1MPAH

Bactericidal antibody against neisseria meningitidis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
225
structure length
225
Chain Sequence
EVNLQQSGTVLARPGASVRMSCKASGYSFTSYWLHWIKQRPGQGLEWIGGIYPGNRDTRYTQRFKDKAKLTAVTSANTAYMELSSLTNEDSAVYYCSIIYFDYADFIMDYWGQGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MN12H2 IGG2A-KAPPA
publication title Bactericidal antibody recognition of a PorA epitope of Neisseria meningitidis: crystal structure of a Fab fragment in complex with a fluorescein-conjugated peptide.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (immunoglobulin/peptide)
total genus 36
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 1997-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mpaH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mpaH02
1MI5E 1FYTE 4JFDB 5JUEH 5FO8B 1U95A 3U9UA 4MJIA 1MEXH 1R5IA 2RCSL 4Y2DD 3O6KH 2HJLB 2WW8A 4JJ5A 1FL5A 2DYPD 2OTUA 4MNHA 5F6HI 1TZIB 5J9PB 1ORQB 5HYQB 2FSEB 1MPAL 3DYPA 1WF5A 4OFIA 3DUSA 3ZSSA 4PJCA 4H5SB 3DHMA 5SV4A 5CFHA 2YBRB 3GUTA 3O2DL 5KN5A 2G2RA 2AV1B 1XR8B 1GZQA 2X4TA 4Z7UF 4M5ZL 3BQUD 4JRYD 3LQZB 3S88H 1HOCB 1KJVA 3N1GC 3QWOA 1RJLB 2R2EB 4R4BA 1JHLL 2XZAH 3H7BA 2NXZC 1FDLL 3B3IB 5ITFA 2VLRA 4LDEB 1VFAA 1A4JA 5IV2A 4Y4HD 1BVKB 1GC1L 5H94A 4QRTA 4XNUL 3W0WE 2HVKA 5DJ2B 5KW9H 3S36H 1UM4H 2IADA 4OIIL 1Y6MR 5ADOL 3VXUA 4M6NH 1HILB 3V4PL 1VFOA 1ZHLA 2X7LA 4LRIA 4MA8H 3FQNA 2W38A 4MGXA 2ITCA 4HH8A 3DWTA 3SQOL 4F7CA 4OKDA 4Y4FD 5ESVA 2XKNA 4UQ3B 5AG8A 2IFGA 4XPTL 2W9DL 4X6CF 5IKCA 3D85A 5CMAB 4NFBA 4XPGL 1AP2A 1A5FL 1D5BA 1EDQA 3CFDB 4UMGA 1DBAL 1TVDA 3QQ9C 3S35L 4Y8AA 3ULUL 2DM4A 3WIIL 3GMRA 1RU9H 5EORL 4IRSC 4ZO8A 1JCKA 5FKAB 1QSEB 1GJIA 3ARGD 1PKQB 5JORA 4QOKA 2ZUYA 3IDJB 1SY6L 1IFHL 3Q5YA 1EBPA 5C71A 3FONA 3IRZA 4Y7MA 4QCIA 2XY1A 4MCZB 4HK3J 5I15H 2VLMD 4LLMB 1QSZA 1BQLH 4OZFA 4Q0XH 4W4OC 2JELH 3NCEB 3MLTB 4WEBH 4EI6B 4EI5B 4YHIA 4OBRA 5BOZG 3UJJL 4NFDA 1P4IL 3HA0A 4H25A 4LGPB 3VMOA 4W81A 5HVWA 2VISB 3IDMA 3QUKB 4JY6A 4XVSL 5CHNB 3TJHD 3LZFH 5HBBA 1JIBA 5IM7B 3DX6B 3RVWC 1I1AB 5C0CB 4JDTL 2P24B 2FEDD 3N85H 3KYOA 1CLYL 4PREB 4RMVA 5FGCB 4FRWA 2GAZA 3K1DA 4M7JL 4N8VB 1FNFA 3DHJA 4F7EB 1JPSL 2NYYD 4IOFC 3MRFB 5L0QB 3B9KC 2QSTA 5B38A 1YYMH 1F4AA 1KTLA 2VZUA 4X6FA 3LEXA 3RWGB 1YEIL 4N90E 5AG9A 1KPRB 2MKLC 4E9LA 1NCUA 5TF0A 1YYLL 4U1MB 3EYSH 3ROLA 4ZO7A 2VZ1A 3VU2A 2YS4A 5F1IA 1MCPH 4WFFE 2DMKA 5AD0A 5HYJB 3FQWA 3GHEH 4QHNA 2EDNA 3TBYB 3RUGA 5TFSH 2ID5A 1YNKL 4QYOA 1RULL 2OMNA 1A2YA 4MS8C 4JFEB 1J0HA 1WSST 5D8JH 3QRFM 4OZIB 3UAJC 3ZE1F 4OLWH 1QSFE 3FOMA 4S1SH 4YDKH 1LEGB 1FAIL 2P5WE 2OZ4A 1CQKA 3ULVE 3WXWL 3REVB 1TVBA 2PR4L 1BZ7A 1SHMA 4YHLH 5HY9A 4OLUL 3MR9B 5TGBA 1KENL 3PL6A 2NY4C 1YMMD 3T08A 4HWEH 2QQNH 1JPTH 4RFNB 2DQGH 4U1SA 1KTKE 4OLEA 3QUYA 1Z2KA 3QXTA 1EV2E 4J3VA 3L7EA 2V2WA 3JWDH 4HKJA 5E99H 4OQTA 3DUUA 3TVMB 3Q6GH 2OR9L 4KJPD 1OB1A 3IGAA 2DLHA 3UDWA 4Y5XA 3LEVL 3M07A 3STLA 4Y4KA 4Z0XA 3SDCB 2DKMA 3TYFB 3JTSA 3AREC 1T7ZA 4M7KH 5DJ8A 1JP5A 1C5CH 3H9SB 3MLWH 1OGTA 3FQRA 3IDXH 3ZKMD 1JN6A 1YY8B 4YHOH 3M1BA 4GBXD 5IOPB 3FMGH 1V7MH 2O5YL 3ARFC 4KTEL 4JHAL 3VGDA 3F7PC 2VL4A 1JYWA 4OFKA 1G0DA 1DUYA 3CXDL 3ZTJH 1Y0LB 1UM6H 5EN2A 4Y4HB 4DGIL 3C5ZA 3L3HA 4HWUA 5GS1B 3PUCA 4IRJB 5FO9B 1UENA 2BNRA 3ZHDA 2ZCHH 3OBAA 3MRHB 5TDNA 1QVOB 4K3JL 4WW2A 4LFHG 5A2KH 3DX9A 1YEDA 3H2WA 4Z9KB 1HHHA 5L2KD 4LOUD 3P11L 4PTUA 1CGVA 4KGJA 4TULH 1WCQA 3RKDD 4LLQA 2VAJA 2Z93A 4BH8A 1S5HA 2HLAB 1MHPH 4HUVB 1UJTA 4U1NB 5GJTH 3VGBA 3B9AA 3BEWB 4OT1H 5EU6E 1MELA 4U0RC 3HG1D 2ZOLA 4L8BA 1KCLA 1N3NA 5CZVL 3QSKB 1DQLH 5F7DA 1OT1A 4X6DA 2ESVD 4RGOL 5GRWA 1UWGH 3IDUA 1XMWA 1JZ4A 4UTAH 2QQKL 4C4KO 4NQCD 3FRPG 3QUMA 2CK0H 3GI8H 2Z8WC 1CICB 2QQQA 4MQTB 3QIBB 4PUBL 3T0BA 7CGTA 2F74A 4LKXA 3JWDC 3UYOD 5HYSB 4LEOB 4YFLF 1WCBA 2I5YL 4PJFF 2BSSB 2EKSA 2XTLA 3BXNA 3NGBB 5DQ9A 1FVCB 5I1IH 4XXDA 1S7QA 1GOFA 2C3WA 3O8XC 4K3EH 1OAUL 4KXZI 2LV4A 4LIQE 4OCMC 4RX4D 1MFEH 5E6IA 1KTRL 4XVTH 1SYVA 5L7XH 4POZD 5IMMA 4XBEH 4APQC 2DD8L 3BDXA 4XCFL 5DMKA 1A3LH 3TZVC 1QOKA 1K6QL 4HV8A 4I0KA 5F9AC 5GGTA 1OARH 1VENA 1HXYB 4HS6A 4PV8B 3QIUA 5CGMA 2BRRH 1I85A 2HA1A 4HWNA 1RZKL 5T3ZE 4KK6C 3FT4A 3QIWD 3U7AA 5DA4A 4MJ2A 1NDMB 1I75A 3CFBA 2Q6WA 3HFML 4NGHH 3SDDA 4PJGE 5ID0A 5EBGA 1ZOXA 1WFOA 4M00A 4M1GH 5CS7A 5I66B 3S5LB 1ZA6A 1BJ1H 4W6YB 2IALA 5B21A 3L3IB 2NY0C 5EZOH 3QHFL 2V9RA 3FQUB 3P9MA 3OHXA 5EULV 5H2BA 4MMZC 2ZUWA 1T2QL 4G80B 2F8XC 2FD6H 3O6MH 3O41A 4TUJA 1GXEA 2AJ3B 3FO0H 4P46D 3X14B 5GRVK 3DECA 1QEWB 2WINB 3GMNA 2JIXD 5F6IC 3UZEA 1NMCB 3VFVA 1MRFH 3ISWA 1BAFH 2MWCA 4UIKL 1CXLA 3U0WL 4JPWL 2O61A 2OR7A 3T2NL 1YNTA 3V6OE 3BZDA 4M4RA 4Z8FL 3T3PE 5IBLD 3MBEA 1FNSL 4HS8L 3V7AG 1XGYL 4PRAB 3SKOB 1WFTA 3NTCL 3TT1H 3VFRB 1J0IA 3OKMA 1HSBB 4AENB 1HI6B 4LLDA 5E2WL 3IU3A 2Z8VC 4PJ9C 3P0VH 4MD5A 4QXWA 1RPQA 4JKPL 3WE6B 4ELME 1MI5D 1FYTD 2GK2A 4KRPC 2R2BB 1A3QA 