1MOQA

Isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
366
structure length
366
Chain Sequence
GDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGQVDLSELGPNADELLSKVEHIQILACGTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGLRLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKLSRLKGLDASIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYPIALEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRARGGQLYVFADQDAGFVSSDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQPRNLAKSVTVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSAMINE 6-PHOSPHATE SYNTHASE
publication title Involvement of the C terminus in intramolecular nitrogen channeling in glucosamine 6-phosphate synthase: evidence from a 1.6 A crystal structure of the isomerase domain.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Glutamine amidotransferase
total genus 141
structure length 366
sequence length 366
ec nomenclature ec 2.6.1.16: Glutamine--fructose-6-phosphate transaminase (isomerizing).
pdb deposition date 1997-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1moqA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1moqA02
1VI5A 4LF8B 5LMNB 1HNXB 1GZDA 3QKIA 2UXCB 1G98A 5LMUB 1N34B 4JI8B 1NUHA 3CVJA 2UUAB 4JI7B 3JX9A 4JI5B 2CXQA 2PUTA 4JI1B 2AMLA 5FLXA 1T10A 3T1HB 5BY2A 2UU9B 4B3TB 4JYAB 4DR4B 2HHHB 1C7QA 1XNQB 2CXOA 3UJHA 4DV7B 1IRIA 2VQFB 2DECA 3G68A 1NRIA 3ODPA 3ETNA 4B3SB 4LF5B 4DUYB 4AMVA 4DV2B 1J5EB 2A3NA 4LF9B 1X94A 3LJKA 2E5LB 1HM5A 2V4MA 3J81A 1VI6A 2PUVA 4JI2B 4DR3B 3HBAA 4DR6B 5IWAB 4DV5B 2UXDB 4YHHB 4OX9B 1U0FA 4GKJB 2VF4X 3IFSA 2CXNA 1VIVA 3HJBA 4M0DA 3Q7IA 2CXRA 2PGIA 4GKKB 4LF4B 4DV4B 4DV0B 3T1YB 1XMOB 1IBMB 1JXAA 2CXTA 2O2DA 1MOSA 3BCHA 1XTBA 4TOIA 2CXUA 1JLHA 3KNZA 2CXSA 1M3SA 3OOJA 4DR2B 4X66B 5I01A 2I22A 2PUWA 5IT9A 4DV6B 1N32B 2UUCB 2E5FA 3FF1A 3FXAA 4X62B 1FJGB 4LZJA 4JI6B 4S12A 1ZZGA 2I2WA 1X92A 3BJZA 4JI4B 4LF6B 4S1WA 3M5PA 2VQEB 2UUBB 4JI3B 4NXMB 2CB0A 1N33B 1B0ZA 1IATA 1JIQA 2ZJ4A 4DUZB 2CVPA 3J7AC 4YY3B 1XNRB 4DV1B 4B3RB 5A2QA 4KHPB 2VF5X 4DR5B 4LFBB 4IVNA 1MORA 2Q8NA 1TZBA 1JEOA 1U0GA 1GZVA 2ZJ3A 4DR7B 1HNWB 1HOXA 3C3JA 2XHZA 2F4VB 1WIWA 2POCA 1HNZB 4JV5B 4AQYB 2WU8A 3EUAA 4NXNB 1IBKB 1TK9A 4X65B 1N36B 1IBLB 4U6NA 3Q88A 2O2CA 1VIMA 1J5XA 2DF8A 2XBLA 2J6HA 3PR3A 3FJ1A 3TBFA 3OTOB 4LFCB 4LF7B 1N8TA 1DQRA 4B3MB 3JAMA 5BR8B 3FKJA 1Q50A 4LFAB 1MOQA 5LL6P 3J80A 4X64B 4EM6A 2ZM6B 3SHOA 1X9HA 2CXPA 1U0EA 1KOJA 1HR0B 4K0KB 3I0ZA 1X9IA 1I94B 3NBUA 2YVAA 1TZCA 1C7RA 3TRJA 4DV3B 1XMQB 4JI0B 4DR1B 2UXBB 2X3YA
chains in the Genus database with same CATH superfamily
1A8SA 4D0SA 1JKFA 4Q3OA 3V4FA 1XCJA 2O2ZA 2OP1A 1TCCA 3OFJA 4WNCA 1IH8A 3DZDA 2QMEA 1YR6A 2Q28A 1XD2A 3EMDA 1YR9A 1ORVA 1TK2A 1CJKC 3C7DB 1K4KA 2YXEA 5EHZA 4ND2A 1Z6ZA 4INZA 5I7RA 2ZR0A 2CLEB 1BA3A 2D8AA 3IIIA 3UHAA 3CO5A 1PNQA 1R0XA 1RBYA 1OFUX 2OAP1 2G4LA 3A11A 4G5RA 1P2TA 1Z0UA 5D2CA 4B3SB 1TM2A 2YOGA 4KN8A 1T4MA 3HWSA 1MRZA 3A3YA 4DA0A 1GKKA 1WB4A 4WZAB 4LBZA 1HLDA 4MVJA 4LF5B 1JHYA 2FPIA 2HJGA 3UJ7A 1C8LA 1ST3A 3HMKA 4FR0A 4X85A 4O63O 1CFJA 3ZDQA 4PYJA 5KYYA 2UZIR 3VAYA 3OE7A 3E81A 4Q4HA 1BW9A 1JIUA 2NZ2A 3HKBA 1L3BA 3TECE 4HQNA 1X7GA 4MPDA 1LPPA 1JHDA 5LYYA 4CDMA 1KO7A 1USKA 2HDHA 5KNCH 1PTJA 3I01A 1BQ4A 1G64A 3IPLA 5JMPA 4CM5A 1H9AA 1F12A 2G70A 4CVNA 3QF4A 2ZTSA 4BMSA 2ZS9A 3K0KA 1N6KA 2OMEA 4WY5A 1ICIA 3LCCA 3O5AA 2LE0A 3KB8A 3HO8A 4DDKA 1KPHA 3O4VA 3ZW9A 4CM6A 1O2DA 3FTNA 4I4TA 4CQMA 1MPTA 3UJ3X 3N6VA 2VAXA 1YVEI 4Y9SA 2X0JA 3UGJA 2AJBA 2F55A 1QYIA 1ADBA 4M7RA 3VKWA 5JSZB 3HJNA 3D7RA 1UFKA 3BRCA 1WUTA 3RIHA 2FRVA 1MQSA 1KYXA 3WADA 3ZKWA 4NNPA 4OJNA 2PZFA 3BJZA 3QYPA 4D99A 1N2OA 2A5LA 2QJRA 5D7NA 1C9JA 1DIOB 2JRLA 2XD9A 4H4DA 3G82C 1QG6A 3JQ8A 3FW1A 3K30A 1Y6QA 1XQYA 1E6EA 5TNXA 3RADC 2FP4A 1I7PA 4O2AF 2AZDA 2ZR7A 4RETA 4MPRA 3V1NA 4QT4A 4N0MA 5A03A 2C7VA 1SC4A 1MEEA 3BH0A 4CGZA 5TQJA 3KKQA 5CAEB 2V65A 3KAKA 4D3SA 1GAWA 5E1MA 3MC1A 3RFCA 5JAMA 1H05A 1TVKA 4DWWA 4P3OA 3E9ZA 2PJRA 1ADGA 3ORRA 5CVJA 3BFXA 4CLRB 4DQKA 4UTPA 5CLLA 1LEHA 3O03A 5DM2A 3UHFA 5PNTA 4FI3F 4DWVA 3MVEA 4F21A 1VGQA 2VJBA 2LZ0A 3TUJC 1C2YA 5CTAA 2C5GA 5JNSA 2LIVA 3X1KA 2ZTLA 3VOTA 4EPTA 1EFKA 4KIWA 1F51E 2Z08A 3ZE7A 4MUNA 1MOQA 4MULA 5EIEA 2C97A 4RDIA 2JEYA 5EC8A 3FSGA 1U6IA 1AQIA 2HK9A 1C9YA 2GASA 3GNQA 4KUHA 1JFFA 5FCDA 3VR5D 4P5PA 3PTAA 4GE3A 2G40A 1C7ZA 4ARVA 4BDTA 3QLTA 2XGJA 4EI2A 5FTKA 3K16A 5LQSA 3T5MA 4RCZA 1RJ9B 2B30A 2VVTA 1TX4B 3R7SA 3U81A 2IXEA 2OGWA 2WUGA 4XLLA 5AHXA 3ILHA 2J3QA 2QA5A 5EZQA 2QUBA 1SOAA 4IDAA 5IBCA 4D25A 1TM7E 4GPBA 1NAHA 3ZD9A 1LX7A 3DFMA 4JI1B 4O4HA 1DDGA 1KDRA 3UHOA 1V16B 4CQLB 3K4HA 1R00A 3HDGA 1U3TA 5PGMA 4ZGGA 5DNCA 5IAOA 3CEMA 1YCHA 1ISRA 4L5JA 4EHKA 1HT0A 3CLHA 5IVIA 1UXIA 3NATA 3OKPA 1E1CB 4Q1VA 3RHFA 3AI2A 2B98A 3EC1A 3GJ0A 2PKCA 5CM8B 2YWCA 3DW1X 4QT0A 1ZM7A 3VMMA 2PJZA 2NSHA 2GPWA 2B1JA 3B1KA 1G8YA 4IGIA 3A7DA 4KX5A 4ZRMA 2Y1KA 1KMCA 3UWKA 2QUZA 5J4VA 3UV6A 1DNPA 1KC3A 4N7RA 4IHJF 1F2TB 1KZ7B 3KLMX 1EVIA 1Q7EA 4PXYA 1AHNA 4HQFA 4CG1A 2PS1A 2HIAA 3NBMA 4Q21A 1Q1AA 4O2AB 2FSIA 3D4OA 4QYTA 1CUSA 3WHKA 4DVGA 