1MOYA

Streptavidin mutant with osteopontin hexapeptide insertion including rgd
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
125
Chain Sequence
GITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPGRGDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptavidin
publication title Structural characterization and comparison of RGD cell-adhesion recognition sites engineered into streptavidin.
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Biotin-binding protein
total genus 25
structure length 125
sequence length 127
ec nomenclature
pdb deposition date 2002-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1moyA00
2AVIA 2Y3EA 2RTNB 2RTCB 1SWLA 4GD9A 5CSEA 1SRIA 2C1QA 2RTBB 3MG5A 1SWBA 1SRHA 1SWKA 1SWPA 3FDCA 2OF9A 4GJSA 3RY2A 4BCSA 2IZCB 2OF8A 5F2BA 5JD2A 4BX6A 1SLDB 1VWJB 5K67A 3EW1A 4JO6A 1KFFA 2RTHB 1HQQA 3RDOA 3T2XA 1SWAA 2RTQB 4BX5A 1NC9A 2IZFB 3RDQA 4BJ8A 4U46A 1VWMB 2IZAA 3WZPA 1HXLA 1VWFB 1VWEB 4CPFA 4DNEA 1NQNA 3VHMA 4GGRA 1VWPB 3SZIA 4CPEA 3VGWA 1STSB 2ZSCA 1VWAB 2WPUA 1VWBB 5IRAA 3WZOA 2RTMA 4GGZA 2IZDB 1VWGB 4JHQA 3X00A 4Z2PA 3EW2A 3RY1A 1STPA 1SWQA 3T2WA 1HY2A 1SWGA 2RTLA 3WZNA 4BX7B 3T6LA 1SWOA 2GH7A 2Y32A 5B5GA 1RXJA 4GJVA 2UZ2A 4CPHB 1SWJA 1SWRA 3RE5A 2RTIB 1VWLB 1VWKB 4CPIA 1HXZA 1SRGA 2BC3A 2OFAA 1VWNB 1LCVA 2F01A 1NBXA 1SWDA 1Y55X 5B5FA 1N9MA 3T6FA 2RTKA 4Y59A 2C1SA 4GGTA 2OFBA 1SWNA 3WZQA 3WYQA 4OKAA 3VHIA 4Z6JA 2IZGB 1NQMA 2Y3FA 1KL3A 1MK5A 4Z27A 2A8GA 2UYWA 1RSTB 1NDJA 5L3YA 2CAMA 1MM9A 1LCZA 1SWHA 2IZLB 2IZKA 1AVEA 1RAVA 2RTGB 1AVDA 1RXKA 1VYOA 4IRWA 4BBOA 1DF8A 1KL4A 1SLGB 1SREA 2IZBA 2IZEB 2IZJA 3SZHA 1SRJA 1VWCB 1SWEA 1N9YA 1WBIA 1Y52X 2RTPB 4Z28A 4BX6B 2A5BA 1VWIB 2MF6A 3SZJA 1N43A 1VWQB 4EKVA 1LDQA 2RTOB 1SWUA 1SWFA 3MM0A 3RDUA 4BX5B 4Z2VA 5CHKA 2IZHB 4BX7A 2RTFB 3VHHA 2FHLA 1RSUB 4YVBA 3PK2A 1LCWA 2RTRB 2RTJA 1LDOA 1SWSA 1VWRB 1SWCA 4JNJA 3WYPA 1MOYA 1Y53X 2G5LA 4Z2OA 4CPHA 1KL5A 1N7YA 5IRUA 1LUQA 2A5CA 1I9HA 2RTDB 5K68A 4GDAA 1VWOB 2IZIA 4I60A 1N4JA 1LELA 3RDXA 1SWTA 5IRWA 1SRFA 1SLEB 1VWDB 3RDSA 2JGSA 4Y5DA 2RTEB 1SLFB 2C4IA 1STRB 1VWHB 2FHNX 1MEPA 1RXHA 3RE6A 3RDMA 1PTSA 2QCBA 1IJ8A 2RTAA
chains in the Genus database with same CATH superfamily
1B56A 1ZNKA 3WXQA 1SWLA 4GD9A 5CSEA 2PI3O 5EPQA 1B4MA 2C1QA 1BLRA 3BY0A 2BS6A 2P8GA 4LZVA 3PEDA 1SRHA 3DTQA 4GJSA 2MWHA 3FDCA 1OBQA 2FGSA 3BU9A 4ZCBA 4BOEA 4NW4A 5IO7A 5JD2A 1I4UA 1SLDB 3VE2A 2RA6A 5F7GA 4A1YA 4A8ZA 4GE1A 2RTHB 3FA7A 3L4RA 4YBUA 4XMEA 3B2IA 1D3SA 1NC9A 2IZFB 4U46A 5DPQA 1S7DA 3WZPA 4ZHHA 4KC7A 5EZ2A 3WJBA 1DZMA 3P6DA 2QOSC 4YGGA 1AELA 3VGWA 2K62A 4FQBB 2MJIA 3APWA 3I17A 5IXGA 1OBPA 2X56A 4I9SA 4YCHA 2CBSA 1ACDA 1T0VA 4GGZA 2X46A 2KW1A 5FQ6E 5LJDA 4AZRA 2R56A 4ORUA 2FT9A 4CDCA 2EU7X 3EW2A 4I95A 2WQAE 4ARHA 3RY1A 3T2WA 1HY2A 4L3RA 3ZW2A 4D6AA 4BX7B 4TLJA 5F58A 4ORYA 5DG4A 1E2TA 1SMPI 2ASNX 1EUOA 2BHVA 3D96A 2AMMX 1B8EA 2OL6O 1PM1X 2KTDA 1VPRA 2Y32A 5B5GA 1RXJA 4GJVA 1FEMA 4U3QA 1HBPA 3P6CA 4CPHB 1G7NA 1KT3A 2RTIB 4OMWA 1VWKB 1EW3A 4TKJA 3STNA 1KOIA 1YWDA 2HYSA 1O1UA 1GT3A 2YG2A 4BQUA 1GT5A 2F01A 1NBXA 1ICNA 5FQ8E 5IO6A 1SY3A 4ON1A 2OFBA 1SWNA 4JGLA 2OVDA 4OKAA 5CYBA 1DZKA 4Z27A 4U8UN 1DF3A 4TQ2A 1RSTB 1NDJA 4LQZA 5HZ8A 3IFBA 2QOMA 4ZJ0A 2ANSA 2IZLB 1LCZA 3AEHA 1EIIA 1L6MA 4EFGA 2OL7A 3RDMA 4YKMA 1AVEA 4NLJA 1RAVA 1ZNHA 3F9DA 4TNNA 4Z2VA 1I04A 1DF8A 