA 1E8NA 1PJAA 4FBLA 4NS4A 4U2BA 5FV4A 5JZBA 3R41A 4ZXFA 2HA4A 1CUVA 2WFLB 2O2IA 3FLAA 1DX6A 1R88A 3K2IA 2FJPA 2XQFA 3WIOA 4NZZA 3W9UA 1R9NA 4CIAA 5AM3A 1TCCA 4AO6A 1EDBA 4IO0A 4XJVA 2OAEA 1HDEA 4U2DA 4E14A 2DQYA 1MX5A 4J0KA 5CMLA 4PSUA 1CQWA 4HXGA 1IZ8A 4Y2QA 3ESCA 1HBJA 4RPCA 3G0CA 1BU8A 2XUPA 1QTRA 1ZD5A 5IKXA 1GPLA 5AKXA 3C5WP 1VE6A 4XVCA 2WU3A 2HA5A 3IURA 4GECA 4PV7A 1UK7A 4KACA 1JFRA 3WL6A 4EHBA 3WMRA 1T2NA 2XUFA 4CG1A 4AN1A 2WFLA 5AK3A 5AM5A 1E89A 4H7IA 5A7GA 1AURA 1VZ2A 5CURA 2LIPA 1YR2A 3E4DA 2IX9A 1MJ5A 3BJRA 1K4YA 4IQ4A 1YA8A 4C87A 3CCBA 4WJLA 3TGLA 3QMWA 1BN7A 1ORWA 1BRTA 3PFBA 3HSSA 4XWGA 1K8QA 3I28A 5ALWA 1DWOA 3U1TA 4AB1A 3A2NA 3H1BA 1UOPA 3R3XA 5A7HA 2PPLA 4M0EA 1XZBA 2WUGA 1LPNA 1WPRA 4KAFA 4KAAA 5HQ3A 5ALKA 2HU7A 3WA6A 5A7FA 3MUOA 2WJ6A 2O7VA 2JGFA 5F4ZA 2WU4A 1QIIA 5A6VA 2HADA 3FVTA 2XUQA 1XQYA 1W1IA 1Q0ZA 1CVLA 1CUDA 4MEBA 4WDQA 3IIIA 1EXWA 3W04A 3VVMA 3PDCA 4PQEA 4PSCA 4DNPA 4BVLA 4YK7A 2HA6A 2AJCA 2JEZA 5ALEA 5E4YA 3V48A 2XUGA 1YB6A 2ZYIA 3VISA 1ODCA 4HXEB 4B83A 3V1KA 1QOZA 2WHPB 2G5PA 3ESBA 3QVMA 4A5SA 2H1IA 3FBWA 2VT6A 4BRSA 2VJDA 2YXPX 5HZGA 1NU8A 2HFJA 3G02A 2ORYA 3F9CA 5K3FA 1QIKA 5LIPA 4W1PA 4ARBA 5KBYA 2R8BA 1MNAA 1G42A 1MT3A 2VJAA 3FWHA 5LZ9A 3JW8A 1GQRA 1BE0A 2QM0A 2HRRA 4NMWA 3LIPA 5AKGA 2PSDA 1XLVA 5D3KA 1WB4A 3EIOA 5JYCA 3B12A 4UUQA 2ONCA 2B9VA 2O7RA 1A88A 4FLMA 5HF8A 1TQHA 1N5RA 1OCEA 1TK3A 4FLEA 2B4KA 4MYSA 3ZI7A 2OCIA 4DSZA 1CUZA 2P8SA 1LPSA 4MXDA 4QDXA 4C89A 2VF2A 3X3HA 2ZYRA 1UT6A 2QZPA 2HIHA 4X97A 1J1IA 1XRMA 2X8BA 3DL4A 3QBJA 4Y2YA 5EIEA 3JWEA 4X94A 5ALLA 4Q82A 4BC0A 5I8PA 5EI5A 5ALTA 1JMYA 3ESAA 4CG2A 3VJKA 3RK4A 3WK7A 3JYHA 3I1IA 5K5EA 1GXSA 3ESDA 2OGTA 2ZJ7A 5C8VA 4H7KA 1JU3A 1QIEA 5EHQA 4Q3KA 4Z49A 1F6WA 5AM2A 4AMYA 1RWQA 2QXTA 3RARA 3S8YA 5AM1A 2BUCA 1Y7HA 1E5TA 4H7DA 1LGYA 5AI6A 2XUIA 5CH5A 5AKLA 2C7BA 3FNBA 3EQ9A 2HDWA 4IHAA 2WM2A 4FHZA 1QIHA 2Y2VA 4WCVA 1DINA 1L7AA 2OLEA 4KYVA 5JAHA 1UOQA 5HCUA 2AXEA 1BEEA 2HRQA 1ACJA 4X93A 2J4FA 5EHNA 2GYVA 2W22A 4OYLA 3HLKA 1XRLA 2XMZA 2JGLA 2WIFA 1UOOA 4X3CA 2J3QA 5T4EA 5JATA 2JGMA 3V1NA 2Y6UA 1JJBA 4BRZA 3KDAA 3OURA 4MWTA 1K63A 1JI3A 4JH0A 4FBMA 1AX9A 2XUOA 3BXPA 3LS2A 1X2EA 1GGVA 4GDMA 2XI4A 1EK2A 2Z5GA 2ZJ6A 2BKLA 3R3VA 4H0CA 3I2JA 1YASA 5LZ4A 1EDEA 1AQLA 4W1QA 3BIXA 1PFQA 5AO9A 1TKRA 3ILSA 3NOXA 4G1FA 3DLTA 4L0CA 4WDRA 3H18A 1P0PA 3E1GA 4DMKA 2HM7A 5K3BA 4Y2TA 2QS9A 1YS2X 4OUKX 3OG9A 4OB8A 2QMQA 3ZWQA 5EFZA 1E66A 1D07A 1YSCA 2Z3ZA 4G8CA 2C0QA 3DEAA 3I6ZA 4X6YA 4QLAA 4X71A 4RGYA 4J0JA 5I7UA 2C5GA 3H2HA 1QFMA 4B85A 5IVKA 5HF9A 1FSSA 2W6CX 1CUFA 2XMQA 2Q0XA 1XZAA 5CBKA 4A16A 1H2YA 1R4ZA 3AJAA 4Q34A 2WILA 4QDOA 2RONA 1XRPA 4CCYB 3R3UA 4W1RA 4BE4A 1VE7A 1TCBA 4ZV7A 1O6GA 2HHAA 3G9XA 1CIJA 3O95A 5HK9A 4MQMA 1U65A 3FYUB 2RAUA 3IBTA 5CTAA 5A71A 3AILA 3C70A 3H19A 4QZVA 2WTNA 1WB6A 2GBGA 4C4YA 4EY7A 4AMZA 2PU5A 2JEYA 2VA9A 2GYUA 2D5LA 3EQ8A 4Y2UA 1EHYA 3QPCA 4H7HA 1J06A 3W06A 1FFDA 4UBJA 2QJRA 3F97A 4PSDA 3V9AA 4FLFA 2YH2A 3C6BA 5BWCA 4GEGA 3WZLA 3QMVA 6YASA 1IVYA 1XZDA 2YASA 3DL7A 1DWQA 2DR0A 3C43A 4OD0A 1ZI8A 3KWJA 5KWJA 3FSGD 4FNMA 1VOTA 4LYDA 1IMJA 5CRIA 2XMSA 3WWCA 2QT9A 1MX1A 4DGQA 4X6XA 5AIAA 3UUFA 2XQIA 5AKHA 2HL6A 1JU4A 4W1SA 2OG1A 4G8BA 4J0IA 3BWXA 1UFOA 2C0PA 5JALA 4AX4A 2EDCA 5FPQA 4AXBA 1ZIXA 4Y2RA 4FTWA 4JYMA 2B20A 3VXKA 1LNSA 4J0CA 2HA0A 4GWLA 4LHEA 2RHTA 2BCEA 3N0TA 4FFVA 3GUUA 3BE8A 1CR6A 4UFPA 2EEPA 1XLWA 1WCYA 1VLQA 3CCCA 1C7IA 3A2MA 1MNQA 4CIBA 4B7ZA 5AICA 4UFOA 5AKIA 4UHCA 2WKWA 3NUZA 4C88A 1A8SA 2WIJA 1P0IA 4BDSA 1J07A 2J4CA 3G0GA 3MGAA 3QITA 1THTA 3SWWA 2OGZA 5AK5A 3OC0A 4F0JA 4ZREA 1UKBA 3FYUC 3C6YA 5D7BA 1DWPA 5AOAA 5BOVA 3DYIA 1CQZA 2PSFA 5YASA 5LZ5A 3KWFA 1P0QA 5ALDA 1ZGCA 3M81A 3PI6A 1XZGA 5ALYA 1MX9A 1ZD4A 1XZEA 4MEAA 3PUHA 3OM8A 4H77A 4X7BA 4INZA 1W75A 3IUJA 5K3EA 1N5MA 3DYVA 4J03A 2GBCA 3FCXA 5K3FB 1MAAA 4TGLA 5ALQA 5DYWA 3D2BA 1MN6A 4Y7DA 2CMFA 1G4HA 1UKCA 4ETWA 2QUBA 2E3JA 2CKMA 4UBOA 4FWBA 4LXIA 4MYDA 1XKTA 1Q83A 4JEIA 1CFJA 1CUGA 3HJUA 4DNFA 2OCGA 5IVDA 1FFBA 2O2GA 4HS9A 4TVKA 1ZGBA 1LPAB 2OQVA 2OXEA 5CT6A 4RE5A 3WA7A 4FNGA 3WJ1A 2RGUA 2XMBA 1DX4A 4V2IA 4HRYA 1QO7A 3IUQA 2WFZA 2R11A 3I2HA 2WIGA 2XMCA 3WKEA 4L9AA 4GLBA 4WFIA 3IULA 4GI1A 2QVBA 1CUSA 3I2KA 2WUDA 2G63A 1ZICA 4C6HA 5SYMA 1ZD2P 4H7JA 1PV1A 1ZJ5A 3AZPA 5FDFA 1DQZA 3AZOA 2RI6A 3T52A 3WKBA 2WIKA 1CUUA 4QLOA 4K6HA 4F21A 4Q3OA 3NWOA 4W9RA 1UKAA 2JGEA 2WQZA 1BEZA 4GXNA 5BV7A 1UWCA 2ZJFA 1QONA 2VJBA 4BVKA 3PICA 2HFKA 4J0DA 5DJ5A 3DKKA 7YASA 1DTEA 1USWA 2XUHA 4QA9A 4MJ3A 5AKKA 3WWOA 3PF9A 2QTBA 4B9EA 5HF6A 1G5FA 1FFAA 3A70A 4BYMA 