4DUXA 4OLVL 1H3XA 5EFIB 1MWAB 5CZXC 3NCYP 3QPQC 5ETUB 1CFSA 3GJFB 5GGRY 4ODBD 3T8XA 4L3EA 4YHYC 2IH3A 3PV7A 1ZTXL 1NQBA 4LVOB 1M7IB 1IAII 3L1OH 3S4SB 4K7FB 5E2VL 3DYOA 1FCGA 4UAOC 4ZFOA 4KMLB 3C09C 5KSAD 4OCXH 3Q48A 3BKJL 3IJHB 3QUZA 4RNRB 4PJHB 5IROC 4ONGH 5AUMA 1RUPL 1YDPA 1B88A 5I19L 3E0GA 4K7PH 2KDGA 4P2OB 3JV5A 3FT3A 5EWIH 1XF5A 1UB6B 2IPKA 4Z7QF 1LO2H 4DKEH 3B43A 2KPNA 5GZND 3T2PA 4MLIA 3W0WD 1OSZB 4TVPE 1T7WA 4YHNB 3I6KA 4YAQB 2NY2C 1RV6X 4XWGH 1KULA 2HFFA 3TNMA 3G6JA 1OP3H 4QEGA 3OTTA 3MLSH 3GNMH 1J18A 3G5VA 2DTML 1R3JB 1U8MA 5DMIH 4GAGH 1LO4H 4O5LH 5JO5B 5GGSA 4ZXBB 1EAJA 1KB5A 3KYNB 3U9PH 2AJXL 4QHKI 1A6PA 3SN6N 2HN7A 4HGWA 4LAQL 4JANB 3SE8H 3MV9B 3SCMA 5A1AA 1NEZB 1FRGH 4EUPG 2E9BA 3UTSD 2XZCL 1SM3H 4PJEA 1CQYA 5T1LD 2A6IB 1JNLL 3KPQB 3L5JA 4OI8A 3BP7A 2EYSB 1KYOJ 5C0BE 2Q8BH 3QG7H 1WZKA 4R7NA 1OP3K 3HZMA 3MA7B 3MODH 4PP1C 5E8EB 4DVBB 1CL7H 1IL1A 2P8MA 4OF0A 3CDGA 4YBQC 3LD8B 2FO4A 4FQPA 3T0XA 1SYSB 3BH8B 3VXME 1T1ZA 3C6LA 2LVCA 1BFTA 2OLDA 4WWKB 4P2QA 5FOBB 3I3BA 1BJMA 3IDYC 3KJ4C 4XVUD 2BSTA 4MAYB 3HZYB 2AXFB 4JRXB 3WEXB 2X4RB 1BJ8A 3DXAE 3RPIA 3KPOA 1L0QA 3KPPB 3VH8G 2BSRB 1ZHBA 4WY7L 4PG9A 5AYUH 2BFVL 4GKOA 4WCYH 4Z95H 5ICXA 1NJ9B 4WDIB 1CVSC 3JVGC 4JG1L 2ICCA 4PJAF 3EOYG 2IQAB 3HE6C 3MRBB 2A74B 3D69A 1G7QB 2CR6A 3FQTA 3G5ZA 4YGVA 3W82A 2X89A 1IM3A 4ONOA 5DFVD 4Q6IB 5A3ID 5CINH 3D3VD 3WD5H 5DUBB 1XZ0B 4KI5C 4G3YL 5FGRA 3LKRA 5F72S 2VUOA 1SEBA 5JHLL 3A67L 3LMJL 3V52H 4CW1A 5DC4B 4HKXB 4OJFL 5BZWA 1ACYH 4O00A 5DI8B 3RPKA 2AI0H 3IFPB 1UXWB 4FQQB 3QISA 4N90D 3B6SA 3QAZC 2NW2B 1VEOA 1GHFL 3W9DA 2P8PA 2AJVL 1JGEB 3VFUA 1WBZA 2MCPH 2IFFH 2BMKB 2GHWB 3BZ4A 5C3LD 4NKOA 3MBXH 2BZDA 1IGJA 1ZT4A 3O3AB 2ZCKH 4PJIB 5GGQL 2YRLA 4LASH 4L4VA 5DVNA 5GSVB 4QRPE 4LCWE 1KJ2H 1AGCB 2A1WH 2P5WD 4NNXB 1RMFL 3KVQA 4WO4B 2G75A 2WWMC 5E94B 1K3ZA 1T0MA 2XTJC 1ED3B 2WK2A 3D9AL 4JCLA 4N0RA 3T04D 1YECH 4QTIH 1I8MB 2BRQA 5MP6H 4LQ1A 1CE1L 3W2DH 5C0DA 4Y89A 4LSTH 3GHBH 3ARPA 5I73B 4WI2A 5D70H 2IBZX 2D4FA 2XWBA 3WUWA 4X6BA 5LGJA 3LSOB 2C1PA 4XX1E 3NA4A 1IQWL 5C08E 2BHZA 3MO1A 5CEYA 5B3JE 2RCSH 1V7NL 5LJYH 4LHQB 3B4NA 4ODHH 3ZZ1A 4K9EL 1N5AA 4LARH 3TA3B 4ENED 1CK0L 4PGZA 5CEXB 3BGMA 5IR1A 4NQDE 4X7SH 1P6AB 5ACMA 2EDKA 2AJUL 1CYGA 2CIKB 5J4MA 5IBTH 2FHBA 2JK5B 2WQ8A 4OZGF 2A6DA 1D5XA 3QPXL 3ZDXF 2VTFA 1A02N 1GGYA 1AC0A 2DQJL 3PWVA 3FFCA 1UWXH 4KROB 3V9FA 4KPHL 1T5XA 1KN2H 3DV6A 1AKJB 1PX4A 2C3XA 1G6RB 5EBLA 4NM8L 5FM4A 1G84A 4DN3H 3S96A 1MFDL 1FP5A 4XNUH 3DROB 4Y19A 2DIBA 3VFPB 1H3VA 5IVXB 3NFPB 1CDCA 4OIIH 4OV5B 1PAMA 4EN3C 5J3HC 3LKOA 1INEH 1GSMA 5HGBA 1UZ6E 4RFOL 5B8CB 5EU6D 3O45B 5A2JH 3DTXB 1NAMB 1UWXK 5KSUA 1TJHH 4P23C 1L9MA 2W9LA 1QUNA 3JV6A 2VQ1B 5D6CB 1YQVL 5HDBE 2R1YB 1WIOA 3I6GB 4XP9H 5FYJD 1A5FH 1VHPA 1ULVA 3OJDB 4QKXB 4G9DB 5IT2L 4ZAKD 2UYLB 2OJEB 5TPWL 3S35H 5GZOC 3ULUH 4FQ1H 1C8PA 3EJJX 4LNVA 3UPAA 4X9HA 2ADIB 1MHHA 3C8KA 3P4MB 4QF1A 4YDVB 5E4EC 1S7SA 1HH9A 3QEGL 2P8LB 3RZCB 3LQMA 1FFOA 4OCSL 2UWEE 1ES0B 4HIJB 4OGXL 4QHLA 1C08A 1JPST 3CDFA 5E1HB 1MLBB 3BHBA 5D1XB 2Q8AH 3HC3H 1A47A 4ODWA 3NIGF 4LSVL 2ED9A 2XXMB 2XNAA 3BMVA 3S6CA 5ITBH 2ARJB 2VZ3A 3KPSA 1DBMH 5E8PB 1P4IH 4BQBA 5FUZH 2GW5A 3BIBX 1NC4D 4PRBA 3O6FA 5T3ZD 4HUUB 1LO0H 5IB5B 2V6HA 1FZMB 2APTA 2R0WH 2H3NB 4LEXL 5GGVL 4F7PA 1HK6A 4EXKA 3VXSE 1UVQB 2DBLL 4PRHE 1BZ9A 1ZA3A 5DK2B 4KU1A 5J6GA 4Q6YA 1UH2A 3FCTB 2R23A 2VLKB 3VGAC 1U93B 1VCAA 1S7UA 2DICA 3UYPA 4GW1A 3BPNC 1WC7B 43C9A 3OXRB 3IT8D 4P2RE 3ARBC 2MSPA 1Z5LA 1JPSH 1DQJB 3AB0C 3DMMB 3DSFL 2IBBA 2VDKL 3HCVA 1CLZL 1DFBH 1WWAX 1IILE 3QNYB 4H0GA 4IEFB 4JLRA 4O2FA 1F3RB 1YEIH 4E5XB 2HT4C 1YYLH 1G7LB 2NNAB 4S1RL 4JO3L 4Z7WA 5CSZA 1C7SA 1KCKA 1QSFB 4KVCH 5AZEH 5I9QB 2FB4L 1FNEA 2YPVH 1BD2A 5F1NA 1FFPB 4FFWC 3CK0H 4JQIL 3BPCA 5HHVL 1YNKH 3MJ9H 4U7SA 3TGXA 2X4PB 5IW1B 3G6AB 2MQ0A 3ULUC 2VDMH 4Z7UE 3AU1A 4Z7OF 1HDMB 1MREH 1WWCA 4WUUB 1M1SA 3HHRB 3TBVA 1WIPA 2I26N 1G9NL 5DHVB 4OF3A 4NO3B 1DN0A 2K9UA 2Y1VA 2PR4H 3U7YH 1QBBA 3MRGB 4S1DC 3IRPX 1KENH 1JI1A 5JQHC 3CXHK 3FB5B 3MLYL 1NAKH 4OQ1A 4JO1L 5A16B 1D5MA 3FN9A 4QNPF 5FYLH 3G6JF 4CDGC 5DK0B 3OPZL 3WDHA 2OR9H 4NZUL 1MHEA 1XCQA 5HHMB 2IPTL 2JJSA 2EDYA 1AFVL 2ERJB 1NFIB 5M94B 4X6CE 3ET9F 5EUKB 3O4OB 1I8LA 1X5HA 3O2DA 3QFDA 3JTTA 4I18A 2YZ1A 1MCCA 1ZHKA 3MCKA 5DD1H 1IAMA 4PJ8D 1M6OA 4PR5A 4HF5L 1KIQA 4MQ7B 1PDKA 4ZUVA 3CXDH 4Z7VF 4JN2A 1QHOA 1A6AB 2QADB 5DD6B 2DQUH 3CPLA 2DWEA 5I6XB 2DJSA 2W60A 5DUPL 3I50L 3QEQE 4ODTL 2QSVA 4NC2B 4TVPD 2ADFL 4CMHC 4M7LL 4MNQB 4CRPA 3ABZA 3MRCB 2ZCLL 2P7TA 5HHPB 4L8SA 4N5EC 1K8DA 5E1AB 1IAIM 5I0ZA 3OKYA 5HHOA 4L8DA 2VR9A 3BPOC 3ALXA 4JVPA 4TUOB 4YR6A 3PQYA 4YDLC 1U8QB 43CAA 2NY1C 4DOHE 4JJHA 3VXTA 2HLFD 4GQ9H 1NCWL 4DN4H 5CZVH 3WNMA 3MJGX 2YD4A 4RGOH 4JM2C 5K9OA 4WGVB 1QLFB 4JFDA 2EE3A 3MCLL 2AJSH 5KVDL 1XH3A 4LKCB 4HWZA 3S37L 2BJMH 5C0BD 4LSUL 2AABH 4ERSL 3MRRB 2Z8SA 4XCYA 4PLKC 2EYRB 4IMKA 3ME0A 