4YGHA 2X34A 3H3IA 2Q9SA 2ZAGA 1VWCB 4RUNA 1N9YA 1MX8A 1OPBA 1UZ2X 4I3DA 1MX7A 3ZQ3A 2GTFX 2Z4IA 3PP6A 4IABA 1LKEA 4FBRA 4QRLA 1Y9LA 1LDQA 1SWFA 3RDUA 1D2UA 1QABE 3BSZE 4QGXA 4YGZA 3HK1A 2JU8A 3UAQA 3DSZA 3FELA 4QYPA 2DM5A 3ZW0A 3FLLA 2FLJA 3CBSA 4YVBA 2FRSA 3EM0A 4AW8A 2O62A 1JIWI 1TXLA 3UEVA 1MOYA 4YKOA 5KHPA 4A60A 3CQNA 4EXZA 1YUPA 5LJKA 1FTPA 2A5CA 4WFVA 1KT4A 1QY0A 5LJGA 3GE2A 1KZWA 4OMXA 1VWOB 2A13A 4I60A 4MVEA 4YFQA 1LICA 4GKCA 3JS1A 3HWFA 2AF5A 2W2AA 3SLTA 4AYHA 2E4JA 1KXOA 1T68X 3PECA 4O3YA 5F1EA 1SA8A 5CE4A 2RTEB 4CV7A 1SLFB 2X8SA 3PDFA 2OVEA 4NV8A 2QM9A 2Q2PA 1JJUA 5H9KA 3IA8A 1LF7A 1KQXA 1TVQA 1MDCA 5D47A 1HQPA 2RQ0A 3WBGA 4FBVA 3MX7A 2RCTA 2Y3EA 2RTNB 4IAWA 4PSQA 4OS3A 2WEXA 2RTBB 4IB9A 2RCQA 4BCSA 4ZHCA 5KICA 2FS6A 1ZNGA 2KD2A 3F8AA 4MISA 1P6PA 2FWVA 2I5ZO 4LKTA 4BX6A 3BS2A 5L8NA 1JQPA 4JO6A 2F73A 4B55A 2FS7A 1HQQA 3FIQA 3RDOA 4QQ1A 1SWAA 2RTQB 3OBLA 1N0SA 3ZUIA 4ORRA 2HKDA 3RDQA 4BX5A 4CSBA 5HCDC 1VWMB 3FR4A 2IZAA 1VWEB 2GTLN 4ORSA 1ZNDA 1BSQA 1GX9A 1KT6A 1DC9A 4TKHA 4UU3A 3OD9A 1SXYA 4M7MA 1BM5A 1BSYA 1NQNA 4ML7B 2NNDA 3O2YA 4PJ2A 2W2BA 2JOZA 3OJYC 4NLIA 4WFUA 5FENA 2AT6X 3TGCA 1STSB 3K3LA 2ZSCA 2WPUA 2A0AA 1S44A 1LPJA 1VWBB 2WR6A 4GZVA 4O3WA 3ZW1A 2RTMA 4I6SA 4IAXA 4JHQA 5F6BA 2OY7A 4QZTA 1K24A 4Z2PA 3CMPA 4KH8A 3WZNA 2KT4B 2X45A 3HWEA 3T6LA 5L8OA 2OL8O 1FDQA 5LJBA 1JYDA 2FR3A 4ZHFA 2PY1A 5F6ZA 1KT5A 2HZRA 4NYQA 2NNEA 1A18A 2ZAIA 1EPBA 4N7DA 3EMMA 5B10O 3TGAA 1RBPA 2A2UA 3WJGA 3ZUOA 1EXSA 1UYNX 2BC3A 1LIFA 5B5FA 1SWDA 1Y55X 2QO6A 3PQUA 2DJFA 4U8UM 4Y59A 3VG6A 3WZQA 4GGTA 3WYQA 1UYOX 5K06A 4YDBA 1JV4A 2K23A 1OSPO 5B29A 2OY1O 3NQ3A 3U9PC 3JSQA 1NQMA 2Y3FA 1MK5A 3LTWA 1A57A 2A8GA 4GNWA 4N7CA 1HN2A 5AJCA 5B2AO 4WBKA 1E02A 1MM9A 1O8VA 4CDDA 2IZKA 1PMPA 1T8VA 1X71A 2L68A 2BT9A 4CPFA 3TGBA 2Q4NA 2RTGB 1AVDA 2AH7X 3NPOA 3CKGA 5H9AA 1XCAA 1KL4A 1SLGB 1SREA 2IZBA 2X32A 2IZJA 3B2HA 3C76X 3O19A 2BLGA 3WJEA 1SWEA 1WBIA 3KQ0A 1Y9TA 1W6FA 3BX8A 4ORXA 1Y0GA 2MF6A 1G85A 3AKMA 1BSOA 3HPEA 3TF6A 2AKQA 4BVMA 4EKVA 2OFRX 5LKFA 1SXWA 2M4LA 2RTOB 1GXAA 2IZHB 1YP7A 2IFBA 4BX7A 1DZJA 3BDRA 4NV7A 3VHHA 4EQAC 4O4UA 2FHLA 4XMCA 3B2JA 1OEKA 3PK2A 4I3CA 5FAZA 2R73A 2RTRB 3RZYA 1FELA 4JNJA 4Y0QA 3D95A 4CPHA 2WQ9A 1N7YA 5IRUA 3MVFA 1KQWA 1VYFA 4GDAA 1SY1A 1AVGI 3HWDA 3SLOA 3PH5A 1E00A 1N4JA 4DQ3A 4QGVA 1IIUA 3RDXA 3T1DA 4FBOA 2CM4A 4EDEA 5HCCC 1FENA 1SLEB 1VWDB 4DCBA 3RKGA 4Y5DA 4BGFA 4L1NA 2OZQA 1YWCA 4XMFA 3VU1A 1BBPA 2FHNX 3FMZA 1EPAA 3ZWEA 2ACPX 3RE6A 1BEBA 1ERXA 4AZNA 4ZGFA 1JJJA 2QCBA 4M6SA 2AVIA 2KTSA 1ML7A 2AT5X 3VG3A 2FKJA 1A3YA 1OBUA 2HMBA 4I3BA 1X8OA 1PEEA 2OY8A 1SWBA 3MG5A 2CBRA 5D48A 5D8JA 2A2GA 3UEUA 1IFBA 1G74A 1I78A 1YWAA 2OF8A 3EC5A 5F2BA 3S60A 3EBWA 1VWJB 1LFOA 5K67A 1OEEA 2VFCA 4KCAA 1X8NA 2GTLM 2LA7A 4GUZA 1I05A 2QMIA 2X8TA 4ALOA 1JJXA 5HWZA 1ERBA 1GX3A 3NR3A 3EYCA 4LKPA 3BRNA 3WJCA 4DNEA 4YDAA 1VYGA 3APVA 1LIDA 3VHMA 1U18A 2OVAA 1VWPB 4ID2A 2JW1A 3P6FA 5B11O 4CPEA 3U0DA 1SXXA 1KT7A 4K19A 3I0AA 3U03A 3RBYA 1VWAB 3VG4A 5AJBA 3ELXA 1SXUA 3SLJA 3VPJE 3ZI8A 5LJHA 5HZ5A 2X55A 3BX7A 2WUTA 2IZDB 2RD7C 1VWGB 4O3XB 3S5VA 5HTDA 1U0XA 2VFBA 3FEKA 3FIDA 3CQRA 1GT4A 1KGLA 1SWQA 2WWPA 4NNTA 3SAOA 3S5XA 4HFOA 2WSJA 5FQ7E 2GC9A 1SWOA 5LKEA 5HZQA 1CJ5A 4QNIA 5EEEA 1X8QA 3NX1A 3KFGA 1G5WA 1FJ1E 3TZSA 4WHIA 4NYRA 2FR2A 3FYFA 5D4AA 4QAEA 1SWRA 2OY5O 3RE5A 2MHDA 