4QEKA 3AZQA 4BBZA 1LPBB 3I2IA 2ZSIA 3G9ZA 3WK8A 4IH1A 5ALRA 2BAGA 2CEKA 3RM3A 4Q1VA 2QXUA 4GBGA 2GZSA 3AIKA 1EI9A 4HZGA 2G5TA 3TEJA 3NGMA 4Q3LA 3WK4A 4UFNA 5AH0A 5HKBA 3LP5A 5DYTA 4HTAA 4I3FA 1CEXA 1QJ4A 2NW6A 1THGA 3DDUA 4E15A 5AKYA 4EY5A 3STTA 3C8DA 3D0KA 3UUEA 2H9YA 3BL8A 2ZVDA 1E8MA 4OYYA 3UMJA 3STXA 5AM4A 2H7XA 5E4TA 5HF5A 3KD2A 3DOHA 5FLKA 1RP1A 5AKZA 1RYYA 4ZI5A 3N2ZB 3KSRA 5JD4A 3G0DA 3WK9A 1H2WA 3GZJA 1GPNA 3BDVA 5BWBA 2JGKA 1EB9A 2DCMA 1LBSA 5ISMA 5AI4A 1GZ7A 4H7EA 3AFIA 5DWDA 1VZ3A 1U2EA 1GKKA 4EY8A 2GZRA 5AM0A 2PKYX 3U0VA 3H2IA 3K9BA 1EVQA 3HACA 4ZV9A 3TJMA 1N8SA 4E46A 1QE3A 4DMCA 3RKSA 5ALNA 4AO8A 2YYSA 3STWA 1TAHA 3A2LA 3I2GA 4X6UA 1TCAA 4QWWA 4C4ZA 4FDMA 2C5FA 5LP1A 1O6FA 1LZLA 4HRXA 3QM1A 1R1DA 5DTIA 2BGNA 2EDAA 4FFWA 1EA5A 3WLAA 4QDTA 3FSGA 4UBIA 2AJDA 3D2CA 3HXKA 3LCRA 1DT3A 4WFKA 3PF8A 3M82A 4DYHA 5JAOA 4UPDA 4G8DA 4KRXA 5HFAA 4C4XA 2Y1KA 2JIDA 4HXFB 4L72A 5LKRA 4E11A 2DQZA 4FMPA 4BP8A 4JUIA 4UHDA 3EF3A 1YCDA 4KJXA 4K5QA 1OILA 1QIDA 1WOMA 4CCWA 1MTZA 3IUNA 1ZOIA 1ZI9A 2PM8A 1DU4A 3CN7A 4BP9A 5DTJA 3OOSA 1KU6A 1SFRA 2ES4A 1BCRA 3VJMA 4EY6A 4ZGBA 4RNCA 1GKLA 3C87A 3QH4A 3FOBA 5EIHA 1LPOA 4J7AA 1SCKA 4QDZA 5JD6A 1DQYA 1IUPA 4J3JA 1U4NA 4ROTA 2FUKA 3FYTA 4KE6A 4U2EA 2O2HA 5K3CA 4K6KA 5KWIA 5DLPA 3WK5A 5CT9A 4EB0A 1XZMA 4EY4A 2GBIA 3ZV7A 3FCYA 5AKEA 2B61A 1M33A 4Y2VA 3IVMA 5FPPA 4Y2PA 5T4BA 5JASA 2V96A 1YAJA 3WL5A 1HLGA 2WG0A 5A62A 3BJMA 2PUJA 3EBLA 4KEAA 1X70A 3I1YA 4X90A 2Z8XA 4ZRDA 4P9NA 4Q05A 3DQZA 2QOEA 4Y2SA 3QPAA 4K6GA 3ICVA 2CJPA 3G9TA 3FVRA 2PBLA 2VAXA 2PL5A 1AZWA 1XQWA 1JJIA 2HA7A 2HA3A 2OQIA 4M0FA 2K2QB 2VT7A 2AJBA 4N5IX 1Z68A 1LPMA 4P92A 1L7QA 2WUFA 3WWEA 1CUJA 1MO2A 4PNZA 4P08A 4JYPA 1G66A 1A8QA 4X85A 2WJ4A 1ORVA 1NU6A 1QIFA 3A6ZA 3R3ZA 4B82A 4N8SA 4PO3X 2FJ0A 3PUIA 2VSQA 1QIGA 5JZ9A 5I9IA 4OU4A 4UBMA 2OCKA 3QZUA 3AUKA 4DIUA 1JKMA 1XZFA 3RLIA 2WJ3A 4KE8A 4DTCA 3L1JA 4DMHA 3G0BA 2XMGA 4OPMA 1CLEA 1ZJ4A 5CW2A 5JZSA 4AO7A 3O9MA 4PW0A 4FKBA 4BTLA 2HU5A 5JIBA 2JGIA 3C5VA 3VKFA 1IUOA 2BJHA 3HABA 1OXMA 1T4MA 1SC9A 3C8HA 3HEAA 2DHCA 4J0GA 4BAZA 4XX1A 3K6KA 1CUWA 4DNOA 3H04A 5CT4A 1Y7IA 3H17A 1VJ5A 3OPMA 4L3WA 5AI5A 4LIPD 3SX4A 2XQKA 5JANA 1VA4A 5FOQA 3W2TA 2WG1A 4FOLA 1AUOA 1HPLA 5DNUA 5AK4A 5ALUA 2ZYSA 3B5EA 4G4IA 1XZHA 2WLSA 1E3QA 2WFMA 3WK6A 1CUCA 2DHDA 2VJCA 1ACLA 4KE7A 5LLSA 4CG3A 1XZIA 3W05A 5AJHA 4EBBA 3PE6A 4MQLA 5LZ7A 2HU8A 4KE9A 4HAIA 2JF0A 2VQ6A 1Q84A 1I6WA 2AJ8A 3SK0A 4W63A 2BFNA 1X2BA 4AZ0A 2V97A 4OU5A 2OGSA 1R9MA 4WY8A 1AMNA 1P0MA 5IH7A 3LLCA 4XIIA 5K3DA 5H3HA 5AK6A 5CT8A 2ROQA 3O9VA 1FJ2A 5AIBA 4G4JA 1H2ZA 3ANSA 5ALZA 2DHEA 2OAGA 3KOOA 5FRDA 3T4UA 2IITA 2WTMA 1BS9A 4K2AA 3DKRA 4IH4A 1ZIYA 2UZ0A 5ALMA 3ZLVA 4IH9A 4G9GA
chains in the Genus database with same CATH superfamily
1ZXXA 2QSYA 2R6ZA 3G5TA 1E2NA 1WTCA 3OE4A 4JP5A 2APJA 1EWQA 1Q1NA 3FZEA 4BIMA 3EVEA 4QDUA 1ZH2A 3U3RA 3ZGXA 3PD1A 1EINA 1T1SA 1Y37A 2E5FA 5KJCA 1WB5A 4MGZR 1D7AA 2OK8A 1V1JA 4PC3A 5B1EA 2Q2WA 2XAUA 4PBSA 3T3NA 4G07A 3BDIA 3OT5A 4KFSA 1Z07A 2VDJA 2DY1A 3RTEA 2XLCA 2YMLA 1IHDA 1QS0A 3DHWC 3MTBA 4MJLA 4NZ9A 4DCOA 4FFLA 2QQGA 3ASZA 2W8ZA 3Q8WA 4ZI7B 2CBGA 1UMDA 2YWRA 3O1JC 4Y9SA 3DZJA 4G0PA 3S6JA 2NIPA 4B9AA 2YV3A 4KQCA 1X1CA 2B1QA 1VKNA 1K7EB 5IVIA 2D6FA 3C4VA 4LHYA 1L5LA 3WGZA 4TKMA 3E9NA 3VA7A 2CXSA 4HDSA 2BMEA 3EOZA 4M9RA 4X92A 4ARAA 5EJAA 1YIOA 4NMMA 1LSSA 4Y2XA 3P5SA 4RPJA 1AC5A 3N76A 4X7MA 3NKLA 2GA8A 3FNEA 4HEA1 3RF7A 1S7GA 3K6RA 4RSHA 2J7PD 4X41A 2X8WA 3REQB 4NZOA 3SVZA 3MOSA 3TSWA 3V1LA 2RAPA 3W9SA 3A9UA 4K6MA 5DYNA 2KJQA 5C7YA 4QWMA 2CGEA 3F8SA 3VU9A 3WKCA 1Y1QA 1PLJA 1TT5B 3QEMA 4BDTA 2WJJA 4JK3A 4B7AA 2O7QA 4ZO9A 5IBRA 1L7OA 3LXXA 4KGXA 2C82A 4JL5A 1T5BA 5CVCA 2OHHA 3O3MB 4GPIB 2AK2A 5EIFA 4G5FA 5J40A 3W34A 4XDZA 2O5EA 2XQJA 5IN5A 2F48A 3IKLA 4ZK2A 4MV4A 5ESXA 2IA5A 4TL8A 1IEQA 4OBBA 3ZJVA 3VAAA 2VUSA 4G1CA 1EBFA 2QVCA 3AI3A 5BW5A 1GAWA 1NDQA 4NAHA 4K9NA 3JZMA 4DIDA 2JI7A 2VR1A 3O75A 5A9RA 1SZCA 1KETA 5J2TA 4AP6A 5I7OA 4X00A 5TS3A 5COBA 2P6PA 2XIJA 3HO1A 3DLCA 1P17A 1I30A 4L8WB 3EG9A 4G5QA 2Y1EA 5JSYA 2C4VA 1CZRA 1UMBB 2XWPA 3DXFA 2RGNC 4GWGA 4ZZ2A 4B84A 3NTOA 2IXGA 3FBTA 4RHYA 4UU7A 1NF3A 5CYOA 3BQMB 1WZCA 3BDAA 1BMQA 2ZUVA 5EINA 1H2XA 5HIJA 3HC7A 2DH5A 2AEFA 4DSNA 3GOHA 1C3LA 3JPYA 3RT7A 1EGQA 3HYSA 3O1HB 2Z8YA 5DLEA 1HDRA 2P9QA 1Z8DA 1O7JA 1SEVA 3PB3A 5DYYA 1VMDA 1IAVA 1A1SA 2JKYA 2QVZX 1R4NB 4IIGA 4LGMA 2R8RA 4R8VA 4U6SA 3ONWA 3FZQA 3IO3A 3HCFA 4RIGA 1DBVO 3H13A 3N1UA 3ZE6A 4F3YA 4B6RA 5K01A 5KNDA 2VPTA 2FWRA 3RUCA 4JBWA 4LDZA 5LA6B 3JATB 4GWKA 2ZVQX 3IIKA 4M7RA 4RSMA 1DKOA 4PLCA 