1MOYA

Streptavidin mutant with osteopontin hexapeptide insertion including rgd
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
125
Chain Sequence
b'GITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPGRGDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptavidin
publication title Structural characterization and comparison of RGD cell-adhesion recognition sites engineered into streptavidin.
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Biotin-binding protein
total genus 25
structure length 125
sequence length 127
ec nomenclature
pdb deposition date 2002-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1moyA00
2WPUA 3T6LA 2RTGB 2F01A 3VHIA 2C1QA 1RXJA 4JHQA 4GD9A 1LCZA 1N43A 1NC9A 1SWUA 2RTMA 1SRIA 1VWGB 1VWMB 2OF8A 4GJVA 5B5FA 1SRFA 2OFAA 1SRGA 2RTJA 1SWRA 3SZIA 4BBOA 1SWTA 4BJ8A 1SRJA 4OKAA 4Z6JA 4I60A 1N9YA 1RAVA 1SWEA 4GDAA 3RE5A 1SWDA 2IZCB 1HXZA 1VWBB 3RDUA 1VWQB 2IZIA 4Z2OA 4JNJA 1HQQA 1RXHA 4CPEA 4CPFA 1KL5A 1SWAA 1LCWA 1SWFA 5IRWA 3EW1A 2Y32A 1VWPB 3T2XA 5IRAA 5CHKA 1SWLA 1SWGA 1SWPA 1SLGB 2IZFB 1VWEB 4CPHB 3MM0A 5K68A 4BX5A 1N7YA 2GH7A 2RTFB 2IZEB 5B5GA 3WZPA 5K67A 2RTCB 3RDOA 4Z2VA 1STSB 1LCVA 5JD2A 1SWOA 1IJ8A 1Y52X 1Y55X 2OFBA 2RTDB 2Y3EA 1KL3A 1MM9A 4EKVA 3RY2A 3WZOA 1SWCA 5L3YA 2RTNB 4BX7A 4JO6A 2IZLB 5CSEA 1SWHA 2C4IA 3MG5A 4BX6A 2A5CA 1SWJA 1VWDB 1SWKA 1VWAB 1VWOB 4GJSA 4Z28A 2UYWA 5IRUA 2RTBB 1STPA 1WBIA 3SZHA 1VWLB 4GGTA 2IZAA 1SWSA 1VWNB 2AVIA 2RTAA 1LUQA 3WZQA 3WZNA 2RTQB 2RTHB 1MOYA 1VWRB 2RTKA 2ZSCA 3RDMA 1SLFB 3WYPA 1VWFB 1SWBA 2BC3A 1VYOA 2RTOB 1RXKA 1HY2A 1KFFA 2A5BA 1SLDB 1HXLA 2IZJA 3RY1A 2IZHB 1SRHA 1N4JA 3SZJA 3T2WA 3FDCA 4BX5B 2A8GA 2G5LA 3PK2A 3RDSA 1SWQA 1MK5A 2IZBA 1SREA 2OF9A 2RTEB 4BCSA 4IRWA 4YVBA 1I9HA 1NQNA 1RSTB 1VWKB 4U46A 4Y5DA 2Y3FA 4BX7B 3RE6A 1DF8A 1NBXA 1LDOA 1N9MA 3RDQA 3EW2A 4GGRA 3X00A 1SLEB 4DNEA 4Z2PA 1VWHB 4Y59A 4BX6B 2CAMA 2RTIB 2MF6A 2UZ2A 2RTRB 1VWJB 1NDJA 1VWCB 5F2BA 4CPIA 1Y53X 3VHHA 3WYQA 1AVEA 3VHMA 1PTSA 3VGWA 1MEPA 4CPHA 2C1SA 1KL4A 1NQMA 1RSUB 2IZGB 4Z27A 1LELA 2FHNX 3T6FA 1LDQA 2QCBA 2RTLA 3RDXA 1SWNA 2JGSA 4GGZA 1STRB 2IZDB 1AVDA 1VWIB 2RTPB 2FHLA 2IZKA
chains in the Genus database with same CATH superfamily
3D95A 4QQ1A 2R74A 3C77X 5HZ8A 2RTGB 4M6SA 2F01A 1SXYA 1RXJA 1BJ7A 1NC9A 1SWUA 3WVMA 4A1HA 1VWMB 1GT3A 1MX7A 4YGHA 2RCTA 3HPEA 4IB8A 2OFAA 1XCAA 4KH8A 4ORSA 1O1VA 2FWVA 2RTJA 3P02A 3SZIA 4BBOA 2HYSA 1CBIA 2F73A 1BEBA 3FENA 3NR3A 2XSTA 4OKAA 5B10O 4I60A 2MO5A 1JMXA 2X34A 4HPDA 1HXZA 1LFOA 3RDUA 1AELA 4IAXA 4YMYA 1SXXA 1T0VA 4GE1A 3B2KA 4MVEA 4JNJA 4ES7A 1RXHA 4CPEA 4O4UA 3LTWA 4LZVA 3OBLA 1U0XA 1SWFA 2QMIA 5IRWA 3EC5A 1E2TA 1HMTA 2DM5A 4U8UM 4AZOA 1CJ5A 4QGXA 1SXUA 1SWPA 4QAEA 1SLGB 3IFBA 2RQ0A 3CQRA 2OFMX 5K68A 2RA6A 4BX5A 5B5GA 2W2AA 3WZPA 1B0OA 2L9CA 1IKEA 1STSB 4YBUA 5JD2A 1GGLA 1TOWA 3MX7A 3VE1A 4EKVA 5HZQA 1KZXA 3WZOA 1GXAA 3FR2A 1SWCA 4CDFA 1A57A 5EPQA 2FLJA 3CKGA 2LBAA 4BX7A 2VDFA 2IZLB 1QG5A 3TZSA 1PMPA 4N7CA 3D4RA 2JMBA 4COTA 1OBUA 4LZUA 3STNA 5DPQA 2A5CA 3ZW0A 3SLOA 2A2UA 4XMEA 4CPHA 1KXOA 1VWDB 2R56A 1VWAB 5D8JA 3OE3A 3KQ0A 3PH5A 4GDZA 1DFVA 1ZNEA 3VG4A 2POAA 2A13A 1WBIA 2QOMA 4Y0QA 5D48A 1FEMA 2HZQA 3F9DA 3T1DA 2ASNX 4ZH6A 3VG6A 5F7GA 1VWLB 4GGTA 2A2GA 1DZPA 1HMSA 2IZAA 1VWNB 1LUQA 4ARHA 5KIDA 3HOEA 4NLJA 1SLFB 5B29A 1O1UA 3NQ3A 3FEPA 1YWCA 3U03A 