4OELA 3RSWA 4CPIA 1GM6A 3CR6A 1HXZA 1OEJA 3P6HA 1JMZA 4IB7A 2OFAA 1VWNB 1PBYA 2L9CA 3G7XA 1MVGA 1NP4A 3T6FA 3C78X 2G79A 1SY0A 1HBQA 2FKGA 2POAA 4CK4A 2C1SA 3FA8A 3HTYA 1IKEA 1DFVA 1GT1A 1H91A 3N91A 4O49A 5H8TA 3WJDA 2Q39A 4Z6JA 2JMBA 5LJCA 4HPDA 5BVTA 5FFHA 1ALBA 1QQSA 2UYWA 3AKNA 1WUBA 2L67A 5L3YA 3PH6A 2W2FA 2CAMA 1HMTA 4MVIA 3STMX 1SWHA 1TOWA 2BSZA 3MBTA 4YH0A 4DQ4A 1XKIA 1E5PA 2OVSA 1ZRYA 1EALA 2NNQA 1VYOA 1LIEA 4BBOA 1AQBA 3B2KA 3NQ9A 1SRJA 4Z28A 3PQSA 2GJ5A 4GH7A 3KFIA 3EBKA 2CM9A 4KT5A 5EDCA 3FW4A 3S26A 1N43A 1VWQB 1NGLA 2MM3A 4O4SA 1SWUA 4XMGA 2RN4A 3MM0A 4TKBA 3KFFA 2LB6A 2DJGA 4LZUA 1ICMA 4ZH6A 2AT0X 4HWMA 5IO5A 3KFHA 1HMRA 4TJZA 5B3MO 1RSUB 5HAEA 1BRPA 1AB0A 2RTJA 1LDOA 2NP1A 3WYPA 4ALBA 1Y53X 1O1VA 3VG5A 3VE1A 2G5LA 4Z2OA 4QGWA 1CBRA 5HCEC 3QQ2A 1LUQA 3CBCA 2LBVA 2HZQA 2RTDB 2IZIA 1MUPA 3D9WA 2OYBO 5EDBA 1E06A 3VG7A 1LELA 2X4MA 3APXA 4HPAA 4IBAA 3ELZA 1SWTA 2AL0X 4GETA 1FE3A 3O22A 4ORWA 3BLGA 1NP1A 3AUMO 4XMDA 1S2PA 3P24A 1KZXA 3KZAA 1STRB 2L5PA 4IMNA 4XMHA 1MEPA 3FEPA 1X8UA 3FR2A 3NX2A 1GGLA 2BS5A 3LV4A 1DZPA 4R0BA 1EQDA 4RUUA 5L8IA 4GGRA 5HZ6A 1JBHA 2RTCB 3FR5A 1SRIA 3NBXX 4C5PA 5HBSA 1SWKA 5C0NA 1SWPA 3RY2A 2OF9A 1QY1A 1QY2A 4O4XA 2IZCB 4AZOA 1QWDA 5D45A 3EW1A 4ZH9A 4GRJA 4YMYA 1KFFA 4HPBA 1X8PA 2HNXA 4ZR2A 3T2XA 5BVQA 4BJ8A 2G8CO 3SOTA 2X8FA 1HXLA 1VWFB 1YWBA 3D4RA 1QG5A 3Q6LA 3JQOA 2ACOA 2CZUA 1W4TA 1ZNEA 2Z4HA 2XSTA 3SZIA 4O4OA 2WEWA 5BVSA 1BWYA 3FENA 2JN3A 2LBAA 4AZPA 4EEJA 3F6ZB 4U8UO 2I5VO 4OS0A 1ZNLA 5HTEA 5IRAA 4MEEA 4U9CA 3WZOA 4ZHDA 4MVLA 5HA1A 4FGIB 4ODDA 1HMSA 3X00A 2R74A 5JR8A 4I9RA 1GX8A 1QFTA 4HPCA 1STPA 1U17A 1SWGA 2RTLA 2OFMX 3P6GA 5BYPA 3WVMA 3ZW0B 2G78A 3FW5A 2LFOA 4A1HA 4AZMA 2GH7A 4MIRA 5H9NA 1I06A 1YP6A 4NNSA 5H9LA 3KVNA 2G7BA 4YBPA 5LJEA 2UZ2A 3NADA 1SWJA 2HLVA 1ADLA 4GNYA 1X89A 3V8UA 1IFCA 1VWLB 4IB6A 4OS8A 3UEWA 1CBIA 1BJ7A 3WJFA 1SRGA 2F09A 4ZHGA 2AT3X 2FTBA 4NP1A 1IKJA 1LCVA 3LHNA 1LIBA 1N9MA 2RTKA 3QKGA 1CRBA 1RLBE 1SY2A 4O3ZA 2IZGB 3VHIA 1B0OA 4GK9A 3BU1A 2QO4A 1KL3A 4KC8A 4OEMA 4UU2A 1W5RA 2A3FX 3FA6A 4IB8A 4ES7A 5KIDA 2AT8X 4YFPA 1GKAB 1TW4A 3NP1A 4ZFXA 4YFRA 3HOLA 3OE3A 4GU8A 4AZQA 1DV9A 3WOVA 1K3BA 3GAQA 1RXKA 3B2LA 1JYJA 1PBOA 4IRWA 2IZEB 3UEXA 3SZHA 3CWKA 2JU3A 1A2DA 4CDFA 4D6BA 4BX6B 1Y52X 2ALLX 2RTPB 4MVKA 2A5BA 1TOUA 1VWIB 4Y0RA 4Y0PA 3SZJA 4COTA 2MO5A 4IMOA 1GKAA 2CZTA 3FA9A 1EI5A 4BX5B 1YIVA 3C77X 5CHKA 1LNMA 3VG2A 2Q2MA 1CBQA 2RTFB 3P6EA 1LCWA 5EEDA 2N93A 5HA0A 5B27A 3D97A 1SWSA 1VWRB 1SWCA 3P02A 1Z24A 1BRQA 3APUA 1KL5A 1QFVA 3Q34A 1R0UA 3ZW1B 1IW2A 1I9HA 3ZZVA 4CDEA 2XKLA 4Y0SA 5K68A 1OPAA 2GTLO 3PPTA 5HZ9A 4ZGUA 3NQKA 4QYNA 4YCEA 1UREA 4INNA 5AQ6A 3HWGA 1CBSA 4KIIA 1EIOA 5IRWA 1SRFA 3RDSA 2JGSA 3CKFA 1JZUA 3HOEA 3RWXA 3STKA 2YMSA 4GDZA 2QO5A 4QZUA 2C4IA 5AEOA 1VWHB 2LKKA 1RXHA 2VDFA 2JU7A 1JMXA 1PTSA 3E3CA 4O9SA 1IJ8A 2RTAA
chains in the Genus database with same CATH topology