5JQGA 3NGLA 2VTBA 1A9PA 4ENUA 3R3WA 4TKVA 3VDMA 1O8BA 2YN2A 2Q21A 4BPRA 5ESRA 1OI4A 1F2VA 5FOVA 5JNVA 2I4OA 5B4UA 4PS0A 4JI4B 3UMRA 5L3SB 7GPBA 3L77A 1DBWA 1UP7A 3LQ1A 3KEQA 3QVJA 4JP3A 1LS6A 1WMAA 3G6WA 4TYQA 1NYQA 2NVUA 4XQ0A 4DQLA 2O5CA 3HN2A 3MUNA 1C8KA 3Q88A 2XBUA 1YDFA 2VHWA 3U61B 2NTJA 4A91A 1EX7A 3DVAB 4EJMA 5EHXA 4IVPA 4AJLA 3RVKA 2P4HX 2PLNA 2RGCA 2XNDD 1E8DA 3KP1A 4HCJA 4REQB 4G56A 4TRNA 3CN9A 1SXJA 2GFQA 4PTLA 4Y6PA 5F51A 3RS2A 1ZOLA 4XWYA 3I04M 2CD7A 1IZZA 4N8EA 1KEUA 3K96A 4OP3A 2WTXA 4KAXA 4Q01A 4TN1A 5EKDA 4AW9A 1AOXA 4U9HS 4ZQIA 2JGJA 4E32A 3DDCA 1SUCA 4QGFA 3GUZA 4J7XA 1QFXA 2BTOA 2Q1UA 4G4GA 1NLMA 5JCZA 4MA0A 1GAJA 1I5OA 1YE3A 5IM4F 4K0KB 1DP4A 3E9YA 4O33A 4L9RA 1DUSA 1O4WA 1Z08A 3QK7A 4BO5A 4IOMA 3OZEA 5IP5A 2P78A 2PUCA 1FTQA 1ZRHA 2YJ4A 4DCSA 1ZGHA 2QNBA 2BRUC 4B87A 1X0XA 5CCEA 4RCZA 1FFEA 3OZ7A 2ZUSA 2VXBA 1NVWQ 2YY6A 3WI7A 1T2VA 3IALA 1OASA 3T1TA 5A4IS 3MMXA 4RK4A 1IDOA 3RVLA 3WIUA 1M6VB 5GIOE 2V6GA 3EZFA 2IEIA 5KTMA 1EFVA 2QDXA 1ARZA 2EX0A 2I3ZA 3UXYA 1GPKA 3EYWA 1MG0A 2B94A 2JVIA 1SKMA 3KXKA 5BRJA 4TUYF 5D3ZA 1UXGA 2FLKA 2BV3A 3CUWA 5JADA 5DCLA 3FUUA 1JSZA 1LRLA 3NM5A 5JAUA 3NQ41 2VWQA 2LR0A 2OB2A 3VV2A 4X1IA 4E08A 4KMOA 1N9KA 3GEPA 3OM0A 5C1DA 2IBMA 2QWXA 4RTRA 2EZTA 3CO0S 1E63A 2CMDA 3OUZA 4CCAA 1T2FA 4KXNA 2FPLA 2QY6A 4JOCA 3T1HB 2RGWA 4DWOA 3WMXA 1H8HA 2C5AA 2ZU0C 4AJ2A 3MJTA 1II8B 1HLPA 2OWEA 2R4TA 2QGZA 5DTRA 1YZTA 4KFRA 3FFBA 1ZKDA 3UENA 1ZGGA 1C0LA 3Q1LA 4IL5A 4NMXB 1ORHA 3C1OA 5EOVA 5JLAA 3V4SA 2HMUA 4LPKA 2X0DA 4KLRA 4WY5A 1LUAA 4I1UA 4ZPJA 3SXUA 4DA0A 3S2UA 2FR8C 2FPPB 1KO8A 4UZEA 4TM7A 4BB9A 4LVNA 2QPAA 2K2WA 4AX8A 5J2UF 1C3OB 1A2OA 1U80A 4PF1A 4GPD1 4ZYWA 2W2QA 1IY0A 1YA4A 3EF1A 2YXEA 1SG9A 3QXCA 5KREA 5LD2C 4E70A 5FD8A 1ZA2A 4Z9AA 3SHOA 3H4IA 2QTCA 4RZQA 4KVGA 1Q3HA 1XZLA 5T4FA 4MWSA 1DIAA 1O08A 4PPQA 2PX8A 4CM4A 1XVVA 3M6MD 1S8OA 2QORA 3EQ2A 2YFQA 4QRHA 1DAEA 5F7ZA 4F2WA 1XA3A 1XLUA 1U3FA 1ZJYA 2I6TA 2GJKA 2A4KA 1TJYA 4KUGA 2OLKA 1USIA 5EJEA 4CT4B 2ZSHA 1MC5A 2HMAA 3ZE1B 2H0RA 4HGNA 4BAGA 1UT5A 3AF6A 5JEEA 5C18A 1HQDA 1TC2A 2PWBA 1KZ4A 1HDZA 3P32A 1LPPA 2JFOA 3PDHA 3FNHA 4RE6A 4F72A 8ATCA 2GJSA 2J6CA 2WRZA 4TLBA 4ZI7A 2WUEA 1Z0DA 1MGOA 3V7WA 5KVVA 3FFWA 2XF2A 1QRAA 7ABPA 5K6RA 2FW7A 4MNTA 4O02B 3SX2A 1D04A 1UF9A 4D3FA 2ZU6A 5I01A 2CMHA 1M83A 1ZU5A 2ZAOA 3FGOA 2DX7A 2UZ1B 4OMDA 1N75A 3LO8A 4OM7A 2VDUE 3BF8A 4OL9A 3CLSC 1COZA 3C15C 3N8NA 2W42A 2A86A 1NBOA 4S0XA 1DXYA 5IBCA 2REQA 3UMCA 2Z56A 2DUNA 2AFRA 1MO5A 3PUJA 1R4MB 5ALIA 3F98A 2R8XA 3FRIA 1Z7GA 4LTNA 2VSXA 1JHOA 5I45A 3H3XA 2CFRA 3FJYA 4O4HA 4Q4AB 4BCDA 1UMCA 2RHCA 3A9VA 3PQ2A 1BG6A 2C03A 4RADA 1XMXA 2QAIA 4KNVA 1EHIA 2FSVA 3Q7IA 4ZC1A 3DKVA 3JQCA 4ML3A 5D6OA 1XKXA 5DN9A 4A8JA 1FFCA 5LLDA 4PGAA 1WQ1R 1XOIA 3IEUA 3TE6A 1ODTC 4WXMA 3PEFA 2ETXA 1QV9A 2PX2A 4G89A 1OXUA 1X14A 1RXCA 3HA7A 2ZS9A 3T54A 3T1YB 2PZFA 1CUAA 1RKXA 4M9SA 1LDNA 5EESA 1TU0A 5B2EA 3O0DA 2WB4A 3G0IA 2MINA 2GB4A 2ISQA 4I2VA 2O8DA 3N58A 1EZ4A 3ZU6A 4H7FA 1IBCA 3LSYA 2QTFA 4ZV4A 1HFKA 4MI6A 3IESA 2GN6A 4MUBA 1GD1O 5G1OA 2RHWA 2X5XA 3VZQA 2GBFA 1MFZA 4GKBA 2OL4A 3QXGA 1EFAA 3GAMA 4JVNA 3WHKA 1W2HA 1Y7PA 2XXBA 4PVCA 4RKQA 4CV2A 4UDNA 4PYQA 3D6UA 4FN4A 4I81A 3RVNA 4GZ5A 3DFKA 4QLBA 1XROA 2FP4B 2WHRA 3AIOA 4U7FA 2QVGA 5AUNB 4BZWA 2O8DB 3O73A 1IN5A 2G72A 4EVIA 3H1FA 3C98A 1W2WB 2ZKIA 5D8DA 2BF4A 2VLIA 3B70A 4XH9B 1YR8A 3FUCA 3ZX5A 2YN0A 4O3FA 3BJIC 1GR1A 4HSEA 1KEEB 4Q0MA 3K16A 2ZS8A 4RHUA 5E8RA 3TX6A 3F7NA 4K9PA 3IE0A 1XIVA 1XRQA 1O9BA 4ZWNA 5CIYA 1UODA 3VO8A 1XT6A 4H60A 3C6XA 2IV2X 4TTPA 3V4VB 2D1FA 4NENA 4C0LA 2PQMA 5BT9A 4R8SA 3K9NA 4MARA 4OMUA 5CPFA 3DW3X 5ALFA 4DDHA 5CEEA 4DF3A 1V0JA 1M6WA 1A69A 2VDVE 4PPFA 2CUKA 3RVSA 5EERA 1KI3A 2BEVA 3OUUA 3T06B 1K5GA 1XU4A 2AN5A 2Q3MA 3DVQX 3HO8A 1RYDA 2YYYA 4MSUA 4KN5A 3SDSA 2V98A 3MMZA 3ZXUB 4JI0B 2WG2A 3FLBA 4XD7D 4B80A 5DIFA 3RFFA 4XRRA 1PZEA 4J76A 4U2GA 2C2GA 2Y6VA 3GUHA 4UE6A 1L7EA 4M0PA 4RKFA 1HLDA 4JCCA 2HQRA 3KD3A 2A7QA 2IHBA 1G8HA 1UK9A 4M1WA 3BMXA 4IDHA 4YDRA 2QAGC 2A35A 1KHHA 2ZYHA 4ZK6A 1WPGA 3K4PA 2BH2A 2CFIA 4BJ3A 4ESHA 1UQRA 1G38A 3EX7C 1QCYA 4IEFB 4RUKA 721PA 3PZBA 2GPBA 3BK2A 4HAUA 3NUQA 4ERXA 1WW3A 1QLHA 4XASA 4YLGA 4OB6A 5I4IA 1LBEA 3P9NA 3HDJA 2I3AA 1MA0A 4X63A 2Q41A 3IPYA 3ZTYA 2A3NA 1Z56C 3D6HA 4RVOA 3COWA 1YFJA 1N6PA 5ER9A 1XU9A 1XTKA 3BB4A 1PVDA 2BM0A 2O7NA 3MJVA 4MRNA 2J9FA 1DLIA 1CS0B 3R40A 3S2YA 5A5DA 3M33A 2HCRA 2H2FA 2NUBA 4KXLA 2HPAA 3KZKA 3F4BA 5PGMA 4ZKDA 1QS0B 1YZHA 2B1JA 2YMPA 3QVKA 1W6RA 5A4KA 4JXXA 1JDUA 3EEYA 1RHMA 3GMIA 3OC6A 3WSWA 1ZN2A 2Y93A 3E9MA 3HVHA 2P0YA 