4S11A 2H32A 2HG5B 4L29B 2GJ6D 4MNGE 1FORL 2D9QB 3LKPB 2ZP0T 1SY6A 1T1WA 3IFLH 2I5YH 2CDEB 2CDFB 4JKKA 1S7RB 4PJ7B 1A14H 5KOMC 3VXMD 4LLAA 1G7MB 3U6RA 4WUKH 2MJWA 5EPMB 4D9RD 1I7TB 1OAUH 1U41A 1KOAA 4OZHB 3VXPA 3RNKB 4R4FL 2FIKA 5IESH 3GSQA 1MUJA 1DUZB 2R2EA 1KXTB 3X11B 3HNTL 1ZWIB 1H15A 5DEFA 2ICWB 2HTLD 1P7KB 1CZ8H 1NLDL 4LLUB 3VXRE 4ZO9A 4JE4B 4EJ1C 2VZSA 2VXQH 4OAWB 4GG6F 2X9YA 4HK0B 1Y18A 1UXSB 3E6FB 4I48A 2Q1EA 2FHCA 4E42B 1T66D 3ZE1E 4OLXL 3O9WB 1DQDL 3BH9B 1RZKH 2H2PD 4YBLB 3VDCA 1CDHA 4QRRA 5IG7B 3RTQB 5IMLB 2VLJE 4M8QA 4EIZC 35C8L 4XNQB 3WJJC 1WEJH 4BQ6A 5INCA 3VXQB 2D7PA 1Q72H 3HFMH 2UZIL 4BKLA 4Y1AB 2D7TL 2GTWB 3K2UL 3SGEI 4FQ2H 5FYJL 3MRKB 3KPRE 1HYSC 3MX0A 4JFFE 2HJKB 5CILL 3LV3B 1TETH 4NPYA 1EGJH 3QNXB 2ICEB 1T2QH 1OT2A 4UBDC 4WU7B 1FHGA 2IGFL 1SMOA 5FKAA 3KPNA 1M7DA 3M17A 3VFNB 2CDGA 1J10A 4JHWL 3VG9C 2RIKA 2Z4QB 2IWGA 1P4LB 4WV1A 2ENYA 5ISZA 4QRPD 1L6XA 4Q9QL 4LCWD 2NX5A 3BAEH 4MCZA 2NXYB 4U3CA 3T2NH 4K71B 5GJSL 1NCDL 4Z8FH 2Y06H 3C5SB 5GSRB 1X5KA 3KYMA 2J6EL 4ELMB 1U8JA 4KI5F 3NTCH 4EI5A 3CFEA 25C8L 4PP2B 1OTUC 4NO0A 4X5WA 1EAPB 1R3IH 1PG7L 5D96C 5HD8D 1O7SA 4YZFF 4YXKL 5GPRA 1OGAE 2V7HB 3KWWB 4V1DA 4UDTB 5IM7A 5C08D 1P1ZB 3RDTD 3SE3A 5E08L 2N7AA 1RJCA 5D5MA 2CUMA 1D5ZB 1UACH 2VUYA 5LAXB 3SEPA 3VWKD 1VGEL 5KSBF 3GRWH 4RMTA 4PY8I 1TENA 1ADQH 1J8HA 2P43B 4HUMB 1ZTXH 4L4TB 1R0AL 4NQDD 4N8VG 3BPLC 5DO2D 4M62L 3L5IA 3BKJH 4LP5A 3MRFA 2PO6B 3KPLB 4O2EB 4QY8B 1MQKH 3C2SA 5H37H 4WFED 1JZ3A 1NEUA 3RWGA 1BLNB 2KH2B 1EPFA 5F9OH 3SGJA 5I19H 5F8RC 2M8XA 1T1YB 4PB9H 3TH2T 4X7EC 1XF2B 4PJFE 3BKML 4POYA 4AT6A 1U8KA 4CUCA 3TBYA 2K7QA 1A7RL 2OK0H 5F3HA 1U91A 1QQDB 4JFEA 4D3CH 1S7WB 2VRAA 3EOBB 1AQKL 2YN3A 4G7YH 3TN0D 5AZ2L 4P4RB 4ZUWA 2FLRT 3T4YB 4HCRL 1CU4L 2R56L 3MR9A 2H8PB 5FYKE 1WAAF 4WTZA 2CXKA 4EVNB 3VDBA 1NUFA 1NL0L 4JPVH 4LCCC 3WO3B 4QHUB 3K2MC 1NBVH 4Y2DA 2DLFH 4MXVF 2AJXH 3MLZL 3D5OF 2DYPA 4LAQH 1CD8A 2PXYC 5J56B 4XHQA 4PJXA 5C07B 3V6FB 2GSGB 3IVKB 5HI5C 2CH8A 4UNVA 1GPOL 3WDIA 1MRCL 4M9PA 4KDTA 1CFNB 3ES6B 4KJQD 5D1QB 3EDFA 4RISL 2A2QT 4TRPH 3VWJC 4NJ9L 3BQUA 4GMTL 4JRYA 2DLEA 4PJBF 3UJIL 4TSBL 2VWEC 2DM3A 5BRZE 4OTXL 2FL5B 3DXAB 3MRIA 1T4KB 2YSSA 3HUJF 3QUYC 3GJEB 3DO3A 5DRWB 5IOPA 2O5XL 4HHAA 4YH6A 3V5DB 4KXZH 5D2NE 1I1FA 4XNYL 4WRLA 1FG2B 4AEFA 1A7NL 3D18A 3O3UN 4NWUH 4Y4HA 3UDWC 4HZLA 1WFNA 1A0QL 1KGCE 1JRHI 2EYTB 5GS1A 5C0AD 2ZG3A 4TVPL 5FO9A 3EOAA 3TV3L 5MENE 2MOVA 4JAMB 5C0FB 4LVEA 1M05A 4B7IA 3HI6L 3KHQA 5HGGS 3MNZA 4M93B 5EOCH 4Y8DC 4JG1H 5CJBA 1R3KA 1ZEAL 1LK3L 3DX7A 3GSOB 4PGBB 4DKFL 5EA0H 3RWEA 3ZO0A 3VXSD 3C5ZC 2QR0A 2LTQB 2ZPKH 4G5ZL 2W92A 4PRHD 4CMMA 1GIGL 2VYRE 3I3DA 3QO0B 4ETQA 1JVKA 3LMJH 3BN9C 1OAZH 4P2RD 5EBMA 3KR3L 4JFXB 3VXUE 1CXIA 2AAVA 4S1QH 4IOIB 1KLFA 3ARGA 1U3HB 3HPJB 2EH8L 3QIBA 3MGTB 5SWQB 4LCYB 4OGYL 1NUGA 1NFDA 1PYWA 3OGCB 1MJ8L 4G42B 3BUTA 5HYSG 2EZ0C 4OSUH 3RWHA 3C9NB 2R15A 1KLUB 1V5JA 5GGQH 2EE2A 4KTDH 1KCSL 4I77H 2ITDA 2O5ZL 2XWJA 3K74B 4N0FB 4X99B 3O2VL 4OI7A 1RMFH 2EE6A 4PRPD 4IHOA 4ODSH 1QRNE 4Z7QE 1QBLH 1T0NA 1TFHA 1XIWD 4P2CG 3D9AH 1X4ZA 4M43L 4PV8A 2A38A 5I1JH 4YWGL 5EO9B 5C08B 3Q3GA 1VPOH 1CE1H 4DEPB 3MLUL 1F3JA 4NN7B 3MYZA 2CGRL 4GRLC 3T4AB 3MUGA 3PP4L 1BX2A 2R9HD 4KKBC 3QCVL 4QRSA 2YD5A 4R4ND 1IQWH 4MX7B 4F37K 3CJJA 4B41A 5J11B 1V7NH 1MFCH 1N5YL 5CP7B 4ODXB 4UT6L 4K9EH 1IAIH 1N0XL 3RGVC 3QRGL 1I85C 4IMLB 5JPNB 1D9KB 4K07A 4MSWB 2VC2L 3CFCL 3S5LG 2C3GA 2CLVB 5INDB 1FN4A 5HGAA 5L9DL 5ANMB 3FQUA 3J8F7 2AJUH 1HCFX 1AO7B 2VLLA 3WHXA 5I75B 3ULUF 5CBEB 4KKLC 4LPWA 4P5KA 3X14A 2XN9B 5DC9B 2V2TA 5E5RB 1B0GB 2DQJH 1EFXD 2YD1A 2WINA 4I13B 1MCDA 4G8EB 3QEQD 1HHGB 4I5BA 1OPGH 4KPHH 1YN6A 2WBJB 1ZLUH 1YY9C 1QO3A 3KLAA 3HI5H 4NM8H 3HLAB 5CD5D 5DWUL 1KTDB 1RJYA 1YMMA 3G08A 1F5WA 3FKUS 5MI0B 3ZKXB 3HMXL 4BZ2H 4PRAA 4D0DB 1P7QB 3VFRA 4QXUH 2IH1A 1HH6A 3LIZH 1ITBB 2X1OA 4PJAE 3JV4A 1EH9A 4MJ6A 2HJFB 3WE6A 1ZLUK 1YPZA 2R29L 5GHWH 1BWWA 1UGNA 1YQVH 5K9JL 1YMHB 3D25B 5IHUL 2B2XL 2UY6A 4GBXA 5BXFB 1RSFA 2E5EA 3S4SA 4U1LB 2DWDB 2BOCA 1YUHB 4PJDB 5DD0H 2ED7A 5HJ3A 3S34L 3VW3L 5GRJH 3QEGH 4HBQA 5ESQB 1VADB 5FB8A 4X8JB 4EZMA 3ARDC 1KJMA 1RY7B 5MEOB 2YRPA 1UB6A 1UEYA 3EYVB 3E1F1 4QTHA 4GQPH 1QFWI 1UG9A 2AJZA 3MLPA 2IEPA 5L2KA 3B2UD 4P5MB 3VXRD 1YEKL 4LSVH 4R26L 2EDHA 3BD3A 4XAKD 3PWNA 4R7DB 2H6PA 4Y16B 2DKSA 2FJGA 1E27B 5F44A 3WNPA 1YEFL 1C16A 5E2TH 3W81A 5IW6B 2PYEE 5FA4B 1Q9OB 1CFQB 2VLJD 4KMTL 3VRIB 3HG1A 4JM2F 5GGVH 4OGAD 3KDMB 3P73B 2ESVA 4GFTB 2J8UF 4LRNL 3BIAX 4FQIH 2DBLH 2G5RA 1AGEA 5DJ0A 4NQCA 5BV7L 3F58H 5C7XL 5JO5A 3BZFA 3L3KA 5CLTA 1DEEB 1GOGA 5LWYL 1IARB 4JFFD 4JANA 1SVZA 1NEZA 4PJ5B 1DR9A 5D2LF 1W0WB 2EEBA 5JLZA 2VDKH 1IEAA 1QFUH 3T0EB 3QHZL 1M7XA 2A9NH 1RURL 1BJ1J 3P30H 3GMPB 4KVNL 4C59B 3HE7D 4HH9B 1QA9B 1IAKB 3T1FA 4RX4A 3OKLA 4JO3H 3HC0A 5TE4L 3KYKL 3T3MF 3GKWL 3SDXF 1NKRA 5DJZB 5C9KA 5JW4M 4R2GC 3BJ91 4NRZB 5BMFL 4JQIH 1J0JA 