2AVIA 2Y3EA 2RTNB 2RTCB 1SWLA 4GD9A 5CSEA 1SRIA 2C1QA 2RTBB 3MG5A 1SWBA 1SRHA 1SWKA 1SWPA 3FDCA 2OF9A 4GJSA 3RY2A 4BCSA 2IZCB 2OF8A 5F2BA 5JD2A 4BX6A 1SLDB 1VWJB 5K67A 3EW1A 4JO6A 1KFFA 2RTHB 1HQQA 3RDOA 3T2XA 1SWAA 2RTQB 4BX5A 1NC9A 2IZFB 3RDQA 4BJ8A 4U46A 1VWMB 2IZAA 3WZPA 1HXLA 1VWFB 1VWEB 4CPFA 4DNEA 1NQNA 3VHMA 4GGRA 1VWPB 3SZIA 4CPEA 3VGWA 1STSB 2ZSCA 1VWAB 2WPUA 1VWBB 5IRAA 3WZOA 2RTMA 4GGZA 2IZDB 1VWGB 4JHQA 3X00A 4Z2PA 3EW2A 3RY1A 1STPA 1SWQA 3T2WA 1HY2A 1SWGA 2RTLA 3WZNA 4BX7B 3T6LA 1SWOA 2GH7A 2Y32A 5B5GA 1RXJA 4GJVA 2UZ2A 4CPHB 1SWJA 1SWRA 3RE5A 2RTIB 1VWLB 1VWKB 4CPIA 1HXZA 1SRGA 2BC3A 2OFAA 1VWNB 1LCVA 2F01A 1NBXA 1SWDA 1Y55X 5B5FA 1N9MA 3T6FA 2RTKA 4Y59A 2C1SA 4GGTA 2OFBA 1SWNA 3WZQA 3WYQA 4OKAA 3VHIA 4Z6JA 2IZGB 1NQMA 2Y3FA 1KL3A 1MK5A 4Z27A 2A8GA 2UYWA 1RSTB 1NDJA 5L3YA 2CAMA 1MM9A 1LCZA 1SWHA 2IZLB 2IZKA 1AVEA 1RAVA 2RTGB 1AVDA 1RXKA 1VYOA 4IRWA 4BBOA 1DF8A 1KL4A 1SLGB 1SREA 2IZBA 2IZEB 2IZJA 3SZHA 1SRJA 1VWCB 1SWEA 1N9YA 1WBIA 1Y52X 2RTPB 4Z28A 4BX6B 2A5BA 1VWIB 2MF6A 3SZJA 1N43A 1VWQB 4EKVA 1LDQA 2RTOB 1SWUA 1SWFA 3MM0A 3RDUA 4BX5B 4Z2VA 5CHKA 2IZHB 4BX7A 2RTFB 3VHHA 2FHLA 1RSUB 4YVBA 3PK2A 1LCWA 2RTRB 2RTJA 1LDOA 1SWSA 1VWRB 1SWCA 4JNJA 3WYPA 1MOYA 1Y53X 2G5LA 4Z2OA 4CPHA 1KL5A 1N7YA 5IRUA 1LUQA 2A5CA 1I9HA 2RTDB 5K68A 4GDAA 1VWOB 2IZIA 4I60A 1N4JA 1LELA 3RDXA 1SWTA 5IRWA 1SRFA 1SLEB 1VWDB 3RDSA 2JGSA 4Y5DA 2RTEB 1SLFB 2C4IA 1STRB 1VWHB 2FHNX 1MEPA 1RXHA 3RE6A 3RDMA 1PTSA 2QCBA 1IJ8A 2RTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AVI A;  2Y3E A;  2RTN B;  2RTC B;  1SWL A;  4GD9 A;  5CSE A;  1SRI A;  2C1Q A;  2RTB B;  3MG5 A;  1SWB A;  1SRH A;  1SWK A;  1SWP A;  3FDC A;  2OF9 A;  4GJS A;  3RY2 A;  4BCS A;  2IZC B;  2OF8 A;  5F2B A;  5JD2 A;  4BX6 A;  1SLD B;  1VWJ B;  5K67 A;  3EW1 A;  4JO6 A;  1KFF A;  2RTH B;  1HQQ A;  3RDO A;  3T2X A;  1SWA A;  2RTQ B;  4BX5 A;  1NC9 A;  2IZF B;  3RDQ A;  4BJ8 A;  4U46 A;  1VWM B;  2IZA A;  3WZP A;  1HXL A;  1VWF B;  1VWE B;  4CPF A;  4DNE A;  1NQN A;  3VHM A;  4GGR A;  1VWP B;  3SZI A;  4CPE A;  3VGW A;  1STS B;  2ZSC A;  1VWA B;  2WPU A;  1VWB B;  5IRA A;  3WZO A;  2RTM A;  4GGZ A;  2IZD B;  1VWG B;  4JHQ A;  3X00 A;  4Z2P A;  3EW2 A;  3RY1 A;  1STP A;  1SWQ A;  3T2W A;  1HY2 A;  1SWG A;  2RTL A;  3WZN A;  4BX7 B;  3T6L A;  1SWO A;  2GH7 A;  2Y32 A;  5B5G A;  1RXJ A;  4GJV A;  2UZ2 A;  4CPH B;  1SWJ A;  1SWR A;  3RE5 A;  2RTI B;  1VWL B;  1VWK B;  4CPI A;  1HXZ A;  1SRG A;  2BC3 A;  2OFA A;  1VWN B;  1LCV A;  2F01 A;  1NBX A;  1SWD A;  1Y55 X;  5B5F A;  1N9M A;  3T6F A;  2RTK A;  4Y59 A;  2C1S A;  4GGT A;  2OFB A;  1SWN A;  3WZQ A;  3WYQ A;  4OKA A;  3VHI A;  4Z6J A;  2IZG B;  1NQM A;  2Y3F A;  1KL3 A;  1MK5 A;  4Z27 A;  2A8G A;  2UYW A;  1RST B;  1NDJ A;  5L3Y A;  2CAM A;  1MM9 A;  1LCZ A;  1SWH A;  2IZL B;  2IZK A;  1AVE A;  1RAV A;  2RTG B;  1AVD A;  1RXK A;  1VYO A;  4IRW A;  4BBO A;  1DF8 A;  1KL4 A;  1SLG B;  1SRE A;  2IZB A;  2IZE B;  2IZJ A;  3SZH A;  1SRJ A;  1VWC B;  1SWE A;  1N9Y A;  1WBI A;  1Y52 X;  2RTP B;  4Z28 A;  4BX6 B;  2A5B A;  1VWI B;  2MF6 A;  3SZJ A;  1N43 A;  1VWQ B;  4EKV A;  1LDQ A;  2RTO B;  1SWU A;  1SWF A;  3MM0 A;  3RDU A;  4BX5 B;  4Z2V A;  5CHK A;  2IZH B;  4BX7 A;  2RTF B;  3VHH A;  2FHL A;  1RSU B;  4YVB A;  3PK2 A;  1LCW A;  2RTR B;  2RTJ A;  1LDO A;  1SWS A;  1VWR B;  1SWC A;  4JNJ A;  3WYP A;  1MOY A;  1Y53 X;  2G5L A;  4Z2O A;  4CPH A;  1KL5 A;  1N7Y A;  5IRU A;  1LUQ A;  2A5C A;  1I9H A;  2RTD B;  5K68 A;  4GDA A;  1VWO B;  2IZI A;  4I60 A;  1N4J A;  1LEL A;  3RDX A;  1SWT A;  5IRW A;  1SRF A;  1SLE B;  1VWD B;  3RDS A;  2JGS A;  4Y5D A;  2RTE B;  1SLF B;  2C4I A;  1STR B;  1VWH B;  2FHN X;  1MEP A;  1RXH A;  3RE6 A;  3RDM A;  1PTS A;  2QCB A;  1IJ8 A;  2RTA A; 