3HC7A 2QTTA 2GQ0A 2VXOA 3EMBA 4U6SA 2A5DA 1Z4NA 2GZ3A 3DZGA 1JDSA 5CXSA 1WDMA 4LE0A 2HTFA 5HK8A 4P5EA 1GG2A 2APJA 3KEFA 1BGXT 4M86A 5MN4A 1KP2A 1TT5B 4P4GA 2C7BA 4BGUA 3KIPA 4JFRA 4CQJA 1EM8B 1ZONA 2QTVB 5IP5A 3VSCA 4AP9A 1LPOA 5CEEA 1UBJS 2ZM5A 4LHWA 1VLLA 4MVJG 2WVAA 2ZR9A 1A77A 3SS9X 3MWFA 4I1UA 3P97A 4LISA 5I7AA 5C0OE 1NF8A 5E4YA 4M4SA 3U40A 2F8TA 3TRFA 1IZZA 3R6DA 1AV7A 1XCGB 1L7PA 1WSAA 2HSDA 1CUDA 1L5RA 1LS1A 2YZNA 3A1DA 5LUBA 1EWTA 1EE1A 1C3EA 2ZJ2A 4TKLA 2FFQA 5LNK6 5H9VA 2RHRA 4LFBB 2XMSA 1Z25A 4IX1A 3GG2A 1C1YA 1MTOA 1PV1A 5JANA 3MJSA 3FJYA 4UHJA 1S4QA 4OGFA 5EXDA 5TPZA 4P7FA 3LW8A 4FX2A 4UZFA 3TW4A 3TVYA 1KXJA 4WESB 5FA5A 5KDDA 2XZLA 5HTOA 3GZNA 2EKDA 5DIZA 4ER7A 4GX2A 5A05A 2I71A 2WTXA 1AXEA 2WWRA 3G8YA 4OO3A 4CL0A 5FUXA 3RJMA 4BC0A 4RA9B 1F6WA 1ZZEA 3WBBA 1RLIA 1W30A 3TLBA 4YJHB 2EYQA 2RHTA 2A7XA 2XW6A 1M2NA 2FU5C 5JAHA 1Q3TA 1T43A 3KZNA 1K97A 4BLPA 1HPLA 4B2IA 4AJEA 1SUPA 2MINA 4M9ZA 1KVUA 4KI7A 1GZHB 3IKMB 1C14A 3FPJA 1YBVA 2HSEA 3OA0A 4JEIA 1JL3A 3DYVA 4MUIA 1QYRA 5LZ5A 4EHDA 4TYMA 3CNHA 4JCOA 2AW3A 3MWDA 4YALA 2YOHA 3GJRA 4BLTA 5AVYA 4HLUA 2Z1NA 1CEEA 3ABSB 1F5SA 3QE3A 4I1YA 4QOGA 4PW0A 2CK3A 2GK7A 3WLRA 1EFPA 1HMYA 2F1KA 3C2QA 3GZTB 4QYWA 1VE7A 5K3EA 1QP8A 4P0QB 4PX9A 1R4AA 3AXTA 3IKJA 4OQFA 2NQ8A 1YFJA 2PGJA 3FWPA 5JT1A 1AK1A 3TTWA 3IDSA 1QYVA 3IBSA 1RYDA 5HOEA 5HUJA 3MAAC 1BWRA 2DHCA 5L51A 1NW3A 2QEQA 2JGIA 2CXOA 3B13B 5L4NA 2NO6A 5CVCA 2C3MA 2J6IA 2VATA 3O0TA 5J59A 3ZHOA 5IVHA 2IODA 1XVVA 2XRZA 2H7CA 1WUYA 3H7IA 2D3TA 7ABPA 4Z4CA 5DXAA 1DCFA 3F7MA 2L42A 2ZTVA 1X94A 1J97A 1P2UA 3PQFA 5HMMA 4EGJA 4AY5A 2ZUCA 2QBYA 1YSCA 4TWZA 4DDHA 1CE8A 5EXPA 1O9BA 1RWWA 3ZE1B 4CDRA 2PSSA 1JQBA 5E9JA 4OHPA 2NT3A 4EO9A 1VSQA 1I1OA 3EGOA 4GDMA 3ZHXA 3N8KA 3D31A 4LAFA 5AVZA 5MHTA 2XI4A 4IGEA 3T8YA 5J2TA 1LZLA 3HRHA 3P45A 4JP1A 4NH4A 4MV1A 4NG4A 2XOEA 4MB0A 1VL0A 3NWOA 2Z2JA 4Y2VA 3RJZA 4F46A 3ZK7A 2JK1A 5B55A 4YV2A 4BPBA 1EJ6A 2XYHA 1EUDA 1YQDA 3GH1A 1A50B 3H83A 2O3UA 4NE2A 4UVHA 1PO7A 3WHPA 1SQFA 2P69A 3ZNNA 4LZJA 1UIRA 2VHYA 2XOKD 5KPJA 4JKYA 4EBBA 5DHQA 5B3JA 2AOXA 2V97A 4H9GA 5L6MB 2XTNA 1JQDA 1QONA 2Q5FA 3OLCX 3KQNA 2HHLA 1KMQA 2X77A 4CTMA 2HU2A 2AZMA 1KZHA 5D1HA 4G0OA 2PUGA 2NN3C 1V7QA 3SPXA 1CUUA 1PFVA 3LZDA 4MGIR 3N2YA 5CNJA 4F4CA 2WWIA 3I5MA 4Y2HA 4PCVA 5CM9C 4H1WA 1GQOA 5HOQA 2JEZA 2IUUA 1DTWA 1T0IA 1SXJB 2ZBEA 3BB4A 3NFYA 3NT2A 5AKKA 1SKYE 4UTNA 5LQKA 4LPKA 3OOEA 3IR5A 5BYAA 4KKXB 4YUAA 2QMYA 3RVRA 3QV2A 1G0NA 3T4UA 5ICGA 4WOCA 3M6AA 2QAGA 3K2IA 3KUXA 2IOQA 3N8DA 4LXHA 3VR5H 5AUNB 4D8UA 5KTKA 4RZUA 1YRAA 3UUFA 2RC6A 3FUCA 1V43A 3TLJA 3PYXA 4LZWA 4KUEA 4QODA 1AB5A 3PDWA 4PYRA 4HGQA 1IONA 4V3BA 1NTOA 2OCLA 3IP9A 2AX3A 4BB6A 3IHTA 2HEIA 4IO1A 1QRUA 1XFAA 2BKEA 2HAEA 2C61A 3R3JA 5CLJA 5CDTA 2BE9A 2BEVA 2I3ZA 3HB7A 2F3QA 4ZVPA 2WJ4A 4OX9Y 3MN1A 1W0CA 2PH3A 3ESZA 1HDZA 4Q1DA 1QYDA 1T91A 2DSTA 3N3BC 1B8PA 1GP2A 1L8XA 3FE2A 1PT8A 5E9QA 4CCYB 3KB6A 2V3VA 4CNBA 4WUVA 1GQRA 5IASA 2RONA 3EDOA 4ZOQI 1WUKS 5F1KA 4C1BA 2D0PB 4WVFA 1M1NB 4CM4B 3IDZA 3J7TA 4MTCA 4RMJA 2G1PA 5JTUA 2DGDA 4I4CA 3R3UA 4BMYA 3GUHA 4AN0A 1LBTA 2CFIA 3KKZA 2JAWA 1O77A 1PRYA 4JLUA 5CW1A 4MP8A 1NUHA 5FT9A 4B34A 5P8WA 3B89A 2E3JA 4QFCA 1GCOA 5DTMA 4BQOA 5J4HA 5MFPA 2P4UA 4BWYA 1H1LB 4FDLA 2M32A 4WNAB 2WPNA 3OQ1A 4TMFA 4IDFA 4BMXA 5KVSA 5EP1A 4WZAA 1Q14A 3CVXA 2RI6A 3TJRA 1WXIA 2G5GX 1LFAA 1XZMA 1XJ5A 3RUAA 3I04A 3QHPA 4YI3A 3VDNB 2P91A 5H70A 4A73A 1T1SA 5F5NA 3P52A 4YQZA 1SIOA 3NDPA 4UBLA 2C9ZA 2HXGA 4P84A 3HZHA 4QBHA 4JMPA 3LU1A 4R68A 2COKA 3HCFA 4OP3A 4URXR 1KARA 2RAFA 1XN4A 1DIAA 2X4DA 5DOVA 3S1SA 5F64A 1RTTA 3D5EA 3GROA 3PHGA 1E94E 1POXA 4NBLA 5SY6A 1SXIA 4JSTA 4DIDA 1N5IA 2GWHA 1P2DA 3FNIA 1A3CA 1MA3A 3K0CC 4ZDWA 1DINA 4D41A 1P5RA 4KQ2A 5IXJA 1XMIA 2X41A 4I2NA 1XD9A 1RQXA 5TMDA 5JDIC 4FIDA 2YXNA 3AR6A 1I6LA 1Z5VA 4YDSA 4C3ZA 4ZO8A 1YQTA 2DM6A 5JSZA 4NLLA 4S1TA 3P9XA 1NBAA 1DADA 2JIMA 4C0SA 1L6IA 5JROA 1S2LA 1NLFA 3G2PA 1RQLA 5G0SA 2GJKA 3QEKA 1H6CA 1I3CA 4KG7A 3KBBA 1QKJA 3QITA 1PJ2A 2BDEA 3QX9A 3HCPA 3Q40A 3T3MB 1F7VA 1HORA 1X7HA 3B1XA 3QVXA 3RQIA 1WO8A 2JGDB 4TVKA 2OSVA 3RUDA 3T38A 3ZG6A 3QIAA 3EVCA 5AJYA 4UM7A 3NORA 2IH2A 2VIIA 3VR4D 4F04A 3HB1A 3ZQJA 4NABA 1RQPA 1E1RA 2V0NA 2HJWA 2XWPA 5DI3B 5BN5B 3STUA 1JNXX 5CAEA 1QQ7A 2JAXA 1YDHA 1ISIA 1F8GA 1C3LA 3C85A 1UJ2A 3PC7A 4RSGA 4XJVA 1O3YA 3A1WA 1XCPA 3B2NA 2QUJA 1UANA 4IO0A 3BIJA 1OX4B 3GFTA 1ZJYA 5AO9A 3PEFA 1YK0A 1Y1SA 2HADA 4QQ8A 4CLRA 3HHEA 4BMNA 4XQEA 3IR7A 1RXCA 1R5NA 1T1JA 4KPYA 4Q93A 1TADA 1YU6A 4F5EA 3I52A 1Y5NA 2RGWA 3SMVA 2DUJA 3WS7A 4EPYA 4C2TA 3IAEA 2OBBA 4UUAA 5DYNA 1YJAA 3DWGA 1AS2A 1QCZA 2H00A 2XRFA 2M6KA 3I0NA 3FTQA 1G8PA 4ARZA 5HYVA 2AW5A 2VOEA 1V4BA 4KKVA 1F8YA 4L5YA 3A1UA 5AK3A 3KSAC 1NY5A 2GERA 4HD8A 4L6AA 3HV2A 2VTVA 3OQJA 5BWLA 2DULA 4R8MA 3ZWKA 2WKRA 1W8DA 1JE1A 1Q50A 1RJ9A 4P3KA 2WE7A 1BXZA 5CLQA 2QG9A 1Q0ZA 1WMBA 4IOJA 2ZUEA 1HFWA 1RYFA 1IPEA 2JFPA 4KPGA 1D4ZA 4GKAA 5DEIA 3WIVA 3JQQA 1E5XA 1TA4A 4QYXA 1R64A 1XRRA 1SUSA 2VSQA 1GUDA 4FQ5A 4PPQA 1GGFA 3C8ZA 3GGJA 1V16A 4BU0A 5JO0A 1AT1A 1S8OA 2XOXA 2YZGA 4BX3A 2B20A 4NEQA 4BE7B 2G7ZA 2CMDA 3L84A 2DTDA 