3IXTB 5HHVH 2E7CA 3GMOA 4OZGE 8CGTA 4M7ZB 5F9WC 3ZDXE 4QHMA 3HZYA 5EIIA 1OWRM 3X3GH 3CVHL 5I74B 4OF5A 2XG4A 5D93C 3GK8L 1EJOL 3GSWB 4NKMA 5IVZA 3IJYA 5EO1B 4ZSOB 3UJTH 3QIWA 2E6QA 2GK0B 3MLYH 3MV7B 4K2UL 3N0PB 3MJ7B 1OGAD 4Q6IA 3CFKB 3OG6B 4M7LT 4YXHL 3WV0A 5EOTA 2NY3D 3DNKA 1OSPL 3K3QA 1I9IL 1XZ0A 4IIQA 2MHAB 5KS9B 1C1EH 4G43A 2ED8A 1TZGH 1XGPB 1H0DB 1CBVL 3BSZL 1N2RA 3MNVB 1AGFB 2IPTH 1FL6A 3RL2B 4EKXA 1CF8L 5C0IB 5IEHA 4H1LB 3UPRA 3GB7B 4MD4A 1S9YB 4P46A 2YMXL 1J05A 2JIXA 4CADA 2B5IC 4J3UA 5BOPA 4U1IA 3GSXB 4A2MA 4X6EA 3UTTB 2NR6C 3TIEB 2DS4A 2V5RA 3ARQA 4C56E 5HHQB 3QQ4A 4PY7A 3WKML 1SBSL 1HKFA 2G9HA 1O7VA 1SQ2N 1NGXB 2D3VA 3QUXB 4KUZL 3WN5B 3OKNB 3EO1B 3MACH 5SX5H 1TQBB 5DUPH 3I50H 4ODTH 5K59F 1FV1B 4BA8A 1PSKL 2ADFH 4HIHB 3OKDB 1VERA 4CN6A 1UJ3C 4NO2A 3IXAA 5FUOL 1AGCA 1K4CB 3WHE0 1JPFB 3E3QE 2OL3H 3NIGE 5FYKD 1INDL 5E70A 2AQ2A 5E94A 4X5XB 1MI5A 1FYTA 2EDQA 2LAGB 3ULSB 4P4KD 3PWPE 1TQCC 3VGEA 1JFQL 1HINL 2FZ3B 1OAXH 3DV4B 3ZMRA 3JBG7 1RJZB 2P49B 2C7UA 1R6VA 4MNGB 4RWHA 3TF7C 4I0PC 2XIDA 1B9ZA 3MCLH 5KVDH 1FPTL 4FFZL 1EEZB 1FFNA 5F88A 3LKQB 1MWAL 4TQEL 3JUYA 4A6YL 1RHHA 1LQSR 1TZHA 4HWBL 1A6WH 5BRZD 1EK3A 1JHKL 3BKCH 1DQQA 2D7OA 2VR5A 4NBZB 4TPRH 4RGMC 1UYWL 4N1CA 3D6GA 2CIKA 3FTGB 4JREB 3VE0B 1AHWA 5D1ZC 1PZ5B 2JK5A 1ZKAA 4AIZA 1EEYB 1IE5A 1KGCD 1TJIL 3MUZ1 1XGTA 3W0WA 1TVHB 3BDYH 2ADJB 5DURB 5MEND 3O0RH 2XWTB 1QLRB 2Z31B 5KTEH 5ICYA 4XRCA 2VLJB 1D3CA 1NLDH 4NQVA 1G6RA 4HJ0C 3EYQD 2A6JB 1RIHH 1I8KA 3X3FH 3HRZB 2AK1H 2ATKA 3QNZB 1VESA 4Z7OE 3RKPA 5C9JB 5D7IB 3HAEB 3DRQB 4JKLA 1DQDH 4OV5A 2XPGB 1MCJA 3HRPA 35C8H 5MEPA 4L9LA 3KPRB 3S98A 5D9SB 1FO0B 3TIDB 2VDQL 4LLWA 4N8CH 2F19H 3V6BR 1FL3A 4F2MB 3QXWA 3EHBD 2D7TH 5T1LA 1R3LB 4FTVE 3RWJB 3K2UH 4QNPE 1TPXB 3HE7B 3EFDL 1Q8MA 2VQ1A 4NSKB 3G6JE 1NBZA 2RHEA 1A9BB 2R1YA 3BEVA 4XNZB 2MTPA 3I6GA 1RD6A 5JPMB 3FL7A 1J1OL 1C7TA 4RAHA 5DMYA 1UQSB 1Q0XL 2I24N 5DEGA 1VFMA 2DI9A 4YIQA 3GO1L 3MUY1 5IWLA 1LE9B 1NGQL 4HS3A 3LAFA 3HZVB 2BCKA 5FCSH 3HNSL 2HTKC 2CKBL 1CD1A 3V0VB 4PLNC 5C2BL 3JZ7A 1OM3H 3U30C 2IAMC 4HIJA 1KC5H 4G6AC 2PF6A 3HI1A 4KY1L 3QO1B 3RWIA 4Q9QH 3H3KA 4Z7VE 1DN2A 3V79C 5GJSH 1JF1A 3W11D 1NCDH 1SJEA 1QRND 3MV11 3TO4B 4L8CA 3GSNA 4FQLH 1H3PH 3C2AL 4NRXB 3QI9D 4H0IA 1OGAB 1N6QL 3D3VA 3L5XH 1V3KA 3I02B 4J1UB 2NY3B 3I75A 3LRGA 2VXTH 1OAYH 4CVUA 5I1DB 4NCC1 1FAKT 4RAVB 2RBLA 2IAND 4JGJA 4YXKH 2FWOA 3LRHA 4F33B 2FX9H 4KQ3H 3KLDA 1T6VN 4FQXC 1RUMH 5IJVA 4XP6H 5I8EA 2DMCA 4F57H 4UOJA 1MRDH 4R0LB 5JIIA 2WUCL 5CIPH 1W72A 2Y9RT 4OM0H 1NKOA 1VGKA 1WC7A 4TSAL 4UI2A 3RWFA 1RK0A 5HPMA 4OUOA 2F5AH 5EC2A 4Y5VA 2V5TA 1A64A 1WBYA 5DHYB 5I76B 1N4XL 1T21A 4E5XA 4PTTA 3VI4F 1BWMA 1VDGA 3KLHC 3MFGB 1I4FA 3L3OA 4MA7L 4XGZA 4NJAH 1IC7L 5ELIA 2FIRT 4HIIA 4QGYA 2P5WA 1Q9KB 5C0JB 4ZUUA 5F1OB 1S7TB 2YOCA 5IW1A 1FGNH 4UINL 2CMRL 4P5TC 4ISVB 5JZ7C 1ETZB 2W0FA 3ZHKA 4KK5C 1C5DB 4UILH 4F9PC 1T7XA 1QFHA 4XTRC 4HCRH 5DHVA 1IAOA 3KPMB 2VIRB 4JY5L 1KNOB 2R56H 3MRGA 2KZWA 3QDAA 1HQRB 5MEQA 5T3XL 4GG6E 5D7JC 5A16A 3O6LH 2Y25A 3TO2A 3I6LE 5D72L 2AEQL 4KK9C 5EB9A 3WL9A 3Q1SL 4YHZL 1RI8A 1EVTC 1F6AB 1U6AH 3U4AA 4NN6B 3SJVB 3VGHA 4QRQB 3QQ9D 1MRCH 3U9UB 5DD3L 2GKIA 4MJIB 4N68A 4IRSD 1R5IB 2X4UA 1NFIA 3BGFC 4JJ5B 1FL5B 2OTUB 3V6ZA 4K7PY 4GMTH 4MNHB 3UJIH 4TSBH 3V4UL 3LPFA 5MENB 4KC3B 4D0BB 3DUSB 4XCNA 2O5XH 4UT7L 5IHZA 4PJCB 3GUTB 3QDGE 5KN5B 2G2RB 2DIAA 2X4TB 5JIKA 1EJ6A 5DD6A 5JNYA 1NH6A 2X70A 3LVEA 3TV3H 1KJVB 5DF0A 1P9MA 4R4BB 3H7BB 2X4OA 4WJ5A 4G6JL 5ITFB 2CUHA 1V3JA 3HR6A 4F37F 5CBAA 1VFAB 1A4JB 2PYED 5EU6A 2EEDA 5IV2B 2HRPL 1LK3H 5JQ6H 5I71C 4OCRH 5H94B 5GRYA 4QRTB 4DKFH 4NZDA 3RVWD 4G9FD 2IADB 1I3GL 1LP9F 4KI5E 5DFWH 4G5ZH 3VXUB 3V8OA 4MWFA 1ZHLB 2X7LB 3MUJA 3U46A 3FQNB 2ITCB 1IKFL 4F7CB 4LP4A 4NRYA 1N0LA 5ESVB 4Y19E 2JB5H 2XKNB 4ZAKA 3SGEH 4Q2ZA 4PGDA 4IOFD 1QFWM 1ZT1A 4KKAC 5DQDL 3B9KD 3D85B 1MJJA 5KSBE 5IFHL 1UT9A 1AP2B 4ZO6A 5E8OA 1D5BB 1TTUA 2HG5A 4ALAL 3NAAL 4E0RA 3LKPA 5FYJU 3VFMA 2CDFA 1MJ8H 2OI9C 1KB9K 3GMRB 5JMRA 2P44B 1RUQL 1U3YA 3CXHJ 4J7RA 5EPMA 4MS8D 1I7TA 5JORB 4OFPA 4QOKB 2VABA 3QI9B 3RNKA 2OSLA 2EIEA 4ZOEA 3UAJD 3WS3A 3TYGL 2DBJA 1NCAL 1G9MC 5C1MB 4QCIB 5DXWA 5DT1L 3VD7A 3X11A 3SKJH 1U2HA 3O2VH 1NC4A 3NVQA 3W9EB 1LK2A 2NY4D 2XTJE 1P7KA 4LLUA 2XFXA 5JW4R 3PDOB 4OZFB 3FJTA 2B1HH 2IMMA 4YHKH 2EICA 2ICWI 2K7PA 4H88H 1T1XA 1ORSB 5FM5M 4YHIB 1TJGL 5FA3A 2EDEA 1WZ1L 4PJGA 2YPLE 5E4IA 4H25B 2X44D 3MZGB 5F3BA 3IDMB 4JY6B 5I1EH 1G7PB 3VXQA 3QCVH 4N0UE 5EBWA 4O4YL 4NHUA 1WAAE 1A1NA 4TOYH 3M8OL 4U6YA 3OXSB 4XMKH 3ARED 4YDIL 5LQBL 5IHLB 1N5YH 3GMLA 3H8NA 4PRNB 3KYOB 5JW3L 4MXVE 2HT3C 2X1XR 2GAZB 4X4ZA 5BZDB 3HB3C 2HJKA 2VC2H 3CFCH 5IMKA 1J7VR 3LV3A 1UWEL 5F6HJ 3ARFD 4S10A 2VDRH 2WQRA 2Q7NA 3WS6A 2OTWA 3WIFA 5B38B 5KG9A 4C56D 1KTLB 3TNNA 3LEXB 1JTOA 3V6OA 4J4PC 5HGHA 3D0LB 4PJBE 3VFNA 1JWMA 4PGCB 4GRWH 4NWTL 3ROLB 2QKIA 5HVHB 1X5YA 5F1IB 1MCWM 1QKZL 