2BS6A 2LBVA 1HY2A 2RCQA 1KFFA 4XMGA 3HOLA 3U9PC 3AUMO 1SLDB 5BVTA 2BSZA 1KQWA 3G7XA 1SRHA 2FR2A 2NNQA 2CZTA 2YMSA 4RUUA 4ZHHA 5FENA 1Z24A 5HWZA 2JU7A 2FT9A 4AZNA 1BSQA 3GAQA 1MK5A 4AZMA 1KQXA 4LQZA 2OVAA 4KCAA 3PECA 4CDEA 4IRWA 4YVBA 3KFIA 2HZRA 3DTQA 1AVGI 3JSQA 1IW2A 4BOEA 4OS3A 4TKBA 1HMRA 1OPBA 4Y5DA 4AYHA 4I9SA 4DNEA 4A8ZA 1KGLA 1SY0A 4MEEA 4JGLA 4EEJA 2MF6A 5D47A 5LKFA 1VWCB 4L3RA 4OMWA 5EZ2A 4A1YA 4CV7A 4FQBB 4GNYA 4QGVA 4NW4A 2KW1A 3APVA 4INNA 4Z27A 1ZNKA 5FQ7E 1KL4A 2WEWA 1LELA 1K24A 1CBQA 2MJIA 2GTFX 1ML7A 2QCBA 4TNNA 4MISA 4UU2A 1HN2A 1STRB 2IZDB 5H9KA 4IBAA 3PQSA 2FHLA 2IZKA 4NLIA 2QO5A 2WQAE 5HCEC 3FA9A 2OVEA 4OEMA 4JHQA 4GD9A 1LCZA 2VFBA 1EUOA 2HKDA 2RTMA 4N7DA 1GX9A 2ALLX 1BRPA 2LB6A 4ZFXA 3PPTA 1L6MA 1QY2A 1G7NA 5B5FA 4ALOA 2N93A 1E06A 3C76X 1SRFA 3WBGA 1SRGA 3ZQ3A 2AT8X 1X8QA 1HBPA 3S5VA 4BJ8A 1KZWA 3FLLA 1GKAB 1ICNA 1N9YA 2JN3A 2RD7C 4TQ2A 3RE5A 1T8VA 2G7BA 1SWDA 2MM3A 3B2JA 4NYQA 5CYBA 4MVIA 2WEXA 1OEJA 2L67A 4IB9A 1HQQA 1PBYA 2AT3X 4CPFA 1I78A 4OS0A 1ZNLA 1ZNGA 1JYDA 1VWPB 2YG2A 5FFHA 5IRAA 3RSWA 3LHNA 3ZW1A 1SWLA 2HNXA 1NP1A 2IZFB 5H8TA 3WJCA 4AW8A 3HWDA 4K19A 1S44A 1YWBA 4ORWA 1LIEA 1MX8A 2NNDA 2GH7A 2L5PA 5AJBA 2WUTA 3U0DA 3UEVA 1BM5A 3ELXA 1FJ1E 1H91A 2G8CO 3RDOA 1ERBA 1SWOA 2RTDB 1GX3A 2AKQA 2AT6X 1KL3A 1AQBA 1MM9A 1Y9TA 2WWPA 3NADA 5IO6A 3EMMA 2A0AA 2RTNB 3ZI8A 3VG7A 1DZKA 4QNIA 1GM6A 2OZQA 2AH7X 3FA6A 1YP6A 2C4IA 4NNTA 4CSBA 3MG5A 4A60A 5HZ5A 1ADLA 4Z28A 3WJDA 1JV4A 3KFFA 1STPA 2QM9A 3SLJA 4EQAC 3SZHA 1E5PA 3IA8A 3RKGA 1VYFA 2JU8A 1SWSA 2JW1A 3TGBA 2A3FX 2AVIA 2RTAA 1I4UA 2RTQB 2BS5A 1DZMA 1MOYA 1VWRB 3L4RA 3KVNA 5FAZA 3WYPA 3RWXA 1I05A 5HZ9A 1D3SA 1R0UA 1W6FA 1U17A 3FMZA 2RTOB 3NX2A 3NX1A 4O3ZA 2A5BA 4GZVA 2WQ9A 2R73A 4YDAA 2AT5X 4YBPA 4QZTA 1HXLA 2VFCA 3I0AA 3RY1A 2Q2MA 1BSYA 2ACOA 2OL8O 3BDRA 1PEEA 3T2WA 3TGAA 3FDCA 2CM4A 2G5LA 1A3YA 4ODDA 4MVKA 5H9AA 5HCDC 1CRBA 1SREA 4O4OA 5L8NA 2OL6O 4YH0A 1EPAA 3HWGA 4WBKA 1I9HA 1Y0GA 2GTLO 5BYPA 3BX8A 3FEKA 3P6CA 4HPAA 1NQNA 1RSTB 1OBQA 2RN4A 4I3BA 2P8GA 1AB0A 3APUA 4R0BA 1DF8A 4PJ2A 2OYBO 1X8PA 3UEWA 3BU9A 3EW2A 3PEDA 1ICMA 1TVQA 2LA7A 4GNWA 1VWHB 4ORYA 3AEHA 4WFUA 4BX6B 5JR8A 5LJKA 4KC7A 4OELA 4YDBA 2RTRB 1HQPA 3DSZA 5D45A 5HAEA 3RZYA 3WYQA 2MWHA 2BHVA 2I5VO 2X55A 1G85A 1QQSA 3CBSA 1NGLA 4HPBA 1VYGA 2FKGA 3VHMA 4ZGUA 4FBVA 1ERXA 1FENA 1EXSA 1BSOA 1LDQA 3SOTA 4ORUA 1SWNA 2XKLA 2PI3O 4L1NA 4UU3A 1LIBA 2RTPB 2X8TA 1JBHA 1W5RA 1IFBA 2AF5A 1DZJA 1IKJA 4Y0SA 1W4TA 3D9WA 4XMDA 5AQ6A 4IMOA 2C1QA 4QYPA 4KT5A 3VHIA 4IB7A 1KT3A 2GC9A 3SAOA 2OY1O 3WJEA 1EIOA 1N43A 1TOUA 4ZH9A 4O3XB 1KOIA 1KT7A 2CZUA 5AEOA 3WJBA 2OF8A 5IO5A 1MVGA 5L8OA 3E3CA 5B2AO 2G78A 3EBKA 1CBRA 1LIFA 2AL0X 1RBPA 1SMPI 3P6HA 4KIIA 4RUNA 4YCHA 5EDCA 4BVMA 3TGCA 1JJXA 3B2HA 2AMMX 2JOZA 4U8UO 2ACPX 1EQDA 4YFQA 2FS7A 4GDAA 5KHPA 2QO6A 1KT5A 4WHIA 1I04A 4I95A 3VG5A 1BLRA 2GTLN 3FIDA 2NNEA 3VPJE 4ZHFA 3FR5A 3ZUOA 1KL5A 1SY2A 4QZUA 5CE4A 3O19A 4BQUA 5HTEA 3T2XA 1JIWI 3V8UA 5FQ8E 4O3YA 1B4MA 1DC9A 1GX8A 3HTYA 3CQNA 1ACDA 2OY8A 1I06A 1IIUA 4O4SA 4CPHB 4ZHGA 2WR6A 3C78X 1LIDA 1TW4A 1YWDA 4B55A 2FTBA 2RTFB 3P6EA 1QFTA 4Y0RA 4ZJ0A 5K67A 2RTCB 3N91A 1MDCA 3BX7A 2QO4A 3PDFA 4NNSA 4AZRA 5LJHA 1BWYA 1IJ8A 2OFBA 1Y55X 2X46A 1EPBA 2Y3EA 3BRNA 1LF7A 5F58A 1GT1A 1ZNHA 4FBOA 4ML7B 5L3YA 2FGSA 5H9LA 1LICA 4JO6A 3WOVA 5LJGA 1SWHA 2OY5O 1B8EA 2KTDA 