#chains in the Genus database with same CATH topology
 1B56 A;  1ZNK A;  3WXQ A;  1SWL A;  4GD9 A;  5CSE A;  2PI3 O;  5EPQ A;  1B4M A;  2C1Q A;  1BLR A;  3BY0 A;  2BS6 A;  2P8G A;  4LZV A;  3PED A;  1SRH A;  3DTQ A;  4GJS A;  2MWH A;  3FDC A;  1OBQ A;  2FGS A;  3BU9 A;  4ZCB A;  4BOE A;  4NW4 A;  5IO7 A;  5JD2 A;  1I4U A;  1SLD B;  3VE2 A;  2RA6 A;  5F7G A;  4A1Y A;  4A8Z A;  4GE1 A;  2RTH B;  3FA7 A;  3L4R A;  4YBU A;  4XME A;  3B2I A;  1D3S A;  1NC9 A;  2IZF B;  4U46 A;  5DPQ A;  1S7D A;  3WZP A;  4ZHH A;  4KC7 A;  5EZ2 A;  3WJB A;  1DZM A;  3P6D A;  2QOS C;  4YGG A;  1AEL A;  3VGW A;  2K62 A;  4FQB B;  2MJI A;  3APW A;  3I17 A;  5IXG A;  1OBP A;  2X56 A;  4I9S A;  4YCH A;  2CBS A;  1ACD A;  1T0V A;  4GGZ A;  2X46 A;  2KW1 A;  5FQ6 E;  5LJD A;  4AZR A;  2R56 A;  4ORU A;  2FT9 A;  4CDC A;  2EU7 X;  3EW2 A;  4I95 A;  2WQA E;  4ARH A;  3RY1 A;  3T2W A;  1HY2 A;  4L3R A;  3ZW2 A;  4D6A A;  4BX7 B;  4TLJ A;  5F58 A;  4ORY A;  5DG4 A;  1E2T A;  1SMP I;  2ASN X;  1EUO A;  2BHV A;  3D96 A;  2AMM X;  1B8E A;  2OL6 O;  1PM1 X;  2KTD A;  1VPR A;  2Y32 A;  5B5G A;  1RXJ A;  4GJV A;  1FEM A;  4U3Q A;  1HBP A;  3P6C A;  4CPH B;  1G7N A;  1KT3 A;  2RTI B;  4OMW A;  1VWK B;  1EW3 A;  4TKJ A;  3STN A;  1KOI A;  1YWD A;  2HYS A;  1O1U A;  1GT3 A;  2YG2 A;  4BQU A;  1GT5 A;  2F01 A;  1NBX A;  1ICN A;  5FQ8 E;  5IO6 A;  1SY3 A;  4ON1 A;  2OFB A;  1SWN A;  4JGL A;  2OVD A;  4OKA A;  5CYB A;  1DZK A;  4Z27 A;  4U8U N;  1DF3 A;  4TQ2 A;  1RST B;  1NDJ A;  4LQZ A;  5HZ8 A;  3IFB A;  2QOM A;  4ZJ0 A;  2ANS A;  2IZL B;  1LCZ A;  3AEH A;  1EII A;  1L6M A;  4EFG A;  2OL7 A;  3RDM A;  4YKM A;  1AVE A;  4NLJ A;  1RAV A;  1ZNH A;  3F9D A;  4TNN A;  4Z2V A;  1I04 A;  1DF8 A;  4YGH A;  2X34 A;  3H3I A;  2Q9S A;  2ZAG A;  1VWC B;  4RUN A;  1N9Y A;  1MX8 A;  1OPB A;  1UZ2 X;  4I3D A;  1MX7 A;  3ZQ3 A;  2GTF X;  2Z4I A;  3PP6 A;  4IAB A;  1LKE A;  4FBR A;  4QRL A;  1Y9L A;  1LDQ A;  1SWF A;  3RDU A;  1D2U A;  1QAB E;  3BSZ E;  4QGX A;  4YGZ A;  3HK1 A;  2JU8 A;  3UAQ A;  3DSZ A;  3FEL A;  4QYP A;  2DM5 A;  3ZW0 A;  3FLL A;  2FLJ A;  3CBS A;  4YVB A;  2FRS A;  3EM0 A;  4AW8 A;  2O62 A;  1JIW I;  1TXL A;  3UEV A;  1MOY A;  4YKO A;  5KHP A;  4A60 A;  3CQN A;  4EXZ A;  1YUP A;  5LJK A;  1FTP A;  2A5C A;  4WFV A;  1KT4 A;  1QY0 A;  5LJG A;  3GE2 A;  1KZW A;  4OMX A;  1VWO B;  2A13 A;  4I60 A;  4MVE A;  4YFQ A;  1LIC A;  4GKC A;  3JS1 A;  3HWF A;  2AF5 A;  2W2A A;  3SLT A;  4AYH A;  2E4J A;  1KXO A;  1T68 X;  3PEC A;  4O3Y A;  5F1E A;  1SA8 A;  5CE4 A;  2RTE B;  4CV7 A;  1SLF B;  2X8S A;  3PDF A;  2OVE A;  4NV8 A;  2QM9 A;  2Q2P A;  1JJU A;  5H9K A;  3IA8 A;  1LF7 A;  1KQX A;  1TVQ A;  1MDC A;  5D47 A;  1HQP A;  2RQ0 A;  3WBG A;  4FBV A;  3MX7 A;  2RCT A;  2Y3E A;  2RTN B;  4IAW A;  4PSQ A;  4OS3 A;  2WEX A;  2RTB B;  4IB9 A;  2RCQ A;  4BCS A;  4ZHC A;  5KIC A;  2FS6 A;  1ZNG A;  2KD2 A;  3F8A A;  4MIS A;  1P6P A;  2FWV A;  2I5Z O;  4LKT A;  4BX6 A;  3BS2 A;  5L8N A;  1JQP A;  4JO6 A;  2F73 A;  4B55 A;  2FS7 A;  1HQQ A;  3FIQ A;  3RDO A;  4QQ1 A;  1SWA A;  2RTQ B;  3OBL A;  1N0S A;  3ZUI A;  4ORR A;  2HKD A;  3RDQ A;  4BX5 A;  4CSB A;  5HCD C;  1VWM B;  3FR4 A;  2IZA A;  1VWE B;  2GTL N;  4ORS A;  1ZND A;  1BSQ A;  1GX9 A;  1KT6 A;  1DC9 A;  4TKH A;  4UU3 A;  3OD9 A;  1SXY A;  4M7M A;  1BM5 