1MO6A

Reca-datp-mg complex
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
329
structure length
309
Chain Sequence
MTQTPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEVGLQARLMSQALRKMTGALNNSGTTAIFINQLTTGGKALKFYASVRMDVRRVETLKDGTNAVGNRTRVKVVKNKCLAPFKQAEFDILYGKGISREGSLIDMGVDQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on MtRecA-nucleotide complexes: Insights into DNA and nucleotide binding and the structural signature of NTP recognition
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords RecA
total genus 95
structure length 309
sequence length 329
ec nomenclature ec 3.4.99.37: Deleted entry.
pdb deposition date 2002-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00154 RecA recA bacterial DNA recombination protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.250.10 Alpha Beta 2-Layer Sandwich Rec A Protein; domain 2 RecA protein, C-terminal domain 1mo6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mo6A01
5H8WA 1UFQA 3RC3A 3PIRA 3SJBA 1J70A 3I62A 3UATA 1YE8A 1PLLA 2GK7A 4NE2A 2R6FA 4A8JC 4AG6A 1W7AA 1TX4B 4MGZR 3FE2A 1IQPA 2RGNA 3FYHA 4AYXA 1LS6A 2XTZA 3T1TA 1OXSC 3GEIA 3L2OB 2JATA 1XCMA 1VPLA 4FIDA 4B2LA 1N6LA 4Q4JA 4GT1A 4TZ0A 1UKYA 2FFHA 4L4UA 3KKQA 2GF9A 1W44A 1Q1QA 4YXWA 1NN5A 4DXAA 1L8QA 3SJCA 1MR3F 1HV8A 3THYB 1NJGA 1IONA 5DGXA 1F48A 1C4OA 1T0HB 2PLRA 1CBUA 4RKEA 4GZMA 3BB3A 3R20A 1IXRC 3AF3A 2ORVA 3TVDA 2XX3A 3CH4B 1KMHB 3A58B 4A2QA 4CIDA 4QJ3A 4D0GA 2ODWA 4YC7A 4DSUA 1GVNB 2PJRA 2NOAA 3JZAA 3MCAA 3T12A 1AGRA 2O8BA 3NC1C 5K8UA 3SYKA 2WJIA 3SS8A 1ZUHA 4NPHA 1S0UA 2GEUA 4QKQA 4HB0A 2C98A 3REGA 2G0NA 2VYFA 1NSTA 1A1VA 3OE7D 2V6IA 2QT0A 3LA6A 4MYTA 2AD5A 4Q9IA 4K8OA 2IC5A 1N5LA 4GDFA 2HEIA 3RANA 4DKXA 3MG9A 2IS1A 3EASA 4LPKA 3HU2A 2QQEA 1SVIA 2WWGA 4UJ5A 5IF9A 2C99A 3WNDA 1XCPA 2C78A 1LV7A 4LJ8A 1BO6A 4ERNA 3W6PA 4RSGA 1N0UA 3HU3A 1WBDA 4QJ5A 5JRZA 4IVQA 4RCYA 2F9LA 2QGNA 4ZI2A 1KY3A 1QVRA 1K5DA 2B6HA 2QE7A 1XJQA 4LOAA 5EZ5A 2RAPA 3BH7A 3WP0A 4B74A 4XSGA 3TMKA 3LBHA 2GXUA 5L3SA 1FZQA 2DR3A 5DE3A 3KZ1E 1W46A 1J8YF 3PUZA 4KJZA 2WICA 2H18A 1CLUA 2JLUA 5IT5A 2MSDB 3CO5A 4NYIQ 1G3QA 3NC0C 5KNDA 3TVTA 1TEVA 4DLZA 4LBVA 3GLIA 3BBPA 5HZHA 2F1HA 4PX9A 1JR3E 4EPYA 4CEJB 1NSFA 5LD2C 5CK5A 1XTQA 2ZSBA 1JR3A 3FKSA 2WJJA 1W0JD 4PC6A 3HP1A 5EXPA 3K09C 2HYIC 4OK5A 1RIFA 5CDFA 3REFA 5HE9A 2FPLA 2O8CA 3VX4A 1O3YA 3LAWA 3EWAA 2DPXA 2F6RA 1UKEA 1W0KA 4JKIA 3VHLB 1TTTA 1WMSA 2OZEA 4CGZA 2HLDA 2XB2A 2C9YA 1E9SA 3BS4A 2CK3D 1P6XA 1FX0B 3GLGB 4A0GA 4NH0A 2FGJA 4QM7A 1P75A 2GRJA 4A8JB 1D2MA 3P32A 2YOGA 4Q1DA 2O8EA 4PPQA 5GVSA 2QMUA 4N0EA 3O8BA 3PEVA 4JKYA 3C4JA 2FPMA 3K0AB 4KITB 3EZ9A 4DCNA 1LW7A 3W6NA 2P6UA 2XZPA 4QBHA 4HB4A 1ZYUA 3U3MA 4P31A 2E87A 2JEOA 2AD1A 2BIFA 4A0HA 4U5XA 3SQXA 1UEIA 3OFNA 3U7GA 2WWYA 5AR1A 2GJSA 2J59A 2IYZA 1OHHD 3CNLA 3Q5DA 4Q1CA 4Q7MB 5FPYA 5DNYB 1KGDA 2J87A 221PA 1BMFD 4G5QA 2B21A 1XBTA 1TUIA 1E2DA 2D06A 3TKLA 4HATA 4HLUC 4RFVA 4IKEA 3WP1B 1KK1A 2NO0A 1EX7A 2C9OA 4CT5A 2QTFA 1KJYA 3E1SA 4IDNA 2FH5B 2J1LA 4M9QA 4AKIA 1JPNA 1DAIA 3LY5A 5ELXA 4DIDA 1XFAA 1YR7A 3CLVA 4JLBA 4I1UA 2QQ0A 1PUJA 4DC9A 1W36D 1PLKA 2E9SA 2VHTA 2F3RA 3BB4A 4UXJA 1NN1A 1Z0KA 4ZCLA 2W58A 3PV0A 5JCZA 2ZRLA 4L9WA 1JAHA 4DCTA 4S2EA 1I4LD 1UDWA 4GSYA 1LS1A 1OFTA 2CCJA 2VF7A 2PT5A 4MGYR 3RSOA 1E9FA 1XXHB 4Q1EA 2WSSA 3X1YA 1EGAA 2QSYA 5J4KA 2PEZA 3NDPA 4A8JA 2O8FA 2JJ2D 3LRPA 1KAGA 2FPKA 2KSQA 4AKEA 1XJ0A 4JMPA 3TUZC 2W6JA 1OB5A 3A6PC 4FN5A 3NWJA 4BFYA 4Q4AA 4JZKA 4JYCA 3PUXA 1WF3A 2R6CA 1E79D 2RGCA 1G7TA 1N6HA 2GF0A 1LTQA 1S96A 1M34E 3TW8B 4Q1BA 1J8MF 3TAHA 1CJTC 1T91A 3VX3A 4C7OA 2BDTA 4KYIB 4LDJA 4NYMR 2GZAA 1Q12A 3WHKA 3AKYA 1OJLA 2H57A 1X1RA 1E32A 5TY0A 2XZOA 2J46A 2C96A 1II8B 2CDNA 2O8FB 1ANKA 2BEJA 2BJVA 1A4RA 1TF7A 1XD9A 3EZ7A 1GKIA 2F9MA 3CRMA 3MWYW 4LYJA 1FMJA 4IVPA 3RAPR 5K8TA 3FWYA 1XMSA 4GP7A 5G3YA 2ZRJA 1YZLA 3SJAA 3KTAB 3LX5A 1SZPA 4R71A 1ZM4A 3UANA 2IYXA 2P6NA 1KDOA 2Z4RA 4A82A 4ACAA 1BMFA 3EPHA 1LB1B 1UAAA 3THXB 5FPSA 1GL9B 2A5YB 2ZJYA 3KJGA 3SYNA 5JSZA 2AL7A 4RFSA 1NVUQ 2ZIAA 4IOLA 4EFLA 5F9FA 5JWRA 1KI1A 3CZQA 5A0FA 1YU9A 3ZQ6A 2V4ZA 1XRJA 1TMKA 1ZMXA 4MKFA 4TMZA 3TR5A 2XXAB 1AS2A 1NY5A 4B71A 1IN7A 2FFQA 2XNSA 1W5SA 1JJ7A 4LYAA 4JSYA 5CDFE 3GPLA 1MABB 2GCNA 1OKKD 4DIEA 3C7KA 2ECKA 3QXHA 4OQMA 4PZZA 2ZAMA 3IILA 2GJKA 4V02A 5AJYA 421PA 4DVGA 1PJRA 4TYYA 1XU4A 1ZD9A 5FL7D 2FV8A 4AURA 4DSNA 3B78A 1G5TA 1YZGA 5JJKA 3DO6A 4D2IA 4JLAA 5L8VA 1T5LA 3C5CA 3HDTA 1W1WA 2VTKA 2Y8EA 5JJIA 2WWFA 2GZDA 1R0XA 4DSOA 3EC1A 4PXAA 2YWHA 4CEIB 4HZUB 4M1SA 4OKSA 2ZEJA 4G3XA 1DO0A 1EK0A 1QHNA 1QZXA 2NO1A 3A1UA 4JLKA 1G1MA 2PZGA 4KBGA 4PHHA 3SJZA 2YVUA 4FD2A 4PQFA 4IVRA 5KDLA 3GQBA 3QXXA 2QY9A 1KO8A 5EP2A 1FUKA 5H1YA 2ZUDA 5EP1A 4LYFA 2FG5A 3LX8A 4BEJA 1H65A 3K8YA 3BORA 3LH5A 5HR5A 2GEVA 2J0UB 3M4YA 4WAUA 1T4GA 1F60A 3A36A 4JL5A 2BMFA 1KZGB 1GWNA 2WWWA 1R5OA 3CW2A 3IIMA 4DUGA 2I1QA 2I1VB 2OFXA 4JLDA 4B3BA 4URUR 4YMUA 3SDZA 2F1JA 1VCNA 5JWOA 4HI0E 4B76A 1R0WA 2XNDA 3LFUA 4B33A 2CJWB 3F0TA 4UNNA 2YZ2A 1ZNWA 4PC3A 4W5JA 5AK0A 4YMTA 4OHWA 2ZRPA 2IHBA 4F4JA 1F5NA 2O52A 2XB4A 