3UAQA 4ZHDA 3MBTA 5DG4A 3TF6A 3LV4A 4WFVA 5HTDA 3BLGA 2ANSA 1SWKA 3PP6A 4GUZA 3JQOA 1VWOB 2GJ5A 3HK1A 3ZZVA 5D4AA 2UYWA 4MIRA 5F1EA 2RTBB 3KZAA 5C0NA 4YFRA 1FDQA 5L8IA 5EDBA 3VE2A 4ZR2A 5LJCA 4TJZA 3NQKA 4DCBA 2Q9SA 3WJFA 1PBOA 3WZNA 4U8UN 3NPOA 3GE2A 2RTHB 1T68X 4O49A 4FBRA 3KFHA 1YUPA 2I5ZO 1VYOA 3HWFA 1RXKA 1OBPA 1UREA 3P6GA 2KT4B 2X4MA 3FYFA 5HA0A 4KC8A 2FR3A 3B2LA 2OVSA 3CMPA 1TXLA 3STMX 1KT4A 4Z2PA 4BX5B 1X8UA 3VG2A 1FE3A 3F8AA 3MVFA 2LKKA 5HBSA 5B3MO 3EYCA 4C5PA 4YGGA 5F6ZA 5B27A 3ZW2A 4AZPA 1GT5A 1JYJA 1E02A 3CR6A 3FW4A 4I3CA 1GKAA 5AJCA 5LKEA 3UEUA 2HMBA 1X89A 4EXZA 4GRJA 2QOSC 4BX7B 3RE6A 4GKCA 1PM1X 1G5WA 5KICA 3X00A 3ZW0B 3HWEA 4CK4A 1XKIA 2CAMA 2RTIB 3F6ZB 2UZ2A 3ZUIA 5LJBA 1VWJB 1NDJA 4I9RA 1SA8A 5F2BA 1HBQA 3ZWEA 1IFCA 1Y53X 2IFBA 3FELA 3VHHA 4CPIA 1AVEA 1U18A 3VGWA 4MVLA 1OEEA 5HCCC 4DQ3A 1NQMA 1RSUB 4QRLA 3T6FA 3EM0A 4ID2A 2RTLA 3RDXA 2JGSA 4QGWA 5HZ6A 2ZAIA 1AVDA 2CBSA 4YCEA 3BU1A 3VG3A 2WPUA 4ZGFA 1QY0A 1RLBE 1G74A 3T6LA 4CDDA 3EBWA 4ALBA 4IABA 4GH7A 2K62A 1K3BA 3FA8A 2FS6A 3PH6A 3D97A 4XMFA 1SRIA 1VWGB 2EU7X 3CKFA 4D6AA 4TKHA 1YIVA 4GJVA 4YGZA 4DQ4A 4FGIB 2O62A 4ON1A 1JJUA 1SWRA 2Q39A 2X8FA 1P6PA 1SWTA 2G79A 3APWA 1SRJA 3S5XA 1SY3A 2ZAGA 3WXQA 4Z6JA 1SY1A 4LKTA 3RBYA 4I3DA 1RAVA 1SWEA 2FRSA 3B2IA 3NQ9A 3QQ2A 2Q2PA 2IZCB 3OJYC 4O9SA 1VWBB 3P24A 4ZHCA 1VWQB 2IZIA 4Z2OA 1D2UA 5FQ6E 4I6SA 1B56A 5K06A 1EALA 1UYOX 3AKNA 1SWAA 3AKMA 1LCWA 3PQUA 4QYNA 3EW1A 4U3QA 2KD2A 2X45A 1BBPA 3BY0A 2Y32A 5F6BA 5HA1A 1BRQA 2NP1A 3Q6LA 5CHKA 3UEXA 3S26A 1N0SA 1O8VA 1SWGA 1A2DA 3APXA 1VWEB 4GK9A 4YFPA 4CDCA 4TKJA 1DV9A 4D6BA 3MM0A 1N7YA 2IZEB 5EEDA 2OVDA 2Q4NA 4HWMA 3K3LA 3D96A 1OSPO 3H3IA 1X8OA 5BVSA 4Z2VA 1LCVA 2Z4HA 1JJJA 1Y52X 3FA7A 4U9CA 4HPCA 3RY2A 1CBSA 3FR4A 2FKJA 4LKPA 4O4XA 4GU8A 5CSEA 4AZQA 2X56A 2OY7A 4EFGA 3OD9A 3STKA 4BX6A 1SWJA 3KFGA 4YKOA 1JQPA 3S60A 1Y9LA 4GJSA 2F09A 5B11O 3SLTA 5IRUA 3P6FA 2WSJA 2L68A 3FIQA 1GT4A 1S7DA 2LFOA 4TLJA 5H9NA 1S2PA 3WZQA 1QWDA 1EI5A 4M7MA 4NP1A 2RTKA 2ZSCA 3RDMA 4IB6A 1VWFB 1X8NA 1SWBA 3ELZA 2BC3A 1QFVA 2K23A 4YKMA 1ZNDA 2MHDA 2W2FA 1A18A 1WUBA 5BVQA 2AT0X 2IZJA 3QKGA 4XMHA 3ZW1B 1DF3A 2IZHB 3NP1A 4ZCBA 1N4JA 5EEEA 3SZJA 4O3WA 1YP7A 1LPJA 2X8SA 5IXGA 1EW3A 1JZUA 2A8GA 1FTPA 3CWKA 3PK2A 1SWQA 2Z4IA 2IZBA 2CM9A 4OS8A 3RDSA 1ZRYA 1KT6A 2OF9A 2RTEB 2OFRX 3P6DA 1E00A 2HLVA 4OMXA 4BCSA 3FW5A 1X71A 2M4LA 4U46A 1VWKB 4ORXA 2Y3FA 3O2YA 1UYNX 4GETA 1NBXA 4IMNA 1LDOA 1N9MA 2BLGA 4GGRA 4HFOA 3RDQA 1SLEB 1EIIA 4Y59A 4EDEA 1FELA 2DJGA 2X32A 3I17A 1YWAA 4BGFA 3Q34A 1OPAA 2OL7A 2GTLM 1NP4A 1QY1A 4Y0PA 1ALBA 2BT9A 1UZ2X 4IAWA 3VU1A 4NYRA 1MUPA 3WJGA 1SXWA 5IO7A 1LKEA 1PTSA 5LJEA 1MEPA 2JU3A 2C1SA 3NBXX 3BSZE 2E4JA 2IZGB 3O22A 1JMZA 2FHNX 4PSQA 2DJFA 5LJDA 4ORRA 1LNMA 2CBRA 2W2BA 2PY1A 4GGZA 4NV8A 3BS2A 1VWIB 1QABE 3CBCA 2KTSA 4XMCA 1OEKA 1VPRA 3JS1A 4NV7A
chains in the Genus database with same CATH topology