A;  1BSY A;  1NQN A;  4ML7 B;  2NND A;  3O2Y A;  4PJ2 A;  2W2B A;  2JOZ A;  3OJY C;  4NLI A;  4WFU A;  5FEN A;  2AT6 X;  3TGC A;  1STS B;  3K3L A;  2ZSC A;  2WPU A;  2A0A A;  1S44 A;  1LPJ A;  1VWB B;  2WR6 A;  4GZV A;  4O3W A;  3ZW1 A;  2RTM A;  4I6S A;  4IAX A;  4JHQ A;  5F6B A;  2OY7 A;  4QZT A;  1K24 A;  4Z2P A;  3CMP A;  4KH8 A;  3WZN A;  2KT4 B;  2X45 A;  3HWE A;  3T6L A;  5L8O A;  2OL8 O;  1FDQ A;  5LJB A;  1JYD A;  2FR3 A;  4ZHF A;  2PY1 A;  5F6Z A;  1KT5 A;  2HZR A;  4NYQ A;  2NNE A;  1A18 A;  2ZAI A;  1EPB A;  4N7D A;  3EMM A;  5B10 O;  3TGA A;  1RBP A;  2A2U A;  3WJG A;  3ZUO A;  1EXS A;  1UYN X;  2BC3 A;  1LIF A;  5B5F A;  1SWD A;  1Y55 X;  2QO6 A;  3PQU A;  2DJF A;  4U8U M;  4Y59 A;  3VG6 A;  3WZQ A;  4GGT A;  3WYQ A;  1UYO X;  5K06 A;  4YDB A;  1JV4 A;  2K23 A;  1OSP O;  5B29 A;  2OY1 O;  3NQ3 A;  3U9P C;  3JSQ A;  1NQM A;  2Y3F A;  1MK5 A;  3LTW A;  1A57 A;  2A8G A;  4GNW A;  4N7C A;  1HN2 A;  5AJC A;  5B2A O;  4WBK A;  1E02 A;  1MM9 A;  1O8V A;  4CDD A;  2IZK A;  1PMP A;  1T8V A;  1X71 A;  2L68 A;  2BT9 A;  4CPF A;  3TGB A;  2Q4N A;  2RTG B;  1AVD A;  2AH7 X;  3NPO A;  3CKG A;  5H9A A;  1XCA A;  1KL4 A;  1SLG B;  1SRE A;  2IZB A;  2X32 A;  2IZJ A;  3B2H A;  3C76 X;  3O19 A;  2BLG A;  3WJE A;  1SWE A;  1WBI A;  3KQ0 A;  1Y9T A;  1W6F A;  3BX8 A;  4ORX A;  1Y0G A;  2MF6 A;  1G85 A;  3AKM A;  1BSO A;  3HPE A;  3TF6 A;  2AKQ A;  4BVM A;  4EKV A;  2OFR X;  5LKF A;  1SXW A;  2M4L A;  2RTO B;  1GXA A;  2IZH B;  1YP7 A;  2IFB A;  4BX7 A;  1DZJ A;  3BDR A;  4NV7 A;  3VHH A;  4EQA C;  4O4U A;  2FHL A;  4XMC A;  3B2J A;  1OEK A;  3PK2 A;  4I3C A;  5FAZ A;  2R73 A;  2RTR B;  3RZY A;  1FEL A;  4JNJ A;  4Y0Q A;  3D95 A;  4CPH A;  2WQ9 A;  1N7Y A;  5IRU A;  3MVF A;  1KQW A;  1VYF A;  4GDA A;  1SY1 A;  1AVG I;  3HWD A;  3SLO A;  3PH5 A;  1E00 A;  1N4J A;  4DQ3 A;  4QGV A;  1IIU A;  3RDX A;  3T1D A;  4FBO A;  2CM4 A;  4EDE A;  5HCC C;  1FEN A;  1SLE B;  1VWD B;  4DCB A;  3RKG A;  4Y5D A;  4BGF A;  4L1N A;  2OZQ A;  1YWC A;  4XMF A;  3VU1 A;  1BBP A;  2FHN X;  3FMZ A;  1EPA A;  3ZWE A;  2ACP X;  3RE6 A;  1BEB A;  1ERX A;  4AZN A;  4ZGF A;  1JJJ A;  2QCB A;  4M6S A;  2AVI A;  2KTS A;  1ML7 A;  2AT5 X;  3VG3 A;  2FKJ A;  1A3Y A;  1OBU A;  2HMB A;  4I3B A;  1X8O A;  1PEE A;  2OY8 A;  1SWB A;  3MG5 A;  2CBR A;  5D48 A;  5D8J A;  2A2G A;  3UEU A;  1IFB A;  1G74 A;  1I78 A;  1YWA A;  2OF8 A;  3EC5 A;  5F2B A;  3S60 A;  3EBW A;  1VWJ B;  1LFO A;  5K67 A;  1OEE A;  2VFC A;  4KCA A;  1X8N A;  2GTL M;  2LA7 A;  4GUZ A;  1I05 A;  2QMI A;  2X8T A;  4ALO A;  1JJX A;  5HWZ A;  1ERB A;  1GX3 A;  3NR3 A;  3EYC A;  4LKP A;  3BRN A;  3WJC A;  4DNE A;  4YDA A;  1VYG A;  3APV A;  1LID A;  3VHM A;  1U18 A;  2OVA A;  1VWP B;  4ID2 A;  2JW1 A;  3P6F A;  5B11 O;  4CPE A;  3U0D A;  1SXX A;  1KT7 A;  4K19 A;  3I0A A;  3U03 A;  3RBY A;  1VWA B;  3VG4 A;  5AJB A;  3ELX A;  1SXU A;  3SLJ A;  3VPJ E;  3ZI8 A;  5LJH A;  5HZ5 A;  2X55 A;  3BX7 A;  2WUT A;  2IZD B;  2RD7 C;  1VWG B;  4O3X B;  3S5V A;  5HTD A;  1U0X A;  2VFB A;  3FEK A;  3FID A;  3CQR A;  1GT4 A;  1KGL A;  1SWQ A;  2WWP A;  4NNT A;  3SAO A;  3S5X A;  4HFO A;  2WSJ A;  5FQ7 E;  2GC9 A;  1SWO A;  5LKE A;  5HZQ A;  1CJ5 A;  4QNI A;  5EEE A;  1X8Q A;  3NX1 A;  3KFG A;  1G5W A;  1FJ1 E;  3TZS A;  4WHI A;  4NYR A;  2FR2 A;  