4FLEA 4KFRA 3PRJA 1FP2A 1E1CA 5G40A 4EJFA 4S1PA 4NMMA 2GAOA 1LK5A 4JR1A 1P75A 3TUZC 4DV7B 4BUCA 4B3DA 4EKEA 4X6YA 3PIRA 2WM8A 5JZMA 3AY6A 1KFEB 1NA5A 1RKVA 3DPIA 4IXMA 5K4AA 4UHFA 1EUCB 2C4WA 3TLXA 3NAZA 5JLAA 3A31A 3AKDA 3HKCB 3USES 3GLGE 4B4VA 4EYKA 1VI6A 2RBEA 4ENRA 2WVGA 4LBWA 4QBFA 2F9LA 4NYIR 3PFCA 3RGGA 4DPMA 4ZI2A 1MJ5A 4PNPA 3AL3A 4YHHB 3GEDA 3I5XA 1IMOA 3VNAA 1S2MA 3ZBUA 5HFNA 1V9SA 4RZQA 4ZK2A 4YTEA 3ONFA 3BL6A 2VDMB 2VP4A 1U0LA 3RRXA 3PZRA 1DARA 1G9SA 1Z4IA 2KYRA 4NOKA 3W6NA 1P74A 1TT5A 1GSOA 3OTHA 3ISJA 1WSWA 2ZANA 3RD5A 4PRZA 2R6GA 1BHSA 1T25A 3L4BA 3MUOA 1G21E 5ALXA 3VHXB 1EM8A 2QTVA 3GPDG 3OQPA 4MUHA 4N5LA 1OH6A 3DMPA 5DK6A 5E1BA 2FKAA 1IY8A 1E7MA 1SVMA 3ZHUA 3QY9A 1V39A 2XNKA 5ECDA 3A14A 2UZAA 2HA0A 5U4XA 1G2PA 2HLDA 1VKRA 1QUFA 4M37A 5FXMA 2Q41A 3H1TA 5JNVA 2X9NA 3HGTA 2UZ1A 4GPAA 1KQPA 1J90A 3EGCA 3G0IA 2VQSA 4OJQA 4PC3A 3AL0C 5ALDA 1D1TA 4QNNA 2H1RA 1U8FO 4MHOA 4RJIA 1PU2A 2R1VB 3T3IA 3J7AC 2GJ9A 4YN3A 2QLNA 1E9DA 2BEUB 4J0CA 1WPXA 3AR2A 2M1XA 2PS0A 3FPEA 1JALA 2HMVA 1R6UA 4Z9BA 4KQEA 3ED5A 3WGOA 4KTVE 5BWBA 2FH5B 3EG5A 5CGZA 1WMEA 3IAUA 2OYSA 4WLVA 3AUAA 1QB8A 1Z7EA 5DZSA 4XSGA 3UMRA 3U4QB 4UUBA 4YDRA 2GSWA 3DO5A 4RA9A 4O2BF 4CODB 5JG7A 5GADl 4BNKA 3ER8A 1JDTA 4O33A 4YJHA 2QS9A 2WOJA 1N7IA 1JDUA 4BNTA 2E82A 1HNZB 3EMVA 4EA7A 2OFFA 4V39A 2E48A 3SQOA 4F6RB 1U3WA 3A6EA 3GPIA 2F62A 2HWXA 1UBMS 3TW0A 4BO9A 3RVQA 4TL7A 3U3KA 3CZ4A 1LTKA 1UJMA 4HYYA 3IURA 2VZEA 2BGLA 2ZDQA 2DFTA 3DBRB 3VO1A 1T26A 1FXSA 3A27A 4C0KA 4DHEA 4QARA 4N9QA 1W5BA 5L4LA 4KW7A 4JROA 3H4IA 1E69A 4UNSA 1CUEA 1PD0A 3CRRA 4J0KA 2YMMA 1M2KA 1ZEJA 1Z38A 3BHJA 3G5TA 1NE7A 2C2WA 2V6GA 4LX8A 4TTTS 2N1MA 1AA9A 4U2CA 2PFKA 2C5FA 2OK8A 2WMOB 5HXAA 2DPXA 1R15A 3GJ4A 3K8ZA 4LF8B 4NDAA 4KQFA 1GEEA 4UMVA 1N34B 3R3VA 3WL6A 3H2KA 4ZVNA 3AVTA 3OWOA 1M8PA 4YX9A 1YO6A 1Y6RA 2IPXA 5DLDA 2WT9A 4MGHA 1T5DX 3NBZC 3N28A 3OKAA 4QGAA 3RUHA 4R1TA 2RB4A 4K9NA 4JLDA 1PZNA 4LJ7A 4U2EA 3MZ0A 4UAVA 1PYGA 3KFLA 5A06A 1EXVA 4EFKA 1ZR2A 2AV6A 3HXOA 4C0JA 1WETA 1B8UA 3GPLA 1F7UA 5H16A 2WUVA 1CV2A 3HYNA 3C3PA 4PBRA 3KQKA 2O8DA 3ZU6A 3HXLA 2C88A 2ZDHA 2G8LA 1KI4A 3BSWA 3EODA 1C0LA 1RC0A 3HKEA 3PFGA 3VH4A 1WMSA 2QI9F 4AZWA 3H0EA 4L8YA 3H3XA 4BNMA 4W9NA 1X1TA 5FWAA 4E94A 5K8TA 3Q3VA 4QM7A 3QFCA 3Q2KA 3LBNA 3K15A 1A2BA 2ACEA 2HMSA 2W2TA 3JD4A 2ONJA 3X1ZA 1ZW1A 1ADJA 1RM0A 4LKOA 3IOMA 4RE5A 4JB0A 2XCRB 1S96A 1K8ZB 5E7MA 3W5UA 3LQRA 4DV0B 2JIBA 4UFOA 5IPFA 3SZ3A 5ARBA 3PQ3A 3LRXA 4CLEA 4G9EA 2Z5VA 5EWLB 3NT4A 1SBHA 1V6CA 5JEDA 3JPYA 1IN7A 1GAJA 1A7AA 3AR4A 2RGAA 2PXXA 3YASA 2O3QA 2C5BA 2I22A 1OB5A 4WXEA 3JR3A 3ROQA 1T8UA 3L7DA 3MFYA 1R6DA 4O2BB 5AIAA 3V6LA 4KXXA 4DJFC 3RABA 1KI6A 2I4MA 4H3VA 1WL8A 3D3EA 4FGKA 4BO0A 4LC9A 2XQFA 2OFOA 5TY0A 3WYFA 2VFAA 4HPJB 5IXYA 5JWRA 3DHNA 4CL3A 1QM5A 4PY2A 2OXFA 3ECSA 4GPIB 5EAIA 3V4VB 1OOEA 3AI1A 2GN8A 2CD9A 3EEYA 4ID3A 5DCUA 3I2KA 4BQQA 1JIQA 1LUAA 2ZBFA 3EZLA 4M7PA 3WY9A 5LKRA 1BMFD 1OTYA 3QUBA 1DWOA 1XVLA 3Q3CA 3F1KA 3NEYA 1YU9A 1YXMA 3ZXXA 3AK4A 3MTGA 1ZL2A 2TYSB 4QVKA 2AZ4A 5ESXA 4JJEA 3KUDA 4YECA 5LR6A 4OLBA 5TT1A 3LYUA 2A7QA 3HL0A 3IMFA 4PRKA 1GTZA 5BO5A 3NVAA 4C7OA 5A7GA 3AKYA 4IJ6A 4HVTA 3Q1LA 5EJ2A 3K96A 2B99A 2V7GA 4RHXA 4KMOA 1F0NA 2YNMC 1K6IA 1RRGA 4MROA 3K0EA 3EOZA 1YDFA 3C3AA 1XAGA 1L7NA 1OWLA 2C59A 2FG6C 5D01A 2PMKA 4B35A 1Y42X 3VBCA 3DUFB 2F64A 4CKCA 1RM4A 2ZI7A 4HR7A 4RV4A 4E0BA 5C7OO 4UEQA 2AFHE 4H77A 3C1AA 4Q18A 4CM4A 4OOEA 2W6CX 3G9QA 3I4LA 4IEFB 3TG2A 3GMIA 4M3NA 4KH1A 4OKNA 2J3DA 2W6MA 4Q7KA 2RH4A 3CW9A 1O58A 3SKXA 4HDRB 3ZIUA 1FUUA 2VTKA 2AC2A 4JZKA 4KB5A 1H1LA 4L0QA 2X5NA 3HS3A 2BUBA 3CJRA 4WNAA 1KQOA 4MV9A 5BR1A 2H2GA 5F23A 4K9MA 4LUCA 3DE5X 1J7KA 4QSHA 1IJEA 3Q3GE 3VAAA 4KFSA 1UXHA 2ECKA 3I23A 1UBRS 4BNXA 1JLRA 3FFWA 3BL8A 3VZBA 4MA5A 5HKAA 3Q9LA 3ZWXA 4CLHA 3FBTA 3TWOA 3BCRA 3N58A 4IHAA 2G3YA 4W9MC 1PEYA 2A1TS 2H11A 5FIUA 2GAAA 1WPRA 4YIKA 6REQB 3F4BA 4E5VA 1IHXA 1CZOA 1XTVA 4Q7LA 2EEPA 1OXKB 1WVGA 2X0KA 3M6VA 4GR5A 1H4QA 4MGKR 5DEOA 2OORA 3W2IA 3ZC3A 2IW3A 4X64B 5JUWA 3GJZA 3QVJA 1QGZA 3ZIAA 5JATA 4HHEA 3C8HA 4M1WA 5ALUA 1VKNA 4MS4A 1U9IA 2UXDB 1SHUX 3P2OA 1BHJA 1MQ8B 1F17A 3GVHA 3JATB 16PKA 1YZLA 2R6DA 3D9QX 2DC1A 4J0HA 1RXIA 2EL7A 3DMTC 3I2YX 3ZNPA 1GKIA 1XSEA 4LJRA 4BEJA 4ARCA 4JBXA 1GGJA 1MG5A 4PCLA 3QUCA 3BD8A 2ANBA 3SD7A 1APBA 5GONF 2JGDA 3OJOA 4QFMA 4IWYA 1ZFNA 3BE6A 3V4SA 4D9EA 4GYJA 1V25A 3P9QA 1EQ2A 1E7QA 3DVQX 4ZU1X 1J9ZA 1R6VA 3BB1A 5EIWA 3TJZA 4ESOA 4DLBA 1XQXA 4RF5A 2VWPA 3KM0A 4DARA 4ESEA 5BN5A 3EUEA 1H2HA 2R2GA 1LBHA 4CLOB 1SB8A 1E3DA 2QRNA 3AHCA 3HWWA 4I08A 4K1XA 4XCQA 5HCNA 1Y9AA 1EAMA 1K0FA 2BGRA 1OY1A 3DL0A 4HXFB 4IQ8A 1OX4A 4I55F 4M1OA 4FB4A 2IOFK 3R7WB 4S1VA 3QHQA 2RH5A 4KR6A 1JLSA 1U2ZA 1CRWG 4FNAA 1AKTA 1HH4A 3ZVRA 2ZB3A 1GSIA 1YRHA 2FW0A 2O05A 3GIWA 4PC2A 4BGDA 4LHYA 1SXQA 3DH0A 5DIFA 1KRWA 1RWPA 1Z8DA 4ZQIA 1ZESA 5LQUA 1QGUB 3EFEA 3TFOA 4K26A 3C7KA 3H16A 5EKUA 6Q21A 4FUTA 4Z9YA 3DMHA 1JEOA 3IUJA 3SOPA 1GARA 4Y9DA 2Q99A 3R7DA 4GPD1 2ODNA 1DAPA 4KK3A 3JVEA 2W2QA 5TMEA 5DOZA 1BH6A 2H5JA 4PAGA 2ECPA 1F9AA 3IQHX 3MT9A 2XYQA 4Y2SA 3T41A 3P0JA 3AETB 1AUPA 3CX3A 2NUAB 2CDBA 