2WPUA 3T6LA 2RTGB 2F01A 3VHIA 2C1QA 1RXJA 4JHQA 4GD9A 1LCZA 1N43A 1NC9A 1SWUA 2RTMA 1SRIA 1VWGB 1VWMB 2OF8A 4GJVA 5B5FA 1SRFA 2OFAA 1SRGA 2RTJA 1SWRA 3SZIA 4BBOA 1SWTA 4BJ8A 1SRJA 4OKAA 4Z6JA 4I60A 1N9YA 1RAVA 1SWEA 4GDAA 3RE5A 1SWDA 2IZCB 1HXZA 1VWBB 3RDUA 1VWQB 2IZIA 4Z2OA 4JNJA 1HQQA 1RXHA 4CPEA 4CPFA 1KL5A 1SWAA 1LCWA 1SWFA 5IRWA 3EW1A 2Y32A 1VWPB 3T2XA 5IRAA 5CHKA 1SWLA 1SWGA 1SWPA 1SLGB 2IZFB 1VWEB 4CPHB 3MM0A 5K68A 4BX5A 1N7YA 2GH7A 2RTFB 2IZEB 5B5GA 3WZPA 5K67A 2RTCB 3RDOA 4Z2VA 1STSB 1LCVA 5JD2A 1SWOA 1IJ8A 1Y52X 1Y55X 2OFBA 2RTDB 2Y3EA 1KL3A 1MM9A 4EKVA 3RY2A 3WZOA 1SWCA 5L3YA 2RTNB 4BX7A 4JO6A 2IZLB 5CSEA 1SWHA 2C4IA 3MG5A 4BX6A 2A5CA 1SWJA 1VWDB 1SWKA 1VWAB 1VWOB 4GJSA 4Z28A 2UYWA 5IRUA 2RTBB 1STPA 1WBIA 3SZHA 1VWLB 4GGTA 2IZAA 1SWSA 1VWNB 2AVIA 2RTAA 1LUQA 3WZQA 3WZNA 2RTQB 2RTHB 1MOYA 1VWRB 2RTKA 2ZSCA 3RDMA 1SLFB 3WYPA 1VWFB 1SWBA 2BC3A 1VYOA 2RTOB 1RXKA 1HY2A 1KFFA 2A5BA 1SLDB 1HXLA 2IZJA 3RY1A 2IZHB 1SRHA 1N4JA 3SZJA 3T2WA 3FDCA 4BX5B 2A8GA 2G5LA 3PK2A 3RDSA 1SWQA 1MK5A 2IZBA 1SREA 2OF9A 2RTEB 4BCSA 4IRWA 4YVBA 1I9HA 1NQNA 1RSTB 1VWKB 4U46A 4Y5DA 2Y3FA 4BX7B 3RE6A 1DF8A 1NBXA 1LDOA 1N9MA 3RDQA 3EW2A 4GGRA 3X00A 1SLEB 4DNEA 4Z2PA 1VWHB 4Y59A 4BX6B 2CAMA 2RTIB 2MF6A 2UZ2A 2RTRB 1VWJB 1NDJA 1VWCB 5F2BA 4CPIA 1Y53X 3VHHA 3WYQA 1AVEA 3VHMA 1PTSA 3VGWA 1MEPA 4CPHA 2C1SA 1KL4A 1NQMA 1RSUB 2IZGB 4Z27A 1LELA 2FHNX 3T6FA 1LDQA 2QCBA 2RTLA 3RDXA 1SWNA 2JGSA 4GGZA 1STRB 2IZDB 1AVDA 1VWIB 2RTPB 2FHLA 2IZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPU A;  3T6L A;  2RTG B;  2F01 A;  3VHI A;  2C1Q A;  1RXJ A;  4JHQ A;  4GD9 A;  1LCZ A;  1N43 A;  1NC9 A;  1SWU A;  2RTM A;  1SRI A;  1VWG B;  1VWM B;  2OF8 A;  4GJV A;  5B5F A;  1SRF A;  2OFA A;  1SRG A;  2RTJ A;  1SWR A;  3SZI A;  4BBO A;  1SWT A;  4BJ8 A;  1SRJ A;  4OKA A;  4Z6J A;  4I60 A;  1N9Y A;  1RAV A;  1SWE A;  4GDA A;  3RE5 A;  1SWD A;  2IZC B;  1HXZ A;  1VWB B;  3RDU A;  1VWQ B;  2IZI A;  4Z2O A;  4JNJ A;  1HQQ A;  1RXH A;  4CPE A;  4CPF A;  1KL5 A;  1SWA A;  1LCW A;  1SWF A;  5IRW A;  3EW1 A;  2Y32 A;  1VWP B;  3T2X A;  5IRA A;  5CHK A;  1SWL A;  1SWG A;  1SWP A;  1SLG B;  2IZF B;  1VWE B;  4CPH B;  3MM0 A;  5K68 A;  4BX5 A;  1N7Y A;  2GH7 A;  2RTF B;  2IZE B;  5B5G A;  3WZP A;  5K67 A;  2RTC B;  3RDO A;  4Z2V A;  1STS B;  1LCV A;  5JD2 A;  1SWO A;  1IJ8 A;  1Y52 X;  1Y55 X;  2OFB A;  2RTD B;  2Y3E A;  1KL3 A;  1MM9 A;  4EKV A;  3RY2 A;  3WZO A;  1SWC A;  5L3Y A;  2RTN B;  4BX7 A;  4JO6 A;  2IZL B;  5CSE A;  1SWH A;  2C4I A;  3MG5 A;  4BX6 A;  2A5C A;  1SWJ A;  1VWD B;  1SWK A;  1VWA B;  1VWO B;  4GJS A;  4Z28 A;  2UYW A;  5IRU A;  2RTB B;  1STP A;  1WBI A;  3SZH A;  1VWL B;  4GGT A;  2IZA A;  1SWS A;  1VWN B;  2AVI A;  2RTA A;  1LUQ A;  3WZQ A;  3WZN A;  2RTQ B;  2RTH B;  1MOY A;  1VWR B;  2RTK A;  2ZSC A;  3RDM A;  1SLF B;  3WYP A;  1VWF B;  1SWB A;  2BC3 A;  1VYO A;  2RTO B;  1RXK A;  1HY2 A;  1KFF A;  2A5B A;  1SLD B;  1HXL A;  2IZJ A;  3RY1 A;  2IZH B;  1SRH A;  1N4J A;  3SZJ A;  3T2W A;  3FDC A;  4BX5 B;  2A8G A;  2G5L A;  3PK2 A;  3RDS A;  1SWQ A;  1MK5 A;  2IZB A;  1SRE A;  2OF9 A;  2RTE B;  4BCS A;  4IRW A;  4YVB A;  1I9H A;  1NQN A;  1RST B;  1VWK B;  4U46 A;  4Y5D A;  2Y3F A;  4BX7 B;  3RE6 A;  1DF8 A;  1NBX A;  1LDO A;  1N9M A;  3RDQ A;  3EW2 A;  4GGR A;  3X00 A;  1SLE B;  4DNE A;  4Z2P A;  1VWH B;  4Y59 A;  4BX6 B;  2CAM A;  2RTI B;  2MF6 A;  2UZ2 A;  2RTR B;  1VWJ B;  1NDJ A;  1VWC B;  5F2B A;  4CPI A;  1Y53 X;  3VHH A;  3WYQ A;  1AVE A;  3VHM A;  1PTS A;  3VGW A;  1MEP A;  4CPH A;  2C1S A;  1KL4 A;  1NQM A;  1RSU B;  2IZG B;  4Z27 A;  1LEL A;  2FHN X;  3T6F A;  1LDQ A;  2QCB A;  2RTL A;  3RDX A;  1SWN A;  2JGS A;  4GGZ A;  1STR B;  2IZD B;  1AVD A;  1VWI B;  2RTP B;  2FHL A;  2IZK A; 