5E95A 5B58C 3GJ0A 3MWJA 3MD0A 1ZW6A 4OK6A 3H1TA 4NCHA 3FHOA 3ADKA 3SNHA 3MGCA 3B8HA 2IS4A 5CLLA 4G5RA 3B1XA 4X8LA 1E2JA 1GUAA 2HXYA 1FP6A 5FUYA 1G7CA 1E2HA 4LK2A 1SXJB 4TQ9A 4ZDWA 4AK9A 1WBBA 4A6XA 2CL0X 3T15A 4FWTA 1XEXA 3NH6A 1ZD8A 2YOHA 2ZPTX 2O8DB 2G0TA 2LKCA 1GNRA 1Z08A 3BB1A 4DB2A 1KI6B 1PZNA 1E0SA 1DAMA 2JJ8A 2RKOA 4LJ7A 1S9DA 2ZYTX 3IBGA 2CE7A 3X1DA 4DRZA 4MRSA 2O8BB 1TF5A 3AP1A 4Y0VA 1KSFX 3UMFA 5J47A 2BJWA 2FE4A 3QUSA 1FQKA 4F92B 4ZPXA 4XH9B 1TQDA 2GA8A 5FFMA 5CJPA 1P73A 2AK3A 3P4YA 1FQJA 4PSKA 4D80A 4ZDJA 1TPZA 1Z2AA 3TJZA 1XP8A 1GITA 3D8BA 5B30A 4RD2A 4K81B 1KIMA 4HEJA 1NMXA 3N5CA 4QRHA 4V0NA 3IUYA 2N42A 2QEQA 2EVWX 4KFUA 1I4DD 4G0NA 1N5IA 1U0LA 2BEKA 2V7QA 1OXUA 1JALA 4RZ2A 4BLTA 4PQYA 4ILEA 4LHXA 2NG1A 1YR6A 4ZKEA 3QENA 2R6GA 1E3MA 2Z0MA 1E98A 4XD7A 4BFVA 2RHDA 4MYHA 2IUTA 1UBGA 2O0KA 3SBEA 1TADA 4US0R 1SKYE 1W36C 2OEPA 1ZC4A 1C1YA 4HZIA 4A0FA 2YOFA 1OIVA 4PTLA 3QE0A 2ZRGA 4NMMA 3Q72A 1ZM9A 2Q0HA 2G6BA 1E96A 3U7HB 4BPBA 5KDOA 4M0LA 3AUYA 3MMPA 3NHAA 5JEDA 1FFHA 1RYFA 2EFHB 4MRPA 4NKRA 3TRFA 3DOEA 2IYTA 1W5TA 2D2EA 3B9QA 4URZR 1Z5ZA 1CEEA 2QRNA 4MITA 2HF8A 2DFLA 2OHFA 5EUQB 3TQFA 3RSLA 3VHXA 4DT1B 3VNVA 4Q9JA 4IFEA 1KZ7B 2RGNC 2OILA 4HSEA 2LWIA 5KPDA 1IN5A 2ZVPX 2IYUA 2RGBA 1Z28A 2PX3A 4F4IA 1L7VC 2CL6X 3R9XA 2OG2A 5H70A 4LV8B 3DOFA 2JLQA 1G5RA 2REXB 4OQNA 1WXQA 2DWQA 2ZROA 2CLSA 1QRAA 3VR3A 3ASYA 2DCUA 2FFBA 3EIQA 4YDHB 5EE5B 2R6DA 1OKKA 3B85A 4CDGA 2ZXUA 1E1RD 3BERA 2PMDA 5D3QA 3I5XA 4OI1A 1AJEA 1GZSA 1U8ZA 1E9EA 2C5LA 5EP3A 1JXMA 1R5BA 3X2SA 1DAFA 3UK6A 3K0CC 3QKUA 2X1VA 1GG2A 1ZU5A 5ANRB 1P9WA 2IT1A 4LJ4A 1VCIA 3E2IA 4P4SB 4BLSA 1FP7A 4E09A 2IYQA 3TGPA 2D2FA 2WOJA 3RVBA 5JMTA 2DB3A 2OO7A 1G64A 3ETLA 4Q21A 1HH4A 4PZLA 4Q03A 4WVFA 2GBLC 3UWKA 3W34A 4B32A 4B75A 1CJUC 3KJEA 3QF4B 4JS0A 5CLQA 4TWZA 2QT1A 1KI9A 5JS7A 1NNEA 1E2EA 3FHTA 3C14C 4JLVA 5F9HA 4PR0A 1AGPA 2ZITA 4V03A 1ZD1A 3MLEA 4HAXA 1ZCAA 3IEUA 4PO8A 4CEHB 2MSEB 2W00A 2LCFA 4O2RA 2IWHA 1J7KA 3U3RA 3BC1A 3FVQA 1DAHA 4BFUA 1DAKA 4TYPA 1AS3A 1ESMA 2ZETA 3B5JA 4HAWA 1Z63A 3DMDA 4WBSA 3QXJA 4HLQB 3VFDA 2FWRA 3WRXC 3GLGA 1G6HA 3DEFA 1W4BA 5SZHB 3ZLJA 2Z4SA 1VG9B 4MKGA 1EFCA 2O8EB 2JLZA 3AEZA 1V5WA 4BFSA 1OW3B 3SU8A 1X8KA 2G83A 3P20A 2NZ8A 3GJ3A 3SHFA 5TARA 3THWB 1RYHA 1NN0A 3PUYA 4NCNA 2YJTD 1N0VC 2DWOA 3W5JA 4FMDF 2J3EA 3TW4A 5JS8A 4P4UA 3QG1A 2HF9A 3AF1A 4ZDIA 4AYWA 4JIMA 2CLCX 1NY6A 4MRVA 2ZJ8A 3EG5A 4KFSA 3PQCA 4HUQB 4JT2A 4RZXA 3PEYA 4ZIRA 5KDDA 4QGFA 1D9XA 2ZTSA 2FEOA 3LQRA 3MWKA 3QPUA 5AUPB 2BM1A 4PHGA 2FDCA 1ZIOA 2QP4A 2OV2A 2QMEA 3BH0A 1U8YA 4J0QA 1YRBA 1E4VA 1EFRD 3AB3A 2IYVA 5HKKA 3EW9A 5UKDA 5K8LA 3BK7A 2ZYUX 1BYIA 3BFXA 3TSZA 1LF5A 4W7SA 2C2HA 3CF0A 3NDBB 2OCPA 1SVMA 2WIBA 4LHYA 5KO2A 4QL3A 5GVRA 4CW7A 2GJAA 3UG7A 2GAAA 3ZVLA 3QOFA 1T8TA 2YV5A 4XWAA 4IOJA 3R8CA 4B3GA 4NTZA 2JLXA 2VHJA 1S1MA 2BCJQ 3ZZ0A 2N46A 2AN9A 2J0QA 2WJGA 3D31A 5CB8A 1G16A 1E9AA 1JPJA 2QP3A 3T5GA 721PA 3AVUA 2ANCA 3GJ5A 4G5GA 4PFSA 3BH6A 4RY2A 1AS0A 1UKVY 4N1AA 2YWEA 1WCV1 4C0LA 2D62A 4A92A 1RC8A 1YZKA 2ZE5A 3T1QA 4DT1A 4AI6A 1VG1A 4DCVA 2IYWA 1E79A 2GETA 4G01B 2BC9A 3OEHD 1CJMA 1YKSA 4YONB 5GJBA 1B23P 3ASZA 4QXAA 3KKOA 4KBFA 2GTPA 3BD9A 1TF2A 2Q3MA 1PLJA 2OXRA 3QKRA 3U44B 1VIAA 1U81A 3IQWA 4PO9A 3M6AA 4OI2A 4TT3D 5D3MB 1KK3A 2ZE7A 1SKYB 1R8SA 4L15A 2MSCB 4B6EA 4YQFA 1XMVA 2QAGB 4QNMA 2CVHA 2WVJA 3VR1A 4ZKDA 3C15C 3AKEA 1VG8A 3BWDD 3TLXA 1P2SA 4DLUA 1OH5A 2VLIA 3CPHA 1KSGA 1Z83A 2JDID 4MKIA 1YZQA 2PZEA 4Q4HA 4RKFA 3Q3JB 1UKZA 3PFIA 3FMOB 1CRQA 2GEDA 4F7WA 1H8HA 5EQTA 3CB4A 4TL6A 3T1OA 4RJLA 4L16A 2FJUA 3KUDA 4PC1A 4JLMA 2ZRIA 4HLDA 1ONBA 5J4HA 4PSAA 4QNRA 2IA5A 3O8DA 1XXHE 3QNUA 1L2TA 2H5EA 3NXSA 2W2TA 2PMKA 3X1ZA 2K5UA 5FTNA 4ABYA 2ZRAA 2YHSA 3K70B 5FTMA 5M04A 2WSMA 3ZQJA 5AUQA 4NCKA 3VR2A 1P9NA 3EZFA 4I81A 1G8FA 1TAGA 3K0AA 3OZXA 1Z6YA 1Q1ZA 4PPNA 5E4FA 3RRYA 4RD4A 2IWRA 3PXGA 4Z1MD 4HAZA 3PUWA 3MUFA 3LVRE 2A5DA 2VP9A 2VSFA 3SEAA 4D0NA 4MRRA 4DUGD 1XX6A 2YC4C 2UZIR 1Z6AA 3OEEA 1P7CA 5EUMA 4ARZA 2WTUA 1OFIA 3FKSD 3HYTA 3PUVA 4OJKA 3RS3A 4BFTA 4MGKR 4OYHA 2FNAA 2XAUA 1OFHA 1EWQA 2J7PA 5EXXA 4O25A 2V8OA 2A30A 2BKUA 1Z22A 5FOTA 3FKQA 4EPVA 4LBWA 5CM9C 4Q4LA 1TUEA 3QKSA 2HLDD 4UJ3A 3G82C 5FBVB 1FPMA 2JIZA 2R9VA 5FOUA 2BHRA 4C0QC 4EFNA 4NZYA 4JL8A 1Q57A 3B2EA 1EX6A 3GLFA 2WKQA 1SVSA 4CZ2A 4JBWA 2MMGA 1GRQA 1N2CE 1AKEA 3W3ZB 1OXVA 2W0MA 3A1WA 5FTKA 3W5IA 5DYGA 5FTLA 1NVVR 3QJYA 1KDTA 2RGEA 4IXNA 3R7WB 4D25A 4GOXA 4QJ4A 4MQBA 4AWXA 3QEJA 4YMVA 1W4CA 3VKWA 1MV5A 4PSVA 1ZUIA 2B8TA 4IXMA 1MO3A 4FMBB 5FH9A 3KUCA 4ASUA 3I73A 1YZUA 3N2IA 1CR2A 1IJFA 1YHNA 1TU3A 2A3RA 2Z6VA 3FDIA 4GMDA 3Q7QA 1WP9A 1HQCA 3OIUA 1IHUA 4LZZA 1OSNA 1MO4A 1SXJE 1KI8A 4BQSA 2P65A 1ZP6A 1G3UA 1Q1EA 2I4IA 5TB5A 3LLMA 4XSHA 1N3BA 5LB4A 2ZI4A 5JZVA 2H7VA 5CIWA 4QGGA 1Q22A 2FSGA 4JBXA 4M1TA 2P3SA 3GLIB 2BVNA 2HCJB 4P4TA 4OHZA 1JEDA 1ZIPA 2DFTA 2ZRKA 3KTAA 5E7JA 3OEHA 2CBZA 3AVVA 2JJ2A 5JLJA 3UXMA 3U7FB 1DOAA 1KYIA 3PG5A 3ICQB 1SQ5A 2EWVA 5F3WB 4B73A 4ON9A 1T8UA 2FGKA 1JB1A 5JEEA 1U0JA 3CNOA 1II8A 1KI6A 1ZRHA 3CWZA 3GJ6A 3LXXA 1W2HA 2F7SA 2V9PA 1E9RA 4AKGA 4ESHA 4A4DA 2JLYA 