3FYF A;  5D4A A;  4QAE A;  1SWR A;  2OY5 O;  3RE5 A;  2MHD A;  4OEL A;  3RSW A;  4CPI A;  1GM6 A;  3CR6 A;  1HXZ A;  1OEJ A;  3P6H A;  1JMZ A;  4IB7 A;  2OFA A;  1VWN B;  1PBY A;  2L9C A;  3G7X A;  1MVG A;  1NP4 A;  3T6F A;  3C78 X;  2G79 A;  1SY0 A;  1HBQ A;  2FKG A;  2POA A;  4CK4 A;  2C1S A;  3FA8 A;  3HTY A;  1IKE A;  1DFV A;  1GT1 A;  1H91 A;  3N91 A;  4O49 A;  5H8T A;  3WJD A;  2Q39 A;  4Z6J A;  2JMB A;  5LJC A;  4HPD A;  5BVT A;  5FFH A;  1ALB A;  1QQS A;  2UYW A;  3AKN A;  1WUB A;  2L67 A;  5L3Y A;  3PH6 A;  2W2F A;  2CAM A;  1HMT A;  4MVI A;  3STM X;  1SWH A;  1TOW A;  2BSZ A;  3MBT A;  4YH0 A;  4DQ4 A;  1XKI A;  1E5P A;  2OVS A;  1ZRY A;  1EAL A;  2NNQ A;  1VYO A;  1LIE A;  4BBO A;  1AQB A;  3B2K A;  3NQ9 A;  1SRJ A;  4Z28 A;  3PQS A;  2GJ5 A;  4GH7 A;  3KFI A;  3EBK A;  2CM9 A;  4KT5 A;  5EDC A;  3FW4 A;  3S26 A;  1N43 A;  1VWQ B;  1NGL A;  2MM3 A;  4O4S A;  1SWU A;  4XMG A;  2RN4 A;  3MM0 A;  4TKB A;  3KFF A;  2LB6 A;  2DJG A;  4LZU A;  1ICM A;  4ZH6 A;  2AT0 X;  4HWM A;  5IO5 A;  3KFH A;  1HMR A;  4TJZ A;  5B3M O;  1RSU B;  5HAE A;  1BRP A;  1AB0 A;  2RTJ A;  1LDO A;  2NP1 A;  3WYP A;  4ALB A;  1Y53 X;  1O1V A;  3VG5 A;  3VE1 A;  2G5L A;  4Z2O A;  4QGW A;  1CBR A;  5HCE C;  3QQ2 A;  1LUQ A;  3CBC A;  2LBV A;  2HZQ A;  2RTD B;  2IZI A;  1MUP A;  3D9W A;  2OYB O;  5EDB A;  1E06 A;  3VG7 A;  1LEL A;  2X4M A;  3APX A;  4HPA A;  4IBA A;  3ELZ A;  1SWT A;  2AL0 X;  4GET A;  1FE3 A;  3O22 A;  4ORW A;  3BLG A;  1NP1 A;  3AUM O;  4XMD A;  1S2P A;  3P24 A;  1KZX A;  3KZA A;  1STR B;  2L5P A;  4IMN A;  4XMH A;  1MEP A;  3FEP A;  1X8U A;  3FR2 A;  3NX2 A;  1GGL A;  2BS5 A;  3LV4 A;  1DZP A;  4R0B A;  1EQD A;  4RUU A;  5L8I A;  4GGR A;  5HZ6 A;  1JBH A;  2RTC B;  3FR5 A;  1SRI A;  3NBX X;  4C5P A;  5HBS A;  1SWK A;  5C0N A;  1SWP A;  3RY2 A;  2OF9 A;  1QY1 A;  1QY2 A;  4O4X A;  2IZC B;  4AZO A;  1QWD A;  5D45 A;  3EW1 A;  4ZH9 A;  4GRJ A;  4YMY A;  1KFF A;  4HPB A;  1X8P A;  2HNX A;  4ZR2 A;  3T2X A;  5BVQ A;  4BJ8 A;  2G8C O;  3SOT A;  2X8F A;  1HXL A;  1VWF B;  1YWB A;  3D4R A;  1QG5 A;  3Q6L A;  3JQO A;  2ACO A;  2CZU A;  1W4T A;  1ZNE A;  2Z4H A;  2XST A;  3SZI A;  4O4O A;  2WEW A;  5BVS A;  1BWY A;  3FEN A;  2JN3 A;  2LBA A;  4AZP A;  4EEJ A;  3F6Z B;  4U8U O;  2I5V O;  4OS0 A;  1ZNL A;  5HTE A;  5IRA A;  4MEE A;  4U9C A;  3WZO A;  4ZHD A;  4MVL A;  5HA1 A;  4FGI B;  4ODD A;  1HMS A;  3X00 A;  2R74 A;  5JR8 A;  4I9R A;  1GX8 A;  1QFT A;  4HPC A;  1STP A;  1U17 A;  1SWG A;  2RTL A;  2OFM X;  3P6G A;  5BYP A;  3WVM A;  3ZW0 B;  2G78 A;  3FW5 A;  2LFO A;  4A1H A;  4AZM A;  2GH7 A;  4MIR A;  5H9N A;  1I06 A;  1YP6 A;  4NNS A;  5H9L A;  3KVN A;  2G7B A;  4YBP A;  5LJE A;  2UZ2 A;  3NAD A;  1SWJ A;  2HLV A;  1ADL A;  4GNY A;  1X89 A;  3V8U A;  1IFC A;  1VWL B;  4IB6 A;  4OS8 A;  3UEW A;  1CBI A;  1BJ7 A;  3WJF A;  1SRG A;  2F09 A;  4ZHG A;  2AT3 X;  2FTB A;  4NP1 A;  1IKJ A;  1LCV A;  3LHN A;  1LIB A;  1N9M A;  2RTK A;  3QKG A;  1CRB A;  1RLB E;  1SY2 A;  4O3Z A;  2IZG B;  3VHI A;  1B0O A;  4GK9 A;  3BU1 A;  2QO4 A;  1KL3 A;  4KC8 A;  4OEM A;  4UU2 A;  1W5R A;  2A3F X;  3FA6 A;  4IB8 A;  4ES7 A;  5KID A;  2AT8 X;  4YFP A;  1GKA B;  1TW4 A;  3NP1 A;  4ZFX A;  4YFR A;  3HOL A;  3OE3 A;  4GU8 A;  4AZQ A;  1DV9 A;  3WOV A;  1K3B A;  3GAQ A;  1RXK A;  