3LY5A 1YJQA 4TPKA 1P31A 1ZP6A 2IHYA 2XB4A 5DNVA 2PPVA 3BCSA 4NDZA 3BCUA 4OP1A 3VNSA 3V4RA 2AZXA 5GONF 1I3NA 3J7AC 1YI1A 1GGFA 4IUDS 3HY3A 2Q62A 5CXQA 5HFNA 1YRAA 3GBSA 3C3XA 4RHCA 1KDPA 1SA0A 2ERYA 4XSHA 3N7AA 1D7OA 4QELA 3SXUB 4NJMA 1GRNA 2CB9A 2E4YA 1I6KA 1QF9A 1WPQA 3COYA 3UEOA 4D9KA 2LRHA 3SM9A 4TWAA 5IXYA 1H4VB 4YHBA 3LPNA 1J2TA 3AOEC 5DT9A 1KK0A 3Q6IA 2F9FA 4TXJA 3AB8A 5CH8A 2VRBA 4URZR 4D9JA 2YYZA 1P8AA 3RSGA 1FW6A 3LGAA 3PUVA 3E27A 4K9LA 1RKQA 3K5WA 2XY4A 1S01A 4OK5A 1F0NA 1TU4A 2NXCA 2CBXA 4HX2A 1YRBA 1NXSA 1YFLA 4RIEA 1GT6A 4V0SA 4Y2HA 3WTCA 5BSGA 4OXIA 4K6FA 4K46A 4LTMA 1SIUA 1VHJA 3HCOA 2PUHA 4A6PA 1OYWA 4EB6B 4WN9A 2QRKA 2XT0A 4V24A 1E99A 3HJAA 5K0BA 1N36B 3IV9A 1N5KA 3C24A 4JOSA 4CM5A 3QI7A 5BV0A 4GYYA 1PFWA 2AG5A 2HUPA 4ND2A 5A5VA 1NFQA 1TLLA 4B7XA 1UBNA 2QM8A 5ALSA 5F1KA 1LQUA 4BE7B 3M70A 5SYNA 2YKGA 3VKGA 2RCYA 2R97A 3EWIA 4BAUA 3NV9A 4QJIA 3B1JA 1X80A 5HK8A 3AVQA 3C6MA 5BYKA 1CYEA 2X0FA 1DHRA 2WIDA 4AWXA 1XTUA 1N5JA 1I2DA 3F1LA 3FCOA 4XDHA 1TKAA 1PEDA 2O2EA 3W2IA 1AK1A 3PE3A 3QE2A 2XYVA 5DX8A 4B2YA 4QXAA 3ZXIA 2PUGA 1LTKA 4J94A 1P6QA 3WAKA 2Z2JA 1TM4E 1JGTA 2ATEA 1DFHA 5H59A 1OX5A 5I3CA 3ESQA 3WIBA 1DV2A 1Z13A 3QW4B 5HOQA 3LFTA 3VUEA 2GEUA 2VH5R 3GRYA 4W99A 3SC6A 3BTSA 4KI7A 2RHOA 5CM9C 1N4DA 3V2IA 2VCYA 1U8EA 4NS1A 5SY4A 1YVUA 2EP8A 3M0EA 3MQ2A 2I1LA 3HDYA 5FKJA 4FYXA 2WHXA 4XJXA 1XWIA 4REQA 4YPOA 3P71T 2GPJA 5COAA 4D92A 3TPFA 2A9RA 1JTVA 3EYAA 5DLDA 2Q5LA 4JEUA 4B2IA 2QPTA 1JKJA 1RM0A 1YJAA 3N0VA 1AK9A 4IBOA 4AUMA 4YHHB 5IG2A 5FBZA 1K8YB 2X0RA 3OFKA 2PGDA 2E82A 2GLUA 1L7VC 1AKNA 2OFXA 2R8OA 3O8QB 4A36A 2EZ8A 2W2LD 4X66B 4TT3A 3MCVA 3RS0A 2Q28A 3W4KA 2FWBA 3YASA 3FKSA 3AINA 1CRLA 3GVXA 3GRFA 4RH3A 2CXHA 5AHXA 1KI8A 2BGRA 5TQ0B 4Z0NA 1KDYA 2QLMA 1Y8ZA 1K6XA 4J1TC 1B23P 4IOJA 3I3OA 3NHAA 3L6BA 3PR3A 1JPUA 1T3ZA 1W4RA 3F3MA 3OJ0A 4MB6A 1RAAA 4BLOA 3LNCA 1QU3A 3X2EA 4G0ZA 1GPUA 1ONNA 2WHPA 3MJFA 1LV7A 4RJIA 2ID9A 3PNQA 3K7EA 4CG0A 4Q1FA 1WETA 2VHQA 4M9UA 4OCZA 4OHMA 4F5ZA 4F2HA 4K28A 1EK1A 2B1IA 3Q40A 4CTMA 3RD5A 4J7CA 5DM1A 3P9XA 3EASA 3QQPA 4J3NA 4YAUA 4O4JB 4Y9UA 2I4IA 4CM6A 2I78A 4ITVA 2XUJA 2PSJA 2QUHA 1QGDA 4XE5A 1C3XA 2H57A 2D74A 1HE3A 1A71A 1T1GA 2WDZA 3I4FA 2JFGA 4WTOA 1ISPA 1PYGA 1QAOA 2W2PA 3KKMA 5JRDS 1HNWB 3BREA 2VNSA 3R3SA 1KJNA 2PX0A 1KVRA 4GPBA 5KMGA 4AS1A 1AV7A 5EWLB 1WDWB 4P3OA 3CINA 5EKXA 3FB1A 3PPIA 1U5BA 5FP0A 3NHWA 1BQ4A 3LH5A 5A6SB 4ZZ1A 2WAXA 1O8CA 1BN6A 2UZ1A 5A4AA 3O4JA 3GGJA 1XZKA 2V4MA 3OO1A 4V39A 4QU5A 2GNPA 5KTYA 3JTEA 1IC6A 5LZ2A 3UAZA 3K8OE 1FVXA 1PJZA 2LDXA 2R7NA 1VCNA 1YS1X 4JZYA 5LM3A 2XYPA 3KXPA 3C39A 2XDQB 2VNHA 4YASA 4LGYA 3P94A 1K6MA 1U8FO 4RPGA 3VYRB 3ZLTA 2C5LA 2V7XA 5CFRA 3KYCB 4B74A 3JU3A 3N2KB 3I6MA 4U2CA 2YVUA 1VGVA 1XRRA 1TQ2A 3PTZA 4AK9A 4QJ3A 2JJMA 4IFEA 2B8WA 5K3SA 2DY0A 2IYXA 5L7TA 1W88B 2A5JA 2BY4A 2LGJA 1NJ2A 3ZK9A 1YRYE 1MAUA 4DLLA 1L4YA 4ZQFA 1REQB 3FCAA 1S3IA 5HKOA 3I9LA 4YY3B 2HAEA 4ZC8A 3GT0A 2XNJA 4JVMA 5KCZA 5E2AA 3EA0A 3H86A 2OHJA 2QV7A 2GI4A 4CMBA 3GLUA 3A6LA 1ZM7A 2BLNA 1OR8A 1DX6A 4QHSA 5EQDA 4KIUA 1HH4A 2PA3A 4FYKA 4G5OA 3WWYA 2WSSA 4AF8A 1LEHA 4FQ7A 1EU1A 221PA 2NXEA 4OAOA 4DZZA 6LDHA 3WIOA 4KLCA 5EQJB 5PNTA 3JASB 1FX0B 1Y34E 3LDFA 5B1YA 2O2JA 1UMDB 4C29A 1AJEA 4NZZA 4UOQA 1KIFA 3IUPA 4OHBA 3TO5A 2ASVA 5B37A 3UWPA 1QVRA 2GEBA 3WAJA 4OHYA 3FWYA 3WGYA 1QAQA 4DA9A 1JHAA 3IV7A 3N6VA 1G9SA 4OF4A 4QGGA 4C5CA 2O0LA 3RH0A 4TMWA 4FEAA 4L08A 1C50A 3B38A 1LVHA 1F14A 3QOWA 3U0BA 4CPDA 4B4WA 2ZYVX 1Q57A 4PVDA 3SIRA 4E94A 3QEJA 1HDEA 2RC6A 5GV8A 3SBXA 1FZTA 4BNVA 4E14A 2DQYA 2WFAA 1QPGA 3JD4A 1AUQA 3ZJTA 4JJEA 4YMTA 1MX5A 2VBCA 1CQWA 2FMUA 3OLQA 1TKCA 2IU0A 4HXGA 3RANA 2OBLA 3RVMA 3FGZA 2X6TA 4A6DA 4B3CA 5AVOA 3R2JA 5TMBA 1PKEA 2GHTA 1RMTA 4RPHA 1R0BA 1XTSA 1G3QA 1CYDA 1QTRA 1ZD5A 2C2MA 1WCXA 2O0KA 2ZYUX 3K94A 4QUBA 1GPLA 3WRYA 4BQFA 5IKXA 1JFFB 1PUXA 4JX8A 3KL4A 1JDVA 1LFDB 4BQNA 2JATA 4QSHA 1OA1A 2WU3A 4BZXA 3HUEA 1ZWLA 3D4OA 1F51E 1QG0A 4GECA 1CDOA 1JXOA 4KACA 3UMMA 4W8OA 4F4JA 3L6UA 3GD5A 5EPUA 4EHBA 4KG7A 3I5YA 4N3AA 3FG9A 3SF8B 4BNUA 2WABA 5CP8A 3ZE0B 4H7IA 3AFMA 1DUVG 2A0UA 1JDJA 1G3RA 5A04A 1GSIA 1T5TA 3Q2OA 2AEMA 2VXOA 4INOA 2QIPA 1OLUA 3EY4A 3EJWA 5A7GA 5IN4A 4BBAA 2BGKA 1GTJ1 2I2BA 2QGFA 3AOEA 1RSZA 3E4DA 1XJWA 2HMTA 3PQFA 4ZAVA 2QTGA 2D59A 3EVZA 1KZ7B 1MJ5A 1SCJA 1XZQA 2QHXA 2QTNA 1L2TA 4YCSA 4IQ4A 1YA8A 4EUNA 3BCRA 1UBTS 3MS7A 4D4IA 1IRXA 2FE4A 3S2FA 2Q2NA 3CCBA 4NH0A 3NM4A 5JH7B 1JJVA 1G20E 2G04A 3K0AB 5B7NA 6NULA 3TGLA 1OYVA 1W9HA 4JI6B 4PIVA 4NABA 3PJRA 3PFBA 3O1LA 1OZGA 1ZN9A 2QQFA 2PD3A 2OA0A 2FX3A 3TUZC 5FAXA 