3AKCA 3EWSA 3B1ZA 5KNBA 2OLKA 3U7EB 2NGRA 3FOZA 3MAAC 1QHSA 4HDCA 1OXTA 2W6ID 4HAVA 3ZDQA 4U7DA 3LD9A 2J7KA 3K9HA 4B3CA 4DEYA 1OH7A 4PAOA 2BBWA 3I5YA 4I4LA 2ZJ5A 3DDCA 3NHBA 3NTUA 3TE6A 5C2JB 1MRNA 2WPDA 4II7A 4QGHA 1XWIA 4HLCA 4NDZA 2ZSEA 2I3BA 4ZCMA 4LC1A 3K9NA 2NPFA 3ZGXA 1KK2A 2H92A 3FFBA 4IDQA 4P33A 4YXWD 4DB4A 2HYDA 2G3YA 2W6IA 4RZUA 2FSIA 3FTQA 2ODNA 1ZNXA 1QF9A 2GESA 3CM0A 2CL7X 1OLOA 3GJ4A 2GVZC 3KJIA 4LJAA 5G41A 3CONA 5EXTA 5DN6A 3L0PA 1JXOA 4URWR 3OFND 4JL6A 2GVDC 1M2OB 3GLHE 4EAQA 3R9IA 2V54A 5KPJA 4O0MA 4DDUA 3TAUA 2B8WA 2DYKA 2OAP1 2ZANA 3AQ4A 3GLHA 1E2IA 3OAAA 2F43B 4HAUA 1WA5A 3IIJA 4M1MA 1FUUA 2GJ9A 2GWHA 4DZZA 4B34A 5SZJA 4AD8A 3DVLA 1SVLA 1YJ5A 2VSXA 1NF3A 5CM8B 2QENA 1HA3A 1IN4A 4LBYA 4ESVA 2J9RA 3QIAA 1SHZA 2ZR0A 3Q7PA 4QC2A 1P2UA 1TNDA 3RHFA 5FOXA 4HB2A 3E70C 4D0LB 4XVQA 5F98A 2BV3A 2ZS9A 1N6RA 1RE0A 1M7GA 1GDDA 3CX6A 2QE7D 1SULA 2ZI3A 4H1VA 2B92A 4X8OA 2WWHA 4LJYA 4Q9HA 4B2IA 2ZI5A 4Z1MA 2REOA 2XTMA 2YNMA 4Q01A 1XTKA 2ONKA 2VEDA 1Z0AA 4XOIA 4C2TA 1HT1E 1JECA 2CNWA 1DBSA 4IHQA 1CXZA 3LW8A 1Q20A 5FUWA 2BCGY 1ZNZA 2QPOA 4Z8XA 5KHOC 1KI7A 4P0TA 1M74A 4URXR 4KV9A 3GLFE 3B1YA 1NG9A 4CEJA 1SXJA 1XCGB 1D6JA 4NYIR 2GAOA 1S4QA 3OE7A 4LHZA 5DIFA 2CK3A 3VU9B 1QHXA 1W2GA 4MDEA 1M8PA 1E94E 4MUBA 3KQHA 2CVFA 3U3JA 1GOTA 4Q7KA 4RCZA 1E2MA 2KBFA 2A2ZA 5HTKA 1NVWQ 1BOFA 3NBZC 4ZI3A 2UZ3A 2FSFA 1GM5A 5FR2A 1DAGA 1QBKC 2SHKA 1NBME 1DELA 2WAXA 3NBFA 4JJKA 1OV4A 5KSYA 3WMGA 2ZUCA 4NU0A 5FPTA 3HWSA 1JR6A 2AK2A 2ZI7A 3GFOA 4ARZB 1NL3A 4WZBE 3OIVA 3U2QA 2KE5A 5FL7A 1L4YA 2QG6A 4ZCIA 2FF7A 4AG5A 4KI0A 1P60A 2NZJA 4QFMA 3T1VA 4XVUA 2QORA 1QHHA 4OI0A 1XTRA 3LNCA 2ZRHA 3QKTA 5A4JA 1V43A 3IO5A 5BN4A 1G6OA 2ANBA 4QHTA 1XF9A 5FBRB 2WMOB 4FMCB 4KXFB 3ZIAA 4URVR 4F93B 1P4SA 1XEWX 5JI2E 4DCSA 4JSTA 1E6CA 2W2XA 2DY1A 2IBMA 3IPYA 1S2MA 5K8IA 1GILA 1HTWA 1GRRA 1Y63A 2PX0A 4IEIA 5BYJA 5CB6A 1OB2A 2KI5A 1SVWA 5B57C 2JDIA 5LPNA 2QPTA 3KKNA 4ZDKA 1Q21A 3WY9A 4TYWA 1SKQA 3QF7A 3R7WA 1P72A 3QKRB 1LY1A 1AZSC 4QHYA 1KNQA 3JVVA 3NEJA 4C0KA 3DPUA 4NHOA 5HKKD 4MRNA 3EAQA 1AQYA 3ZS8A 4KYUA 2OESA 2VSOA 1FTSA 2GKSA 3EZ2A 3SYLA 1TL7C 3THOA 3U3KA 3WNCA 3CNNA 4A6PA 1MT0A 4BZQA 3GEEA 3QPWA 4CT4B 1U8AA 1CULC 2Q6TA 1S3GA 1R0ZA 1Z0FA 4M4SA 3O47A 4PAMA 1KTVA 3O8RA 1BKDR 1PUIA 2ZUBA 3V4FA 5AUOB 3HYRA 4RD1A 2EYUA 3A1VA 1G3IA 2P67A 4KFRA 4C0AC 4EQ6A 5TMPA 2CHVA 5L3SB 1CIPA 4I1VA 3WMEA 1JNYA 5L3RA 3LVQE 3SI7A 1SVOA 3WYAA 4AY2A 1N6OA 2R6AA 4UNQA 3UG6A 5BXQC 1KSHA 4W5HA 1S3SA 4US2R 3TNFA 2NIPA 1EFHA 5J4VA 3THXA 1E2FA 1TQ2A 1Z0IA 5HE8A 2ZSAA 3ZVNA 4M9XA 3AVPA 3B60A 4PPFA 4IOMA 4DHEA 2OE2A 1VDZA 2Z5FA 1E2QA 1Z29A 5GJWC 4D81A 2FU5C 2AFHE 3VKGA 4KVAA 5B64A 1A2BA 3WMFA 2NO7A 2AHOA 2CMKA 2REBA 1G3RA 4Q7JB 1U90A 2EYQA 2WHXA 3K70D 4UNRA 3G5UA 4PHFA 3ZH9B 4R9UC 4B3DA 1P61B 4NBSA 1DARA 1OYYA 2XITA 2A9KA 2JAQA 4WA7A 3IKJA 4D6PA 4R98A 1NKSA 2BMDA 3B13B 2VP5A 1AN0A 4BASA 1KO4A 1ZJ6A 4FCTA 1EFRA 4AYTA 1ESNA 2G1JA 1OHHA 4M21A 2VF8A 1GL6A 1WQ1R 2RCNA 4MKHA 2VP0A 3WXMA 4F91B 1E0JA 3HJNA 4A15A 5LBIA 1OH8A 2NO6A 4UNPA 4A0RA 4KVGA 3FB4A 3A4NA 4OJQA 4YDSA 5TXGA 5L3QB 3CPEA 4Q4HB 2JLVA 3A1SA 2TMKA 4URYR 3MSXA 1GKUB 3UKDA 1QHHB 2EFDB 4V0ME 5JWHA 1ZVQA 2H8KA 4V0OA 3KQUA 3WRYC 1Z6GA 4I1OA 3NBYC 4C0JA 1NG1A 5FPKA 3QVUA 4U00A 3ZVRA 1IY0A 1WRBA 3KDSE 4D4LA 1IXZA 2VO1A 1MO6A 1E9DA 4M1KA 1WB9A 4B3FX 2XTNA 3BRWD 1UBCA 5AJXA 4IDHA 2ZRDA 1GIAA 2QRZA 4IJMA 4X8MA 5JECA 4RZ3A 1Z6TA 1AIPA 1Z3IX 2IK8A 4E03A 2DFKB 5CYPA 2ZI9A 4B35A 3AH8A 4BECA 3L0IB 1IY2A 1AA3A 3B7GA 5C46F 4KODA 4JLPA 4L5BA 2RHMA 2C04A 4LX0A 5AUNB 1DADA 2QBYB 2A5FA 3P27A 1U9IA 1ODFA 4DLYA 1Z0JA 1IOZA 4TQAA 3GP8A 5P21A 4NYMQ 2ZYWX 4A2WA 2EQBA 3SHWA 3TBKA 3RDPA 2XZLA 4RD0A 1XMIA 2B7CA 1E69A 2JJ1D 4OQFA 2JASA 4M9SA 1E9BA 1XZQA 3WHLA 3VR6A 1HQYE 2ORWA 5IK2D 2GNOA 3OHMA 3LBNA 1COWD 4DBLC 4M8NE 4TMWA 3U60B 3PEWA 2R65A 2IEYA 3PENA 3C5HA 4FI3C 4JLNA 5JRJA 3Q9LA 1W49A 1AZTA 2P0EA 1OFUX 5JCPA 2OUKA 1B0UA 3SFVA 3S1AB 2ZJBA 2YKGA 3FMPB 1F2UA 3VR5A 3EPLA 3P26A 2GXAA 2ZSDA 4WOPA 2BKEA 4TQUS 2AXPA 4DEXA 2ZVQX 2R8RA 4Q4AB 3A8TA 4GMXA 1SXJC 5F2EA 2V7QD 2C8VA 4GPTA 2P5TB 2IF2A 2V3CC 3OESA 3QPVA 1KMHA 1YQTA 1T0JB 3B1WA 4AIIA 1IJEA 1RRFA 1VYUA 3GFPA 1G291 2PT7A 5SZIA 2QA5A 3LDAA 2Q21A 1U98A 2HT1A 3F3YA 4R2IA 3SOPA 3ND8A 2G9NA 4M1WA 1E2LA 1DEKA 3MRSA 4M1YA 1J2JA 2GK6A 3RS2A 1P9RA 3U44A 1EESA 3CKLA 1FNMA 3ZIAD 3FMIA 2CE2X 2NQ2C 1NMZA 5EE0A 3RWOA 3CX8A 5E7IA 1T3LA 2V55B 4TTPA 4JBYA 5FOSA 3N70A 3NIBA 4Z51A 5EE1A 6Q21A 4BEBA 3FMFA 4BFXA 2GCPA 2WSSD 3PCRB 2PEYA 1UDXA 5AJWA 2A78A 4IRUB 3GCGA 3H4MA 1UJ2A 1ZAKA 3FHCB 3EA5A 3PR1A 4RFSB 2W2VA 4N0DA 3SE0A 3U4QB 3SQWA 1RW4A 2EFEB 2EW1A 4Q02A 3C16C 4LY6A 5LD2B 5E7MA 3L0SA 4W5WA 2EFGA 2N1BA 3W3AA 5CK4A 4R7ZA 1D2EA 4O2LA 4NP6A 2BMEA 3DMNA 1N6NA 1YVDA 2ZS7A 4C3ZA 4I1SA 4Z8YA 2QZ4A 1CP2A 2WIAA 4OHYA 2HJVA 3IPXA 1UADA 2D4HA 1Q0UA 2IF0A 1HYQA 3DZ8A 3I4LA 3PITA 4DDWA 1VHTA 2CCGA 3U5ZB 5LDDC 1U2RA 1R4AA 1NP6A 1WE2A 3RNLA 2J0SA 4M22A 2PJZA 5TVKA 5CYOA 1S1CA 3T35A 1G8YA 1U0HC 4CEHA 1DPFA 4FXPA 1LNZA 2Q9AA 1L4UA 2JLWA 4CF7A 4TMKA 1JAIA 4FWIB 2VRWA 4HUQA 2GXQA 1HUQA 3A4LA 4BLPA 4HYYA 