2LKCA 3RKUA 2XT6A 2PWPA 2ZT7A 4C6HA 1AS3A 1W1IA 1VE5A 1FF9A 1SKQA 5FPKA 5C32A 1YL6A 3B6IA 1A9TA 4TYQA 2C4VA 3CRW1 1B8NA 1GADO 1M74A 1NJFA 3R0JA 2RGNA 4G37A 4MRRA 3J80A 1MLDA 4GOJA 2CXPA 1RXSA 2FSHA 5J5VA 2QYHA 3JQCA 5DN9A 3MCVA 1NGSA 1FVOA 5HF8A 4N4AA 5JNRA 2BCJQ 3DA8A 4FC6A 5G0WA 2DUUA 3ZBPA 1FS6A 2QL6A 2JIDA 4FLFA 1IU9A 3NXSA 1G7TA 3A1EA 2HXYA 4H7PA 3WLAA 3FROA 3TQTA 1ODTC 4JI8B 1CKEA 3Q7RA 4Q9DA 4YP0A 1OFTA 3ZGYA 4D9JA 4ZANA 2NU6B 1XZHA 3NG1A 2OLEA 3P32A 5JS7A 1NFRA 1BU5A 2D3WA 4BQNA 1J9EA 2II6A 4EUHA 2AMLA 2P79A 4MR7B 4QNRA 5GONB 1EUCA 3WOHA 2ACVA 3WRVA 1U8AA 3I76A 4W7IA 3CSUA 2WIGA 1KQGA 3AKEA 3P9SA 1GAQA 2VPZA 3K2EA 2W71A 2DECA 1OFUA 4L27A 4MMXB 3WGYA 1VSUA 3Q4GA 2VPIA 5EXEA 4CTKA 4C3UA 3C48A 3KCQA 4OLFA 2G67A 4HYQA 1CG6A 1UDCA 3HZOA 5LNK1 1U81A 1VHLA 2OE2A 1GTSA 1P7CA 2YVUA 3GFSA 4I55B 3FFTA 1OI2A 3EIOA 1DC8A 1X3SA 2I1LA 2G71A 2FPSA 3I8SA 1IAQA 3VHXA 2FB9A 1SPBS 1KEVA 2F00A 1EXWA 1PT5A 3H2IA 3ZY4A 4BMPB 4JEHA 1SVIA 1V3UA 1SG0A 2CLOB 2V0CA 4Q3AA 2YJ4A 3SQXA 2I54A 3GLHB 2Z04A 1AH2A 2HRBA 1YDGA 2IZ5A 3CZQA 4XXHA 5CK4A 1X42A 1A9QA 4NHOA 3KNZA 3GFGA 4IJKA 4GMGA 3TXXA 4NCIA 4NONA 9ABPA 3GLRA 1A9ZA 1N8NA 1UZMA 2O0KA 1RZUA 1W49A 4GVPA 4KO3S 4YMSA 1U7WA 2WHYA 5HF9A 3FPFA 3VISA 4H7FA 4IDPA 2CL6X 5LU9A 3R44A 4QM6A 2JGMA 5B1EA 1S5PA 1NF3A 4JBNA 5IKXA 4N8SA 2EW2A 3O8QB 2R1VA 3ZZ0A 1SNYA 3FHLA 3N2ZB 4BVKA 2BEUA 1AQUA 2QMUA 1HQYE 3BFJA 4HWGA 3L6OO 3KL2A 3EIWA 3ROGA 1JG4A 2ATXA 2DWCA 1FP4B 2V7QA 4PONA 2MYTA 2QAIA 1F14A 3SLKA 1IATA 3M5CA 3NOVA 5BV7A 2VZ0A 3U4QA 4YJ2B 3F6RA 1NVVQ 2J31A 2PQMA 1KSHA 2VJMB 2VTDA 4GI5A 2X6TA 3GBVA 2IZZA 3LLSA 4NBRA 4NYMQ 4OXRA 1NP3A 2OVBA 3CH5A 3Q7PA 4PC6A 4Y0NA 5HZKA 4FFBA 1CC1S 3AZOA 5H68A 3HCWA 4F6RA 1P7ZA 2WUDA 4MVCA 3HYTA 1H2YA 4WOBA 2K2WA 1QZUA 3ZWPA 3OP1A 4LY9A 1RJDA 3H9QA 5C9ZA 4PGGA 5LD2B 3F9RA 3V34A 3CZRA 3CZMA 2JLSA 4N5NA 2YIMA 3OIDA 4Y7DA 2B6HA 3LHKA 4CIAA 1RQNA 5AHWA 5TMPA 2MYUA 4ZCQA 1GILA 4Q39A 1Y3CE 1ZI6A 4BVBA 2Q3LA 2FN7A 3MQ4A 4PYLA 3TQOA 2ZSKA 3ETDA 3KP1A 2XB8A 1RPJA 3TOSA 5HM6A 3T7SA 4BLVA 3UMSA 1IQPA 2WC1A 2H2DA 4J7CA 3CH4B 5DDIP 3EZGA 5BXYA 5EIOA 2PT5A 2VHZA 4FZ5A 1GFIA 2GZMA 2FXVA 1EA7A 2QXTA 3L7NA 4NAVA 3EQ2A 2BGWA 2PUDA 2R8XA 4LSMA 4MIOA 2IEDA 4FZJA 4QJIA 3B1FA 1E8DA 4HXGA 4UBKA 5AXCA 4F71A 2UYHA 3OIGA 3FWHA 2A9VA 8GPBA 1FYFA 1NHWA 4KVFA 5JASA 5KX5F 1GLVA 2PS3A 3IE1A 1MC1A 1SAYA 1TYBE 2J41A 4PR0A 1PW7A 3EZ6A 3GAFA 4FYHA 1OH5A 1STOA 3KB2A 1M72A 2FV8A 5HTKA 5IVPA 1H6AA 5H1YA 2H16A 4ZDIA 4M6WB 5K6AA 3THXB 1PNVA 1E5VA 4WJLA 4MYHA 3EF3A 3OQVA 2BGJA 1H2FA 4P53A 3K9CA 4EG1A 1YS4A 1UKYA 1ZUD1 1W47A 4GP9A 4QG7A 4UPDA 4AL4A 1CJSA 2HMTA 2PWAA 2AR9A 3F5MA 4RPIA 2OQVA 4H3SA 2PL1A 4A27A 2FW1A 4CEIB 4ESHA 1XVTA 3I09A 4JR2A 4YDQA 1I4EB 2V4MA 4H2DA 4HL6A 4WKCA 3GBSA 4QDTA 3TI7A 3DL4A 2GXQA 4YMWA 3DVLA 2DLNA 3KQTA 4PQYA 4CF4A 5EWLA 4O1HA 3Q87B 2Z8ZA 4M8NE 1AMNA 3SX0A 3ILYA 3TR5A 4KIJA 2HU7A 3QXXA 5CJ2A 4RTPA 2KWIA 1OREA 1Z4JA 1F6BA 4DJDC 3ZWMA 5A0VA 3KJQA 1IK6A 4O2BA 5HRUA 4PZ9A 1DDIA 2CE7A 1UM8A 1V8DA 1RJGA 4MV8A 5D5QA 4Q4DA 4B79A 3EVFA 5B7QA 2VTEA 2FWAA 4MA4A 1L5FA 1VJDA 3A1FA 5K03A 4XARA 3N5CA 3QPWA 5BSUA 1EB8A 4E70A 2P9JA 3ZGOA 3EZ9A 4LOLA 3EB9A 1Q22A 2W2LA 2R8PA 2FXIA 2FUKA 1ZOSA 1E8MA 1T5LA 1UR5A 2RAUA 3H11A 1PQPA 1ILWA 2J9ZB 1TFUA 3N7UA 4JC5A 2QZSA 4JQYA 4WFIA 4E5YA 4XSHA 2QD4A 3FI0A 4J2OA 3UGQA 2FW7A 5HM8A 2CJPA 3ACCA 3PT9A 2BFDB 2FNAA 4S1WA 2QU8A 4EI9A 2PUCA 2V7WA 4C43A 4II7A 2JFXA 1SQGA 2W2NA 4QU5A 5JNTA 1N33B 1GT91 3GYBA 3T99A 4D4HA 1DFGA 1AZLA 3DTVB 4AF6A 3FGPA 1PV4A 5GVSA 4L5IA 4ALIA 1H8EA 1XXLA 2EYUA 3QW4B 1HDYA 3R5KA 1XQVA 3MIIA 3W9SA 3HHPA 4C3OB 4WOJA 4RF4A 1WY5A 4XIYA 1ABBA 4URZR 3WQSB 1JDBC 1P6XA 1JECA 2ZIGA 5J2UA 4MWOA 1YNOA 3DUFA 4EG5A 3GT0A 3QFHA 2XMZA 5FAXA 3EHDA 5KX5B 2XCQA 4HT3B 5AKJA 1E1KA 3I6IA 4H1UA 1DBWA 1K66A 2AYYA 3FOZA 5JZSA 5DGHA 1KEKA 5JLJA 3O47A 5EPUA 4B3FX 1JV2B 3RIYA 3FMVA 1O5TA 3NJ8A 3ORFA 3REFA 1YB2A 4WFKA 4GXRA 4Z2AA 3KJNA 2EGHA 3T35A 5A5EA 3FTEA 1GPH1 1N6IA 4JUAA 2IE8A 3WWZA 4EG7A 2CN1A 3FKJA 4MDHA 4OK5A 4QJ3A 2A1TR 3COVA 4MQLA 3U7EB 5AJZA 1O8CA 2M9MA 1E60A 3CF0A 1PI3A 1JHXA 2J5KA 1HR0B 1K5PA 3NP7A 3UK2A 3VA7A 4LTMA 2WJ6A 1ZHHA 1YFLA 1SVUA 4IPTA 3JQBC 1ZVKA 3HB0A 4ZCPA 3PX7A 4MS3A 1E2QA 1YQWA 5DMXA 1E6WA 1YJXA 4OQ4A 4X3PA 1ZN7A 5CVVA 3W5CA 4EO4A 4ZEMA 1U0NA 3TQFA 4GKVA 3MWYW 2XZDA 1MC8A 3TIVA 2OCYC 4F1WA 1CERA 5B3LA 1T9CA 4PFQA 2FN4A 4RLQA 4YRRA 3RVKA 4YUZA 4EI8A 6REQA 1UOOA 1IXZA 1BDJA 1U1IA 5IK2D 2WF7A 3QVTA 3JWHA 3UUGA 1FDTA 2XB6A 4JA2A 1TW2A 3WMXA 4HDNA 1BTOA 1CUCA 1ZIDA 3ZWWA 3AR9A 4FOPA 1FRFS 1CJCA 2RGDA 4U4AA 1D2AA 1IDOA 4IZIA 2I6TA 4KXQA 3WBJA 2QM3A 1FZQA 3RFUA 3JATA 3HRIA 2YWXA 5HQJA 4M8IA 5AVSA 4NL4H 2A3NA 3DAHA 5KNDD 1D8TA 1XL0A 2VKQA 4HJXA 2Q3EA 1KPIA 4R3UC 1Y82A 4HH0A 3ZCQA 1FDWA 2IZ6A 3CRNA 3W1EA 1VYUA 2Z2KA 3K7EA 1AC5A 1N7GA 1Z2DA 2IELA 2OHIA 2WAAA 1T9GS 2CZGA 2VDKB 3D6AA 3OZUA 4FNOA 1PWHA 5DWQA 5MDHA 2D2XA 4ZTBA 1JHQA 1JIJA 2RMKA 1LU9A 1Q7BA 1SOMA 5IAEA 3DZJA 2Q4EA 2JVJA 1JHPA 1CZRA 3G2NA 3OFVA 4ITRC 4KXUA 4U7PB 4NFYA 5FULA 2A9PA 2FPXA 4BCDA 4NENA 1D0SA 4QAJA 4BAZA 1WMDA 2W58A 4BVEA 3EA5A 1X7XB 3RIGA 3RC3A 1PSZA 