1JDZA 2IOQA 5ALWA 1UBMS 3EMKA 2D2VA 5DV9A 1L3CA 2O3SA 3A2NA 3H1BA 1KP2A 2XZLA 1OIWA 1XZPA 3O92A 1TB4A 4CR7A 2GCPA 2E5WA 3IXLA 5A7HA 5IU6A 1MHPA 1XZBA 1MZVA 3SJBA 1DPFA 1VLJA 1WPRA 2VNJA 2Z4SA 3FPFA 3H2ZA 1RKBA 4HX9A 3T4PA 3WB9A 4FGWA 1D4ZA 3NC0C 4IFIA 2H1HA 4RZSA 5FWDA 1LLQA 1YL5A 4WD3A 5ALKA 5HQ3A 4AJOA 2VDQB 2PT5A 2WA1A 1U3VA 2CWWA 3II6X 1OC4A 2WYVA 4NCXA 3QUQA 2WJ6A 4O2BF 2B8EA 5CG1A 1XK6A 1E3IA 4CMCA 1E9VA 1QIIA 3DT6A 5A9SA 4ERNA 2W48A 3QJYA 1KWKA 1SCUA 2PK3A 1GUFA 1XNGA 4MQFB 4RH1A 1NBHA 2JHGA 3FVTA 3N6RA 4UNIA 3BMOB 1RAGA 4MGHA 1XQYA 2PUAA 1RKUA 2RJOA 3P0FA 2J3MA 1W1IA 2C8LA 3K72B 2JI6A 3LUPA 1RBQA 4FB4A 1GCGA 2BFWA 3DZHA 3GHYA 4D26A 3L7NA 3ENZA 3QBTA 3H5LA 3BSYA 5KO2A 1L4UA 4QEZA 4ER7A 2GASA 1NSFA 4ZO7A 3NAMA 5ECDA 4JI1B 1ZBQA 2GK3A 3IIEA 1HEYA 4W8GA 1Y89A 3CEMA 5DGXA 5JH7F 2A6PA 3TQCA 4BL5A 3ADCA 3W04A 5CA1A 3ME5A 1V5IA 4WLOA 4C0XA 2BYTA 2AF4C 3THYB 2ODNA 3JYQA 4U5QA 3CKKA 1YC5A 2PMKA 1BHJA 1NSYA 3QKRA 5CNIA 4DNPA 1YOVA 1RS0A 1NW8A 2IDZA 4UEWA 2DLDA 4XWTA 4YK7A 2P30A 3EN0A 4RGQA 1FFXA 1FRQA 4AVYA 1QRRA 1C8LA 5FA5A 4OO3A 2JEZA 3W6PA 3ABQB 4KP7A 5E4YA 3TOSA 2XRZA 3BZWA 2XUGA 4M1MA 4B5LA 3CMMA 5H16A 3ZCSA 5JS8A 4LYGA 1VYTA 4KVFA 3L9XA 1KP9A 3I9V6 2A9PA 4E6PA 4ER5A 5KX5A 4WH0A 1DBQA 3HNRA 4OQZA 1A9RA 1I36A 3HEBA 4NYMQ 5I9TA 3L18A 2LTAA 3UWMA 4K9DA 3H6HA 2WYHA 3FBWA 1T8PA 5D6NA 3R9KA 1GZ6A 1ZK0A 1OXSC 3AUFA 2OCDA 1GO2A 2WA2A 4V0RA 5BO5A 5KAMA 2YXPX 3KQQA 4AWBA 5HZGA 3H4TA 1JZTA 4P7GA 2DWCA 1D2NA 1NU8A 2OGWA 3U7HB 2MOKA 1NQTA 1M2FA 2I91A 3BJZA 1DIGA 5F3RA 4AJKA 5CLQA 2EFHB 4EVSA 8AT1A 4UCFA 5JXGA 3OU2A 1DFIA 1GV1A 1Z25A 5BSWA 5LIPA 2VHVA 2I2DA 4MRPA 2FJUA 2R8BA 1G42A 1K97A 1LX6A 2C99A 1Q7GA 3AQ4A 1DG9A 3ORRA 2QXYA 1BA3A 2JW5A 3CX4A 3LT5A 5JYBA 4YUYA 1C1XA 3FUVA 2Q1SA 1G20A 1SVKA 1ISRA 1V16A 1HDCA 5T3UA 3PC3A 2HRRA 1BJKA 2IEZA 2GEJA 2X23A 4A92A 1ECGA 3H9EO 3LIPA 1H1TA 3VZDA 5AKGA 2Y3IA 2PNFA 5KSWB 5F52A 1XLVA 2OZKA 2VBIA 2ZR0A 3JV7A 3ETCA 2A78A 1WB4A 3PFHA 2IY9A 4JJ6A 5THKA 3SXPA 3P9YA 621PA 4V3CA 2A58A 3ICCA 5JVDB 1NPYA 3D6TB 1GG9A 3THOA 3G5LA 5L3ZA 3VR6D 2B9VA 1BVHA 2RHMA 2FCAA 1P81A 1RLMA 4MRSA 1JQKA 5FI3A 1A88A 3O8RA 1XL1A 2ZJ3A 3HZHA 1SOAA 3IIJA 4QYWA 3DVRX 5HF8A 4BP1A 1AO0A 1OCEA 3MCWA 3BKWA 1E1KA 2MR5A 1F6DA 1Q20A 1IQRA 4LG1A 1TK3A 3OAAA 4D5GA 1DRWA 1CX9B 1F48A 1U2DC 3H84A 3IEMA 2OYRA 3M6IA 4INJA 4M49A 3HZRA 1I32A 4NONA 2P8SA 5BORA 1LPSA 3QQ5A 3L5OA 3CRNA 5I7FA 4YJ2A 3DV9A 2OFFA 3T3EA 2SKCA 1LDEA 1L5FA 2FNAA 1DWUA 3TK1A 3AR9A 3F3SA 1UT6A 2QZPA 4YMLA 3E9RA 5BNZA 2VTBB 4LX0A 2WWWA 4BV8A 1IBKB 1MQ9A 1F9EA 4G0XA 1P4HA 2RHBA 3UFXA 4EI2A 3I9OA 3D8RA 5FPKA 1HLFA 1NVUQ 4WLFA 3DL4A 1FL9A 3JWEA 3IKJA 4P3XA 1THMA 1XEWX 2L18A 2XKJE 3NKFA 3MG9A 4FHEA 4CHTA 4MDEA 2X42A 4GBED 5IDWA 1JMYA 3LF2A 1AGRA 4KQEA 4L5JA 1XVUA 1RM3A 2KLHA 2P9EA 3M5PA 3MEQA 1PZNA 3MK31 3SQMA 3TIVA 2ZIAA 1DC4A 3TW6A 5B1IA 1QKJA 2XTNA 3PZRA 4KXMA 5H68A 1QH9A 1SHJA 1ZZGA 4A3SA 2QI9F 4IJQA 4XVHA 1IXZA 5DHTA 5TC4A 1JEAA 1Q21A 2G9NA 5C8VA 2I7XA 2C00A 1ID1A 5CYFA 4HNTA 4FOPA 3UVEA 3DWGA 4P22A 1UWVA 2FLWA 3PPVA 3Q7QA 3R5KA 4D9MA 4RTMA 3HB9A 5FWXA 5LUAA 1Y42X 2AG1A 4D8XA 4YUAA 1QFYA 3EZ9A 2FA9A 3VSDA 5AM2A 5I7RA 3W5BA 1RWQA 4HDAA 2EQ5A 2YWGA 3LU1A 3E05A 3FPGA 4LY9A 4UULA 4HNQA 4IKOA 3WGMA 5EUCA 2H8KA 2YZ7A 4UM5A 4EG3A 2GN0A 4YT4A 1KBZA 1AHNA 1C1DB 2PV0A 2Z95A 3P0IA 1FX0A 4JZKA 5AM1A 4ZVUA 3FVWA 3IOCA 5C1IA 1UZNA 1H6DA 1NXXA 1BEUB 4HDQB 2CSUA 3FOFC 2EIXA 4UXJA 3TSZA 2AFHB 3LHKA 4XFKA 5AQ1A 5AKLA 1OFTA 2R3SA 2C7BA 3FNBA 1KY2A 4KC0A 4OHWA 4ZVNA 1SXPA 2HBQA 1VHTA 1GAEO 1PL7A 1OW3B 1SJ9A 5DX0A 2KHZA 1SRRA 3OWHA 2WM2A 1KKLA 2BFBB 2EKQA 2C4KA 4HBGA 4A6XA 3HEMA 3ZDYB 4Z0PA 4JXZA 1XB2A 5EXDA 1TT5A 1O77A 3N2LA 5F2OA 3L1KA 1KDZA 4BWYA 3CJTA 4WCVA 3B6EA 2QTZA 1JQAA 1DINA 1DLJA 1PQPA 2R4UA 5HGJA 4KRGA 1REQA 5KVQA 5CGQB 5HCUA 3RYIB 3NH6A 1Z06A 4URVR 5LOVF 1SC6A 2QK4A 1LK5A 4L6CA 5K8CA 1U9IA 2HQOA 4R51A 1QH1B 3EXEA 5EJ6A 1I6LA 2HPHA 4NCHA 4OMFG 2OEPA 2I54A 1OH7A 2W22A 3GDGA 4A1FA 2ECKA 4JT2A 1IEWA 4L4SA 1P2SA 2V74B 1Z6XA 2J6IA 1K6JA 2H1SA 4MW1A 3MFQA 1Y5RA 4PO1A 4WECA 4J1TA 2IPXA 3HB7A 2FGJA 3LCVB 1I9CA 2QZ9A 2J3QA 1WOYA 3QG5A 2DUJA 1P1KA 4MUKA 5IJ0B 4ALJA 4QRDA 3K70D 2HT1A 1HT3A 4FYHA 4PTYA 1Y8RB 1C30A 3E5NA 1JJBA 3JY6A 4BY9E 4RGVA 2GBPA 1II9A 2DFLA 4LDRA 4K3VA 2JFBA 1NBMD 1QQ5A 1DEOA 1JI3A 1K63A 4FBMA 3TJZA 3DPIA 3TRFA 3TRIA 2WAYA 1AX9A 3JYNA 2QUJA 2XUOA 1YBMA 4X1OA 1SXJC 1JILA 1PJ2A 4KXQA 1NQOA 5CJ2A 4DXHA 3KDPA 3LS2A 2ZUFA 3A27A 1XL0A 1GGVA 5K0CA 3NBMA 2FPPA 3KOYA 1O4VA 3OEHA 4PEVA 4TQUS 5AJXA 3P0JA 5MDHA 1SD5A 2QE6A 2W43A 3A6GA 3NNNA 4BLTA 5AJVB 2BKLA 