4GOKA 2HXSA 5DI3A 2FFAA 2QSZA 2XNDD 3K0FA 4EJSC 3M0EA 1ZNYA 2GJ8A 4LPSA 4XVRA 5GADl 5TV2A 3KX2A 3IQXA 4BLOA 1VHLA 3CPJB 2JA1A 5SZKB 1KKMA 3KJHA 4LV6A 4LJ9A 4KSBA 5KU1A 1X1SA 2CNWD 5EZ6B 4B2PA 1PVOA 5EE9A 4F4CA 1ETUA 4G1UC 2Z83A 1N0WA 4GL2A 2P2LA 3L8YA 3P1JA 4Q18A 1VCMA 2AFIE 621PA 3EIHA 1FMLA 2MMCA 2IYLD 1TQ4A 3P4XA 1CJKC 4KHZA 4IOKA 1FOEB 1O87A 5DSZA 2QM8A 1G8PA 2DFNA 4JJZA 2VH5R 1F2TB 1NIPA 4Q19A 4XIGS 4ACBA 4IW3B 3TSOA 1WDTA 1E0AA 1KI3A 3V00A 3BIFA 2QAJA 5C4MA 4V0LA 1Z47A 4FMCF 4TYNA 3AGQA 2QPAA 3B82A 1GRNA 3U3OA 1I4TD 3I8XA 1W0JA 2C03A 1IXSB 3HR8A 2QAGC 4MYUA 2WKPA 2IW3A 3OAAD 4HB3A 1XMJA 5FL3A 2QTVB 3QI2A 2RGXA 3W9YA 1EWRA 3VQTA 1G19A 1A7JA 2CEAA 1KOFA 1VYTA 2QAGA 3CF2A 3RYTC 1XEFA 1KK0A 3TUIC 2OCBA 4TLBA 3EA0A 3AF0A 1E2PA 1HEIA 1AK2A 1P3JA 5DI9A 4EUNA 1NI3A 1CS4C 2GXSA 1YR8A 1E1QD 4WZ6A 1C9KA 4DJTA 4DDVA 3LWNA 3DZDA 4EKDA 2IHYA 3EC2A 3CRRA 5L3QA 1XZPA 4O3MA 2DWPA 1KMQA 4B6FA 3K0FB 3O8CA 2X2FA 3W8RA 1QG4A 4UXIA 3BAFA 2WPDD 5HPYB 1RFLA 2IXFA 2PLFA 4XTRA 3ND9A 1E2KA 2KJQA 4JVMA 4NCIA 1P2VA 3AV0B 4Q1AA 1OIXA 3QKSB 4IEEA 2HCBA 2ZYVX 1NLFA 3BXZA 1OIWA 1NBMA 2QMOA 4XJXA 3DM9B 2R2AA 5JHHB 4QM6A 1ZUNB 2Q3FA 1ZM3A 2FZ4A 2CCKA 1QHGA 4LJ6A 3GFTA 2GDJA 1W48A 3KXLA 2ODBA 3ZJYA 4BRWA 5E3HA 3W6OA 5FI0B 2IEZA 2ZE6A 4MDFA 3C8UA 4IDPA 5G3ZA 4D82A 2O0JA 2IYRA 3CH5A 5GJCA 1X8JA 1ZU4A 2H16A 2OFWA 3RRZA 2A7QA 4RD6A 1GNPA 4Q9KA 2BWJA 5BQ5A 2W6JD 4FW9A 3B9PA 1R2QA 2ZREA 3CWQA 3IBYA 2G1KA 4N3NA 3SR0A 4OI4A 3VTKA 1GSIA 3SN6A 1AKYA 2FSHA 2QP9X 3UMRA 4EDHA 2FX3A 2ZAOA 3HPRA 2F55A 1EXMA 4C0BA 1YRAA 5KNCA 2PL3A 5KSZA 1KI2A 4JYBA 1N6PA 1Q3TA 2ZJOA 2J45A 1BS1A 1Z2CA 3QXSA 4GI7A 2H1LA 3BJIC 3CRVA 3D6TB 1P62B 4QBGB 5KSPA 4MGIR 1J90A 3HU1A 4G5OA 2BBOA 2WJVA 2G77B 5AJZA 2F3TA 1GTVA 4P32A 1G8HA 5DO9A 1CR4A 3DKPA 3HPQA 4AKHA 4ITRC 4BRUA 2HV8A 4LHVA 2FA9A 3T06B 1XD8A 1OE0A 3CBQA 2NTYC 2R62A 2IUUA 5DH9A 4JLOA 2O8DA 4PAQA 1ZINA 4LC0A 3CIOA 1SGWA 3H86A 4E22A 4M53A 1ELOA 2FMXA 2OBNA 4YMWA 2AXNA 5BYKA 3BFVA 1GL7A 4ZO4A 4OHVA 3LW7A 2JIZD 4S35A 2QN6A 2ZR7A 1EFUA 1E0KA 2V6JA 3A37A 1UBFA 3KQNA 2RH5A 5G53C 4A9AA 3GJ8A 2JJ1A 4TMXA 5AWFC 3PJRA 2D7CA 3LLUA 3LO5A 2BBTA 5IHPA 1P2TA 1UF9A 2WWXA 3ECCA 5CIQA 5AJVB 5EE3A 2VQSA 2ZR9A 3T34A 4EJSB 2XJ9A 1EG7A 5JJLA 1N25A 1G7RA 5EXSA 3WBJA 3K9LA 2J7PD 2UKDA 3DL0A 4L9SA 1DG1G 3QBVA 3ZZUA 5FTJA 4V0KA 3V4RA 1X3SA 5FI1B 4C30A 3RWMB 5CJ2A 3QBTA 4NONA 1D8TA 3CRQA 3L43A 4KO8A 4P3YA 4C0HA 2QGZA 4C9BA 5DHAA 1GNQA 2F1RA 3SZRA 3KL4A 3K70C 3ZYCA 2CJWA 3NEYA 4UXHA 3IIKA 4POAA 1E1RA 4EPXA 3RC8A 4OQLA 4U02A 1IN8A 1GP2A 4OBEA 4GRAA 3GLIE 1VG0B 1FW6A 2JCSA 3LXRA 2HJGA 1Z0DA 2QMHA 5C1BA 4TTRA 4TL8A 1F6BA 3B6EA 3ZD6A 1SXJD 4PO1A 4BFZA 4BWYA 5JHGB 2WWIA 4Q48A 4GP6A 4LJ5A 1KJZA 2AWNA 3B1VA 3RS4A 3AKDA 4W9MC 3TUJC 3BGWA 3THWA 2Q9BA 1NJFA 4WXPA 1QG2A 4KFTA 2F1IA 5C18A 3G0HA 2HUPA 4Q00A 3CUEF 2O5VA 1NN3A 4B47A 1XD2A 5DN6D 3TQCA 1DG3A 1XB2A 4BLRA 3FFAA 4YLGA 1E9CA 1DO2A 2VL7A 5DI3B 4F38A 1NLZA 2AR7A 2KB0A 1Z6XA 3HR7A 2WOOA 5GJVC 1MABA 3GMTA 1YR9A 1K6MA 3OIWA 2YWGA 1TU4A 4LUCA 4A2PA 3VKHA 2GILA 1MRSA 3GJ7A 1N5JA 4WW0A 2J0UA 4EJSA 2IXGA 1E2GA 4WZAE 2AX4A 1OYWA 2VHCA 2EFCB 4PANA 4OHXA 2ZU6A 1HY3A 2AWOA 1AQUA 3OEED 5KSOA 2W83A 3RS5A 1XTIA 1A2KC 3EX7C 4QOSA 3K9GA 2QU8A 3CX7A 4H9GA 5J5CA 1S8FA 2FOLA 4LYHA 2G88A 2OSBA 3AUXA 3IHWA 5FBQB 4HZUA 4C4PA 3A4MA 3DHWC 4TSFA 4MUAA 1DVRA 1HURA 1KDPA 2DHRA 4FCWA 1J99A 1II9A 3UWOA 1OH6A 3LQQA 3WYFA 3DM5A 1TEXA 5A5GA 1KNXA 8OHMA 2WAYA 2GZHA 2IS2A 3N2EA 1SHKA 4HLUA 4X8HA 3TK1A 1MO5A 4WXRA 3KXIA 4EIWA 2E1RA 2J5XA 3AP2A 1KI4A 2RGGA 4OQXA 3BE4A 1JJVA 4HUTA 2QBYA 1F2UB 2ZSFA 1OF1A 5J40A 3C41J 1W4RA 4D26A 4FCVA 2ASEA 2D3WA 3D7MA 3QEOA 1U9IC 2KWIA 3EXAA 2VPPA 1G4UR 5DISB 1CR1A 3VMFA 2X2EA 4GBMA 1QHYA 4LRWA 4MA4A 2IL1A 2EU8A 2WM9B 1D9ZA 1G18A 1XTJA 2ZQ5A 4K46A 3X1XA 1II0A 3UPUA 3AGPA 4GOJA 2GHIA 3S1AA 4NYJQ 1KO5A 2VIIA 3K1JA 3KKPA 2IYYA 1A5TA 2HDNB 3FPAA 1DAEA 5IRCD 4A1FA 2D74A 1W47A 1JQLB 4LV5B 1HE8B 1I2MA 1AM4D 4UKDA 5FBWB 2KBEA 1RPZA 2XJ4A 3RABA 4A36A 821PA 2ZJZA 1G17A 1KAOA 1VECA 4EFMA 3K0SA 4JT4A 2OAQ1 2W0SA 2IYSA 3CRW1 3EIEA 1X6VA 1QVAA 2R44A 1W0KD 3KFXA 1I2DA 4QHSA 1M1YE 5CITA 1IAQA 1Y3AA 2NPIA 1MH1A 4C7OB 4D4MA 1GAJA 4Q1FA 4IFBA 1NBMD 3AVOA 3K0CA 1G8GA 1N6KA 3I92A 4CVNA 1VYVA 1X8LA 4WIAA 3L0OA 1XPUA 4LGMA 1G41A 2XSZD 4Q4JB 1W36B 1VTKA 1XPOA 1G7SA 1E2NA 1GKYA 1DS6A 4PPGA 1JR3D 1S9HA 1ZCBA 2X8AA 5TDHA 2ZRMA 3IEVA 4XWOA 3WBKA 1IM2A 1IN6A 1QHIA 2PCJA 1ZM2A 4PC7A 3RRNA 3W8NA 5C4GB 1CJVC 1F3OA 3VR4A 3T5DA 3KB1A 1VCOA 5G40A 1KDRA 2OBLA 2LKDA 3VAAA 4G5SA 3GEHA 4TL9A 4XTCS 5EP4A 2ODEA 1VKJA 4BGDA 2QTHA 2OCYC 3KKMA 4Q47A 2OFOA 1X86B 3E5HA 3LV8A 3EARA 4EPRA 2GCOA 2X19A 4PQRA 4LHWA 4TLDA 4ASUD 1T3HA 2A5GA 3QQ5A 3DKVA 1KO1A 3RLFA 4FMDB 3KQLA 4B43A 2RMKA 5BN5A 5HCIA 4R2HA 3GLFB 2OM2A 4Q5IA 4QBFA 1RKBA 3QVVA 1CU1A 3D3QA 4RD3A 5L3VA 2CLDX 1IBRA 1U94A 1NVXQ 4V0MA 5FOWA 5BWMA 5JSZB 1TQ6A 1OT3A 2VP6A 2ZE8A 1JBKA 2Z43A 5FUXA 5B2ZA 1UPTA 1M7HA 3QF4A 4HDQB 4C0SA 2A5JA 1US8A 4XD7D 5FR1A 5IDVA 1KO7A 2P6RA 4CRWB 2YWFA 3GJXC 1NLYA 2PH1A 2ZS8A 3ADBA 1XNJA 3UMSA 2ZRNA 1JI0A 1Z07A 2WJHA 1G5PA 1RRGA 2GCOB 