2V17L 4GUPA 2Z4QA 3HUJE 5AD0B 1P4LA 2DQIL 1G7JA 3FQWB 3CUPA 3V0AC 2JB6B 2H9GA 5DWUH 4QYOB 4AL8L 1A2YB 4UB0L 3C5SA 1EMTL 2E3VA 4OKVA 5CSBA 3FOMB 5F7EL 5IGXL 2X42A 1F4YH 3PWPD 1CGUA 1BZ7B 2F58H 5HY9B 2D03L 2DB8A 1S3KL 5TGBB 3PL6B 4U7KA 5J1SC 1Z3GH 5D7SH 3S8WA 4U1SB 3LDBB 4X9BA 1A1MA 5K9JH 3K4DA 3L7EB 2V2WB 3DUUB 1I3UA 5IHUH 1EXUB 4EI5C 1OB1B 1JWUA 3IGAB 5ICZB 5JR1L 4PJ8A 5IJKA 4Y5XB 4Y4KB 3OAUH 4Z0XB 3I2CL 5GGRA 3JTSB 3JUZA 3O8XD 2CPCA 4PV9A 3VW3H 1A6ZA 1T2JA 1OGTB 4APQD 4X4XA 2XZQL 1BLNA 1JN6B 1I1AC 3M1BB 1KEMH 4U3HA 1RZFL 3TZVD 3ZTNL 4FFYH 3RQ3A 1H8SA 4LSQH 5CJXC 1JRHH 2E7LA 5E8NA 2VN4A 2YHGA 3L3HB 3O2WL 1TLKA 3O3BA 4MZ2A 2BNRB 3EOBA 5J0BA 4XPAL 4WI3A 3H42H 3PABA 5L0QC 5TDNB 4KK6D 5LGKA 2Z8RA 1CLCA 3PNWA 2VXVH 4WW2B 3T4YA 3DX9B 1YEDB 5EO0A 1NBQA 1HHHB 1MIMH 4PTUB 1JGVL 2X2YA 4IRZL 4KQ4H 4LLQB 2IQ9H 4EVNA 2Z93B 4BH8B 2N7BA 4FTVD 5C0BA 4QHUA 1X5AA 1YJDH 2ZOLB 2NY0D 4L8BB 2GJ6A 5F7DB 4X6DB 4KVNH 3VXMA 5L8JB 3QUMB 1MEXL 1XCTA 5FOJA 3RVUC 4JR9H 3RIAK 3MJ6A 4RFNC 3GKWH 3TH4T 5KVEL 5LGHL 2F74B 4LKXB 3GJEA 1EA9C 1WCBB 2EKSB 3U1SH 3TFKC 5DQ9B 3BXNB 1JTPA 1BBDH 1U0QA 3TVMC 3ULUE 1S7QB 5IHBA 1F11A 5A40E 2XXCB 2P1YA 1I9RL 4JFYB 3VMPA 5E6IB 1SYVB 5H35A 5IMMB 5E00A 3UEZA 1CDJA 5E9DE 3S88L 2VSDA 4KDTC 3SDCC 7FABH 5DMKB 1A1OB 2DTSA 3MGAA 1EJOH 1EVUA 2P5ED 2A83A 4PJ9D 3IDIA 3D39E 4HS6B 3QIUB 2J2ZA 4I2XE 4FMFA 4KRPD 5F7MC 2FH8A 5CZXD 3UC0H 3QPQD 3SDAB 1CLOH 5KW9L 1UM4L 4Y4HC 2HVJA 3FT4B 4HUWA 5AWNL 5GS1C 1BOYA 4JQVA 4IRJC 4M6NL 3QCUH 5EUOF 2D4DA 3EKCA 3IFOA 4ETYA 4MA8L 1QR4A 1AQDA 4X5LA 3CFBB 5DJDA 2Q6WB 1JNNH 4H26A 4FZ8H 3SDDB 5ID0B 4HKZA 4JFXA 2RB8A 1IC5L 3RX7A 5EU5A 1WTLA 1ZA6B 3BE1H 3HPJA 3PHQA 2LQRA 4X83A 2C4FT 1R3HA 4YPJA 4F9LA 1YJDC 3P9MB 3OHXB 3QFJE 5H2BB 4RCAA 2I07A 3N06B 4LCYA 3PIQB 3O41B 4QRPA 4LCWA 4TUJB 3OGCA 4POUB 3UZVB 4HZAA 3OSKA 1IC1A 2EC8A 4KUZH 4NC1C 2Q86A 1KLUA 3GMNB 1PSKH 1WT5C 5T1MA 1CICC 4LCUA 4C55A 3HMXA 2O61B 2BDNH 3QIBC 3FN0H 3T0WA 3UXFA 5I15L 5FUCE 3MBEB 1BQLL 5JA8B 2A9ML 2UVFA 2GJZA 3NGBC 4Q0XL 2JELL 5EO9A 4WEBL 5C08A 1T0PB 3RDTA 5ISZE 1X5XA 3I6LD 3STZA 3VWKA 3GIVA 3IU3B 4XNMA 4ZFFA 4J3WA 5DQJA 2GTZA 4MD5B 4PB0L 1T04A 3WUZA 3LZFL 4K55A 2J8UE 4NQDA 4HSQA 5DEZA 1L9NA 1CFSB 1MCFA 1NSNH 1MWAH 4PP1D 3T8XB 5FYLE 3N85L 3GJFH 4YBQD 2IH3B 2XA3A 3DURA 1U3JA 4Q7DA 5INDA 5D2LE 4ZFOB 4L1HA 3EBAA 4ZTOL 5ID1B 3QDGD 3QUZB 4JDVB 5AUMB 1F6FB 3B5TA 3TN0A 1D6EB 3EYSL 3T3ME 4RIRA 3SDXE 1QFWH 3NCCB 3FT3B 1X5IA 1XF5B 2IPKB 2WIIB 3GJFK 1IGTA 3HE6D 1B2WH 3MREA 3KS0H 5TFSL 5IBUB 5D8JL 2VE6A 1F4HA 3NCBB 1U2CA 4XBGA 5EOCJ 4CJ1A 2C5DC 5F7KC 3QB7C 4OLWL 1OW0A 4KI5D 3I6KB 1NC2D 4D0DA 4YDKL 4NUGH 2HFFB 3TNMB 3G6JB 1MFAL 1FIGH 5L8LB 2FYYA 2VDQH 1NMCC 2R2HA 4DVRH 1OAQL 5LG1A 3QWRD 4HWEL 1U8MB 2DAVA 3TCLA 2AK4E 1JPTL 4TSCL 2DQGL 5BQ7A 2Z0BA 3LRSA 1KB5B 3MPCA 1F90L 2HN7B 4HGWB 3TBSA 3JWDL 5E99L 3RY6C 3SCMB 1Y6NR 3EJZC 3Q6GL 1CGSH 2UWEA 1JHTB 3F5WA 4WHTA 5FHAL 3BP7B 3REWA 4R7NB 1J1XH 5IP4A 3GO1H 3HZMB 4WFHE 4Z7VB 2P46B 3TH3T 1DL7H 1IL1B 2CKBH 5C0AA 3MFFA 1C5CL 2BXZA 2FO4B 3MLWL 3IDXL 4YHOL 1KIRA 2GFBA 5B3NA 4EDWL 1T1ZB 3C6LB 4KY1H 4ZDHB 3ZKNC 3FMGL 1J1PH 2GCYA 3C08H 3LS5H 1I9JH 1QNZH 3BP6B 1AGBA 4LVOC 5J8OA 2WWMD 3NFSH 2BSTB 3WLWC 2XTJD 1QR1A 3KPOB 3RNQA 3EYUL 5K59E 1ZHBB 2NY7H 4WFGE 4MXQC 4PG9B 2BY2A 3VXSA 5I1LA 5H8DA 1DBBH 5ICXB 2YPLD 3PHSA 2JTDA 3RBSA 2WP3O 4PRHA 2J1KA 5FA4A 3MRDA 3VRIA 1MJ7L 3D69B 3MXVH 3FQTB 3G5ZB 1X5LA 4RA3A 4YGVB 1XGUA 3IDGA 1IM3B 4P2OC 4P2RA 4TULL 3U83A 4HIXH 4U1HB 1MHPL 4HT1H 1GYAA 5GJTL 3LKRB 2P45B 3G5YA 2WUCH 1DEEA 4YXLH 4WI4A 1U8OA 1MFNA 1UWGL 1W0WA 4UUJA 1N6VA 4UTAL 5BZWB 1ZHNA 3GMPA 2Y5TA 2CK0L 2YC1A 3GI8L 4Q97A 4M03A 5DC0A 3NZ8A 4JO2L 3H6JA 4Z7UA 3B6SB 1MAJA 3L3DA 1JNHB 1W0VA 4OM1H 2P8PB 4ZXBC 5DJZA 3VFUB 2OTPA 3O3EB 3VFTA 1MSPA 4BSJA 1GGTA 1YEHH 3BZ4B 4YGAB 4QO1A 4NKOB 5I1IL 1IGJB 4K3EL 1ZT4B 5F7NC 1XIWA 5D6DA 4XVTL 5L7XL 1JGLL 4XBEL 3ZYOA 4EN3D 4X98B 5KVMC 5J3HD 4DKDC 4L4VB 1DBKH 3LH2H 1NFDE 4I1NB 4G8GE 3IAGC 3IS1X 3LD8C 5I1AB 1HZHL 1OARL 4WI8A 2G75B 4CNIA 1CXFA 1T0MB 2GY5A 5T3XH 4BFGA 4P23D 4E41E 3RWCA 2J4WH 5DD5L 1WIUA 4WWKC 3MJ7A 1RZGA 3CFKA 5D72H 5ENWA 4MAYC 1A7OH 5JOFA 4L3AA 4X6CA 3KGRA 3ILPB 2IPUK 2HFTA 4UTBL 3U0PA 1T89A 3WUWB 4QHKJ 1XGPA 3PWJA 4X6BB 4A6YA 5LGJB 1AGFA 5GZOD 1AXTH 4HWBA 4DGYL 5DD3H 4NGHL 3MO1B 5CEYB 3C6SA 5DJXA 4P3CH 3GGWA 4H1LA 2BVTA 2C4FU 1N5AB 4Q6IC 1EFXA 3BGMB 4R3SA 3VRJA 5IR1B 3QEQA 5EZOL 1BMGA 4H20H 4DZ8A 1DSFH 4UT7H 3ESVF 3OMZA 4DTGH 1DE4B 2FD6L 3O6ML 2A6DB 3F65A 5L88H 3UTQA 2VAAB 3FO0L 1VFBA 4ZPVB 1GOHA 3WN5A 5C09D 3EO1A 3PWVB 3UP1A 4JEGB 1HXMA 3FFCB 1UKTA 3SDYH 4G6JH 4HIHA 3OKDA 4I3SL 4NQEE 1BAFL 1I3RA 3DV6B 5EBLB 4JKWA 2HRPH 4OLYH 3S96B 3CSGA 1G6RH 3BP5A 4Q9RH 1JPGA 1H5BA 1J9CT 5CKGA 4Y19B 1NGPL 4X5XA 5I1KL 2UY7A 5JHDE 3QDMD 5DDHA 3ULSA 4FZEH 3TT1L 5HGBB 1I1CA 2BC4A 3WIHH 2O26U 3DV4A 2P4AB 3ZDZF 1LE5B 3SGKA 5I18H 4LHUD 3P0VL 5KSUB 