4IRMA 4NEGA 3C48A 4Z4QA 1D0SA 3LHDA 3JAKA 4N47A 5LZ4A 2F1JA 5DTQA 3QNWA 1X7ZA 5HEKA 5CCBA 4W1QA 3I04A 1S02A 3BIXA 4BBJA 4Z53A 2OBBA 4S1PA 4BJ5A 3PUWA 3ASYA 4HNUA 4Z7JA 5M34A 4Y18A 5IFKA 1UADA 1T9HA 1XK7A 3WMFA 3UHOA 1J0DA 4W7SA 2R6CA 1HSOA 3WBBA 1JEJA 4X1IB 2YIMA 4S35A 3X1WA 2DG2A 2DTDA 2Q3CA 4L0CA 4ZHQB 2O8FA 1Z6QA 1X8JA 1MOQA 1W35A 1XCPA 2Q6KA 3A4TA 3P4UA 3E1GA 1Z45A 3OE7D 4FYPA 3C6KA 3CRQA 2B83A 3ML1A 1M6YA 3QIAA 3UV3A 3KR2A 4DMKA 2GD6A 2P1RA 3QLVC 3F7OA 4E3ZA 2J4DA 5KQLA 2HGSA 5K3BA 1SBNE 1L5QA 4I50B 4YJDA 4Y2TA 2VQFB 1M2VA 2XGJA 3EGWA 1KSFX 2Q3DA 1E7QA 1H3NA 1YS2X 4RZHA 5TQJA 2QN8A 3RREA 3OG9A 2E4WA 2HWUA 4ZD6A 1CHNA 4N5LA 3L0DA 3H5VA 2VDWA 2C0CA 4P4SA 3S5JA 4DG9A 4QBGB 3AXSA 1TK9A 3HFSA 4D3DA 1E3MA 1C14A 1RQRA 1Z6AA 2QMQA 1J2JA 4JBGA 3ZDZB 3ZWQA 2Z3ZA 3TIIA 3RF6A 3TTWA 2G9UA 2ZQZA 4KYIB 3DEAA 4JC8A 4FYYA 4CEJB 1AUXA 1IJFA 4O2RA 1XE3A 4RGYA 1Y5IA 1UM8A 3U48A 5K0GA 4E13A 4B85A 2VYVA 3ETGA 3A6DA 4UKDA 5JNTA 2AW3A 3TXXA 5CVDA 5DBFA 3GJ6A 4KO2S 2VRCA 3CLVA 3D8UA 1OV6A 1VGQA 4JP2A 3T9BA 2XWJI 3V6LA 3DE4X 3NI2A 1AKTA 2NU6A 4B09A 2AFIA 2VFAA 2PWYA 3BK1A 3RBAA 3V46A 1Z2AA 4A16A 5HXAA 1B8VA 2C2ZA 4RXTA 1J42A 4IIXA 4QDOA 3DVAA 1G21A 1DAGA 2JASA 3MS4A 1XRPA 4F9FA 4A8HA 3R3UA 4CQNA 3ZIAA 1V39A 4M1EA 1G5IA 4BE4A 5C1BA 1TCBA 4PYOA 3GUYA 1CR0A 1QUFA 2PEZA 3VU1A 3G9XA 1XZNA 3IEPA 5JS2A 5I47A 1NW9B 2FMXA 2ZWMA 1HG1A 4Y9TA 3IPRA 3O95A 4NWIA 5HK9A 8ABPA 4TQ9A 3IVGA 1IN8A 2VDOB 3AKYA 4LQCA 4ZAFA 4JENA 3H2YA 2JLVA 1AS0A 4MQMA 2WIAA 3T9EA 2WV9A 3IDZA 1U65A 1L9XA 2C3PA 4YACA 1G5PA 2Z5LA 5BYJA 3SXJA 5KTRA 3IBTA 4TYPA 4NE7A 5KNBA 4PFJA 3HKCA 1KOFA 3L43A 4EJ2A 3DOFA 2IUFA 3RC7A 1ADBA 3JD1A 3IP7A 4DQVA 5TF4A 5C5IA 5TNXA 2GGSA 1J1ZA 3GB9A 4MI3A 4OX9Y 2XCRB 3DF7A 1GVHA 1FY2A 4P6VF 4EY7A 4KQKA 1T4CB 3UATA 3ZS9A 4AMZA 1RZRD 1FUYB 4GC5A 1BS1A 2O23A 4UUPA 3IL2A 3EQ8A 2IYVA 3PDWA 2OP0A 2HRCA 2JJ1D 4RL6A 3QPCA 2PRIA 3E5MA 1KZYC 1ISSA 1J06A 4ZO6A 4YRDA 3SYMA 2W2OA 4EYGA 3E53A 2ZRJA 4MVYA 4RS4A 4MUGA 2NADA 2PUEA 2HR1A 3ZH2A 3RSQA 1G4AE 5FO1A 3NTRA 5CB4A 1CZHA 1JUDA 1QAMA 2E55A 3PCTA 2IYUA 4IJ5A 1FYEA 2XZTA 3IUSA 1ZEJA 2O1XA 4ENTA 3GQVA 5CFPA 1NXVA 4FLFA 2R9VA 2A0KA 3LUJA 3C6BA 5BWCA 1RHUA 1ZWKA 2IHTA 1IN6A 2C7OA 1U6IA 1X7HA 3JYPA 3NHKA 4LXYA 4JA2A 4N6NA 3WRWA 1U2ZA 2D4AA 2OVBA 1N0IA 5CLLA 4ND5A 1CULC 4A26A 4M0DA 5HCIA 4TZ0A 1QH8A 3RAPR 3SPXA 4FNMA 1BWRA 4Q19A 1XUOA 2FSVC 4DLBA 2PY6A 4HEA6 4BX9A 1GNSA 3OEYA 1PUIA 2DFDA 2HMYB 4B44A 3JWJA 3BD6A 4I5FA 1XTPA 2YV2A 4HN9A 5FNVB 2QT9A 5ICGA 3M3PA 3OZIA 1MX1A 3LBIA 4G0NA 1IHYA 2EYUA 3LD9A 3EIUA 4PICA 4X6XA 3SBEA 4BIIA 5AIAA 4NAVA 4D4KA 1S0UA 4LRWA 2J9ZB 3EEFA 4RELA 2E4AA 1Z5OA 3TW8B 2DWOA 2VZ0A 5KPDA 3WQSB 1IY9A 1R0WA 1YCFA 3QXHA 2UZAA 2YWXA 3DO6A 2FPSA 4RWEA 5EMLA 4HDMB 1UPXA 2FUG1 1Z12A 2PZ8A 2FFBA 3U2QA 3A7EA 4DV1B 1OX6A 1XMIA 4R0VA 2QE7A 2VQSA 5I9SA 3TAHA 4B6PA 1DS6A 5JAIA 3WS7A 3PC6A 1K9SA 5AVSA 2QI9C 1RI1A 2E6UX 2EDCA 5FPQA 3KCNA 2GAIA 4D0RA 4IEIA 2HJHA 1E1CA 4BV9A 2GF0A 1RRGA 3V55A 2GVZC 2OV1A 1TI7A 1MPTA 3KHSA 3Q3IA 5CYGA 4Y2RA 1QYIA 3QKIA 2DR3A 4FTWA 1V8BA 3EBOA 2ASEA 4D9HA 3PLAE 3FWPA 3I8XA 3HBMA 4CMJA 1NXTA 3AEQB 3BBLA 1RWPA 2Q8QA 1ZGJA 3DMPA 4FUTA 4IXWA 3AR4A 4NSNA 1O6ZA 3EXHC 3OLXA 3VXKA 3L0CA 1TNDA 3NHJA 4L75A 4LWQA 1ILWA 1FVFA 2PANA 4MV8A 5BN4B 1NN5A 1EFCA 1XD8A 1K08A 2RHTA 3NASA 1UAYA 4D57A 5FJJA 1UWLA 4FFVA 1EP9A 1TMYA 4I3HA 4YV7A 3L7OA 2VNKA 1B1AA 3BE8A 4LYAA 5C53B 1JG3A 1WS6A 2H1RA 1RRKA 3R5FA 4HDRA 2D13A 4OGWA 4PYIA 5B3KA 2M1ZA 3AL2A 1PHPA 1WCYA 3J7TA 1DADA 1UWKA 3FMGA 4PWYA 1HTTA 3W6NA 3F6PA 4KLNA 3WGLA 1S9DA 2H1WA 5IAJA 2D0IA 1KYWA 3N3AC 4CIBA 3V3KA 1QP7A 3CPSA 2MU1A 3EH1A 2YWJA 3V6MA 4ARUA 2DRIA 5JS7A 1I7DA 3OF5A 5AICA 1G0OA 4QIHA 4UFOA 3LYUA 4JI5B 4C6TB 3H5TA 3THWA 1BFDA 1N9ZA 2WIJA 4NDAA 4N5MA 2YNMD 4M7OA 1TAQA 2J9XB 3A9TA 5SICE 4EHNA 1E2HA 1F0YA 3SWWA 4NBRA 1EFKA 1VCMA 3AOGA 5JCOA 1C0KA 1U6KA 1HV8A 3R9WA 3NHSA 1R0ZA 1NBME 1WNTA 2P3QA 3G7UA 1IXSB 1HEUA 2DJIA 3LWNA 3MC1A 4GOLD 5CX1A 3MWEB 3FYUC 5E3IA 2V5UA 3GMTA 2N75A 1GAQA 1TQ8A 2WPNA 1OGJA 4IIHA 4OHKA 1L5HA 3DYIA 4M1TA 2IX3A 1DPGA 5LZ5A 1VL2A 1OYYA 3ZNOA 1WMSA 3FZGA 5AXCA 5IUNC 1X1RA 3IPLA 3PI6A 1CW2B 2DQ4A 5ALYA 1MX9A 1G5TA 3N0XA 2FEOA 2W6NA 3REGA 2ZJ4A 1TZJA 4LRSB 1DDOA 3PPXA 1ZD4A 2BBOA 1GHTA 4UU0A 1IL0A 1Z2EA 1QF7A 3GLIB 4MWBA 1OT3A 2QMHA 3KT0A 3CRZA 4X7BA 2AC4A 4BV2A 1NG9A 1F1BA 3ELUA 1WKVA 3ZNPA 4NYIR 3WR5A 1W8DA 4BN4A 2ZUBA 3RGWS 4U7DA 2H0QA 2P69A 1CNMA 3D0RA 1P61B 3F47A 3ILYA 4GEKA 4MH0R 1DIBA 3EGDB 5D01A 3TQHA 1G2PA 1BHQ1 3OLYA 4P2BA 1HZZA 3W6ZA 2WJYA 1Z9BA 1MAAA 1XAHA 1A9XB 1L5WA 1H2AS 1G18A 2LIVA 