3HU5A 1YRWA 1MB4A 2X4IA 4ZZ1A 3UV3A 5ED4A 3OZIA 1DQPA 3R7WA 2WMDA 4PSAA 1PFWA 3ASUA 3JASB 5F7JA 5KYWB 5HK9A 5DBIA 2IP1A 3ZJ4A 3AONB 3O4HA 1NXXA 3WFZA 2ID4A 3ENNA 1REQB 2YRXA 3FDFA 1QGUA 2DBQA 4RIFA 1ESEA 4M1QA 2XD4A 3SP1A 2MMCA 4X20B 1AXRA 2XTMA 3ND9A 3T0GA 3ES9A 1CRLA 5JAOA 4BFXA 3DKPA 3K1JA 4J3JA 1YL5A 2BE7A 4OKIA 4RGVA 4TRRA 4B3HA 4S04A 4M89A 5AYVA 1BKSB 5AVJA 1PYDA 2W6IA 3CB2A 2LW7A 2OVFA 1AKWA 3BBLA 2D54A 4MXDA 4RAQA 4TKUB 3ZGLA 5CD1A 5HP4A 2GLUA 3SF0A 1WP4A 3W8FA 2Z4SA 1OW3B 1YMVA 1ZCJA 3GGOA 3AETA 3I1IA 5IWCA 4FXPA 2NUAA 3AG5A 5DF1A 1QGAA 3RQSA 1Z35A 3RWMB 1EWKA 2AYZA 2UYOA 4Q19A 3Q2IA 5B6IA 4F85A 1PCXA 1ISMA 1GOTA 4XWYA 1HUQA 5LZ8A 1CBUA 5ALHA 4FVTA 1WABA 3GFPA 3T1QA 4OH7A 3FPKA 3B85A 3A6HA 4WL0A 2VNKA 3FVWA 5DBEX 4BOYA 4RESA 2CUNA 4DFDA 4NECA 3V1YA 1TL7C 4LJ8A 4XYLA 1E99A 1YZUA 4RXMA 4DY6A 2EKBA 2E4VA 4NDZA 1XRNA 5LP6C 4DDUA 4YUYA 4CIWA 4KPEC 1I36A 4J7XA 2A94A 1UMDA 5KNBD 5JFOA 5HJ2A 2GZHA 3ZDAA 1SUFA 4BYMA 2CUTA 2WK1A 5JBNA 4UBIA 5ICFA 2NU6A 3TNYA 1Q16A 3CH6A 4JHXA 4M21A 3VOSA 3U61B 2FZ5A 3WLSA 1RI3A 2YXBA 2V4ZA 3AHJA 4MYUA 1T0UA 2GRAA 4C6TB 1EHIA 4MR7A 3TEJA 5D85A 5GONA 5C53B 4E30A 5KVVA 1LNQA 1Z0IA 2AN5A 2JKVA 3OT4A 2C2MA 2DHEA 3X1YA 1IZ0A 2WFZA 3UA4A 5T57A 2DWOA 2ONZA 1PJQA 2D7DA 1UZUA 1ECJA 2VHCA 5CJJA 3N2KB 3N8IA 5FDFA 2ADOA 3KXIA 2HCTA 1GLNA 3MGBA 3K5WA 1AZWA 3L8GA 3QVLA 1OPXA 4I9NA 2P2ZA 3S7ZA 3DGFC 2YWGA 3CX4A 4E1VA 2ZUTA 3BIWA 4DCSA 3EPKA 1MJGM 2CDNA 3SHFA 4C5BA 3CISA 4NWIA 1YJQA 4IXNA 1Q17A 2K2QB 1OJLA 2H65A 1M2WA 3QH4A 1RCFA 1V8BA 2VR1A 2QVGA 2VO1A 4M0UA 5BV0A 3PWZA 2OFPA 3ZHVA 5DO9A 3N9IA 2MT9A 4KYTA 1C3OB 1EK2A 1X7YB 2QM0A 2WMNB 4GF5A 4U39A 4UUOA 3T3DA 5CDHA 2YHIB 4W7SA 5FWDA 1XDGA 1PDWA 1MVOA 2X8WA 2OZLB 1NPTO 1TQDA 1Y4ZA 3CINA 3DP7A 2PH5A 3KZMA 4PAMA 5F33A 1Y8RA 5JWHA 4A6XA 1ADFA 1JLHA 2ZYIA 1R0SA 3N70A 1Z0FA 2JH3A 1RXWA 2A86A 2Z8YA 3O8QA 1LZKA 2Y93A 1S3IA 3IPYA 4MP6A 2JCSA 1PVVA 2ZYTX 4PBTA 4RFLA 2KPOA 4ZEOA 4B7CA 4DLSA 1GQSA 3U80A 5DGDA 3PCRB 4R51A 1QGED 1ECCA 3R3XA 1FP4A 2PKXA 1DKMA 3H2ZA 1U0SY 4HEJA 4QIHA 5AXBA 1NVMB 1SK9A 4YJ2A 2GBCA 2PBLA 1F60A 5EWMA 4KX3A 2QZ9A 5LP6A 4RZ2A 1M7BA 1VRWA 2DHQA 2QD3A 4WPGA 5FLYA 4Z1MD 2Z5LA 3CZCA 3CUUA 2Q7DA 3ZBQA 1UMCB 1X19A 2CCKA 1G7CA 1XXHE 3VI3B 2BH2A 1PGOA 3KVYA 4FCWA 4BNDB 1O6CA 3DM5A 5F3RA 5D6OA 1S02A 2R6CA 5DVZA 4OP1A 5ESRA 4IJWA 5EEHA 2J32A 4F2HA 1LBQA 4WD3A 3VR3A 3NTRA 4L8GA 4NOJA 4ILKA 1ENZA 1ZN2A 4RK1A 1BVUA 3PD7A 4MJ3A 4M0KA 2VUTA 1A5ZA 1ZOIA 5AW4A 2G82A 1M2HA 3HYLA 4DAEA 2IYAA 1ZIPA 2EDAA 3BF8A 4AU1A 2KE5A 4DDMA 2LRHA 2CFCA 5GINE 1VBNA 2JFNA 2FQQA 4N7MA 2WWFA 1SXGA 4CWAA 1K8YB 3GCGA 3CR3C 4KAXA 2VNAA 1G0OA 3I3OA 3FIUA 3LUBA 2CFTA 3O1IC 4M60A 2EXXA 4R0VA 1ESZA 5JCPA 3DZCA 2ZUUA 2AT1A 3SHOA 2PVSA 4L8WB 2EERA 3ETCA 3UCEA 1B2RA 3HUUA 1RHUA 3ADBA 1DJMA 3DMYA 4NE7A 5K8VA 2WJJA 1YS2X 4NV3A 1M83A 2C96A 2GAIA 3D2CA 1Q1NA 4DLUA 4GGOA 1TUIA 4MVJM 4PU0A 2V4UA 5A6SB 4BECA 5JXJA 3U7GA 1UM9B 3KZ1E 2VPTA 3GUYA 4Z9FA 2I62A 2OXTA 1P19A 2OUIA 3E8XA 4Q1BA 3WX0A 3EDRA 3QKIA 5KNDH 3EBPA 2I4NA 4M6WA 5ITZB 2O3TA 1ID1A 3THXA 4BRZA 1QQAA 1U94A 4G5HA 1JPJA 4YYEA 2BT4A 3MPOA 5CFZA 4BNZA 2FETA 2PZBA 1U9JA 2ZWVA 3HJTA 2HNKA 2W93A 3NJ4A 4R1UA 2I1WA 5AI5A 1C50A 3H9GA 2GARA 3W5VA 3OE5A 3S2UA 1DXQA 3TIGA 4BO1A 4CEIA 1K63A 4V0RA 5EGNA 2V7XA 3VVCA 2J48A 1OBFO 2XX3A 5BPFA 2ECOA 5DM70 1NN1A 1B1AA 1OXXK 1ZCZA 2DWUA 2FDRA 1N2XA 4Y7CA 5LBTA 5CT8A 3B36A 2Y77A 1XYYA 3BN3A 2O7NA 1RD4A 3EPPA 2HI0A 1LJ8A 1YONA 3M82A 4KWHA 4PSVA 3F6EX 4BEVA 5LQNA 3OCJA 2ZI4A 4DR3B 2YQ4A 1OWMA 2A9OA 3QUQA 2ZB8A 1LBEA 1HDIA 1BG6A 4LVUA 1TK3A 5BUSA 3NALA 4M1ZA 2I29A 5AKZA 2CNKA 1VLQA 1JQKA 3HNOA 3KT3A 4ZVQA 2H08A 2IIQA 2HZ7A 3A6KA 5ITVA 4PTZA 5K6RA 5EJEA 4G09A 1P39A 4NBUA 5BSTA 1XTBA 2VLIA 3P2YA 4FS3A 3H87A 4QJBA 2XIJA 4KLAA 5K8IA 3L4JA 5IFKA 3BC1A 4JLNA 2ZUSA 4J1NA 4RY2A 5BRJA 4BZWA 1MJHA 3LBAA 4L02A 2UAGA 4IV8A 2CMGA 3V1UA 2V03A 3U4AA 1L4UA 1T2EA 5C8VA 2FWJA 5T4BA 1NFFA 2ARKA 5MGBA 3DTVA 4OMUA 5ALOA 1JXQA 1VFPA 3EIFA 2Q0SA 2OM6A 3EXFB 4RPCA 5DYGA 1HA3A 1BDHA 1OU0A 1PEDA 2CK3D 3GV0A 3QVGB 5EJGA 1CQXA 3E7WA 4YP9A 5IDQA 2O7VA 3GLFE 1NM5A 4MWBA 3SU8A 3ZLVA 3L0IB 3M4XA 3N53A 1WU8A 4L78A 4XD7A 4KFUA 4ETMA 3FWYA 5L8VA 1Z9BA 1QHFA 1A2KC 1MVLA 5IEJA 2ZLBA 3QPUA 4ZAVA 4Y1RB 4JGBA 2QENA 3VO8A 2V7UA 1LF0A 2G9VA 2J0QA 4ZV9A 1CK4A 1JHAA 2NZUG 5KNBH 1M0EA 1XJWA 5DXJA 4OQEA 1TGYA 5IH7A 2RGXA 1AO0A 1IL0A 4LIPD 4AC9A 4ER5A 3NCHA 4OHZA 5FV4A 1QFMA 4G5QA 5ENZA 3Q5EA 1D6JA 1O5IA 4DIUA 1J2YA 4BZZA 5BV2P 1V1RB 2HL6A 4F9GA 1NVDA 3HN2A 3GRVA 4ND6A 4RPGA 3R6LA 2HUPA 4UHBA 2GJ4A 4LJ9A 2EBFX 2AJ8A 5CNMA 2E89A 2O3RA 3F67A 1V8FA 1QE0A 1Y9ZA 4J9UE 2P9CA 5ALQA 1DG9A 1KP9A 5TXGA 3KJIA 1DG1G 2D5IA 4LQ4A 4MCIA 2LTAA 2OQ2A 5ES3A 1H5UA 2QJWA 3MJVA 4AKGA 3E2MA 1IWPB 2C5SA 5GJWC 3WLHA 2P6MA 4FYKA 1P6QA 3WO0A 3OJEA 1U63A 3RSLA 2UYCA 1MB9A 5LWHA 4BU1A 1I1NA 3D02A 3L7OA 2VPPA 4BFZA 2O2XA 4BO6A 3IPRA 3F7NA 3WLKX 5JXHA 2RD2A 4P4TA 3OIFA 1KSFX 5TEVA 2ET6A 3V4OA 2FW6A 3KHTA 3MMSA 1IN5A 2VDNB 2ZBVA 3LDFA 4HQKA 3BCUA 3JCZA 1TE2A 2YV1A 1F8UA 3OH8A 2VDLB 1OWNA 3A4NA 3D1JA 5CDSA 5HR5A 4MW6A 3KK0A 5CYOA 1QCYA 1FS5A 4DSTA 1JQEA 2HPAA 2BJVA 