4MNGA 1IGIH 1K8IA 1NAMH 2J5LB 3JV6B 4YC2B 2V2XA 3C8HA 3OG4B 4WO4C 4AIOA 2BXYA 1OTSC 1N6UA 5IFHH 2HT4D 4ALAH 4ACPA 2FGWH 3AM8A 3MMEA 1RVFL 3L1OL 1JJUA 3I9GH 2WAHA 5I73C 1RUQH 3K7UA 3VE0A 4OCXL 3ULUD 3C8KB 4J6RL 4KI1A 1I8IB 4QF1B 5HI4C 3VXRA 3E8UL 1S7SB 1HH9B 5E5MA 2XT1B 1EEYA 5E9DD 3VI4E 3L7FA 3MOAH 4GRWF 2PNDA 4QHLB 2DDQH 4K7PL 1QLRA 4XNXH 2NLJA 2X4SA 4S1DD 3BHBB 3TA3C 2VLJA 1LO2L 4ODWB 4U33A 3D39D 4N0UB 1INQA 4HJGA 2FBJL 4B50A 4DUWA 3OR6A 3KPSB 4UU9A 1A6TA 3QULA 3O4LE 4PRBB 3O6FB 3HAEG 1QZ1A 4XWGL 1BECA 3RX5A 4LHUG 4V2CB 4F7PB 3PGCA 4JFFA 4KROC 3GNML 3M8OH 1XGRA 2E6JA 2YK1H 1E4KA 4YDIH 4GAGL 3DVIA 1LO4L 1BZ9B 3HE7A 4O5LL 1ZA3B 3CZFB 5J6GB 4TYUA 1DDHA 2R23B 3HG1E 3U9PL 1UC6A 1S7UB 1XF3B 4JGUA 1BZQK 4F80A 4GW1B 1FBIH 3AS0A 3HR5B 43C9B 1UWEH 3SE8L 1B4RA 3BYYA 1FRGL 2D2OA 2CRYA 1OD7A 2F9BT 2OM5A 3HCVB 3QFJD 5B8CC 5I16B 2GUOA 3ROOB 1M71A 1S9VA 2GITA 4JLRB 3TWCH 4O2FB 2Q8BL 3H7LA 3QG7L 1IGYA 1YEJH 1CL7L 3HZVA 1Q0YL 4Z7WB 2VMFA 5CSZB 5B39A 1F4WH 1FNEB 1BD2B 5F1NB 1REIA 4N5ED 3FQXA 5C2UB 5K9KB 4C4KT 2SEBA 2ILLA 4AL8H 1AIFB 4G6FD 3ULVH 1FZOA 3AU1B 4DGVH 5IB2A 4NRXA 4P49A 4OIAA 1B90A 1OGAA 1DCLA 3LB6C 3TBVB 2CKNA 3IAPA 5AYUL 3DVNA 1DN0B 3GMMA 1K4DA 4MA1B 3RZCC 2D03H 1S3KH 4CVXA 4RAVA 4JM2D 5J6HA 4XH2B 1PX3A 2CRZA 3V7AE 3RIAF 5JW5A 1D5MB 5D1XC 3THML 3WD5L 5ACLA 4PLKD 5BVPL 5FYLD 2F54E 5A3IC 4PG2A 4EIGB 2YD9A 1MHEB 1XCQB 2XI9A 1I1YA 4OIBA 5FM5O 3B2VL 3I2CH 3V52L 4BK5A 1T2XA 4Z5RA 4PJFA 4WU5A 4KH2A 5D7LE 1ACYL 2A0LC 5DHYA 3EOTH 1AY1H 3QFDB 3JTTB 4I18B 4LQFL 5FAAA 2AI0L 5GISH 4HC1H 3QZWG 1ZHKB 4G8IB 3MCKB 1NCCH 1QHPA 5A2FA 1M6OB 3ILQC 5C0NC 4NDMA 3U79A 1WQVT 4PR5B 1KIQB 5HVGB 4YJZL 1HWGB 4JN2B 2MCPL 2IFFL 1FFRA 1F58H 3FO1A 2M26A 3MBXL 3CPLB 2DWEB 4FOMA 1S7TA 2W60B 3FRUA 4ESKA 2HAZA 2A73A 3DMMC 2APFA 2RFXB 1GL4B 2FLBT 2YD6A 3KXFE 2AERT 4XPAH 1OP5H 3CDYA 4P0DA 5ESAA 4U31A 4P4KA 12E8H 4RRPA 4TNWK 4BQCA 2P7TB 4L8SB 5EZIH 1K8DB 1KJ2L 1P84J 2A1WL 2VIRA 4MLSA 1H8OA 1KNOA 4I9WE 4IRZH 4L8DB 5I9QC 3PHOA 4OCWL 4HPOL 4Y5YA 2EH7H 4YR6B 3PQYB 43CAB 4D9QE 3ULVC 1YECL 4QTIL 2AK4D 3VXTB 1KG0A 5FYKU 1HYSD 3AY4C 1IKNC 2EEAA 2J7LA 5CUSL 2PTTA 2ZSVA 3GHBL 3L5WA 5D70L 5BRZA 1OP5K 4N1HB 4QRQA 3UX9B 5K9OB 1LVEA 2R0ZH 5C70A 1XH3B 4UBDD 4HWZB 1X4YA 5D2NA 2WBWB 4XCYB 4WFHD 3CNKA 3MROA 2H32B 3EZJB 4AG4L 4ODHL 5CJ5A 1S7XA 3ECBA 1N59A 5E9DB 4LARL 5KVEH 5LGHH 3SE4A 1T1WB 3ZE2F 5MENA 4D0BA 1KPUA 1E4JA 2E7MA 4X7SL 2ZOKB 1YQ2A 2WBKA 1J0KA 3U6RB 2VL5B 4AQOA 5IBTL 1UM5H 1I9RH 3VXPB 2FIKB 3W39B 3GSQB 1MUJB 1CR9L 2ERJC 5GGVY 2BVEA 4WFGD 1OTUD 3GSRA 3GI9H 1H15B 5DEFB 3O4OC 5AYQA 1DP0A 2F53E 1KN2L 4MB5A 1F00I 4HEPG 4K3HA 4X8XA 4DN3L 5DLMH 3B9EA 1Y18B 1PY9A 3P40A 4I48B 5HPOA 3RBGA 3RWDA 2QADC 4QRRB 5AWNH 3GSVB 5I6XC 1INEL 2QQLL 4M8QB 4L5FH 5INCB 2BVOA 3GDBA 1DJSA 3RAJL 2YR3A 4BKLB 1TJHL 4G7VH 1TXKA 4AEIL 1IC5H 5FDYA 4XP4H 3QDHA 1SMAA 1EZVX 4KRMB 5GS0H 1UH3A 3DGGA 4N0YH 4XP9L 3UTSE 4ZMAT 4NPYB 4ODVH 1FJ1A 1CT8A 2A6KA 5I30L 1SEQH 4FQ1L 3ARZA 5ALBL 3BRDA 5CP3H 3UBXA 2ORBL 4DCQA 3KPNB 2VKWA 1M7DB 1QRNA 3M17B 2Q20A 5TQ0H 2CDGB 3DRTA 2NY6B 3QI9A 2DQCL 4PJHF 4WV1B 1NMBH 5ISZB 4G8GD 3G5XA 2NX5B 2W0KA 3W9EA 2WMPA 5DGQA 1KCVL 5SWSE 2Q8AL 3HC3L 2IANA 3PDOA 2A9MH 3KYMB 2KZ1B 4E41D 1U8JB 1KFAL 3VJ6A 1ORSA 3WFBH 5ITBL 4OZFG 3CFEB 3WO4B 4WI5A 1DBML 4NO0B 4X5WB 5FUZL 2CLRA 3KNBA 1U8NA 2PXYD 1LO0L 1G7PA 4PB0H 3V5HB 2R0WL 4V1DB 3H9HA 3D3VE 5F96H 3UMTA 3OXSA 5D5MB 4LVNB 5FIEA 4HQQH 3VWJD 1DZBA 4PRNA 4CAGA 4ORGA 1J8HB 2ZUVA 3MOBH 3QUYD 3CSBA 4I4WA 4LSSL 5BZDA 3O9WC 4YBLC 4EQ3A 3RTQC 2GIYA 4ZTOH 1DFBL 5MHSD 4JHZA 1R24A 3F7YB 5D71H 4YE4H 5B38G 3D0LA 2OYPA 3AS3A 4DAGH 4M1CD 4PGCA 5IB1A 4N8PA 3JWOL 5GS0C 5AZEL 4KVCL 3P4LA 2YPVL 4C83A 4AT6B 1U8HB 3AROA 1U8KB 4NQED 3CK0L 2JB6A 2VDPL 5F3HB 1U91B 3MJ9L 4PJAA 2VDML 3IYLW 1A7BA 1G9EA 2OP4L 3OJMB 3AS2A 1R5WA 3C5ZD 4HKBA 1MREL 2AK4B 4MAUH 5FKPA 3EJYC 4ZUWB 4AM0A 5JHDD 3MV8E 1U92A 5GIRA 1MFAH 3CVIH 4LPTA 4JVWA 3U7YL 4LFHD 3BN9D 4MD0A 2ZUSA 4IJ3B 5FXCH 2MPAL 1IC4H 1OAQH 2F15A 2AJYH 1NAKL 4NN5B 1KB9J 4TSCH 2B1AL 2NXYC 3QJHA 2GEEA 4K71C 4IRSA 5FYLL 4Y2DB 3CMGA 3MLRH 1F90H 1BEYH 2DYPB 5EUOE 2XKSA 4PJXB 1EXUA 3V4VH 4NOFA 5ICZA 3D2UD 5FHAH 1MLCB 3RVXC 1RZIA 2EZ0D 1OQOA 4MB3A 3BQUB 4ZOBA 4JRYB 3P9WB 3MJ8A 4K3DH 5CGYC 3MGOA 4W4OA 5H37G 2XRAH 3MRIB 2YSSB 2W65A 5DD1L 4HJJL 1Q94A 4EDWH 3WFHB 1EHLL 1MH5A 4HHAB 4XP1H 1I1FB 5FDWB 3D18B 4M5YH 2CLZB 4WHYG 2PYEA 4HZLB 2BY0A 5BW7C 2DQUL 3EOAB 3EYUH 4G9FA 1M05B 2XV6B 4GRLD 2PO6C 4PJIF 3O4LD 3MNZB 4O02H 2AXJA 1DQML 1PVHA 4KKBD 3UPCA 1MJ7H 3UCRA 1R3KB 3DX7B 3IJSA 4Y4FB 3BDBA 2PW1A 2VOTA 3RWEB 1N64H 3P0YH 1S9WA 2QR0B 1Q1JL 3B9KA 1LO3H 2OXHA 3HNVH 5TDOA 4CMMB 1A3RH 3RGVD 1LILA 2AQ1A 4ETQB 4GQ9L 3EW3B 4AEEA 3FZUC 1CCZA 1G0XA 4HPYH 4DN4L 2VDOH 2AW2A 1R5VB 5EBMB 4JZOB 2EO9A 4KKLD 2AJSL 1GZPA 3EDEA 4U49A 2AXHA 5EIVA 2BJML 3ARGB 2AABL 4JO2H 2P47B 1YEGH 4OZGA 3CFJA 5FYJE 4RBPH 