2YC2C 4KLNA 2ZJ2A 3CF6R 3ZS9A 2VP4A 3AP3A 3A1TA 1R8QA 3MFYA 2J0VA 4NYJR 4OL0A 4NL4H 1T9HA 4TMTA 3KB2A 2BM0A 1T6NA 4MH0R 3ZD7A 2O0HA 1LF0A 3H0KA 3J81k 2YINC 2WBLC 1M6NA 2XSZA 2PCLA 2AKAB 3AVQA 4TL7A 2GBLA 1ZC3A 4YMSA 3I61A 3IO3A 2CXXA 5BN3A 1NKTA 3AM1A 3K53A 3VNUA 3ZZTA 4M2LA 3VU9A 1ZBDA 1BYUA 1US8B 1OPXA 1AA9A 4KAXA 4DLVA 1Q44A 1Q3HA 2PZFA 1G9XA 2ONJA 2ZI6A 1VIYA 3QY0A 2IUSA 3I1FA 4L8GA 5DHFA 1KY2A 1FTNA 3GLHB 4DLWA 1F2TA 3ADDA 2BBSA 521PA 4B48A 2OCAA 4UNSA 1KKLA 4Q9LA 4EQ6B 3ONWA 2F43A 1G3MA 5FUVA 3F5FA 3U61B 3NBXX 3TR0A 2QNRA 4TLCA 3IHLA 5FOVA 1HE1C 2XEXA 1D2NA 5D3MA 3PVSA 3MWLA 2OLJA 4M9ZA 2HT6A 1GFIA 3ZVMA 1YZTA 1A82A 1XDBA 4GNKA 1PV4A 1ZM7A 5KUTA 4LCBA 2NMVA 1H8HD 3MJHA 3JVUA 4HAYA 1MOZA 4TTQA 4B44A 2XXAA 4OK3A 4LI0A 3GLGE 5HCNA 1XEXB 2ZRCA 4CYMA 2QM7A 1N6IA 2BOVA 4Q7LA 2CHGA 2C95A 2IS6A 3H84A 1CKEA 2VHQA 4KU4A 1RRCA 2WZQA 4BLQA 1T3SA 4PHTA 1G20E 2OT3B 3Q8XB 2IXEA 5FPHA 5JBQA 3OIYA 2XGJA 4DLTA 3K09A 4TN1A 1FNNA 4BFWA 3NH9A 1SVKA 4TMVA 2Q3HA 2L0XA 1UM8A 5KOYA 1E99A 2Q9CA 2IX3A 4LWZA 4TLEA 3NVAA 1IY1A 3I3SR 3I8SA 2QROA 1CRPA 1COWA 4Z54A 4TSFD 1RVDA 4RVCA 4E07A 3I72A 2ZM5A 1UEJA 5IK2A 1M7BA 2QUZA 5BW8A 5JFGA 1XPRA 4EPWA 4ZIRB 4ZV4A 3V9PA 3UIEA 4TLAA 2C77A 4JLJA 5J4YA 1Z06A 3EPJA 4P4SA 1FX0A 2RGAA 3GD7A 4JVSB 3QSYA 1E4YA 2V1XA 4NCJA 3X1WA 3T61A 2UVQA 3TH5A 3IGFA 1R7RA 3BOSA 3AVTA 2ATXA 4BUJA 1RJ9A 2H17A 2JLRA 4IDOA 3F8TA 3AF2A 2WJYA 3CZPA 3U6BA 1YZNA 2JLSA 1H8EA 1R5NA 2YYZA 1XEWY 4EPTA 3SC3A 4BE7B 2FN4A 1BIFA 4CEIA 1CR0A 3AVWA 1R6BX 4M1OA 5HZKA 4KSCA 2XOKA 1JQJC 3CR7A 5KYKA 4MYCA 3MJRA 1K5GA 3PEUA 2VP2A 1E1QA 1JEEA 4AC9A 4E5UA 3JZMA 4UQOA 2D7DA 2ORIA 1T5IA 4BZPA 4DCUA 1Z8FA 4DWJA 3R8FA 3AF4A 1R10A 2VBCA 2XOKD 3AVXA 1XD2B 1NRJB 1EFTA 3QXCA 4FINA 3EPKA 2JGNA 1K8RA 2WV9A 5DYIA 3RS7A 2C9CA 2P5SA 2WKRA 2ZU0C 1N5KA 4KLZA 4PZYA 3ADCA 1U99A 4Q66C 3SFZA 4LSGA 4GZLA 2ZRFA 1QDEA 1CF4A 2CHQA 1Q1BA 4KCGA 1W4AA 3TSWA 2OXCA 2ERYA 1MKYA 2ERXA 1D5CA 2J41A 3L82B 4US1R 4DDTA 4DSTA 1HT2E 4DLRA 3KXKA 2ZRBA 1DTSA 4PC2A 4DLSA 3NG1A 4B3XA 3FGNA 3BFKA 2FZLA 2RB4A 4HDOB 4QBIA 1NIJA 3KQKA 3SBDA 1XXHA 4Y0AA 2WMNB 4LBZA 4GFDA 1RJ9B 5H68A 3H2YA 4JVNA 5DLQC 3TIFA 1KHTA 1NMYA 2RGDA 5EJEA 1LVGA 5KTYA 4C2UA 3EZ6A 2B7BA 1RRPA 1DE0A 4QG7A 2DBYA 4D4KA 1G4AE 4TYQA 3R9WA 2BMJA 1G21E 5JI3E 1FL9A 1VMAA 3NKVA 3L8ZA 3CR8A 1RZ3A 1XJCA 2NO9A 4QGAA 3AVYA 3THYA 2FEMA 4JVLA 1KSJA 1XTSA 2VA8A 3I32A 2VHUA 2V1UA 2O8CB 3WYGA 2QL6A 4XWKA 3U4QA 1R0YA 1KJWA 1UBEA 3RS0A 4DLXA 3U6KA 5FBLB 2EWWA 3RRMA 3Q85A 4TZ6A 3LBIA 2OBMA 2ZJAA 3KFVA 1NVVQ 2X77A 3QG5A 3W90A 4I99A 1OXXK 4H1UA 5LB2A 1H8ED 1CTQA 3Q5EA 2AKYA 4TT3A 3OF5A 1BH2A 4D4JA 4BZXA 3IDQA 121PA 2QI9C 5J4LA 3ICEA 3K0EA 2PBRA 1LFDB 3M1IA 1P5ZB 3WNBA 2ATVA
chains in the Genus database with same CATH superfamily
4NEGA 1QO9A 2GAFA 1CLEA 2PH3A 2V9CA 4DBZA 4DIFA 1H4TA 1JAXA 1Y1TA 2XGSA 3FCEA 4LXXA 4O29A 3BPSA 3I62A 2W6NA 1YE8A 5JMWA 4MV4A 2O7NA 3CBGA 2RGRA 1LBTA 5J2TA 3OOSA 1AE1A 4AG6A 3FJYA 3T9DA 4Q0MA 1D5WA 4MGZR 3FE2A 1IQPA 2OCXA 2L19A 3L1VA 1XNHA 1C0PA 1FYFA 2WTXA 4DMFA 3KK0A 1KDZA 2O50A 4N7BA 3GEIA 1J22A 5ALGA 5F33A 1VPLA 1OBHA 3T0FA 3V5NA 4BMNA 1BQ3A 4GT1A 4ZEVA 1UKYA 2FFHA 4HWTA 4L4UA 1YJBA 3UUGA 3HCFA 3I9KA 3BCRA 4RVHA 1NN5A 1TB4A 2EJVA 3OLYA 3AZPA 3EGXB 3F98A 3LUBA 2JK0A 4GE0A 4OQDA 4ZC1A 2BTQB 3SJCA 4DXAA 2OLEA 4ETWA 1HV8A 1TJ3A 3EXG2 3FPBA 2LW7A 3PT9A 1SC4A 2QXUA 1IMOA 4BO3A 1T0HB 1T1GA 1YBAA 4I1IA 2QZ9A 1DQYA 1V4NA 2R8YA 3R3ZA 1F5SA 4RKEA 3TVDA 3PDJA 1XZCA 4DIBA 3AETA 3TQQA 3A58B 4MVJG 2I4TA 2QYOA 3EEYA 1BE8A 4CIDA 4DNFA 4F0JA 1ZGHA 2ODWA 5DBEX 4BDTA 1GVNB 3JSAA 2XTJA 1K86A 3JZAA 3T4UA 1HTBA 1OX4A 1EU1A 2PH5A 1AGRA 2DTXA 2PSFA 2Z2KA 2O1XA 1YR2A 3NC1C 1J2EA 2O05A 2GB4A 4HAIA 4C87A 2WJIA 1NLMA 5IANA 4IINA 4NPHA 3LZCA 1HSOA 4Y6LA 3LT2A 1O1YA 2H4JA 5EG5A 3REGA 4ZT2A 2VYFA 3GRYA 1NSTA 4J03A 1KZ9A 2ID9A 4AJLA 4KQIA 1THMA 2ZUUA 4L0DA 5KYYB 1YK0A 4Q3EA 5A71A 2IC5A 2RGYA 3C39A 3QTLA 4IZOA 1VL1A 1V25A 4I55F 5JD6A 2O3JA 4RTRA 3MG9A 1YB5A 4YJDA 3UJ3X 4JP1A 3VA7A 4LPKA 4MQLA 4RPJA 1C8BA 1E4OA 3SIPA 4LF7B 3L6DA 3GG2A 3JQCA 2NUAB 1XZNA 4UHJA 1N0UA 1O6CA 2JGRA 4TKUB 1CUIA 2BGMA 1VLZA 1CK4A 1Y4AE 2WVHA 4AJPA 2BFEA 4ZI2A 2B6HA 1ISMA 2Z1MA 4JBNA 1N0HA 3QJGA 4B74A 2DUUA 4UUOA 3DO5A 1Q1GA 3BXGA 1U2QA 1EDOA 3LBHA 3QLEA 4XSGA 1HLFA 4LDQA 1EMDA 2LE0A 5A3SA 1L4LA 5DE3A 3PLNA 2FEPA 1J8YF 3PUZA 4JXZA 5K3AA 4KO3S 5ALRA 1FP4B 1DCKA 2C3YA 5DHPA 2YXNA 4LNAA 3CLHA 3B52X 3CO5A 2XB8A 4NYIQ 3MFQA 3NC0C 5TC4A 4C4XA 4P83A 1TEVA 1KJIA 3TVTA 4DLZA 3GLIA 5L53A 3WADA 3BEOA 4PX9A 4LRUA 3UH1A 4E31A 1GU1A 1CZNA 4QOEA 3G5MA 3AWDA 3LC1O 1X7GA 1UP6A 4L50A 2VZEA 4NDAA 4L95C 2C58A 4P6VF 2P1DA 2ZTUA 3FKSA 3OY2A 1Z68A 1WVGA 1GA4A 1O6ZA 3OJCA 5JRDS 4M86A 4PC6A 3WZMA 3DQPA 1CEYA 4WINA 5KVQA 4EZEA 1GGMA 2OC9A 1XDWA 5K8VA 4GF5A 4R0VA 3SVTA 2QOEA 3EWAA 1X1TA 2F6RA 2P2ZA 1ULZA 4FZVA 3A6KA 2PLAA 1SUDA 4MMZB 1ISSA 4CGZA 1YBVA 2W22A 3ONNA 5ED4A 1ZUD1 2G63A 5BV7A 1ZESA 5ESDA 8GPBA 2NNWB 4CV2A 4WOCA 1VGQA 5CDHA 1B1CA 4XYLA 5M2QA 5LLTA 3MCTA 4Y1RB 3B9BA 4H7DA 1VJGA 4ZAVA 2O8EA 3IVXA 3LYLA 3RSZA 1T2NA 2W4QA 2NQ8A 2QMUA 3QUCA 3ZDEA 4YRSA 