#chains in the Genus database with same CATH topology
 3D95 A;  4QQ1 A;  2R74 A;  3C77 X;  5HZ8 A;  2RTG B;  4M6S A;  2F01 A;  1SXY A;  1RXJ A;  1BJ7 A;  1NC9 A;  1SWU A;  3WVM A;  4A1H A;  1VWM B;  1GT3 A;  1MX7 A;  4YGH A;  2RCT A;  3HPE A;  4IB8 A;  2OFA A;  1XCA A;  4KH8 A;  4ORS A;  1O1V A;  2FWV A;  2RTJ A;  3P02 A;  3SZI A;  4BBO A;  2HYS A;  1CBI A;  2F73 A;  1BEB A;  3FEN A;  3NR3 A;  2XST A;  4OKA A;  5B10 O;  4I60 A;  2MO5 A;  1JMX A;  2X34 A;  4HPD A;  1HXZ A;  1LFO A;  3RDU A;  1AEL A;  4IAX A;  4YMY A;  1SXX A;  1T0V A;  4GE1 A;  3B2K A;  4MVE A;  4JNJ A;  4ES7 A;  1RXH A;  4CPE A;  4O4U A;  3LTW A;  4LZV A;  3OBL A;  1U0X A;  1SWF A;  2QMI A;  5IRW A;  3EC5 A;  1E2T A;  1HMT A;  2DM5 A;  4U8U M;  4AZO A;  1CJ5 A;  4QGX A;  1SXU A;  1SWP A;  4QAE A;  1SLG B;  3IFB A;  2RQ0 A;  3CQR A;  2OFM X;  5K68 A;  2RA6 A;  4BX5 A;  5B5G A;  2W2A A;  3WZP A;  1B0O A;  2L9C A;  1IKE A;  1STS B;  4YBU A;  5JD2 A;  1GGL A;  1TOW A;  3MX7 A;  3VE1 A;  4EKV A;  5HZQ A;  1KZX A;  3WZO A;  1GXA A;  3FR2 A;  1SWC A;  4CDF A;  1A57 A;  5EPQ A;  2FLJ A;  3CKG A;  2LBA A;  4BX7 A;  2VDF A;  2IZL B;  1QG5 A;  3TZS A;  1PMP A;  4N7C A;  3D4R A;  2JMB A;  4COT A;  1OBU A;  4LZU A;  3STN A;  5DPQ A;  2A5C A;  3ZW0 A;  3SLO A;  2A2U A;  4XME A;  4CPH A;  1KXO A;  1VWD B;  2R56 A;  1VWA B;  5D8J A;  3OE3 A;  3KQ0 A;  3PH5 A;  4GDZ A;  1DFV A;  1ZNE A;  3VG4 A;  2POA A;  2A13 A;  1WBI A;  2QOM A;  4Y0Q A;  5D48 A;  1FEM A;  2HZQ A;  3F9D A;  3T1D A;  2ASN X;  4ZH6 A;  3VG6 A;  5F7G A;  1VWL B;  4GGT A;  2A2G A;  1DZP A;  1HMS A;  2IZA A;  1VWN B;  1LUQ A;  4ARH A;  5KID A;  3HOE A;  4NLJ A;  1SLF B;  5B29 A;  1O1U A;  3NQ3 A;  3FEP A;  1YWC A;  3U03 A;  2BS6 A;  2LBV A;  1HY2 A;  2RCQ A;  1KFF A;  4XMG A;  3HOL A;  3U9P C;  3AUM O;  1SLD B;  5BVT A;  2BSZ A;  1KQW A;  3G7X A;  1SRH A;  2FR2 A;  2NNQ A;  2CZT A;  2YMS A;  4RUU A;  4ZHH A;  5FEN A;  1Z24 A;  5HWZ A;  2JU7 A;  2FT9 A;  4AZN A;  1BSQ A;  3GAQ A;  1MK5 A;  4AZM A;  1KQX A;  4LQZ A;  2OVA A;  4KCA A;  3PEC A;  4CDE A;  4IRW A;  4YVB A;  3KFI A;  2HZR A;  3DTQ A;  1AVG I;  3JSQ A;  1IW2 A;  4BOE A;  4OS3 A;  4TKB A;  1HMR A;  1OPB A;  4Y5D A;  4AYH A;  4I9S A;  4DNE A;  4A8Z A;  1KGL A;  1SY0 A;  4MEE A;  4JGL A;  4EEJ A;  2MF6 A;  5D47 A;  5LKF A;  1VWC B;  4L3R A;  4OMW A;  5EZ2 A;  4A1Y A;  4CV7 A;  4FQB B;  4GNY A;  4QGV A;  4NW4 A;  2KW1 A;  3APV A;  4INN A;  4Z27 A;  1ZNK A;  5FQ7 E;  1KL4 A;  2WEW A;  1LEL A;  1K24 A;  1CBQ A;  2MJI A;  2GTF X;  1ML7 A;  2QCB A;  4TNN A;  4MIS A;  4UU2 A;  1HN2 A;  1STR B;  2IZD B;  5H9K A;  4IBA A;  3PQS A;  2FHL A;  2IZK A;  4NLI A;  2QO5 A;  2WQA E;  5HCE C;  3FA9 A;  2OVE A;  4OEM A;  4JHQ A;  4GD9 A;  1LCZ A;  2VFB A;  1EUO A;  2HKD A;  2RTM A;  4N7D A;  1GX9 A;  2ALL X;  1BRP A;  2LB6 A;  4ZFX A;  3PPT A;  1L6M A;  1QY2 A;  1G7N A;  5B5F A;  4ALO A;  2N93 A;  1E06 A;  3C76 X;  1SRF A;  3WBG A;  1SRG A;  3ZQ3 A;  2AT8 X;  1X8Q A;  1HBP A;  3S5V A;  4BJ8 A;  1KZW A;  3FLL A;  1GKA B;  1ICN A;  1N9Y A;  2JN3 A;  2RD7 C;  4TQ2 A;  3RE5 A;  1T8V A;  2G7B A;  1SWD A;  2MM3 A;  3B2J A;  4NYQ A;  5CYB A;  4MVI A;  2WEX A;  1OEJ A;  2L67 A;  4IB9 A;  1HQQ A;  1PBY A;  2AT3 X;  4CPF A;  1I78 A;  4OS0 A;  1ZNL A;  1ZNG A;  1JYD A;  1VWP B;  2YG2 A;  5FFH A;  5IRA A;  3RSW