3FPBA 4KO1S 4LN1A 3VH4A 5JZMA 2CV2A 2O8CA 2BHTA 2J31A 2PRJA 3D2BA 4I5DA 4WE3A 5FOXA 3SNKA 1XAJA 1MN6A 5C1PA 5LIRA 3CMCO 1ODFA 2BF7A 4V0ME 1W0KD 1ULHA 4WX2B 2I8AA 4Y7DA 4B47A 3HE3A 1X7WB 1G4HA 4ARIA 2QZ4A 1QVWA 5ADUS 4G6ZA 3RIXA 3F5SA 5FEUA 3AERA 1C3OA 3GLFE 4WZBE 5A06A 3VPFA 1U1IA 2E1RA 2XUZA 2CKMA 3AL3A 3LZ6A 2OORA 3ZGZA 1C3JA 2HV9A 4ZAZA 4FWBA 4OJKA 4MYDA 4TV9B 3G82C 2FZEA 3LVBA 2YWFA 3RKUA 1TGVA 2NT4A 4IS2A 2E89A 3PNLA 1IVSA 1W8IA 1UMKA 5C3UA 1JHRA 2ZQYA 1JXQA 3V9PA 3DV0B 2NXJA 3Q6MA 5BQPA 4I8XA 3TXYA 5CB0A 4LMBA 4C14A 2O8BA 1Q74A 3QNMA 4IIYA 1YRHA 4MITA 3UG7A 2G09A 1YZFA 1LF0A 1O97D 3BGVA 1S1CA 4HS9A 1ZS9A 4TVKA 1N0UA 3MS2A 3ETJA 2VYND 1C4OA 4LSMA 2AX3A 1Y1SA 2ZWPA 2HSEA 5DKFA 2OXEA 2QLFA 3A14A 1A96A 4KR2A 5TGDA 3WA7A 3A4IA 1X1EA 3WJ1A 3NPMA 4JQSA 1WXIA 1ZH6A 3QXSA 4NCJA 5DCWA 5ERYA 1LV8A 3CQ9A 5TF0A 2M6LA 1DJMA 1DI0A 1MAWA 2BM8A 3NCTA 1COWA 1QO7A 1ZUD1 2ZI7A 1XLTC 2ZJAA 4MV9A 3SZRA 4BNXA 4I55F 4BVBA 2WSBA 1PJCA 2ZR8A 1JH8A 3NYWA 3QGMA 2DUUA 1VYHA 4DDVA 3I30X 1IB6A 4L9AA 3WKEA 5K05A 4FM9A 4BMXA 2AVDA 3EDCA 4WFIA 5IS2A 1RAEA 1YBHA 4ZOEA 2HDOA 2JS7A 3KU1A 4YR9A 4G09A 1YVPA 4JV5B 4YALA 1ECPA 1U9CA 3LW7A 3L0IB 1J8MF 4J2OA 3UMFA 3O8OA 4CM8B 5BV1A 1Y6FA 3TMKA 1LVGA 3VM6A 5SYMA 4G0UA 3PT5A 3QLUA 1ZM3A 1ZD2P 3MMSA 2QZJA 5KYVA 4AULA 1ZR4A 4DM4A 1PV1A 4DRZA 2ATVA 4FDUA 1LW7A 1GL9B 5ELLA 1DQZA 1YQXA 1Z3IX 1QHHB 2D1QA 3C7TA 3LCCA 5F9MA 1DIOB 2WD8A 5BOSA 5M29A 2I9PA 3B3AA 3T52A 4QLOA 3TQRA 2BC9A 2D7CA 1LDMA 3NBUA 2R48A 2YC4C 4Q3OA 2JLUA 3QNUA 5ENVA 4GLOA 1RZRA 2YN4A 2ZW9A 2EL9A 4Q1CA 1M2GA 1BYIA 2WINI 3K0CC 4GGPA 4Q48A 3KEMA 4TKUB 3SKXA 1DJQA 4RY2A 1BEZA 2JLCA 2CYAA 3DBLB 4XD7A 3ABSB 4D0GA 1UWCA 4PLHA 3A9SA 2ZJFA 2RGXA 4BVGA 1QONA 1IVNA 2VJBA 3EBPA 4IF4A 2VSYA 2XCUA 5JZOA 4JLDA 3E7WA 5F5NA 2BFDA 4LOLA 4A8TA 3PICA 2C9ZA 3OZSA 4QDKA 1JDBB 2YCBA 3HR7A 4Q00A 2IPNA 3DKKA 4ZZ3A 4JFRA 2W90A 1IWBB 4HWGA 2VYQA 1L6RA 4E03A 3R1IA 2XUHA 3UHPA 1KAHA 4HWRA 4YMHA 4JMPA 4YMGA 2AZDA 4RSRA 2UVQA 3JQ9A 4D44A 5CDFE 2EJUA 5AJTA 3BMQA 2DB3A 3TG8A 2BN4A 3HLYA 4GGOA 3BVPA 3L6OO 1VE9A 2R8EA 3C3YA 4YDQA 4HZUA 4BOYA 1Z34A 3RSFA 1UJBA 3AEXA 3KR0A 4N12A 5HF6A 1FFAA 1DCFA 2J6BA 2QP9X 3MQ4A 1JQ5A 2FZVA 2MYTA 4NV1A 3VI4B 4BYMA 3DBRA 4QEKA 4NHOA 3C3EA 4E5PA 1H2EA 5BVGA 2XVAA 3PXEA 2C2HA 1R9GA 2B69A 3B1FA 3CXRA 4RKWA 2ZSIA 1IHUA 3WK8A 1ENOA 4AWAA 5BN4A 2CEKA 1SVUA 1E1MA 2DAPA 3W9YA 1EBBA 1G17A 2FMFA 1K6IA 2QXUA 4I1YA 4S1OA 3T7KA 5JTTA 3AIKA 3PENA 1CERA 4J1QA 5JHHB 2JZCA 1JAHA 4QPJC 4RA6B 1IHXA 3A6JA 1CRQA 4EYKA 1C9KA 1NJ1A 3GFQA 3Q11A 3SIWA 4HT3B 1FBNA 4R2IA 1Y3CE 4HTAA 4CR8A 3OLVA 1GGNA 2QTTA 2EFEB 2WBLC 1WBDA 2VP2A 4BFXA 4RV9A 5KWSA 4RVCA 4YV2A 1DRJA 4EF6A 3QVLA 4EENA 1X7XA 1THGA 4DQUA 4UEOA 2AX4A 4IDDA 3I12A 2P4SA 4LBZA 5KKCA 3UH0A 1Z37A 3DFMA 4POOA 5AKYA 2NSDA 5ENDA 1UJ6A 3OZVA 5JI3E 1ISGA 3D0KA 1LK7A 4F3RA 3BL8A 3WX0A 4ZANA 2AXQA 2HLHA 4X61A 4EEKA 3PI7A 1DL5A 3RC1A 4OQ4A 5AM4A 2EBHX 2KYRA 4HGOA 1F2UA 4LDJA 1X9HA 1OAOC 2QL5A 3ANMA 1TA4A 4JELA 3KD2A 2CT8A 3ZDRA 1U0OC 3DOHA 2QT0A 4XM0A 5LMUB 4Y3UA 4LOJA 2C84A 1G21E 1SQ0A 2Z2XA 3PK0A 3AK4A 4FR5A 4ND6A 3VYTB 5BXQC 4LFBB 3LOQA 3KSRA 2O2ZA 3NEPX 1OOEA 2A0XA 1OJLA 3DBHB 3O03A 4H4CA 3G0DA 3IODA 4MKHA 2AQKA 3ZJUA 2YNMA 1H2WA 2DUMA 3UWDA 4WJZA 5BWLA 3AM5A 5MFPA 1RHRA 1YFZA 5G1PA 1EJBA 3N28A 2JFFA 2NZYA 3AVOA 3SZGA 2CC2A 2DCMA 3LBAA 5ESWA 1VKJA 3DMFA 4BYGA 1I7QB 3SN6A 4DLSA 3DR5A 1EP1B 1LBSA 1UL1X 5GZ6A 3NB0A 4X60A 1SUFA 1BXKA 2P2GA 2FV8A 3KTOA 3KV3O 3P96A 4HUJA 3TLZA 2PZLA 5CJPA 5CAEA 1P2GA 3I5XA 1YXMA 5BN5B 4H7EA 4D82A 3UGQA 3AFIA 4KV9A 5DWDA 3OHSX 5F2NA 1U2EA 2CXQA 2JA2A 3WRXC 2L42A 3JD3A 4EY8A 1FTWA 5AUQA 3EWNA 3USCS 1R5BA 2H5JA 2YBEA 3N75A 5AM0A 2BKAA 3ZOKA 2SNIE 3AF4A 3AONB 3FFTA 3K9BA 3K2EA 4IDBA 4WIAA 3U0VA 3VR5D 2Q5IA 1IZYA 4JU9A 5KMGB 3QRWA 1AIPA 3ETLA 4FW9A 4E1BA 3HVKA 3U3DA 2JCYA 4YAKA 4ZMBA 2D3TA 2FU5C 4JT4A 3OZFA 3TNFA 1V37A 1ZH4A 2HH9A 4GL4A 1TEHA 4TL6A 3RS4A 4DV0B 3SIPA 4PZUA 2PQ2A 2YYSA 4EHIA 4M89A 5BMVA 1MABB 3A2LA 3LK6A 1NM5A 4GX2A 2L0XA 4ICIA 4YMUA 2BCJQ 4IRXA 4QNMA 4AJIA 5DK4A 2BHLA 3DDSA 4C4ZA 3GCGA 4Z4EA 1Z82A 2VT3A 2C5FA 2O6LA 3E18A 5LP1A 1V8PA 1O94D 3I09A 1LZLA 4L8VA 4R5HA 4MTCA 1V8DA 3CS3A 2UKDA 4CMAA 5F76A 1WV1A 2V4ZA 1GUDA 1PHRA 4B8ZA 2BGNA 1M34B 1FYFA 4MPJA 3GVCA 1TYZA 2YMQA 3W8NA 3NJ8A 4BKPA 1RNLA 4UBIA 2WWFA 4NATA 4WOKA 3HJCA 3H7AA 1XLTA 1L4KA 2FRDC 3DE0X 1MJNA 3MGCA 4ZCSA 4D9FA 4EIWA 3D2CA 3K09C 3HXKA 1VPLA 1XXHA 2IYNA 3COPA 4IJKA 4DR1B 3A3NA 3MWDA 3COSA 5DBGA 1OLXB 1JB9A 1QGZA 3LCRA 1AQIA 1VFPA 1GITA 3KJXA 5U9CA 4ESVA 3ECSA 1DT3A 2W6JD 7REQA 1D0IA 4FIDA 1K8ZB 