3BILA 3GC6A 3HVIA 3V7UA 4I6EA 4B4WA 2QP9X 3NHAA 3UMGA 3VSAA 4QPPA 4U7DA 4F5YA 2JATA 1CEXA 3KQWA 1NQTA 3QWBA 2XB4A 4OQZA 5A3RA 2FZLA 2I7CA 4EEXA 2MWMA 3FZGA 2BSXA 3GAMA 4NSNA 3MGAA 1X7XA 4IUDS 3MBKA 2HQRA 4ZO7A 1MF7A 1RRCA 4E5SA 1M7HA 1FMCA 1GAEO 2CYAA 2Q2QA 1H65A 1H2BA 4RO0A 2CFSA 3JASA 3H9EO 4AVYA 2V8OA 5KYWA 2JA2A 2R00C 3H2GA 4O8ZA 4I1IA 3DW3X 4KNVA 4K6MA 2QLLA 3U3OA 2QQFA 3K0FB 3U4GA 4ZHSA 5AK0A 4H31A 3OX2A 5F7XA 3FCOA 4GG1A 5FL3A 1NBMA 3BXZA 2OBMA 1G4AE 4KWTA 1G3QA 5IYZA 3TG8A 1R3DA 4E5NA 4X20A 4QDOA 4KDFA 1ZIOA 1EIWA 3RE1A 1G8FA 4O4LF 4PRYA 4UOQA 1VPTA 3I39X 4RDCA 2H63A 4TS1A 1FDUA 3RC1A 1E9EA 1XAJA 2JFFA 3KKKA 4OHMA 4TKUA 1FTWA 4UMEA 1MIHA 4E5MA 3HBNA 3FDXA 3R3HA 3T1NA 4CFSA 4YRAA 4W8GA 5DM60 4DUZB 2JHPA 4C4XA 3AF1A 3O1HB 1E6MA 2F1IA 3LT4A 5FEUA 4WN9A 2BMFA 1NXQA 3SFZA 1PWXA 4BNYA 1GFZA 4TTQA 3Q8KA 1IZYA 3AV0B 3UK0A 3CRZA 3FDZB 4DM4A 1RJEA 3M6LA 3ZUPA 2CCJA 3HKDB 4DLYA 3S5UA 1FOEB 3CC8A 4WDQA 5NULA 4DCPA 1DC4A 1T3LA 2WU8A 2C2XA 1UBGA 3HCOA 1A5BB 1I5OA 1YIOA 1P72A 2BGGA 2WHPA 4Y2PA 2C2GA 2FEMA 2YJZA 1Y3DE 3KSBC 3JYLA 4QPJC 4J3NA 2QSJA 4JXZA 5LJIA 1BVYF 4Y9TA 1J07A 2QVZX 3PBKA 1Y89A 5ALWA 3SIPA 4OHFA 5FBHA 3G02A 3STVA 2AWOA 4A10A 4LFAB 1TLFA 3S2GA 2EX4A 2YV4A 3EVTA 4D0GA 4DRZA 1YUBA 3OX4A 1DQSA 3IDQA 3S4YA 3ORSA 2A9JA 5I8WA 1K98A 1Q77A 2RHGB 2WB4A 1XMQB 1P0PA 1V1MB 1KPGA 2ZE5A 4ZVOA 1Q6YA 2D06A 4LJLA 2EVWX 4EBFA 4NCJA 3GBPA 2ZR8A 3OCWA 1P60A 2I6SA 4AZ0B 1ML3A 1H85A 2D5AA 3PL1A 3LP6A 5B12A 2HF9A 5DSTA 3FMGA 3PUXA 4Q03A 3R74A 3WZMA 2TRSB 3TF5A 1XYVA 4OJKA 1QHXA 4HRVA 5IN4A 2XDQB 1DHTA 4ZCIA 2Q07A 2TMGA 2PMDA 3EXIA 1KI3A 4ZQCB 1UT8A 3L8FA 2FKNA 2Y1EA 2ZYVX 3ETLA 3T5GA 4HX5A 4MGZR 5F5LA 2P3SA 1YGPA 3FCCA 1BN7A 4A16A 1DIRA 2WD9A 4YREA 3TRJA 4FBMA 3T1VA 3KR9A 1HQDA 4F6LA 2AFIB 3HDJA 3K32A 4JLMA 2HD4A 3ZXSA 3CCFA 4D81A 1BD3A 3LWNA 1P81A 4X63A 2YV3A 1PFQA 1WUJS 3LL4A 3LKVA 3AM5A 1DUIA 1WEKA 1X7YA 1ZGZA 1U2SA 3PDCA 4O4LB 4EDHA 4EGSA 5CYGA 3UCXA 1VQ1A 2OZLA 2QIPA 4R84A 2R7LA 5D3QA 1FFDA 2P78A 4ZCRA 2EZUA 1N3LA 1W59A 2G83A 3DYBA 4GX5A 3MHPA 3RO7A 1DMRA 3FOCA 3Q7IA 3WYEA 4H3HB 4HNQA 3ZNOA 1EZ1A 2GM4A 3K9QO 3QG5A 4C7BA 1K4YA 4FCTA 3QVOA 1A9SA 1NSFA 3IAS6 3IQEA 4TT3D 1Y3IA 2FHPA 4E12A 1OLOA 1PEAA 2JDIA 1M10A 2GCPA 3CPSA 4PIPA 1FW6A 1NNLA 1DRKA 4V24A 2KS6A 2IWHA 3OMXA 4UNRA 3N05A 4J4HA 3NOOA 1MN6A 1U7DA 2ZULA 3I30X 1CNFA 5HG0A 3TMKA 4CL8A 5C8YB 1UMCA 2FPMA 3Q11A 1G6HA 4YQYA 2B35A 3I58A 2C78A 1SO8A 3KQQA 3LC7O 3NBAA 4CCAA 1R0RE 2FWRA 2HRQA 2ZK7A 4K9SA 1R9GA 1EJ2A 1TD9A 2JA1A 2XXBA 3GGDA 3VSEA 5F2EA 1R0ZA 4FMCF 1F1BA 2JJ2D 1RWBA 2F67A 3ZVKA 2HJSA 3OU6A 4TMKA 2NV0A 3THSA 4EY6A 2W5UA 4XLZA 1GTVA 2CL5A 3C3EA 3AEZA 1N1EA 2Q9BA 3WGLA 3HA5A 3KALA 3HB5X 5E7QA 4KSBA 2JI7A 3P7MA 1V3QE 4QFBA 3RFXA 1U90A 1WDWB 3DR5A 2QDKA 5AOCA 2QPAA 2WTEA 1VRVA 3CV3A 4Z99A 1T24A 3PB3A 1NW7A 2BI8A 4EGAA 1NOJA 2QM8A 3I05A 3MD0A 3NC0C 8AT1A 5JEEA 2Q6LA 5DM4A 3BFPA 1VTKA 1T2FA 2GPJA 3QX8A 4F06A 4J0GA 2WYOA 5M3BA 1OXVA 2Q9UA 3H8WA 4RNCA 5K05A 1NURA 3OJWA 1L5QA 1W9HA 4JMLA 3N0RA 2HIGA 2XUGA 4KCGA 3TAHA 1HO3A 1FFGA 3EW9A 3T7KA 4DDVA 5IABA 1N5MA 2DTXA 4RQBA 1ZJWA 3H6KA 2LUOA 1F4VA 3DZKA 3UMBA 4RKQA 4MKRA 4PHCA 4XGNA 4JKOA 1TIBA 1UDXA 4Z0NA 5A6SA 1UM9A 2D0DA 3MXOA 3BB3A 1DPGA 2G72A 1V5GA 1W6RA 3L9XA 3LUAA 1F2VA 3QKSB 4J16A 4JLJA 3B1ZA 4RFVA 3S2EA 2IYRA 4QFDA 4JDPA 5KDOA 1GKLA 3RDPA 4JC0A 4CKEA 1IN8A 3HDYA 4BIIA 1VJ0A 1KAHA 2FP3A 4HAUA 3G7NA 3SGLA 2D4AA 4XRRA 1IBRA 3TBKA 1GG5A 2H4HA 4DSOA 4JQSA 1IJFA 1OCEA 2EIXA 2WABA 4G0PA 3QFTA 4ERXA 1L8LA 1ZXLA 1L5MA 5CX4A 3DLPX 3D1VA 1UXOA 4QTYA 2WFLB 4POAA 4L16A 1SC6A 2BHSA 3A4LA 3NFRA 4DW8A 3U7HB 1TW3A 4QLAA 4BKMA 3I6ZA 4KQWA 1PZHA 2P27A 1CTQA 2PMCA 2D2IA 1RCTE 4H7KA 2BYTA 4HVAA 3SLGA 4IS2A 2HQ1A 3QI7A 4JOCA 4N6OA 2Q50A 5HVNA 4K6KA 3DE0X 3KVRA 4L5CA 4M0LA 2P9FA 4J0IA 3H04A 3PPWA 1IM2A 1XL1A 3HGMA 3WLLA 1INLA 1XI2A 2PPVA 4MVWA 3RJ5A 1VCNA 1I0LA 5CITA 5JVDF 1SBQA 4QYMA 3QEMA 3OCZA 5FJIA 4C89A 1K6JA 3NQ41 4GI2A 3RC9A 4ETNA 4YRKA 4J76A 1ZJJA 1NC3A 2P7HA 4QUJA 4FMCB 2P7IA 3EEQA 1W4AA 1NW5A 2HNBA 3TL3A 3ETHA 1E7WA 4YPOA 2Q1TA 2Q4RA 2BEKA 3I2FA 3QOXA 2ZI6A 1K0UA 5EWMB 2R60A 2JD0A 4GOMD 4EB6B 2ENUA 3PXEA 3PJRA 2YYZA 1FMFA 3CIFA 1UJ6A 4A8TA 5GIPE 4L08A 2B6NA 3EXFA 4U7WA 1M6HA 1WHTB 2I6UA 2IDMA 2OYRA 5AW3A 5LXTA 3TPCA 1MR3F 5BMVB 1YHNA 3DDCA 1X77A 5F2OA 4CKYA 4B3GA 2HBZA 5KQMA 2CVHA 2RGBA 2ZI5A 3BZUA 3CWQA 2D7JA 4Q1EA 4BNHA 4ZI7F 4Q24A 1USGA 3HCAA 4Z8XA 1CJUC 1ZU5A 2E0IA 2WQ7A 1NI3A 3Q41A 4OF4A 3UG7A 1N6HA 3A9UA 3FPAA 3NH9A 4M55A 3SHTA 4MOWA 3OOYA 1EWQA 1NR7A 1E4VA 4R83A 1P4RA 3MPUA 4GS5A 4FNMA 4EI7A 4ICIA 4ZCLA 1CQJA 1S3SA 2JGLA 4LS3A 3HFGA 3F8SA 4YLGA 1Z2EA 1Z82A 2WFAA 3CPJB 2WIDA 3GW8A 3MTEA 4HNHA 4P7BA 1ZCAA 4RMGA 5GWXA 3T9AA 4CMJA 4FC7A 4ZAGA 3EZYA 5FQOA 5LYJA 2HHJA 4NJMB 3RSFA 3EGIA 4I8DA 3FTPA 1ILEA 2ZSFA 3D7NA 4GSYA 4NCXA 3AJ9A 1C3JA 4KU4A 4XM0A 3MWJA 3HPRA 1JEAA 3LUJA 2JLZA 4CI0B 4CYMA 3GA7A 1ZS9A 2O8VA 5IC4A 3KU4A 1DO8A 2QZZA 4D4JA 2V6FA 2WD7B 1S2NA 3QENA 1L5NA 5DNAA 4P35A 3QRWA 3IVRA 2VL7A 3C74A 3KQHA 4Z49A 2R8YA 4G0XA 1QRAA 4YONB 5EQDA 3QFFA 2WLTA 2OCDA 3OHPA 4YV0A 5ICEA 5D86A 2ZFUA 4WZBB 4GLJA 1AOXA 5P21A 