5GVSA 1D6SA 1HG0A 2GZ1A 2H48A 3GGOA 3TZCA 4KRFA 1BE6A 4LDNA 3EZ9A 4DCNA 3M6LA 2P9QA 3JTMA 2OFPA 3IURA 2P6UA 1WTAA 2IPNA 4QBHA 2OECA 3U3MA 4AZ0B 1G9TA 4P3KA 3GLFE 2E87A 2JEOA 4MIEA 1BXGB 3E5MA 5TE9A 1P0PA 3AXTA 3R23A 3TTUA 4PZDA 4E2ZA 1BZYA 3QYJA 1UEIA 4UUQA 4HH0A 4RTLA 3U7GA 2ALJA 3IP1A 3CNLA 3Q5DA 4ZXFA 3PTLA 2DFVA 1DV1A 5SY4A 2RHJA 2VYNA 3F7OA 4UE6A 5D5HA 4ZREA 1J5XA 1U3FA 4C5BA 1GRVA 2D06A 2PS9A 2XGMA 3P45A 3GEGA 3WP1B 4KXNA 4S1WA 2YQZA 1DEHA 3GDHA 1BWSA 1NHWA 1V6CA 3O0TA 4E21A 1RVV1 4ZJUA 2JA2A 1T34A 4WNAA 1JPNA 2PMBA 4BP9A 4PCVA 5SYMA 4CCYB 3TZHA 5ELXA 1XFAA 1LPMA 3CLVA 2CN1A 3GUVA 4I2NA 4DC9A 1W36D 1BXZA 4DLKA 2E9SA 2IXAA 1NT4A 2X4GA 1JHRA 3D5EA 2JEZA 1P0QA 1M33A 2DH6A 4HTFA 4JEIA 4UXJA 2C4UA 3ZE2B 2O2SA 1MAUA 5JCZA 4G1MB 5KJCA 1EGQA 3PCXA 1GZDA 5E9AA 4RWZA 2FQQA 2JRCA 4U39A 4BVGA 1N78A 1YHYA 1FYXA 4U4AA 2FUKA 2PT5A 3PNYA 4PLTA 3UK2A 4AKTA 1V1MB 3FFWA 3VJLA 4ZCTA 2QN9A 1UFKA 1GPLA 2NW6A 3FNHA 4Q3DA 4LJSA 4IHKA 5AQ1A 1WNTA 2CZGA 1XJ0A 3DFIA 2V45A 3E05A 2W6JA 4RHCA 3TZEA 4UTNA 3A4IA 1VPVA 1OB5A 2NTJA 1M2FA 2HK7A 4KQMA 4B7CA 2ZZNA 1DUSA 3PUXA 5K0EA 4J75A 1S6YA 2PPVA 2QR3A 3C8HA 2DHQA 1EWVA 1GNSA 2RGCA 2RGWA 2GF0A 1ZK3A 1LTQA 1M34E 1NXOA 3C3CA 5CLGA 1IMJA 3GYBA 1M10A 5DDIP 3TAHA 3U4GA 1NUUA 4NBNA 1CUGA 1VSVA 1WKVA 4KYIB 1T24A 1LU9A 2FETA 5CT4A 2H57A 4RK4A 1FLAA 1E32A 5TY0A 2XZOA 1T1JA 2J46A 5B1SA 2C96A 2CDNA 4FGSA 1ANKA 1MH9A 1V48A 2BEJA 3DFKA 2BJVA 4LXUA 4XLTA 1A4RA 3IAUA 4MVYA 5AM1A 5HJ7A 1IDOA 2F9MA 5J2UF 2ZSIA 3L93A 4R0NA 1SUCA 1KJJA 1SN7A 1NXQA 2VDJA 3AIKA 4IFTA 4O5AA 1VMKA 3JQ6A 3H8VA 3KTAB 1Q7GA 4PGFA 4TROA 4CFZA 5A7FA 1ADYA 1ZM4A 2FSVC 5EJMA 4Y30A 3O4RA 3IT1A 1TC2A 1KVUA 3LC7O 2Z4RA 4R8RA 4S3MA 3GY0A 1LB1B 4KQWA 2ZB2A 3THXB 5FPSA 1GL9B 1L5KA 3LIIA 4RA6A 2AL7A 1JZTA 4RFSA 4IOLA 2O2CA 1B14A 2CVPA 2IV3A 5JWRA 2XMCA 3G8CA 5F9FA 4L0MA 1UBMS 3OURA 3IAS1 4CM9A 4JI6B 1BFKA 3LUHA 1BX0A 3QUAA 1XDUA 4N47A 1PFKA 1XRJA 2XUDA 3TCKA 5B6PA 5AVTA 2XXAB 3UXEA 2QZSA 1NY5A 1P33A 2P3OA 1D07A 2PA0A 5AI0A 1F8UA 5BV2P 2XNSA 1H4QA 3QFHA 3LK6A 3WYDA 2GUWA 1ISIA 4ZVPA 1JJFA 1MABB 2E0IA 2IGTA 3H04A 4O4HF 3HC7A 2OYSA 3FWPA 1EJ2A 3C7KA 4B7XA 4PV7A 1EUDB 1B8PA 4HWGA 4OQMA 3RYHA 2AG5A 3TVYA 1O97D 2ZAMA 3ZY6A 1TTHA 3O3OB 4RDHA 3R0QA 1M1NA 2ZUSA 1T25A 2WZCA 1BHO1 2I6FA 3D7RA 3DF9A 4XWYA 4TYYA 2F8TA 2LTAA 2FQYA 5DGCA 4AWBA 1W85B 2PRKA 3DO6A 4JLAA 4ESOA 1I5RA 1T5LA 1WR8A 1DKMA 3FD8A 4MR8A 5K20A 3C5CA 3ROKA 1NT2A 1UQTA 5JJIA 2P2YA 4HDRB 1SU7A 4MVJI 4KR6A 1UQUA 1R0XA 4AJ2A 3EC1A 4PXAA 2YWHA 4XLZA 4OKSA 3LP8A 2AE1A 1OTXA 1FLNA 2ZEJA 1WXFA 3HY6A 3IQFA 1KC3A 4EZIA 3OLXA 2D1YA 4PN7A 4EHNA 4PQFA 1C9YA 2DUJA 5DHSA 5KDLA 2NVUB 3HJCA 2L69A 1KO8A 1U5AA 2BELA 1B8NA 3C1OA 3L9XA 1E7QA 5H1YA 5LWHA 1CNFA 1COZA 3HA5A 1UZMA 4BNWA 1AHHA 1QS0B 2FG5A 4ZT5A 1L5LA 3KSRA 5HKOA 1F0KA 1H65A 1B0PA 1Z45A 3QA9A 3H9EO 2J9XB 4AF8A 2GEVA 3DD1A 4WAUA 3CPSA 1T4GA 3A36A 4JL5A 5FI5A 3PQ6A 1WL8A 2QJWA 4X1YA 1GWNA 2WF9A 1R5OA 2J5QA 3CEHA 3QTTA 4Y0NA 3OLQA 4LZPA 3QRWA 4HTFB 2V4UA 2OFXA 1YHZA 1UZUA 2YHIB 1KEZA 4B3BA 3VSEA 1D3AA 4BTLA 1QRRA 2ACKA 1RRMA 3ID6C 4PGHA 4WECA 1TO2E 1WZUA 2A9RA 1FDVA 3LFUA 4XASA 5I5GA 1S2LA 2OO5A 2Q1SA 3CURA 1FZTA 3MCUA 5MGNA 1KH1A 2ZRPA 2IHBA 1GPH1 5BWCA 3T9CA 1KY5A 1HZZA 5TT1A 1TUGA 2XCQA 3AR5A 3LUFA 5FWXB 2PUCA 4MTLA 3GJ0A 4EITA 1LSJA 2PE5A 1L6RA 4QLBA 2E82A 3FHOA 2EERA 1E5XA 1YMQA 3G6WA 2VDKB 1BROA 2Y4NA 3JQ8B 5D51S 4G5RA 3FVRA 4Y2JA 3AMVA 3ASVA 3WRWA 2RK4A 2HXYA 4NNPA 4QUKA 2OBXA 3AM5A 4RMJA 4YRAA 4ZDWA 1SUFA 5G02A 5DBFA 1EFVB 1V96A 2IEIA 2FB9A 1ABBA 1R16A 4IIFA 5JVDF 4MW7A 2CXTA 5AM5A 4CLHA 2O8DB 2QN2A 4BN4A 5JJBA 3G49A 1XZ8A 1GNRA 2QQFA 2X14A 3H9UA 1FNDA 1Z4KA 5C5DA 2HMVA 3E15A 1PZNA 3MPUA 4PYLA 2HOQA 5CNIA 2QRMA 2RKOA 1S9DA 2X4DA 2ZYTX 4DTCA 1R8JA 2CE7A 3A10A 5LQAA 3T3IA 3ME5A 5AM3A 4LF9B 3KSUA 3SPXA 5AVKA 2FDXA 4CQJA 5J47A 1KSFX 1V9SA 4IIBA 3IYLW 4V0SA 3RD5A 2FE4A 4CETA 3ESAA 4HWPA 1ZX1A 4F92B 3ED5A 1EE1A 2QRQA 1F8FA 2HY7A 4GD3Q 4IF4A 4LGCA 3D64A 2WR8A 3CFYA 2AK3A 4Y6PA 2CVZA 3P4YA 1ZK0A 1QDUA 3ET4A 1WXXA 3SHTA 3TDMA 1FLVA 4OAOA 5ARDA 3EDOA 1XZHA 2ZUWA 1L5HB 2I6XA 1GV1A 3IBTA 2VRCD 4HEJA 4K81B 3DHVA 4XGKA 4QRHA 3GN1A 2GN4A 3BKWA 4PLWA 3KOZA 4V0NA 3BE6A 4F5ZA 4KZPA 2P4UA 2VJMA 1W35A 3DXFA 3HXPA 2RC5A 4G0NA 1LCIA 2WUWE 4J7CA 4L9RA 4U5QA 4XZ3A 5HS6A 2XKBA 4CIXA 5H81A 3EOAI 4IMPA 1IG0A 3SXJA 4LHXA 1C7JA 2AYXA 4Y6OA 1YTLA 3AFNA 5IJ0B 3OOJA 3V2UA 1KU6A 3OTHA 2RHDA 4ALNA 3QWIA 1JDSA 3LXMA 1YB1A 1WSDA 2Z30A 1NVTA 1PFYA 4US0R 1OAAA 1SKYE 4TV9B 3DL4A 3D6MA 4DILA 2OEPA 1ZC4A 2IPLA 2C8LA 3BD7A 4PX3A 3T3EA 1OIVA 1FY2A 4PTLA 3EDMA 4B4UA 2ZRGA 2X8WA 3E9CA 4NMMA 2I34A 2WWRA 1ZM9A 2PAFA 2Q0HA 1FC0A 4QQRA 1U31A 2UYYA 1E96A 3OZCA 3QYPA 3T7IA 1H42A 1P1BA 4M0LA 3UAVA 5CLJA 3MMPA 2VSYA 3NHAA 4Z7OB 1RYFA 2EFHB 5IKPA 1VHQA 3MBOA 4HH3C 1QPZA 2BISA 1T6XA 3DZIA 3H11B 4MRMA 2BGGA 3WV4A 4URZR 4EB0A 4EDFA 4WH0A 4MITA 2O57A 3C6KA 2HF8A 4PR3A 5DHQA 2J33A 4QYXA 4Y9UA 2OHFA 1FMTA 5EUQB 3TQFA 2AN5A 4K1XA 3VHXA 4DT1B 2O1EA 3LGSA 4JB2A 4Q9JA 5KTMA 3JVDA 4DRYA 2DX7A 2RGNC 4OP3A 4R16A 4WK2B 3T1NA 1TEZA 2IYUA 4IIHA 3OFSA 1JSZA 4XB6B 3H5WA 3RRJA 