5J43A 3M82A 3BWDD 3ZWKA 1K7XB 3MWGA 5MGNA 4O3MA 4HDNA 4UPDA 3SU8A 1EUCB 1PJRA 2JKVA 4GR4A 1TA9A 2Y1KA 5HFAA 5J2TF 4EPVA 5KKAA 3UAGA 3VNUA 3TRJA 4OEHA 4JLWA 1XELA 3UUWA 2OKGA 2VG8A 3DZBA 5FUWA 1NF9A 3S99A 3X1JA 1KI2A 4JLSA 3RRMA 3ZGNA 1QXSA 1I1QB 3CV3A 3EZ2A 2CXNA 2ZRIA 2PCLA 3CYFA 1JTFA 4LV5B 3FTNA 3TG2A 1N0WA 4FVTA 2W00A 4K5QA 4KJXA 3U3JA 1TT7A 5K8UA 4M8LA 3A4LA 4KDRA 4DQDA 2CLMB 1BCRB 3CUSA 3MJRA 2OY0A 4Y30A 2ZE6A 1BQEA 3UYLA 1E69A 5JD6A 1WZUA 1D2AA 2Q6IA 2OHOA 4NYJQ 4ND7A 3MJEA 1ZI9A 1OBCA 2PM8A 3IT1A 3ZZNA 4UOEA 1PWEA 3Q7RA 1G6HA 1JZQA 1X1BA 3OOSA 1ZX1A 3C5CA 3K20A 3B7WA 4I9FA 2NZ2A 5J5CA 3ZUPA 2LCFA 1LWNA 5JY6A 1RBZA 2WYWA 4CFYA 2O3JA 3ABZA 3CGWA 3KFXA 1M73E 1WG8A 4KZKA 5GM1A 3RU7A 5CDUA 3HY6A 3GLHA 1WZEA 4GI3A 5FBRB 1GKLA 3C87A 3GZNB 3PRHA 3QH4A 1YBVA 4HUQB 4RU1A 1P0CA 4KCGA 3T1OA 5EIHA 3WXMA 4R0MA 5BSEA 1SBIA 4R01A 2OHVA 2BL4A 3NBXX 3VTKA 1CWUA 2P5YA 3ENKA 4F3KA 4QXOA 1X15A 4IQFA 3QSGA 1VYUA 2ZEJA 4K7JA 5A3QA 3P20A 5DEOA 3JAKB 1ZMXA 3QY0A 4NX2A 2DFVA 4ROTA 5CNMA 3UB2A 5J4KA 4WNYA 1EEHA 1VTKA 3SAJA 4KE6A 1ONPA 3ACBA 5K3CA 4NOKA 1D6MA 4XWKA 1IOZA 4BO4A 2CLDX 3M3HA 4C7XA 5KWIA 1IH8A 3DMHA 1MB3A 4EB0A 3V4ZA 1E6LA 1K92A 3IPXA 3PHHA 3HHEA 5DBEX 3R3HA 1VJCA 2DBRA 1Z8HA 3DSRA 2Z6AA 5J4HA 1U2TA 4PHHA 4UTRA 2GN9A 2C77A 3X44A 1M33A 1GFIA 3PPWA 1ZC4A 4Z4HA 5KU1A 4Y2VA 4YB8A 1AKYA 1ZUWA 3VPHA 3ZV5A 2PE5A 1GZVA 1OXVA 1X74A 5EMHA 4L16A 1TVCA 4BQOA 3UK7A 5IHXA 1DRUA 4KKVA 1J8YF 5A4JA 4E5DA 3SR3A 1A4UA 2WLTA 4BN0A 2DM6A 1HLGA 1J49A 2WG0A 2H63A 5BN5A 1GFSA 3EGEA 1JP7A 2ZBDA 3LCMA 4DHEA 1O0CA 3JWIA 2VKQA 5E9QA 3DCIA 5C51B 2DBZA 5BV2P 1CF4A 4GPAA 1EUDB 3I1YA 4X90A 3GDHA 2A5GA 3R6GA 1AS2A 4G97A 4JJIA 2WQ6A 3R7LA 4ZRDA 3A04A 1FRVA 1GGMA 2ZUDA 3GJ5A 3WV4A 2HD4A 4PHTA 3OJLA 1LX7A 3AP3A 2XQVA 3TBHA 1S3FA 1ZMOA 2VWGA 3G68A 3OPVA 3PITA 5CUQA 5SZIA 3CH4B 1QHNA 3GRRA 2AS0A 1MC8A 5AFSA 4CMGA 3ZVKA 3CR7A 3EVDA 3OCVA 4H3VA 4QXQA 3O7MA 4R2JA 2BFPA 2IIPA 2OBFA 4C4PA 1SD1A 4KXUA 3WDMA 4LZLA 1ONSA 2VAXA 1RQXA 4QULA 4UTXA 4EI7A 1J8FA 5KB3A 3GT4A 3ORSA 1JJIA 1NVVQ 3JQAD 4CM3A 1P9LA 4XCQA 1AGPA 4M0FA 5EMMA 1NN0A 1QCDA 1N6RA 1QCCA 4GF5A 4MS1A 4X0EA 1IWOA 1E4EA 1LPMA 3JQAA 2NO5A 1GCUA 1GSAA 3IE1A 4C7VA 5KDOA 5DLQC 4DRXA 5BQXA 5AOVA 3V8NA 1ZK1A 2QTLA 1HKUA 1Z4KA 1ZOOA 3A6FA 4MUAA 1XTJA 5CVJA 5FTLA 1ECFA 2QY9A 3FJOA 1MLDA 4GZ3A 2WJ4A 4NICA 2XR1A 3UT6A 3EPLA 1Z33A 3VPSA 1NU6A 1QIFA 4Q1EA 2O07A 3AQIA 2D8MA 3HJTA 3DMGA 4OH7A 1YR6A 4I1RA 2FJ0A 1LI5A 5FI1B 3LVRE 4FR0A 7MDHA 2R7LA 5BNFA 2CJXA 5LJLA 1AV6A 3I05A 1QX4A 5FBLB 2WWYA 3QLJA 1RMQA 1YZUA 4BB6A 5KKNB 1ULZA 1ZM2A 1C9DB 2H92A 2QRMA 2X7HA 3SQDA 1MMFB 3TCXB 1IEVA 4EAAA 1KOGA 1ZMTA 2WUWE 3OECA 3AUKA 1LXCA 2V03A 3M7IA 3NNDA 3M5CA 1KEPA 3OOJA 4F9TA 2Z6QA 3QEAZ 1K27A 4O1MA 2HHJA 3ODGA 1Z6TA 3QTLA 2CV1A 2UVPB 2WJ3A 4AZSA 4FR2A 4AY4A 4GVLA 4E5VA 3DAYA 2NVOA 4DMHA 3WLFA 1X19A 4ER3A 4G0WA 1DBPA 3LM8A 4OPMA 3UUGA 1EFDN 1CLEA 1G9XA 3HO6A 3IDFA 1EDZA 4FC6A 5L3RA 5A9TA 4OLBA 5JZSA 1JX6A 2BFEB 2QR3A 2GO1A 3AIIA 3CU5A 1UBKS 3DMRA 4FJ0A 4KW7A 4L6IA 3T3HA 1SK9A 4GOND 4AO7A 3O9MA 1W5BA 4PW0A 1FDRA 2QQ5A 4RMNA 5EVJA 3G5AA 3RJZA 3RVPA 3UT5B 4B4VA 1KOJA 2IH5A 4DUZB 1OBFO 4ZVTA 3R74A 1GGEA 2MYNA 2YVLA 1OB5A 2QSUA 3Q87B 1EJ6A 2QN2A 1PJTA 3AEZA 1W19A 3HG7A 4TWRA 2Q5HA 3HABA 4L8LA 4OHVA 3KVOA 3U4AA 3T5AA 1FVHA 1GA4A 2CB0A 1C8BA 1XJ0A 1P1FA 1GDDA 3I6BA 4HAYA 4I66A 2CXTA 4FILA 1PW7A 2BR3A 4UM9D 5FFFA 3H1GA 5KIAA 4XX1A 4MDFA 3BRWD 3NHUA 4D42A 5HYVA 4DNOA 2II6A 3H04A 5LQRA 3PNOA 1YL7A 1M6NA 3GJSA 3LX6A 4HRVA 2CFOA 3KXIA 1HRKA 1WVIA 4L3WA 3O4VA 4LIPD 5AI5A 2B4AA 4II2A 4Y1RA 3CTPA 1EM6A 2RGBA 4NE9A 1FDUA 1U2QA 4DG8A 1Z4PX 3EDRA 5K4HA 2PUDA 4DCMA 3W2TA 1TW2A 1CHDA 2XXJA 3M9LA 3SYNA 2O50A 3G9QA 5DGIA 1ZITA 1E1NA 3H9QA 3S70A 1VSQA 2CK3A 1HPLA 2P0EA 1J00A 3ACDA 2J87A 2W58A 3BJEA 3FIUA 3OZRA 1G7TA 1ULUA 2ZYSA 2XA9A 3AP2A 4HG2A 5ALUA 3CISA 5SYAA 3G2OA 3IMFA 3IR5A 5JC1A 2VQEB 4B7CA 3Q2IA 1T34A 1HFWA 1GN8A 3WK6A 1CUCA 1M2NA 2NVWA 3RODA 2X6RA 4RJLA 3TSCA 5EZ5A 3GIWA 4Q93A 4YCLA 2UZ4A 1E79A 4A9AA 4KTVE 2H18A 1JFVA 4EFMA 4Q66C 3E3LA 1QORA 4CG3A 3NC1C 4GRAA 3W05A 5K45A 1ZK2A 1SY7A 4Q9LA 2FXVA 1JVNA 4L0DA 1W25A 2I29A 1KYZA 5LZ7A 2A1IA 4MWCA 4KQMA 2AG6A 4XVRA 2WE7A 2OUIA 1PX2A 3B6IA 3FRJA 4XUEA 3IDQA 1Z26A 3WLTA 1OZFA 4UXIA 2JF0A 5AYVA 3W5UA 1DQSA 2FF7A 1CK4A 1Z62A 4IIDA 3SK0A 4QNRA 4W63A 2HLNA 3DMTA 3MAJA 4I08A 4WKCA 1V95A 3RVJA 4BQIA 3GU3A 1LNQA 3LMKA 4TV8A 4EX7A 2VK2A 3DXYA 2WMOB 2WYOA 4LRTB 4OIMA 4UTZA 5DASA 4Z0TA 1OGYA 2QNRA 4KWIA 1WSAA 5IMSA 5LQMA 1X2BA 1QV6A 4GP9A 2X2EA 4AZ0A 2IS6A 4PLWA 1ZJWA 1FNCA 2R5FA 3M1YA 4LBVA 5AK0