3DAGA 4OXKA 4OJYA 4TTAA 2X3FA 1XVUA 4Z4HA 4G1BA 3LLMA 3NDJA 4XCXA 3BEDA 4MV6A 3WGGA 1YDMA 3G89A 5EJ6A 5ICCA 2X42A 1DX9A 3H17A 3X2FA 4Z7QB 2QL7A 5FTNA 3ICVA 1T2UA 1T5IA 4YRQA 5C8DA 2X8LA 2GD0A 4RJJA 2V96A 1RBMA 3BQ9A 4WLUA 5JHGB 1ZD5A 3AVVA 1QZZA 1LJLA 2NYVA 4DCNA 2FDCA 4CT5A 4D4KA 4ALJA 2C29D 1NVVR 5CT5A 3WQHA 3C7AA 3CIOA 4DAOA 3TTUA 4NYMR 4YQEA 4W5TA 1SUDA 2D2EA 1HLPA 4NK5A 4OFBA 1IVNA 1OV6A 1QQ6A 1CR4A 2X1LA 3SSMA 1IEVA 4QOFA 1AKEA 4GR4A 2HWYA 4LOAA 4D74A 2OT3B 1GZSA 1JPNA 1LSOA 4N7BA 4ZKEA 4QLBA 5DX1A 3V48A 4BAGA 1KFKB 4OAQA 3CNOA 1U02A 2CLMB 4AF7A 1SCKA 4HMQA 4TLLB 4ZI7B 4G85A 4XWGA 1Y9JA 4XWAA 3PHIA 3IFSA 3ZWCA 1TYAE 5DXFA 3I64A 2PO7A 4UARA 3UJBA 2OBFA 2AUTA 4AS2A 2JLYA 1PL6A 2IEIA 3FH0A 4HZUB 1K08A 4PZYA 1F06A 3R0IA 4TOIA 4A0SA 5I5EA 5LQDA 5D51S 4E5KA 2IHBA 4CPDA 4GDFA 2YWHA 2FLKA 2B8WA 3C41J 3EVBA 4DL9A 1L9XA 3E18A 1M8GA 2I2BA 2PX6A 3EIUA 3PYMA 3UUWA 3PD1A 2HFKA 1YD7A 1A69A 1Y1TA 1XO1A 3ZK8A 3P2JA 2IITA 1W9MA 3A6ZA 3I6QA 1IHOA 1OI4A 4ZC1A 4IAOA 4WOPA 1L4YA 1R9NA 1SUIA 3JY6A 4LY3A 4R8KA 2JJ1D 3D3WB 1Y1RA 4EUSA 1EVEA 1BEEA 3Q0IA 2G4CA 1FX0A 2EL9A 2MSCB 3BIOA 4BQPA 4CMGA 3FDZA 4MR8A 4PIVA 1YZQA 5SICE 3WMGA 5IX8A 4TZ0A 3CR7A 4J6EA 1KMMA 1ONPA 4OQQA 2IXDA 1P4SA 2NUPB 3H99A 5J5CA 2KMLA 2OA0A 2ZZMA 2ZSIA 1CRZA 3PZBA 1W85B 1YBHA 1FK8A 2Y2VA 4IMIB 2XT9A 3ZWVA 2CHVA 5TB5A 1D5CA 1VLVA 4H6WA 8ATCA 4Y30A 1BHO1 5KNCA 2VQ6A 3IMEA 4TKVB 3TIFA 1MENA 1X8KA 3F1LA 3NTQA 4FOLA 1SPXA 4LMBA 4XH9B 4ZAZA 3V80A 3OX1A 1JJAA 2GNAA 3FYUB 3W34A 1YVPA 3ZGVA 4LSZA 2VUSA 1DAOA 1WW8A 1XCBA 3KPJA 2H92A 2VA8A 3Q88A 3RJ9A 1CVRA 2QVBA 2AOUB 4OHXA 4J1SA 4R6XA 1JR3D 1ORHA 2DBRA 2GN4A 3LK6A 4WHMA 4RFSB 4L9SA 3UOGA 4PN7A 1NQUA 1GRRA 1V1MA 4H0NA 2H17A 1FTQA 5CYPA 1KJQA 1W34A 3GJXC 4C7KA 1QV6A 2Q9CA 2ZE7A 2YJNA 1LNSA 2ZT8A 4AZ0A 1Z63A 1A04A 1AKUA 2JCGA 4HB0A 1UKAA 3C8UA 2XUFA 3HY6A 3O4FA 2IP4A 2WHRA 4JJKA 1CQWA 3QU9A 1I1QB 3CRQA 3ZI4A 5C2JB 3ZJVA 5CURA 3DTTA 2XDQA 5I4CA 2HW8A 4Z4QA 3OPMA 5CVDA 4GRDA 3T9FA 5I7UA 3PNLA 1OHHD 1YS9A 2OGUA 3HJUA 4GZLA 3NPAA 4C08A 1YMUA 5BYKA 5C34B 2XODA 2FCRA 4TRNA 3KAQA 3ROKA 3A1NA 3R3SA 3L5OA 4RIEA 4HUQB 2V9ZA 4HAYA 1VIDA 1JHVA 2BUAA 2ZI9A 2AFIA 2GH1A 3KYBA 5KDLA 2IU0A 4KIFA 2CHQA 3LIIA 2WYHA 3I1JA 1W0KA 2OOKA 3DEIA 3L7KA 1O08A 2I6QA 1PZMA 5DSZA 4URVR 1P5JA 3MUEA 3O9MA 4H59A 4HB3A 1NXOA 3VVMA 3D3QA 5TS2A 1KWKA 1EP9A 4BCBA 3AI3A 3K92A 2EFCB 3NJRA 4P3NA 3IVMA 1FSFA 4JS0A 4ZV7A 1FMJA 4LZLA 4BWFB 2F9MA 1IQ0A 2RHHA 4QXAA 5SYNA 2H52A 1GUZA 2BV3A 1WSBA 1I2ZA 2HIMA 2LD4A 3G9UA 3MOSA 2QRLA 5EIBD 3ZDZB 4YMLA 1YHZA 4GOND 1Y6ZA 5TARA 4Q3EA 3W90A 4B84A 1QIIA 1E1MA 3O3NB 1OC4A 2VSXA 3GJ3A 4UAUA 4P1ZA 1J33A 4LPSA 3HP1A 3HV0A 4UU7A 2WKWA 4JNCA 1YQQA 3S2YA 2JIQA 2QMOA 3GEEA 5IT0A 4BEWA 2HOQA 3BH6A 5C8YA 3LLVA 2ZJAA 1LCIA 3A32A 1SQ6A 5JXGA 3NEAA 4E3WA 1Q6ZA 4ML3A 4XZ3A 1XTJA 1ZH0A 3GMSA 3OUTA 3WK6A 2WBLC 2PMFA 3QVVA 2M6RA 4KVZA 2XB9A 3ISTA 1BKDR 1T3SA 4B09A 4W7HA 5L95A 1AA6A 1NOKA 1NP7A 4TSRA 4COOA 2B9EA 3A05A 1ORDA 1U4NA 2Z1DA 4KXMA 4WGFA 5IAKA 1OJ7A 1QG0A 5EIFA 4HN9A 1S6YA 3UBMA 3VM6A 1K9VF 2ESRA 1ELOA 1VJCA 2F17A 4V03A 1P91A 4GXNA 1M2VB 1M2GA 3E3OA 4KODA 1SZPA 5AXAA 3OIVA 3AP1A 3CG4A 3CX8A 3PNMA 5AVOA 2OCIA 1U2QA 4P6VF 3GFVA 1DAGA 1L3IA 1KA9H 3UH0A 1TJ4A 2O1EA 4U7GA 3W6OA 2VYFA 3L1VA 2VYNA 3B3GA 4QO8A 1ZD9A 2PT7A 3C6ZA 4LDNA 3UMCA 5JSQA 3VOBA 2DU8A 3CCCA 1E2NA 1V5EA 3KHSA 3JQAD 1W4ZA 4HNTA 4G8CA 3UNXA 2H7VA 3HDTA 2R1ZA 3RYIB 4DXAA 2J0SA 3F2IA 4KBGA 1XVIA 4ND1A 5BQOA 4QYIB 4TGLA 4U2GA 3DOOA 4TVBA 1QMPA 2YQZA 4R2JA 1FMLA 2W2VA 4JLWA 2G09A 3B60A 2IEBA 1CYDA 4F3CA 4C1NA 1WDKA 4OREX 2OCAA 3QKSA 4M53A 4D9KA 4JT8A 5CB4B 4BJ3A 1F4LA 1W4CA 4AMBA 5BV8A 4QNMA 1N8KA 4DLZA 1H23A 5JCZA 3OQNA 3K9FC 1JILA 3AUTA 4NNOA 2ON6A 3SKYA 2ZM6B 7REQB 4QGFA 3JQ7A 4B7AA 5KUTA 3LDAA 4CKBA 4E13A 2A5JA 2NWQA 2QRHA 1IB0A 2WFLA 1ZRHA 4GU5A 5I8PA 3D6JA 2GTPA 1BWPA 1EVKA 4CQNA 5LMNB 1N9KA 1PG2A 1QIGA 2ZJFA 1N5RA 3BWBA 3NWEA 1HC7A 4RHUA 3BQNB 5FPTA 5BURA 2Q21A 2RGGA 1NVFA 2GJ8A 3KPUA 4IIXA 3TNFA 1LPAB 1XHFA 1DBVO 2W6PA 1DRJA 1P62B 1XMJA 5K7SA 5HW0A 2YCLA 4P2BA 4UEWA 4JR0A 4OQXA 1GNSA 3SK0A 2P4EA 3U9LA 2E1RA 5DBGA 2O8BB 4ZVRA 4GNRA 3T5DA 4EY8A 2O2HA 3IE2A 1J0DA 2QRQA 4KDRA 2EJTA 1LTHR 1MFPA 1EXNA 1ST2A 3FPGA 1O94D 3G0CA 2P8SA 5EZ6B 1OLUB 4N54A 4GAEA 3DVRX 1CUYA 3BTOA 4JVMA 1HKUA 3G8BA 3FIJA 3UAVA 5DNYB 4TN5A 1Z4OA 3I5AA 3C5CA 3N2GA 2QRJA 4KMSA 1UK6A 4MMZB 3V8BA 2X2OA 4EY5A 4Z0HO 1A4XA 3CUTA 4DIKA 1TGVA 3OQIA 1KH1A 4XDGA 4EB6A 3TGPA 4N5DA 1NG9A 2CXNA 2IGBA 1O87A 4BGEA 5AVRA 1Z5WA 3PSAA 5K0BA 4DEXA 3HCRA 2QX4A 3SXUB 3OLZA 3CE6A 4MKZA 1WHTA 4LYEA 3K0CA 3RYTC 1JG7A 3WQRA 1MB2A 4BBZA 1V11B 4LN1A 5BMVA 3VDRA 3OZTA 4UMDA 4HLCA 3WRXC 3AF4A 2VWHA 2O8NA 4INOA 1RS0A 2QTMA 5ALGA 5JDIA 4XM2A 4ESVA 1PD1A 2AC7A 2D0IA 5HE9A 1D8AA 2P6OA 5IJZA 3RS7A 3W78A 5J4KA 1DAKA 1LI5A 3TMYA 4MO2A 2H7XA 1XQWA 3V97A 1TFRA 3TIXB 5CDFE 2VPXA 1JU9A 4WXRA 2D74A 2AE2A 4KN9S 2CKMA 1X7ZB 4PC7A 3P0RA 2VDVE 5DHRA 2NAPA 1E0SA 1NQWA 2FPWA 3EWAA 3WKCA 3AGQA 4L85A 4PAQA 4H7EA 3L6EA 4B76A 4J29A 4RPKA 3P5SA 3AT1A 1CNEA 2E6UX 2RKOA 3O9VA 3TLYA 4NJMA 4BVLA 3ND6A 4ER6A 1H22A 1GEGA 3UMMA 1MORA 4EB0A 2DB3A 