3B2L A;  1JYJ A;  1PBO A;  4IRW A;  2IZE B;  3UEX A;  3SZH A;  3CWK A;  2JU3 A;  1A2D A;  4CDF A;  4D6B A;  4BX6 B;  1Y52 X;  2ALL X;  2RTP B;  4MVK A;  2A5B A;  1TOU A;  1VWI B;  4Y0R A;  4Y0P A;  3SZJ A;  4COT A;  2MO5 A;  4IMO A;  1GKA A;  2CZT A;  3FA9 A;  1EI5 A;  4BX5 B;  1YIV A;  3C77 X;  5CHK A;  1LNM A;  3VG2 A;  2Q2M A;  1CBQ A;  2RTF B;  3P6E A;  1LCW A;  5EED A;  2N93 A;  5HA0 A;  5B27 A;  3D97 A;  1SWS A;  1VWR B;  1SWC A;  3P02 A;  1Z24 A;  1BRQ A;  3APU A;  1KL5 A;  1QFV A;  3Q34 A;  1R0U A;  3ZW1 B;  1IW2 A;  1I9H A;  3ZZV A;  4CDE A;  2XKL A;  4Y0S A;  5K68 A;  1OPA A;  2GTL O;  3PPT A;  5HZ9 A;  4ZGU A;  3NQK A;  4QYN A;  4YCE A;  1URE A;  4INN A;  5AQ6 A;  3HWG A;  1CBS A;  4KII A;  1EIO A;  5IRW A;  1SRF A;  3RDS A;  2JGS A;  3CKF A;  1JZU A;  3HOE A;  3RWX A;  3STK A;  2YMS A;  4GDZ A;  2QO5 A;  4QZU A;  2C4I A;  5AEO A;  1VWH B;  2LKK A;  1RXH A;  2VDF A;  2JU7 A;  1JMX A;  1PTS A;  3E3C A;  4O9S A;  1IJ8 A;  2RTA A; 
#chains in the Genus database with same CATH homology
 2AVI A;  2Y3E A;  2RTN B;  2RTC B;  1SWL A;  4GD9 A;  5CSE A;  1SRI A;  2C1Q A;  2RTB B;  3MG5 A;  1SWB A;  1SRH A;  1SWK A;  1SWP A;  3FDC A;  2OF9 A;  4GJS A;  3RY2 A;  4BCS A;  2IZC B;  2OF8 A;  5F2B A;  5JD2 A;  4BX6 A;  1SLD B;  1VWJ B;  5K67 A;  3EW1 A;  4JO6 A;  1KFF A;  2RTH B;  1HQQ A;  3RDO A;  3T2X A;  1SWA A;  2RTQ B;  4BX5 A;  1NC9 A;  2IZF B;  3RDQ A;  4BJ8 A;  4U46 A;  1VWM B;  2IZA A;  3WZP A;  1HXL A;  1VWF B;  1VWE B;  4CPF A;  4DNE A;  1NQN A;  3VHM A;  4GGR A;  1VWP B;  3SZI A;  4CPE A;  3VGW A;  1STS B;  2ZSC A;  1VWA B;  2WPU A;  1VWB B;  5IRA A;  3WZO A;  2RTM A;  4GGZ A;  2IZD B;  1VWG B;  4JHQ A;  3X00 A;  4Z2P A;  3EW2 A;  3RY1 A;  1STP A;  1SWQ A;  3T2W A;  1HY2 A;  1SWG A;  2RTL A;  3WZN A;  4BX7 B;  3T6L A;  1SWO A;  2GH7 A;  2Y32 A;  5B5G A;  1RXJ A;  4GJV A;  2UZ2 A;  4CPH B;  1SWJ A;  1SWR A;  3RE5 A;  2RTI B;  1VWL B;  1VWK B;  4CPI A;  1HXZ A;  1SRG A;  2BC3 A;  2OFA A;  1VWN B;  1LCV A;  2F01 A;  1NBX A;  1SWD A;  1Y55 X;  5B5F A;  1N9M A;  3T6F A;  2RTK A;  4Y59 A;  2C1S A;  4GGT A;  2OFB A;  1SWN A;  3WZQ A;  3WYQ A;  4OKA A;  3VHI A;  4Z6J A;  2IZG B;  1NQM A;  2Y3F A;  1KL3 A;  1MK5 A;  4Z27 A;  2A8G A;  2UYW A;  1RST B;  1NDJ A;  5L3Y A;  2CAM A;  1MM9 A;  1LCZ A;  1SWH A;  2IZL B;  2IZK A;  1AVE A;  1RAV A;  2RTG B;  1AVD A;  1RXK A;  1VYO A;  4IRW A;  4BBO A;  1DF8 A;  1KL4 A;  1SLG B;  1SRE A;  2IZB A;  2IZE B;  2IZJ A;  3SZH A;  1SRJ A;  1VWC B;  1SWE A;  1N9Y A;  1WBI A;  1Y52 X;  2RTP B;  4Z28 A;  4BX6 B;  2A5B A;  1VWI B;  2MF6 A;  3SZJ A;  1N43 A;  1VWQ B;  4EKV A;  1LDQ A;  2RTO B;  1SWU A;  1SWF A;  3MM0 A;  3RDU A;  4BX5 B;  4Z2V A;  5CHK A;  2IZH B;  4BX7 A;  2RTF B;  3VHH A;  2FHL A;  1RSU B;  4YVB A;  3PK2 A;  1LCW A;  2RTR B;  2RTJ A;  1LDO A;  1SWS A;  1VWR B;  1SWC A;  4JNJ A;  3WYP A;  1MOY A;  1Y53 X;  2G5L A;  4Z2O A;  4CPH A;  1KL5 A;  1N7Y A;  5IRU A;  1LUQ A;  2A5C A;  1I9H A;  2RTD B;  5K68 A;  4GDA A;  1VWO B;  2IZI A;  4I60 A;  1N4J A;  1LEL A;  3RDX A;  1SWT A;  5IRW A;  1SRF A;  1SLE B;  1VWD B;  3RDS A;  2JGS A;  4Y5D A;  2RTE B;  1SLF B;  2C4I A;  1STR B;  1VWH B;  2FHN X;  1MEP A;  1RXH A;  3RE6 A;  3RDM A;  1PTS A;  2QCB A;  1IJ8 A;  2RTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...