A;  3LHN A;  3ZW1 A;  1SWL A;  2HNX A;  1NP1 A;  2IZF B;  5H8T A;  3WJC A;  4AW8 A;  3HWD A;  4K19 A;  1S44 A;  1YWB A;  4ORW A;  1LIE A;  1MX8 A;  2NND A;  2GH7 A;  2L5P A;  5AJB A;  2WUT A;  3U0D A;  3UEV A;  1BM5 A;  3ELX A;  1FJ1 E;  1H91 A;  2G8C O;  3RDO A;  1ERB A;  1SWO A;  2RTD B;  1GX3 A;  2AKQ A;  2AT6 X;  1KL3 A;  1AQB A;  1MM9 A;  1Y9T A;  2WWP A;  3NAD A;  5IO6 A;  3EMM A;  2A0A A;  2RTN B;  3ZI8 A;  3VG7 A;  1DZK A;  4QNI A;  1GM6 A;  2OZQ A;  2AH7 X;  3FA6 A;  1YP6 A;  2C4I A;  4NNT A;  4CSB A;  3MG5 A;  4A60 A;  5HZ5 A;  1ADL A;  4Z28 A;  3WJD A;  1JV4 A;  3KFF A;  1STP A;  2QM9 A;  3SLJ A;  4EQA C;  3SZH A;  1E5P A;  3IA8 A;  3RKG A;  1VYF A;  2JU8 A;  1SWS A;  2JW1 A;  3TGB A;  2A3F X;  2AVI A;  2RTA A;  1I4U A;  2RTQ B;  2BS5 A;  1DZM A;  1MOY A;  1VWR B;  3L4R A;  3KVN A;  5FAZ A;  3WYP A;  3RWX A;  1I05 A;  5HZ9 A;  1D3S A;  1R0U A;  1W6F A;  1U17 A;  3FMZ A;  2RTO B;  3NX2 A;  3NX1 A;  4O3Z A;  2A5B A;  4GZV A;  2WQ9 A;  2R73 A;  4YDA A;  2AT5 X;  4YBP A;  4QZT A;  1HXL A;  2VFC A;  3I0A A;  3RY1 A;  2Q2M A;  1BSY A;  2ACO A;  2OL8 O;  3BDR A;  1PEE A;  3T2W A;  3TGA A;  3FDC A;  2CM4 A;  2G5L A;  1A3Y A;  4ODD A;  4MVK A;  5H9A A;  5HCD C;  1CRB A;  1SRE A;  4O4O A;  5L8N A;  2OL6 O;  4YH0 A;  1EPA A;  3HWG A;  4WBK A;  1I9H A;  1Y0G A;  2GTL O;  5BYP A;  3BX8 A;  3FEK A;  3P6C A;  4HPA A;  1NQN A;  1RST B;  1OBQ A;  2RN4 A;  4I3B A;  2P8G A;  1AB0 A;  3APU A;  4R0B A;  1DF8 A;  4PJ2 A;  2OYB O;  1X8P A;  3UEW A;  3BU9 A;  3EW2 A;  3PED A;  1ICM A;  1TVQ A;  2LA7 A;  4GNW A;  1VWH B;  4ORY A;  3AEH A;  4WFU A;  4BX6 B;  5JR8 A;  5LJK A;  4KC7 A;  4OEL A;  4YDB A;  2RTR B;  1HQP A;  3DSZ A;  5D45 A;  5HAE A;  3RZY A;  3WYQ A;  2MWH A;  2BHV A;  2I5V O;  2X55 A;  1G85 A;  1QQS A;  3CBS A;  1NGL A;  4HPB A;  1VYG A;  2FKG A;  3VHM A;  4ZGU A;  4FBV A;  1ERX A;  1FEN A;  1EXS A;  1BSO A;  1LDQ A;  3SOT A;  4ORU A;  1SWN A;  2XKL A;  2PI3 O;  4L1N A;  4UU3 A;  1LIB A;  2RTP B;  2X8T A;  1JBH A;  1W5R A;  1IFB A;  2AF5 A;  1DZJ A;  1IKJ A;  4Y0S A;  1W4T A;  3D9W A;  4XMD A;  5AQ6 A;  4IMO A;  2C1Q A;  4QYP A;  4KT5 A;  3VHI A;  4IB7 A;  1KT3 A;  2GC9 A;  3SAO A;  2OY1 O;  3WJE A;  1EIO A;  1N43 A;  1TOU A;  4ZH9 A;  4O3X B;  1KOI A;  1KT7 A;  2CZU A;  5AEO A;  3WJB A;  2OF8 A;  5IO5 A;  1MVG A;  5L8O A;  3E3C A;  5B2A O;  2G78 A;  3EBK A;  1CBR A;  1LIF A;  2AL0 X;  1RBP A;  1SMP I;  3P6H A;  4KII A;  4RUN A;  4YCH A;  5EDC A;  4BVM A;  3TGC A;  1JJX A;  3B2H A;  2AMM X;  2JOZ A;  4U8U O;  2ACP X;  1EQD A;  4YFQ A;  2FS7 A;  4GDA A;  5KHP A;  2QO6 A;  1KT5 A;  4WHI A;  1I04 A;  4I95 A;  3VG5 A;  1BLR A;  2GTL N;  3FID A;  2NNE A;  3VPJ E;  4ZHF A;  3FR5 A;  3ZUO A;  1KL5 A;  1SY2 A;  4QZU A;  5CE4 A;  3O19 A;  4BQU A;  5HTE A;  3T2X A;  1JIW I;  3V8U A;  5FQ8 E;  4O3Y A;  1B4M A;  1DC9 A;  1GX8 A;  3HTY A;  3CQN A;  1ACD A;  2OY8 A;  1I06 A;  1IIU A;  4O4S A;  4CPH B;  4ZHG A;  2WR6 A;  3C78 X;  1LID A;  1TW4 A;  1YWD A;  4B55 A;  2FTB A;  2RTF B;  3P6E A;  1QFT A;  4Y0R A;  4ZJ0 A;  5K67 A;  2RTC B;  3N91 A;  1MDC A;  3BX7 A;  2QO4 A;  3PDF A;  4NNS A;  4AZR A;  5LJH A;  1BWY A;  1IJ8 A;  2OFB A;  1Y55 X;  2X46 A;  1EPB A;  2Y3E A;  3BRN A;  1LF7 A;  5F58 A;  1GT1 A;  1ZNH A;  4FBO A;  4ML7 B;  5L3Y A;  2FGS A;  5H9L A;  1LIC