4KV5F 2APXA 5BS0D 4N5UA 3B8SA 3TBWA 1FLRH 4M6OH 3IFLL 1NFDB 1PYWB 1T83C 4HGKC 4FA8A 1A14L 1KELH 4WUKL 4HEME 4LPCA 3RWHB 4JFYA 1JGLH 4YO0B 5IESL 2WLZA 5D1QC 2ITDB 4OUUA 2QLVB 1A1OA 2XWJB 3INUH 3V2AR 1ZGLA 3RU8H 2GT9A 2QJDA 4IHOB 4RBPK 1T0NB 1HZHH 3V95A 1CZ8L 1GGIL 5DD5H 2VXQL 1UZ8A 3KAAA 3Q5TA 3Q3GB 1SBBA 3P9LA 3UTOA 3SDAA 3STBA 1F3JB 1RFDL 5IVXF 3MUGB 1BX2B 4DJMA 1F3DJ 1WEJL 3QG6A 4UTBH 3MRJA 2F54D 1MNUH 2Y36L 4ORZC 4QRSB 1Q72L 4DGYH 4KK8C 3ARFA 3C87A 2BVUA 1UH4A 4N0CD 4M93C 5SWZE 2B0SH 2QSCH 3MLXL 4C56A 2MQCA 4FQ2L 5D7LD 5IUSA 1KN4H 2F8OA 1WJ3A 3PXJA 5IEKA 5J89A 4JO4H 1X7QA 4XB7A 2YPKA 4XAWL 1CXKA 2LTQC 1FN4B 3ARDD 5HGAB 5M95B 1TETL 4ZS6C 2VLLB 3WHXB 1EGJL 4OFVA 3PIQA 5KZCD 4GH7B 4YHPA 4P5KB 5I1CL 4RMWA 2Z91A 2V2TB 4OV6F 1CTOA 4LNRA 1J0ZA 1TCRA 1AXSA 4QGTA 3KXFD 4I5BB 4NNYA 4UQ2A 1YN6B 4I3SH 3PWPA 1U3HC 3P4NA 1QO3B 2XICA 3OKOA 4IM8A 3KLAB 4WWID 2LFGA 3BAEL 4F9LC 1RJYB 1YMMB 4I9WD 3G08B 4IS6A 4NM4H 2Y06L 1NGPH 4ZFGL 2G60H 5I1KH 4YK4B 4S0SD 3BJLA 5T1KD 4D9QD 3QXDB 2VR4A 4HMCA 2IH1B 1HH6B 3H0TA 4F7MA 4NKQB 2HMIC 3ZT6A 1R3IL 4GRMA 1I7RA 4JPKH 4LMQI 3JV4B 3TLRA 4BZYA 3ZHLA 4MJ6B 1F02I 5DTFA 3R1GH 2Q3AA 1QD0A 1YPZB 1JF5A 1XF4B 1AC6A 3O8XA 4W68A 1NGZA 1CGXA 3VXNA 1UACL 4RFEB 3GRWL 4U1JA 2YEZA 1ADQL 4APQA 4KKCC 2J88H 4OQTL 4GBXB 4DEPC 4F58H 1RVFH 4QRUA 4R2GD 1KEGH 4NN7C 3TZVA 2WUBL 2BOCB 1Q38A 1O5DT 1V3MA 5HJ3B 4J6RH 5ID1A 1LD9A 2R69H 3E8UH 4JDVA 1MQKL 3MC0A 5HI3C 2V5YA 5F9OL 5FB8B 5J11C 3EGSB 1S78C 4NNPH 1D6EA 4PB9L 1BQHA 3WCYA 3DX8A 1KJMB 3DOSA 1GCFA 3IU4H 1JYVA 2B39A 5GGUA 4QTHB 2WIIA 3VI3F 2AJZB 2F53D 1D9KC 4XPHL 5L2KB 5TQ2H 1UB5A 2OK0L 3CAFA 3PWNB 4FN0A 2H6PB 4FQCH 4XC3H 2FBJH 2HKHL 4D3CL 5I75C 1P2CA 2FBOJ 1AJ7H 2FJGB 2OJZH 3SPVB 4G7YL 5IBUG 4FTVA 1C16B 4RGNE 5C0EA 2M1KA 1M4KA 3HG1B 5FFLA 2HFGH 4NZRL 3CC5A 2ESVB 2WBJC 5EDXA 3TBTA 1MCEA 2AGJH 2JJTC 2BSED 1F45A 1AGEB 5DJ0B 4I3RH 4NQCB 4JPVL 3BZFB 3L3KB 1ODAA 1NBVL 2DLFL 3WJLA 3IFNL 5MI0C 3ZKXC 3R4DA 2FH6A 3WNOA 5JLZB 1IEAB 2NR6D 1JHTA 3QEHA 2E9WA 4CJ0A 5E6ZA 1FGVH 4ODUA 4TNWF 1BPVA 4Z7VA 3T1FB 4MJ5A 4TRPL 1Q0YH 2GJ6E 3OKLB 3ORJA 3HC0B 4U6HB 4QWWC 4GS7B 4KJQC 4YHML 3BOVA 1AE6H 4K8RH 1K5NA 4ZDHA 3GMOB 2P5EA 3CH1A 5DFTA 4D9RE 3MRNA 2GQHA 4PJ9A 3F62A 4NWUL 3BP6A 3NN8A 1L7IL 5SWSD 4QHMB 1N26A 1DEDA 5EIIB 1L0YA 5EC1A 3WFEH 1QSEE 1PKQE 1KYOK 3WXVH 4Z78A 3EFFB 3BVNA 3LY6A 4NKMB 5IVZB 3IJYB 1RAMA 5EOCL 2F54B 3QIWB 2UZXB 1U8IA 5GGTL 2JJWA 1CG9A 1V8HA 4I0PD 3WLBA 2C26A 2I9TA 1IM9D 3THMH 3VXOA 5EA0L 5E5UB 4U1HA 5BVPH 5EOTB 4NP4L 1YZZA 2ZPKL 4IIQB 2B20A 4XBPA 4G43B 4Y16C 3ZDZE 3DLQR 1N2RB 1N7ML 4OD2B 4W70A 5TE6L 3E6HA 1FL6B 3CCHA 3B2VH 1OAZL 5EU7C 5IEHB 5D1ZD 4LK4A 3UPRB 2AEPL 4MD4B 5A2LH 4S1QL 2HH0H 4XWOC 4LQFH 4P46B 5DVMA 5IK3A 1J05B 5C0CE 3B9DA 1WTGT 2JIXB 4CADB 4XPFH 4U1IB 5L2JA 1JNHA 3NZHL 1MCLA 4X6EB 2MFNA 5FGCE 3O3EA 3K8MA 3ZT7A 4U6XA 3OZ9L 3QQ4B 4PY7B 2FX7H 3U4EA 1LEIB 1CE6A 2G9HB 3RZWA 4PJ7F 4J3XA 3MYJA 4OSUL 5DMJB 3T0EC 1I7ZB 3X13A 4GG6A 4OZHF 4GRWE 4X98A 4KTDL 3KS0J 4I77L 4NO2B 3IXAB 1H3GA 3MV8D 2NW3A 4F7TA 3TCXA 4ODSL 5I1AA 4K8RC 1QBLL 4OCWH 5BJTB 4HPOH 2EDJA 4LPXA 1MI5B 1FYTB 2P48B 5JTWA 2RR3A 5I1JL 5HDOA 5TDPA 1VPOL 2WWKO 3ZL4H 3I85A 3K8LA 4M7ZC 1AR2A 1A7PL 5CUSH 4RAUA 2C7UB 5EOQL 3ILPA 1CIDA 1JGUH 5I74C 1MAMH 5SV3A 4WNQA 1OP9A 4EUPB 1U8LA 1JYXA 3WUWG 4UV7H 1FFNB 5F88B 5KSAB 1KJ3H 2WM0A 4OD3L 3QDGA 1G7IA 3EO9L 1MFCL 6CGTA 4XCEA 2DJUA 4PRDA 4QXTA 4AG4H 2HTKD 4KGLA 2G5BA 1IAIL 1RHHB 1TZHB 4C54A 2WIMA 2IAMD 1DQQB 1J5OH 1FLTX 5IQ7L 4HBCL 4XI5C 3JVGA 4JFQA 3TPUA 1AHWB 1DE4A 2ZUXA 3HE6A 3Q6FA 2X05A 4AIZB 1VB9A 4WFEE 1T22B 2VAAA 1IEBB 3RY4A 1CR9H 2H45A 4ZPVA 1XGTB 3W0WB 2IG2L 5T1DH 4XC1H 3H9SE 4M4PA 1NC2A 1OPGL 3VFSB 4Z7NF 1AR1C 5ICYB 4XRCB 4GJTB 3DETC 4NQVB 2X6MA 4N9GA 3HI5L 1HHIA 5CEZL 1I8KB 2ATKB 4FQXD 3PWLA 2YA2A 5CD5C 4BZ2L 3HAEH 2QQLH 4LBEA 4P48A 4ELMF 3QUXC 5MEPB 3WN5C 4QXUL 4L9LB 3LIZL 3ALPA 1CXEA 1TQBC 5KSBA 1LE5A 4B0MM 3RAJH 4LLWB 1FO0H 2Y6SC 1FL3B 4G8FB 3UTSB 5HXMA 4DK6A 5T1LB 5EG6C 4AEIH 5GHWL 1CGWA 4RQQA 1P53A 1NBZB 4PLOB 1C5BH 32C2A 3BEVB 3ZE0F 3KLHD 1V3LA 4TTDC 3MRQA 4WI6A 3ALWA 4F15B 4XCCL 5IB4A 5DEGB 2IBZY 5I30H 8FABB 5DD0L 5ALBH 4YIQB 2ORBH 4NC1E 4P5TD 5JZ7D 4HS3B 1I8IA 4FHBD 2BCKB 2DQCH 5GRJL 1CD1B 1LNUA 4KK5D 4UT9L 1H3UA 4XTRD 5IFJB 3GM8A 3HI1B 3RWIB 4HFUH 2YPLA 3RVVC 1JF1B 1KCVH 3AM8C 1SJEB 3H3PL 2D31A 4L8CB 3GSNB 4JFPA 5DS8A 5C0AE 5D7JD 4N0UA 1KFAH 1WAAA 3D3VB 1T20B 2UV3A 4JREC 5J1AA 1JE6A 5F7FA 4KK9D 4BSVA 5EU4A 3I75B 5LCVH 5E2TL 4R90H 2XA8H 4JZJB 4ZOAA 3KJ6H 2FWOB 2Z31C 4K94L 4FQIL 1EBAA 2ZKHH 5SWZD 5IJVB 5I8EB 1QPPA 2VDLL 1BFOB 3F58L 3CZFA 3RA7H 4FMKA 4KWUA 1XF3A 4LSSH 1W72B 4LSPL 1VEMA 4M3JA 4PJBA 4YEFA 1VGKB 3HR5A 5C6PB 3HUJA 3M45A 3RWFB 1RK0B 1QFUL 5HPMB 5I16A 3ROOA 5EC2B 2A9NL 4Y5VB 1WBYB 3P30L 4DZBB 3SKMA 1PQZA 4HAFA 3WNNA 4NKDB 1ZGLM 5TJWK 1T21B 3CLEH 4IBLT 5JIHA 1OCWH 4PTTB 1I4FB 3L3OB 4EN3A 1TPXC 