2AX3A 4L8YA 4UASA 4F4IA 4R01A 1TKBA 1L7VC 5ALOA 2RHHA 3OCWA 5KX5F 1DSSG 1HGXA 1WU8A 2VPYA 1K5HA 1HLGA 3OU2A 4P82A 4N9QA 1OUMA 2DM6A 3FX2A 2C94A 2ILVA 2FFBA 2R6DA 1OKKA 2QUJA 4WNIA 3FH0A 3MRTA 4MR7A 4LJRA 3E1GA 2WG0A 3E48A 4JH0A 4EW1A 2IEAA 2PKQP 3RLIA 4E32A 1QFJA 5ERGB 3HVRA 5CA1B 3ZXUB 2FW7A 4IV8A 3WA6A 3OTWA 4EYGA 3L02A 3X2SA 1NQAO 4JJ8A 2BH2A 2QUIA 1MX9A 2GLTA 3F5QA 3N6RA 2PJUA 4RGYA 2I03A 1BCRB 4IRXA 1GG2A 2PYZA 2ZJ3A 5ANRB 4EELA 1A4UA 3F49S 4P4SB 4RVUA 3GL9A 1Z6ZA 4R8MA 4Q3AA 3R7BA 2D2FA 3CNQS 2OO7A 4H7IA 4HGNA 5J1TB 1G64A 1V7PC 3BWMA 4P2BA 4F21A 1AKRA 2PG3A 5DM2A 3UWKA 1CJUC 3DBLA 1RBYA 1GPAA 1KS2A 4AZWA 1GZ4A 2EZ4A 4H7JA 2BFDA 5F9HA 2CJYA 2ZITA 1PEKE 2CFRA 5AVOA 2W00A 3KPWA 2ENUA 4JNKA 4IJVA 3EMVA 4O2RA 3U3RA 3WLTA 4UFPA 3RREA 5CA1F 5D7NA 3N8NA 1OGYA 2A9JA 5AKHA 1SU4A 4TYPA 3RS9A 3TBFA 2EJUA 2ZETA 4B5KA 4DL9A 3H6HA 2O20A 5I4IA 4WBSA 1ENZA 1P7YA 2VJLA 2W5UA 3FVTA 3CKYA 1MU0A 1P8AA 1U0SY 2ZCVA 3I37X 1U5CA 3JAWA 1X7WB 3MT8A 4OHPA 4HPWA 4EEKA 5IH7A 5AVJA 1E7SA 1XZLA 1WMEA 2AR0A 1E3TA 2H9YA 3COJA 2Z4SA 1PDVA 1BA2A 2ONZA 3QLVA 3OX2A 2Z5VA 5IM5A 4B6RA 1VG9B 3FBGA 4YRJA 3G2KA 1O7JA 4DEVA 2HA3A 2O8EB 3HM2A 1ZLXA 2HK9A 2QR2A 3CJTA 4DBLE 5LXTF 1KE1A 2JLZA 2GYVA 2Y1GA 1SBCA 1VA4A 1OW3B 1FRFS 2G83A 3SU8A 4BFSA 1TAUA 2NZ8A 4KQHA 3GJ3A 3KV1A 4OB6A 4ZCRA 3O2SB 2OQ2A 3QU4A 1C2YA 1L7EA 5TMEA 1CUXA 2HSEA 5JS8A 4C6TB 4P4UA 3QG1A 3F7MA 4ZDIA 2JVJA 3KAJA 2CLCX 4JIMA 1EK2A 1SZJG 1YQGA 2ZJ8A 4EEZA 1NONA 2Y0PA 4KFSA 5DTQA 4NJEB 1H9CA 4BCBA 4QGFA 2ZTSA 3C87A 2IGBA 2WU0A 3MWKA 1GT6A 2B83A 1YVUA 2RKWA 2FDCA 3ZLVA 3RHZA 9MHTA 1K2WA 1U8YA 3BRQA 1E3WA 3BJEA 2EJTA 3M4NA 5K8LA 2P6MA 3IRVA 1QH1B 4G26A 2QTTA 4A10A 1X13A 2XUFA 3MERA 3QLUA 5TPZA 4LVOA 4ZZIA 1SVMA 4X1KB 3CMMA 4LHYA 4UDYX 5KO2A 2XBLA 5KNDH 3FCAA 3UUEA 4RDIA 3PGXA 2ACVA 1OLUB 3OF2A 3ZVLA 1XO1A 1UDAA 1V95A 1U2SA 3FNGA 5HMLA 2UYGA 2YV5A 4G1FA 2OBFA 1KAEA 4J0IA 2W2KA 4RZHA 5CUQA 1N7JA 1GKKA 3KYJB 4D42A 2JLXA 3MTGA 1CX9B 3N39C 3ZZ0A 2G4LA 4HX5A 3DOIA 2XVAA 3OUTA 2FEXA 3I42A 2R1ZA 3LBFA 4LOIA 721PA 2OR3A 1UOEA 2A94A 4G5GA 2DR0A 3MN1A 3DHNA 4L4XA 2Q5IA 1WCV1 3GN2A 4QLOA 5COQA 4C0LA 4P7FA 3GEPA 2N3ZA 1Y9DA 1KEPA 1KVTA 2A88A 1EGMB 2GZSA 2NT3A 2P4SA 2OHGA 2Q99A 5DYWA 1YZKA 2ABWA 3GGPA 5K0NA 3HCBA 3T1QA 4DT1A 1E3LA 4HXEB 4G01B 4RZSA 5KTSA 3M8KA 4MWCA 5KI6A 1CJMA 1YKSA 4B4VA 5JH7A 5GJBA 1B23P 3IQHX 4FGKA 3W7VA 4JX9A 3X2EA 3FOAA 1YE5A 4KXMA 2NYAA 2K6GA 3U44B 2C7PA 1JEQB 1U81A 3DUWA 4TT3D 3LNTA 4PG7A 3AR7A 3E23A 3GUZA 4JV5B 5TPWA 3V34A 4B6EA 4XQEA 3ER8A 1T8RA 3R0ZA 1XZEA 4JXXA 1UOQA 3Q3VA 1XVAA 3AKEA 3UT6A 3R24A 5M7EA 1KSGA 3CPHA 5HOQA 2UUCB 2VATA 4K87A 4EG3A 1DAOA 4J1TA 1CF9A 1DLJA 3G9QA 2K87A 1IQ0A 3LZ6A 3VI4B 5K0GA 5IULC 1P9LA 1I0ZA 4F7WA 1ADJA 1MUUA 4KGDA 1PJSA 5EQTA 2FKNA 3L7DA 4YUXA 3KIPA 3KUDA 1B8VA 5LM3A 4JLMA 4N0QA 2NUTB 1BAPA 1XVLA 1GL3A 4HLDA 4DCJA 1M34A 1ONBA 2PKCA 4YMGA 4PSAA 2WM3A 2I29A 4ZVVA 4N41A 1T15A 4FFVA 4WESB 3T99A 2FZEA 1XXHE 1Y8QA 2PQ2A 3QNUA 4W1QA 2RKBA 2W2TA 1ZXBA 3EVZA 1E62A 2K5UA 5B1HA 3ZY4A 4D4GA 4DIMA 5H16A 4X1KA 4Q7EA 5ECGC 5EL0A 5HM6A 5FTMA 1AMUA 1ODLA 4CJXA 2WSMA 1KS9A 3K73O 3GT3A 1ZXXA 4RELA 3EA4A 1LC0A 3CHYA 1TAGA 1RYYA 2JFYA 2Y3IA 3ND6A 2R8OA 3BMQB 2AG8A 3OZXA 1U8FO 2WU1A 1Z6YA 2BHSA 1VYHA 4PPNA 2RC6A 4X1IA 3RSGA 3EVEA 3GR6A 1BEZA 3PUIA 4XDZA 3T7RA 3LECA 3PXGA 3KG2A 2ZB8A 3JD2A 2XA1A 2VP9A 4GC5A 3IA7A 3DDHA 5KVVA 1R50A 2JCBA 3OEEA 1O0BA 1E7WA 1NUPA 4KWTA 3HYTA 5IKXA 1L4NA 3M2TA 3RS3A 1RJDA 2D0OB 3AR6A 1Q0TA 2C5SA 4KIGA 4HNVA 3FNRA 4OLHA 1QFSA 3GGJA 3HCWA 3GJQA 1UXJA 1YJAA 1AMNA 2N9UA 5FOTA 1C9DB 1JX6A 2MR6A 2NTVA 2HH9A 3FA2A 3NHKA 4LBWA 5CM9C 2J9ZB 5DWDA 4Q4LA 2AUNA 4BV2A 4UZSA 4FYPA 2PXAA 3HLKA 4UJ3A 4X91A 3NWOA 3G82C 2CNOA 4HVLA 3WQQA 4BGIA 3V97A 2JZOA 1MCZA 5FOUA 4EFNA 3O94A 4GHWA 2WQ7A 1LI4A 5C51B 1CS0B 1T0PA 1TYAE 4NZYA 4PZ0A 5DPMA 5JAQA 5JCJA 4X66B 3RBZA 5LFAA 3OFKA 1Q74A 5CX1B 3EGDA 3F5SA 2MMGA 1N2CE 1R4ZA 2YWXA 1X77A 2YWBA 3FM9A 2NSJA 3FZQA 4I50F 3W3ZB 1KEEB 5JYEA 1SFRA 4WQMA 5JE8A 1VP9A 3K1AB 1MEOA 1BE0A 5C7LO 3QJYA 1KDTA 2RGEA 2Y1DA 4RV4A 5B55A 3R5XA 4GOXA 2O2GA 5HK9A 4HDNA 4AWXA 3V2HA 4BQEA 4XRGA 1WY7A 3QX3A 1TCVA 1I1NA 2IXBA 5E9JA 3VR5H 1W4CA 1X19A 3VKWA 1ZUIA 3AEKB 3UUFA 3G5TA 4JI7B 1DT3A 2B8TA 2BHNA 3FYSA 3PNKA 4NECA 3T4XA 1YQ9A 2AFHB 2AOTB 4FYIA 3PJEA 4BVHA 2FN3A 5BSEA 2PX5A 2A3RA 1R27A 3ZV6A 4N12A 1WP9A 2FPIB 1ZPDA 2V7XA 3GRAA 4IL5A 4XIIA 3IHTA 1JKXA 1OSNA 4AMGA 1TI7A 1MRZA 1Z25A 4NR0A 1RWVA 3OTQA 2P65A 3PC6A 3LLMA 1TKCA 1N3BA 1U7WA 2WLSA 2ZZKA 1F8GA 2H7VA 5CIWA 3ZN2A 2XNHA 1GA6A 2C2KA 1Q22A 3H1EA 3Q3IA 3L1KA 5IZ4A 3H3FA 2AFVA 1FU8A 1XAIA 1JHXA 4IICA 2BVNA 3M1LA 2DFTA 2ZRKA 2C83A 4AM8A 2Y1FA 3OEHA 1AT1A 3AVVA 4DYVA 4S05A 3LHKA 1XTUA 1DOAA 1KYIA 5DXFA 3L8FA 3UXMA 5LWQA 2VHXA 4OCZA 2EW8A 1FDTA 2EWVA 1W6RA 3MRVA 1T8UA 2FVXA 4GXQA 5FORA 3H2KA 1JB1A 2Q4RA 3L7OA 3Q41A 2M1ZA 3CNOA 4GYYA 4OBBA 4J8PA 4D3FA 4L02A 4NJOA 5FOQA 3I64A 2P35A 1W2HA 4MDYA 2ZTLA 4GE3A 1N2XA 1CVRA 4GVPA 2VJAA 3EWSA 5KNBA 3WAGA 3TSAA 4XCXA 2C4TA 4MUNA 1M0TA 1K5PA 3BMCA 3OD1A 1OXTA 3PWTA 1SJ9A 1A98A 4IIJF 4LVCA 1U9JA 3ES9A 4RVFA 2J7KA 3K9HA 1OH7A 