A;  4JO6 A;  3WOV A;  5LJG A;  1SWH A;  2OY5 O;  1B8E A;  2KTD A;  3UAQ A;  4ZHD A;  3MBT A;  5DG4 A;  3TF6 A;  3LV4 A;  4WFV A;  5HTD A;  3BLG A;  2ANS A;  1SWK A;  3PP6 A;  4GUZ A;  3JQO A;  1VWO B;  2GJ5 A;  3HK1 A;  3ZZV A;  5D4A A;  2UYW A;  4MIR A;  5F1E A;  2RTB B;  3KZA A;  5C0N A;  4YFR A;  1FDQ A;  5L8I A;  5EDB A;  3VE2 A;  4ZR2 A;  5LJC A;  4TJZ A;  3NQK A;  4DCB A;  2Q9S A;  3WJF A;  1PBO A;  3WZN A;  4U8U N;  3NPO A;  3GE2 A;  2RTH B;  1T68 X;  4O49 A;  4FBR A;  3KFH A;  1YUP A;  2I5Z O;  1VYO A;  3HWF A;  1RXK A;  1OBP A;  1URE A;  3P6G A;  2KT4 B;  2X4M A;  3FYF A;  5HA0 A;  4KC8 A;  2FR3 A;  3B2L A;  2OVS A;  3CMP A;  1TXL A;  3STM X;  1KT4 A;  4Z2P A;  4BX5 B;  1X8U A;  3VG2 A;  1FE3 A;  3F8A A;  3MVF A;  2LKK A;  5HBS A;  5B3M O;  3EYC A;  4C5P A;  4YGG A;  5F6Z A;  5B27 A;  3ZW2 A;  4AZP A;  1GT5 A;  1JYJ A;  1E02 A;  3CR6 A;  3FW4 A;  4I3C A;  1GKA A;  5AJC A;  5LKE A;  3UEU A;  2HMB A;  1X89 A;  4EXZ A;  4GRJ A;  2QOS C;  4BX7 B;  3RE6 A;  4GKC A;  1PM1 X;  1G5W A;  5KIC A;  3X00 A;  3ZW0 B;  3HWE A;  4CK4 A;  1XKI A;  2CAM A;  2RTI B;  3F6Z B;  2UZ2 A;  3ZUI A;  5LJB A;  1VWJ B;  1NDJ A;  4I9R A;  1SA8 A;  5F2B A;  1HBQ A;  3ZWE A;  1IFC A;  1Y53 X;  2IFB A;  3FEL A;  3VHH A;  4CPI A;  1AVE A;  1U18 A;  3VGW A;  4MVL A;  1OEE A;  5HCC C;  4DQ3 A;  1NQM A;  1RSU B;  4QRL A;  3T6F A;  3EM0 A;  4ID2 A;  2RTL A;  3RDX A;  2JGS A;  4QGW A;  5HZ6 A;  2ZAI A;  1AVD A;  2CBS A;  4YCE A;  3BU1 A;  3VG3 A;  2WPU A;  4ZGF A;  1QY0 A;  1RLB E;  1G74 A;  3T6L A;  4CDD A;  3EBW A;  4ALB A;  4IAB A;  4GH7 A;  2K62 A;  1K3B A;  3FA8 A;  2FS6 A;  3PH6 A;  3D97 A;  4XMF A;  1SRI A;  1VWG B;  2EU7 X;  3CKF A;  4D6A A;  4TKH A;  1YIV A;  4GJV A;  4YGZ A;  4DQ4 A;  4FGI B;  2O62 A;  4ON1 A;  1JJU A;  1SWR A;  2Q39 A;  2X8F A;  1P6P A;  1SWT A;  2G79 A;  3APW A;  1SRJ A;  3S5X A;  1SY3 A;  2ZAG A;  3WXQ A;  4Z6J A;  1SY1 A;  4LKT A;  3RBY A;  4I3D A;  1RAV A;  1SWE A;  2FRS A;  3B2I A;  3NQ9 A;  3QQ2 A;  2Q2P A;  2IZC B;  3OJY C;  4O9S A;  1VWB B;  3P24 A;  4ZHC A;  1VWQ B;  2IZI A;  4Z2O A;  1D2U A;  5FQ6 E;  4I6S A;  1B56 A;  5K06 A;  1EAL A;  1UYO X;  3AKN A;  1SWA A;  3AKM A;  1LCW A;  3PQU A;  4QYN A;  3EW1 A;  4U3Q A;  2KD2 A;  2X45 A;  1BBP A;  3BY0 A;  2Y32 A;  5F6B A;  5HA1 A;  1BRQ A;  2NP1 A;  3Q6L A;  5CHK A;  3UEX A;  3S26 A;  1N0S A;  1O8V A;  1SWG A;  1A2D A;  3APX A;  1VWE B;  4GK9 A;  4YFP A;  4CDC A;  4TKJ A;  1DV9 A;  4D6B A;  3MM0 A;  1N7Y A;  2IZE B;  5EED A;  2OVD A;  2Q4N A;  4HWM A;  3K3L A;  3D96 A;  1OSP O;  3H3I A;  1X8O A;  5BVS A;  4Z2V A;  1LCV A;  2Z4H A;  1JJJ A;  1Y52 X;  3FA7 A;  4U9C A;  4HPC A;  3RY2 A;  1CBS A;  3FR4 A;  2FKJ A;  4LKP A;  4O4X A;  4GU8 A;  5CSE A;  4AZQ A;  2X56 A;  2OY7 A;  4EFG A;  3OD9 A;  3STK A;  4BX6 A;  1SWJ A;  3KFG A;  4YKO A;  1JQP A;  3S60 A;  1Y9L A;  4GJS A;  2F09 A;  5B11 O;  3SLT A;  5IRU A;  3P6F A;  2WSJ A;  2L68 A;  3FIQ A;  1GT4 A;  1S7D A;  2LFO A;  4TLJ A;  5H9N A;  1S2P A;  3WZQ A;  1QWD A;  1EI5 A;  4M7M A;  4NP1 A;  2RTK A;  2ZSC A;  3RDM A;  4IB6 A;  1VWF B;  1X8N A;  1SWB A;  3ELZ A;  2BC3 A;  1QFV A;  2K23 A;  4YKM A;  1ZND A;  2MHD A;  2W2F A;  1A18 A;  1WUB A;  5BVQ A;  2AT0 X;  2IZJ A;  3QKG A;  4XMH A;  3ZW1 B;  1DF3 A;  2IZH B;  3NP1 A;  4ZCB A;  1N4J A;  5EEE A;  