2G5TA 4B9AA 2BFEB 3NUGA 4Q12A 1M34B 2GA8A 3BSYA 4KAAA 4YCBA 5A4MS 2FW8A 2WU3A 3ZPXA 2J1LA 3QUAA 4UAJA 2W4MA 3F7OA 2XHZA 4YRDA 2JAOA 1RMTA 4ZREA 5IUKC 2HKIA 2QX9A 1HE2A 2FHSA 2RG7A 4FBGA 4RENA 1SOUA 4RIHA 5EXTA 1C9NA 1M73E 2BN4A 2XSZD 1QAQA 1KVSA 4LDAA 5EHGA 5JR3A 2ZXEA 3IYLW 5BT8A 4BP3A 4WZBA 2R1TA 3G5MA 4Q15A 4PAWA 4PVCA 4Z0TA 2IXAA 4IYRA 5CUQA 1WWKA 3USCS 1VPWA 4RGYA 1N6LA 1PF7E 2GEKA 3ADOA 3IUBA 3RTGA 1RYHA 4EG4A 1PGNA 3WAGA 2EJCA 3IQZA 4IIJB 2I9KA 3KPYA 3B1JA 4GT1A 4DCMA 2EQAA 3ISVA 4XB6B 2BDTA 3K6JA 3PIIA 1SIUA 5FI0B 3VH1A 3IAFA 2CLDX 1PJAA 1RADA 2DJIA 1R88A 3DMRA 4NNJA 4B73A 5K0JA 3OJCA 1L1EA 1TAGA 1WB6A 4KZKA 1SCAA 3AF2A 4L3OA 3U7QB 5LOVF 3IDOA 4PYQA 1AHPA 2O0JA 1GPNA 2QNIA 1BFUA 1SURA 2OCGA 3OCXA 5L3RA 4TZ6A 1COZA 2M98A 1YAHA 4D8TA 3Q8MA 4F56A 4DRXB 4CIBA 1FBTA 3OUZA 4ZOBA 4DA4A 3DGEC 4D80A 4F3TA 4BFSA 3VR5A 2BGKA 2IZOA 1GWNA 4FSXA 3VU0A 2HHHB 4ASUD 3C8MA 3RYHB 2PL3A 1JSLA 821PA 2QSYA 1YDEA 4LTDA 4A2WA 2P40A 4FT4A 4KQMA 1XJ0A 4MVYA 4ZVTA 3QBDA 3HSKA 1KOFA 2FSVC 1Y0BA 3FZEA 5LDDC 1JFVA 1TZJA 1D1SA 3V8EA 1KJJA 2GYUA 1KFJB 1X15A 4XVQA 4HZUA 2XAAA 3UB4A 3SZMA 5HILA 2JS7A 5AM5A 4B6EA 4BO4A 1A27A 1A1VA 4G3XA 2PGXA 4JWTA 4FMPA 2CLCX 2JHCA 2PGIA 2W83A 3KE8A 1E3MA 3U9SA 3N59A 1CUJA 3GFRA 1E1LA 1JXAA 2IS2A 3H2HA 5K45A 4IYJA 1T2VA 1V8OA 1V8PA 3EK2A 3IVXA 4YASA 4I14A 2BEJA 1ZOLA 4YP6A 3TQHA 2ORWA 4IUCS 4EUKA 1EUYA 1C9EA 3WDMA 3GELA 2H1OA 4LDRA 4K3VA 5TSDA 4GMXA 2DQKA 3KSZO 2XCUA 4XPIB 1YRLA 1DEXA 3D3WA 3DT6A 5DW3A 3CKMA 5FOWA 1S9HA 1U8XX 2AEFA 4PINA 3UVEA 1TZ2A 4ZO4A 3X0DA 3GCXA 3PUZA 3AVOA 2NUPA 1VBKA 3K35A 3P4XA 3ZI0A 3RC8A 1C1HA 3DF9A 3H2YA 3IP3A 3TXYA 4DC0A 1W5FA 1SUAA 1NDHA 1KRXA 2ZUDA 3N0WA 5LUAA 1Z7GA 4UTXA 2O8FB 3EVDA 2E37A 1JE0A 3DNFA 3X3HA 4TKVA 2GFHA 1I7DA 2VF5X 3E35A 3OC6A 3I34X 3R7FA 1JMVA 4J0JA 1TUBB 3CZ9A 3HJGA 1WZNA 4LCJA 4RH0A 3H0KA 2AOUA 2ZSJA 4FKMA 3MTBA 5BVGB 1D2MA 1FNSA 3HA7A 3WIEA 2GNPA 4ZK6A 4RFSA 1RDFA 5TE9A 4AQYB 2ZRDA 1U2DC 1WCYA 1CDEA 1FRQA 1OGJA 5LOVB 4BX8A 1W4RA 1LBSA 2LP4Y 1MKYA 3PNQA 2YIJA 4NI5A 4EA9A 1F1JA 1DAMA 2WSMA 5LU8A 3QNMA 1YWGO 5HIKA 5EYPA 2CNBA 2D6FA 3FPSA 3RTDA 5JQGF 5EMMA 3NBYC 1NKSA 2R5WA 3F5FA 2R4UA 1EP2B 9MHTA 4BBPA 3PUJA 5E7IA 4WJKB 2OSBA 1FFHA 1V95A 4L5AA 1KO5A 1LS6A 2LGJA 1IVYA 4I5DA 5EHIA 1VDMA 2HSZA 2QQGA 3IAS1 2YXPX 3NAGA 4HAVA 4J3FA 1J2TA 4HUQA 3TCKA 3JAWA 5HCUA 3OIUA 3B6MA 4ND3A 2FWNA 1T1IA 2RI1A 3WMWA 1ULSA 2NPFA 1L5VA 4P32A 1Z29A 1URPA 1Z2PX 2C9OA 3I8OA 1QG4A 3O95A 4UDOA 3HVHA 1E5TA 4D2IA 1VKHA 3RYCB 3NHJA 5BN3A 3AESA 5DP2A 1XZJA 2Z2IA 2GOYA 1TO1E 4EYSA 3B6ZA 3CMMA 2O6HA 3D3NA 4QEDA 5DBFA 1WG8A 1ONSA 2C4KA 2WKQA 1G17A 3ME5A 3OWXA 2W6ID 4HDKB 3VR0A 5F77A 1OBCA 5AR1A 4RWEA 4CKWB 3B1WA 5A9SB 3FGZA 2O4UX 3Q12A 1E3LA 4HNRA 4BVHA 4FW9A 2OO5C 2ORYA 1CS0B 2PUVA 2JKYA 3MELA 3PJGA 1XTSA 3FB4A 3OZSA 2ILVA 3G1UA 1IOLA 1Q2XA 3P9CA 4UXJA 3T54A 1FCJA 5TEWA 3JWGA 4XB1A 4HX2A 1OI3A 3P96A 4WKOA 5AHRA 2F43B 1NJ5A 3EGVA 2XCTB 3TNJA 4B6PA 1EBBA 1WZCA 3CYFA 4H6XA 4RHCA 1KIFA 1NQVA 2COUA 4JVLA 3U48A 5CIQA 3FZNA 3KZCA 2ZBRA 4NKRA 5EIBC 4B8YA 3G8CA 3LOPA 3L02A 2PX3A 4YCMA 4BNNA 3IAHA 3MW8A 5BSMA 1ZGAA 3Q3IA 1HDCA 4DR2B 3LTNC 1J0EA 1CNMA 4H6VA 3VJRA 3BFKA 4AMYA 3AY7A 4UBJA 4QOEA 3A3OA 3EZ2A 2HCJB 2E5FA 3HUFA 1XZPA 1VXRA 1SK8A 1U04A 5H7XA 5CCBA 4DCOA 1ONNA 1ZNQO 1M2VA 3URKA 2HPVA 5K51A 5TR9A 1WKBA 3I53A 2D0OB 1G1AA 2NUBA 2YJ5A 2PZ8A 5L6LB 4PS0A 1COWD 4IIGA 5GJCA 2NO4A 2NO0A 2PFGA 4GIBA 4OBBA 4X1IB 3L05A 3QSGA 1ZO8A 3ZHSA 2R6JA 5L7WA 1J0CA 3NBQA 2HCRA 1T9DA 5JQGB 1ZA1A 1RM3A 2Q5EA 2JEOA 1S3GA 4JLAA 1KGDA 3RYIA 4ES6A 2HJ9A 3TE7A 1ISSA 3L2OB 4YJFB 1ZD1A 2XOKA 1FU8A 2P11A 1U0GA 2RG1A 5M2QA 3LQ4A 4QDXA 3IXQA 4QRIA 3WSVA 3U1TA 2O5CA 4KYVA 4PLTA 5F4ZA 1WHSB 5CB4A 2V98A 3KUKA 2R8BA 3ADPA 4HLQB 3ZU2A 4JD5A 3U2QA 4MH0R 5IBQA 4CMIA 4CF3A 1AUQA 2PNFA 3T3GA 1XMVA 3KZOA 2J8ZA 4K88A 2NVOA 3IBGA 5AW6A 2W8BA 1GGVA 2YNMA 3NTVA 4JENA 3S55A 2A0UA 4TZTA 2GXAA 1HQCA 1JDBB 2A4KA 2C83A 2NACA 4QELA 2UYGA 4KBFA 3SIXA 1BE8A 2R44A 3DDSA 1QH1B 1X9HA 1I51A 1KOJA 3OAAD 3B1VA 1RHMA 1X9IA 2D1RA 3TW8B 5BN3B 2CXXA 1YDWA 2J85A 2CV2A 4PR3A 1GVHA 4EB8A 3B7GA 2JIZD 3N7AA 2ANCA 2JGNA 4RVDA 2G76A 1M2EA 2R6AA 4JBWA 3SSNA 1RWMA 5CBPB 5BNZA 5H82A 2FMUA 1QP4A 4L8LA 1KDPA 2ZB7A 3LX4A 4Q3CA 4QWWA 3VGPA 5IARA 1J0BA 3VUFA 4DSZA 3ZDFA 3G0BA 1Y3HA 3IVGA 5CA1A 2O8BA 4RV5A 2DFPA 3G7SA 4NU8X 2J67A 3UJDA 3EGXB 1L7RA 3X1JA 2PUTA 1JAZA 1FW8A 5LMZA 2DP4E 1VHJA 2VEOA 4YJGB 1ISFA 1OLUA 3QXHA 4G1CA 3ODGA 3W77A 1W5SA 1YVUA 2G77B 3C1UA 4B3TB 4WUTA 5JD6A 1MG0A 3B2QA 4PO9A 4FN4A 2BONA 3LLCA 4NCNA 4PXSA 1TCAA 4WZZA 5ECYA 5THXA 4KXVA 3DD1A 3N0VA 1E4EB 4DQXA 1XDSA 3HJAA 3IO5A 1YT5A 4CLDA 4QA9A 4DMKA 5FBVB 3IEMA 4LTNA 1RLUA 3WIBA 3A0RB 3TDNA 2PGNA 3D6MA 2E49A 3G0DA 3SXUA 3A6JA 3MF4A 3ZOKA 1IM8A 1O54A 1WXGA 4K9RA 3H9JA 3V9PA 1NBIA 2C98A 4CZ2A 2GXUA 2VF4X 3EFOB 3GLKA 4HVLA 4Y6GB 3IBCA 4YMIA 3H9CA 1S8FA 1VB3A 3EAGA 3M4YA 1O94C 5A0FA 4DJAA 3ZY6A 3TYXA 1TUGA 3RTBA 3VU3A 3PJEA 5LMCA 3KVOA 4K6OA 4PZ0A 1RPAA 2BKLA 3PKIA 4FFOA 4C7JA 4URUR 4HDQB 2AB0A 3PQDA 5BNTA 4PX3A 3UMVA 1RI1A 4MKIA 4UU0A 1J1UA 2OFXA 4FKBA 3DMTA 3WNDA 1F9EA 2IV3A 3LQQA 2JJ8A 4TV9F