3VPGA 4PAOA 4MVJP 1P7ZA 2BBWA 2D8AA 1BNCA 4CMAA 2ZJ5A 3AJ9A 4LAFA 3NHBA 2AI1A 2OVFA 4UCWA 5FNVF 1ZL0A 4B3JA 5C2JB 2WPDA 3AHGA 1P4RA 4AZTA 1JE0A 3GDGA 1XWIA 3D2BA 4NDZA 3RCBA 1UPUA 3V8QA 3UAYA 1H66A 2H07A 3QWAA 3MWGA 4DJAA 2I3BA 4N3GA 1DIOB 2NPFA 2BI4A 4DB4A 2ZXEA 3M3DA 1PR3A 4YI5A 4DA9A 1X1DA 1NLUA 1QE0A 4RZUA 2FW0A 5FUBA 4B3IA 5EZSA 2FSIA 4TS1A 2ODNA 3CM0A 2GESA 1GTRA 2XAAA 3I5MA 3S0JA 1C8LA 1IWOA 5IASA 5MDHA 1JJIA 7AT1A 3WJAA 2LRHA 2AUTA 3JD3A 4RX1A 1P5HA 2WD7A 3M6XA 1DJPA 1JXOA 2XUPA 4ZK6A 4URWR 4Y2RA 5CLFA 4ZYUA 5CXSA 3TWOA 4EAQA 1IBSA 1MB4A 3GT4A 4UCXA 4KDCA 4BB0A 3GA0A 3TAUA 4A5SA 2VYCA 3OKCA 5CPBA 3B3JA 3GLHA 4BVKA 2ZIXB 3ISVA 3EQ2A 2OA0A 1E2IA 1D6NA 3O3CA 4H4EA 1H6AA 5B5SA 3WXBA 3IP9A 4U0JA 5DVZA 2F43B 5H3HA 2D2VA 4LQLA 4KWIA 2FWNA 3JAKA 4K88A 1WA5A 1DKPA 2JJYA 4LE1A 3UC5A 2BM9A 4B34A 5BQOA 2I8AA 4AD8A 4F9FA 1U1DA 1VOTA 1SVLA 2VSXA 3LQYA 4D79A 2SKEA 3UAGA 6CHYA 3V4SA 4FHZA 2SNIE 5C35A 4LBYA 4GVLA 3TLGA 3ZXYA 5FCDA 1DRUA 2W93A 4JASB 4EK9A 1TNDA 1FK8A 1G6KA 3AK4A 3RHFA 4JSRA 3VISA 4KXWA 1NUAA 5A04A 3CLKA 2NU7A 2JK1A 3VC3A 2BV3A 1FA9A 1RE0A 4P8RA 3T3DA 2QS9A 4YT8A 4X8OA 4H1VA 2J3HA 2MYPA 2PKQO 3V4OA 1SD2A 2PSHA 2REOA 2SICE 1U3TA 4NEQA 2BSXA 2WF8A 1WJGA 1ESEA 1YXMA 2ONKA 2O2EA 3W8DA 4C76A 4CTJA 4EY8A 2VEDA 1Z0AA 4FOOA 3K0HA 4B2YA 2CJPA 3H1GA 2ILTA 4EFKA 2CNWA 1FFCA 1U0TA 1Q20A 2GCEA 1QWOA 1ZNZA 2NTNA 2JC3A 1ISFA 2QPOA 2VSQA 4Z8XA 4JROA 4ZTZB 3P9SA 4XSVA 1MC8A 1E1DA 3LI2A 4GQAA 4NRDA 4NYIR 1F9AA 3SVZA 5C8DA 1XTTA 3FAKA 1AB5A 3ZWPA 5DTRA 1RJWA 4LHZA 3CO0S 3PTAA 2E5LB 1ZVJA 2VAMA 4MUBA 1UXKA 2ADMA 4EUKA 4Z3DA 5CCEA 3KQHA 1QK5A 3FMVA 1OCEA 3PGVA 4HAOA 1DQZA 1GOTA 2W2MA 4Q7KA 3U3JA 5KB3A 4YMLA 2FE1A 3B6ZA 1NVWQ 1BOFA 2NV0A 5IUNC 3RG2A 2UZ3A 2FSFA 3RT7A 4K7JA 1YJCA 4PNEA 4U9IS 4CUZA 2HMUA 4O2BB 3WSTA 2JRLA 2C2XA 2DVMA 3OZVA 5DM4A 1D4ZA 4DXHA 4F4UA 4JJKA 1ULHA 4O4JF 3KVOA 5FPTA 2G8LA 3VPSA 4IXWA 4X3CA 1I6MA 1BMQA 1IULA 5HX7A 2GZ2A 1XGKA 4G36A 5FL7A 2BR5A 4ZCIA 1CSEE 4FONA 2NZJA 4MPJA 1K8YB 4JXJA 3RAJA 4JX8A 4AF6A 4ZICA 2AV6A 2FN9A 2WZDA 1V8DA 1HFWA 1RJGA 2ISCA 3CZCA 2WMOB 1N5OX 3QZUA 3JZDA 3ZIAA 4DVJA 4F93B 1SOWA 1YUBA 5LNK6 3FIJA 4DLLA 5JI2E 5JNWA 5LZ7A 4DCSA 2WABA 1IUOA 2V74B 3FRHA 2W2XA 4X00A 4C22A 5BMVA 4L72A 3AL2A 5E9WA 4MW6A 3ABIA 5K8IA 1GILA 5BUQA 1GNVA 1RM0A 2O2XA 3AR3A 4TPKA 2CLMB 3H87A 5BYJA 4E08A 1Y3DE 4G5FA 4DV2B 2JDIA 4KN5A 5ERYA 4KQGA 3RI3A 1Q21A 1LA2A 1NTOA 4DV5B 4TYWA 1A9SA 3O75A 3ZU3A 3L06A 1VGRA 4K26A 3GXOA 3R7WA 1R4MB 4Z86A 4CWAA 2XCSB 2VDWA 1P72A 4Q15A 4MVWA 1AZSC 1WF6A 3ZG6A 1GYRA 3OEWA 4D46A 4RTMA 4NHOA 3MRXA 3LLCA 3EAQA 5CVEA 3RW9A 3ZS8A 4RPGA 2C7VA 2VSOA 3Q2OA 2PRJA 3L46A 2QYTA 1QG6A 1L7BA 5ICGA 2YMLA 3I6QA 2A4MA 4PF1A 3BD8A 4FDTA 3U3KA 3GARA 1Y4DE 2R48A 3RR2A 1J6UA 1O54A 1MT0A 2WUDA 4BZQA 1QQBA 3QPWA 3RSQA 2Q6TA 1S3GA 1PR4A 1K6XA 1NXTA 2VA9A 5CBPB 4X5OA 3PCTA 3V4FA 4XM0A 1AB6A 3HYRA 3BTUA 4W6QA 3ZI4A 5AUOB 1Q7EA 1WUJS 4C0AC 1L8XA 4EL5A 1VXOA 3JY6A 1A77A 5IEJA 4PYRA 5CFNA 1ZCFA 5L3SB 5DNCA 2O4UX 3WMEA 2YZKA 3DMYA 4ND3A 1CDOA 3MBKA 2H59A 1WCXA 2XH8A 3SI7A 1N6OA 3VDQA 4AY2A 1BSVA 3FZEA 4UNQA 4ZQHA 3EGOA 4IYJA 1PEAA 4DC1A 2H63A 3OCZA 2YICA 3GJTA 1S3SA 3ZWMA 4CKWA 4US2R 4R8KA 1EFHA 5J4VA 4LWQA 1Z0IA 3QIVA 2QHXA 1Y3BE 4JP2A 4BNIA 2PYDA 4M9XA 2QLNA 3AVPA 3ED1A 3MMSA 4YEDA 5ALPA 2YJNA 1X74A 2C4KA 3Q12A 1ZN2A 2Z5FA 4ZI5A 2QPLA 1ZGBA 2ZYAA 2AFHE 4D81A 5AVXA 3PT5A 4GIBA 3QITA 3QPBA 5ALLA 3EC7A 1XTVA 5K2OA 4B1FA 2RIPA 3EDCA 3U0VA 1ZO8A 1ZISA 5AQEA 4EKIA 1S2IA 2R25B 4L76A 1PX2A 4BE9A 1I2ZA 2B1RA 1ZN8A 1VLVA 3QFSA 4PHFA 3ZH9B 4B3DA 1H3EA 2O7SA 1KQ3A 1JZSA 4I9UA 1OYYA 4NBSA 5E1OA 2JAQA 3VZSA 4B0PA 2ZJ4A 3DTVD 2KPOA 3IKJA 4PRLA 2JEYA 1NKSA 3V1UA 5DIZA 3WICA 3OOYA 3PHBE 4GMKA 1PJ4A 1KO4A 1SWWA 3UICA 4EG7A 1PSWA 2HJWA 2VJDA 3UJHA 1O6GA 1QE5A 1UT8A 3S27A 2QNIA 2G1JA 3NAQA 1JIQA 3MQ4A 3GP3A 3C24A 3ZWXA 1QR2A 4N5LA 2RCNA 3MAGA 4H7PA 3WXMA 5KMGB 3DR5A 1XMPA 4BNNA 5JEEA 1GDTA 4A15A 3ZLUA 4F2WA 2I6QA 2NO6A 5BXYA 3FB4A 3WJ7A 4GSKA 4L3VA 4YDSA 5L40A 3HWRA 4FUTA 5TXGA 3W5VA 4B5LA 5FEUA 3ITEA 5AW0A 2DF8A 5KDOA 4B8ZA 4F3KA 3KQOA 1C4KA 1QHHB 2YW2A 1ZVQA 3JZFA 1LWNA 2C9ZA 1JDBC 3DONA 2OGWA 3VMFA 3A70A 4KUHA 3WRYC 1QKJA 4K3UA 4OLFA 1UXOA 3IAS6 1MAAA 3CUUA 3HCEA 1AUPA 2HKIA 2KQUA 3DLCA 2Q50A 2QRGA 2FPUA 3HDGA 2FEKA 3QVUA 1AQJA 2ZBDA 2C20A 2I87A 4X20A 4QSHA 2JLBA 3RYFA 4B4KA 1JEYB 2OCLA 1L4MA 5I47A 1RJEA 1Y7TA 2JAWA 2VO1A 3FR7A 3O73A 2YS6A 5IZCC 3E84A 1K1EA 1NVEA 3TZBA 4NPAA 2F9FA 2XTNA 2ZWPA 1ZN7A 4TWRA 4IDHA 3KKKA 4IJMA 5TQ0B 1PR1A 3SIRA 4KQ6A 4CR7A 2XKAA 1Z6TA 1Y4UA 3JQFC 4MX8A 2WYWA 1Z3IX 1PZEA 1VA5A 2IK8A 2Y9MB 3RFUA 4N48A 4KN9S 3BXHA 4QQFA 4RKRA 3O1JC 3Q6MA 4GVXA 5CYPA 1X7XA 2ZI9A 3T0IA 3M3PA 5AVQA 3L0IB 4QU8A 1S01A 4LYDA 1F20A 2HA5A 2H9AA 1PQPA 1KORA 1BCSA 3HYCA 4JLPA 4L5BA 2IX9A 4RY0A 5DTEA 1RT9A 3LPCA 1SKAA 1YS1X 2J3MA 1PGJA 2HX1A 1HZJA 2A67A 1HYHA 1ODFA 1N92A 1Y1LA 1Z0JA 4TTAA 1P2BA 2QB5A 2JIQA 1QIDA 1RLIA 4Q34A 1RP7A 3GP8A 4JJGA 4U7FA 5P21A 4NYMQ 3Q9UA 2OV4A 2ZYWX 3IT2A 3TBKA 1OFUA 4CM5A 4IS3A 4D9IA 5C4IA 2XZLA 1Y9AA 4WJKB 5TQ2B 3W6UA 1E69A 4QFDA 4UHKA 4YCDA 3KDAA 2CLLB 1R6VA