3SZJ A;  4O3W A;  1YP7 A;  1LPJ A;  2X8S A;  5IXG A;  1EW3 A;  1JZU A;  2A8G A;  1FTP A;  3CWK A;  3PK2 A;  1SWQ A;  2Z4I A;  2IZB A;  2CM9 A;  4OS8 A;  3RDS A;  1ZRY A;  1KT6 A;  2OF9 A;  2RTE B;  2OFR X;  3P6D A;  1E00 A;  2HLV A;  4OMX A;  4BCS A;  3FW5 A;  1X71 A;  2M4L A;  4U46 A;  1VWK B;  4ORX A;  2Y3F A;  3O2Y A;  1UYN X;  4GET A;  1NBX A;  4IMN A;  1LDO A;  1N9M A;  2BLG A;  4GGR A;  4HFO A;  3RDQ A;  1SLE B;  1EII A;  4Y59 A;  4EDE A;  1FEL A;  2DJG A;  2X32 A;  3I17 A;  1YWA A;  4BGF A;  3Q34 A;  1OPA A;  2OL7 A;  2GTL M;  1NP4 A;  1QY1 A;  4Y0P A;  1ALB A;  2BT9 A;  1UZ2 X;  4IAW A;  3VU1 A;  4NYR A;  1MUP A;  3WJG A;  1SXW A;  5IO7 A;  1LKE A;  1PTS A;  5LJE A;  1MEP A;  2JU3 A;  2C1S A;  3NBX X;  3BSZ E;  2E4J A;  2IZG B;  3O22 A;  1JMZ A;  2FHN X;  4PSQ A;  2DJF A;  5LJD A;  4ORR A;  1LNM A;  2CBR A;  2W2B A;  2PY1 A;  4GGZ A;  4NV8 A;  3BS2 A;  1VWI B;  1QAB E;  3CBC A;  2KTS A;  4XMC A;  1OEK A;  1VPR A;  3JS1 A;  4NV7 A; 
#chains in the Genus database with same CATH homology
 2WPU A;  3T6L A;  2RTG B;  2F01 A;  3VHI A;  2C1Q A;  1RXJ A;  4JHQ A;  4GD9 A;  1LCZ A;  1N43 A;  1NC9 A;  1SWU A;  2RTM A;  1SRI A;  1VWG B;  1VWM B;  2OF8 A;  4GJV A;  5B5F A;  1SRF A;  2OFA A;  1SRG A;  2RTJ A;  1SWR A;  3SZI A;  4BBO A;  1SWT A;  4BJ8 A;  1SRJ A;  4OKA A;  4Z6J A;  4I60 A;  1N9Y A;  1RAV A;  1SWE A;  4GDA A;  3RE5 A;  1SWD A;  2IZC B;  1HXZ A;  1VWB B;  3RDU A;  1VWQ B;  2IZI A;  4Z2O A;  4JNJ A;  1HQQ A;  1RXH A;  4CPE A;  4CPF A;  1KL5 A;  1SWA A;  1LCW A;  1SWF A;  5IRW A;  3EW1 A;  2Y32 A;  1VWP B;  3T2X A;  5IRA A;  5CHK A;  1SWL A;  1SWG A;  1SWP A;  1SLG B;  2IZF B;  1VWE B;  4CPH B;  3MM0 A;  5K68 A;  4BX5 A;  1N7Y A;  2GH7 A;  2RTF B;  2IZE B;  5B5G A;  3WZP A;  5K67 A;  2RTC B;  3RDO A;  4Z2V A;  1STS B;  1LCV A;  5JD2 A;  1SWO A;  1IJ8 A;  1Y52 X;  1Y55 X;  2OFB A;  2RTD B;  2Y3E A;  1KL3 A;  1MM9 A;  4EKV A;  3RY2 A;  3WZO A;  1SWC A;  5L3Y A;  2RTN B;  4BX7 A;  4JO6 A;  2IZL B;  5CSE A;  1SWH A;  2C4I A;  3MG5 A;  4BX6 A;  2A5C A;  1SWJ A;  1VWD B;  1SWK A;  1VWA B;  1VWO B;  4GJS A;  4Z28 A;  2UYW A;  5IRU A;  2RTB B;  1STP A;  1WBI A;  3SZH A;  1VWL B;  4GGT A;  2IZA A;  1SWS A;  1VWN B;  2AVI A;  2RTA A;  1LUQ A;  3WZQ A;  3WZN A;  2RTQ B;  2RTH B;  1MOY A;  1VWR B;  2RTK A;  2ZSC A;  3RDM A;  1SLF B;  3WYP A;  1VWF B;  1SWB A;  2BC3 A;  1VYO A;  2RTO B;  1RXK A;  1HY2 A;  1KFF A;  2A5B A;  1SLD B;  1HXL A;  2IZJ A;  3RY1 A;  2IZH B;  1SRH A;  1N4J A;  3SZJ A;  3T2W A;  3FDC A;  4BX5 B;  2A8G A;  2G5L A;  3PK2 A;  3RDS A;  1SWQ A;  1MK5 A;  2IZB A;  1SRE A;  2OF9 A;  2RTE B;  4BCS A;  4IRW A;  4YVB A;  1I9H A;  1NQN A;  1RST B;  1VWK B;  4U46 A;  4Y5D A;  2Y3F A;  4BX7 B;  3RE6 A;  1DF8 A;  1NBX A;  1LDO A;  1N9M A;  3RDQ A;  3EW2 A;  4GGR A;  3X00 A;  1SLE B;  4DNE A;  4Z2P A;  1VWH B;  4Y59 A;  4BX6 B;  2CAM A;  2RTI B;  2MF6 A;  2UZ2 A;  2RTR B;  1VWJ B;  1NDJ A;  1VWC B;  5F2B A;  4CPI A;  1Y53 X;  3VHH A;  3WYQ A;  1AVE A;  3VHM A;  1PTS A;  3VGW A;  1MEP A;  4CPH A;  2C1S A;  1KL4 A;  1NQM A;  1RSU B;  2IZG B;  4Z27 A;  1LEL A;  2FHN X;  3T6F A;  1LDQ A;  2QCB A;  2RTL A;  3RDX A;  1SWN A;  2JGS A;  4GGZ A;  1STR B;  2IZD B;  1AVD A;  1VWI B;  2RTP B;  2FHL A;  2IZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...