4XGZB 3HE7C 3JWOH 1K3IA 4HIIB 4RWYL 5FF6A 1JWSA 4XNZC 1CGTA 2P5WB 4ZUUB 5ACZA 5K9KA 2VDPH 1AIFA 1KJ2A 2ADGA 2W0FB 4P23A 2OP4H 1HHJA 3QJFA 1FQ9C 3X3GL 5F1SA 3BX7C 3NFNB 2DRUA 1TNNA 1IAOB 2E27H 2X5PA 4TUKH 3LHPL 4PRPE 1B0RB 4TNVK 3UJTL 2MPAH 3FB6A 5MEQB 1IGFL 3LQAH 4XH2A 4KKAD 2B1AH 3QP3A 3TO2B 2GSIA 5HHOD 3TO4C 3WL9B 2BHYA 5FHBH 4BQ8A 1C1EL 2JCCF 1TZGL 2NY3C 3FFDA 2X4UB 3V6ZB 4CBPA 1PEWA 4G8IA 4HJJH 1EHLH 4XCNB 5IHZB 4R0LC 2NZ9C 2CRIA 4JQXC 4N1EA 3RP1A 1NLBH 2V7NA 4HUNB 5JNYB 1MFBH 1H9VA 3BP4A 1PEZA 2X70B 5IVOA 2Y7QA 1JL8A 3MACL 2RFXA 2BP3A 4PJHE 1D5IH 2X4OB 4WJ5B 1SJHB 3QA3A 3VCLA 5CBAB 1DQMH 4RGND 5HDQH 1FG9C 3OKEA 3AGVA 5EU6B 3JWOC 4RMQA 3RL1A 1FSKB 4LHUA 4RMUA 3BWAA 2OL3L 3X12A 4CGTA 3ARWA 1E6JH 1PFCA 1Q1JH 3LPGA 4MWFB 2HT3D 3BRFA 2APBA 3D0VA 3U46B 1OAXL 1OWWA 3HB3D 2ZNXA 5KJRH 4MDJA 4MYWB 1QFOA 4P99A 3R06B 4NRYB 4ZAKB 4Q2ZB 1BQSA 4PGDB 3L9RA 1ZT1B 1LDPH 1FVEB 1F8TL 1B6UA 3UO1H 1MJJB 4I3GA 3LQAC 4J4PD 4GMSH 5E8OB 4BFEA 4UNTA 5HHXL 2VXUH 3NACH 1L0XA 2ZWLT 3DARA 5E9DA 4E0RB 4B5EA 1A6WL 3BD4A 3BKCL 4JFOA 3VFMB 4ELKA 3MV9E 4TPRL 2ZOKA 1JZ5A 4NCDA 3ZSTA 1HCVA 2VL5A 2NTFA 4NN6C 1BFSA 3TM6A 5IFAH 2VABB 5DJAA 3D39A 2OSLB 4HUKB 4I2XA 3W39A 1QLEH 3CMOH 4FFVC 1LGVA 3WS3B 2ATPB 1QSED 3BDYL 4U1KA 3O0RL 1CTNA 1NC4B 3F6LA 5KTEL 3HPLB 1LK2B 5C0RH 3TP4A 2XFXB 3OB8A 1GGIH 1U9KA 2NPLX 4XAKE 1RIHL 3X3FL 5IF0A 1T1XB 2E7HA 4OZFH 2AK1L 3MRMA 3BKYH 3T2OA 4XVJH 5FA3B 4PJGB 1RFDH 4JRXE 2NTSP 1Q9WB 2H2SC 4B7LA 1E4WH 3GSVA 2DL9A 5F3BB 4X9IA 1WBXA 3QH3A 4EI5D 2Y36H 4LSRH 5EBWB 4D2NA 4NHUB 4AZ8A 1A1NB 4N8CL 2F19L 3OWEA 4U6YB 4L9DA 3QFJA 3U0TA 3ARVA 5DR5H 3MLXH 5GS3A 3GMLB 4D0CA 1GGBH 4ONFH 4J12A 5IW3A 4JFHD 5C8JA 2K1MA 5F71A 1I1AD 1DLHA 5DYOA 5C0CD 5IMKB 3J7HA 5IQ9B 1BBJA 4XAWH 1QYGH 4Z76A 3IETB 4OI9A 1UA6H 2OTWB 3WIFB 3OF6D 4OCYH 5HGDA 4LRIC 5KG9B 1JI2A 5I1CH 3TNNB 1Q9LA 2CQVA 1OTTC 4PJDF 5HGHB 5DVOA 1JWMB 2QKIB 3PF2A 5ABDE 3MJ9A 1T5WA 3ZKQD 4GUPB 3FAXA 4LHJB 3IF1A 1TTGA 3MA9H 1OM3L 1G7JB 3S3JA 5F9JA 1KC5L 3CUPB 2H9GB 3K4AA 2WSKA 2PKDA 3VA6A 2FJHA 4GW4A 4WVRA 3RGHA 5HYJD 4JM2A 4FQLL 4ZFGH 1H3PL 2WV3A 2D7MA 1LHZA 4OKVB 4KZEL 3ARUA 1VACA 2J8UA 3L5XL 2YUZA 4XP5L 3ZKSD 3CSPA 5FCUL 4PJIE 1N8ZA 3QI9C 2VXTL 3F7RA 2OZ4H 1OAYL 5DJCA 5C86A 1FH5L 4HX1A 2CIIA 4O2CB 1A4KA 4M9OA 3V5HA 1S9XA 1BIIA 5T3XE 2FX9L 3U36A 5D2LA 4KQ3L 1A1MB 1II4E 1QFPA 1HKLH 1RUML 5I0DA 3S9DB 1OF2A 3OAYH 3RVUD 4XP6L 4F57L 1MRDL 1SJVA 4ZS7H 4OQTH 1QTYT 1JWUB 4OM0L 1CXHA 4PJ8B 2WUBH 4CU6A 3TFKD 3SDXA 5GGRB 3TVMD 4DFHA 3V5KA 4PV9B 2F5AL 1A6ZB 1JUFA 1RUKH 1GGUA 2VJXA 3DPBA 3F7YA 4HLZG 4X4XB 4RZCB 1BVZA 2DM7A 3SDCD 4KV5E 4GXVH 2R39A 4LSDA 3KHOA 1WLHA 2LE9A 3G04A 4NJAL 3OAYK 3H9SD 4WHYH 4RGNB 3WJJA 1U8HA 4XPHH 1FZKB 3LN4A 5E8NB 3QDJE 3O3BB 2IC2A 3BW9A 4NZTH 1FGNL 2HKHH 3PABB 1AD9A 1PD6A 2ICWJ 2AK4A 4YPGA 4UILL 4IRJD 3PNWB 2ZSWA 4YFDB 5F89A 5EO0B 5HVHC 5CCKH 5T33H 1NDGA 2HFEA 4NZRH 4ZQKA 2Q7YA 4PS4H 1P5VA 4WTZG 3O6LL 5C0BB 3OR7B 5IVXE 4BFIB 3IFNH 1BGXL 1U6AL 3OGOE 2GJ6B 4L3CA 2UVEA 5KS9F 3WNLA 3T77A 1MLCA 3VXMB 4LLVA 3PL6C 1XCTB 5MERA 3QUMH 3QQ3A 2OMBA 3UROR 1G9ML 2WLYA 1JMXA 5DUMH 4HXBH 3LDBC 4K23L 4NO5A 4YHMH 3U4BL 1CICD 4NFCA 3U7WH 2AXGB 1QRKA 1RZ7L 3HKFA 3WFHA 3CX5K 1WZLA 4HDIA 1RZJH 3QIBD 5FDWA 1F11B 2CLZA 4JY4B 4DK3A 1L7IH 3S37X 5H35B 2XACC 3QEUA 4J8RA 5E00B 5CLWA 3OJ2C 5DHXB 4Y5XC 4Y4KC 5E56A 1MCOH 4M6MH 3AAZA 4P3DA 1RZ8A 2A83B 1EO5A 3IDIB 3BISA 4WHCA 5GGTH 3RY5A 1MHCB 5JQ6L 4MQXC 4AMKL 1T7YA 4OCRL 1CFVH 4Y4FA 5F9DC 4WI9A 1DVFD 4WTXA 2HVJB 2YKLH 3R0NA 1YN7A 4GKSB 4NP4H 2X4NA 4HUWB 1RIVH 3IKKA 1LO5B 5KVGL 3LS4H 3IFOB 1P6FA 1N7MH 1AQDB 3K1KC 5DJDB 2R0LL 3NA9H 4R97B 5TE6H 1NCBH 2FX8H 4H26B 5LXGH 2JB5L 3C5JA 4WW2C 5HHNA 2HT2C 1R5VA 1MF2H 4HKZB 1A9EA 2W59A 4JZOA 1I3VA 3A6CH 2AEPH 1EGJA 5F21B 2H41A 5EU5B 4N9OB 2DMBA 3PGDA 4HD9A 3PHQB 4YUEL 1R3HB 5I1GL 3NZHH 1IZKA 2VLKE 1UCBH 4GRWB 4QXGH 4Z77A 5I1HH 3QXVA 2I07B 2BVPA 2H26B 4G8GA 3OZ9H 4QRPB 4LCWB 4U1GB 2CK2A 5I8OH 4F3FA 4X80L 4LF3A 1JNJA 3DIFA 2Q86B 4E41A 3F7VA 4YO0A 4LCCA 1MOEA 4KHTL 5T1MB 4UV4H 4XZUB 4BM7A 1ZXQA 4LCUB 1T6WA 3SKJL 3RVTC 1ND0A 1NGWA 2WANA 3VI3E 1MCRA 2PXYA 4XXCA 2QHLA 2PETA 1RZJC 2B1HL 2GJZB 4YHKL 4H88L 5CJOL 4KZDH 4KHXH 4NUJA 4MQSB 2FR4A 3RDTB 3STZB 5E6IC 3VWKB 3CSYA 3GIVB 3N1PC 5D7IF 1A7PH 3VWJA 4WUUE 5EOQH 4YFEA 4XNMB 4ZFFB 4GKZA 3EJZD 4NBYB 5I1EL 2IANE 4NQXA 5DQJB 4EDXA 2GTZB 3GRWA 1T04B 1WWWX 5AAMA 1JBJA 1ADQA 4QT5A 4NQDB 4TOYL 4AEHL 5K93A 2A77H 3TT3H 2VZOA 5B4MC 1WV7T 1Z9LA 4XMKL 4OD3H 3EO9H 3QIUC 1S7VB 5DMGC 1OHQA 4M61B 2GY7B 1YNLL 3SDAC 3DURB 1PG7X 2PUQT 4OB5L 4XMLH 2R1WB 5IQ7H 3ZKND 4HBCH 3MRLA 2VDRL 5HHME 4NQEA 3WLWD 3EZ8A 4HG4K 3SDDC 3EYOA 2IG2H 4TN9A 4MXQD 3TN0B 4X4ME 4RIRB 5JOPD 5JHDA 1PZUB 4G6KH 5FM8A 3GEWB 2PW2A 1IGTB 4KAQH 5CSGA 3AS1A 4YDJB 3MREB 5CEZH 4P2OD 4GKNA 4GXUM 4O51A 3VFWA 3MLVH 2VE6B 4XBGB 3BGAA 1B3JA 1KXVC 4HAGA 1F4YL 3QXDA 4IDLA 3E3QC 3RJDA 5BV7B 5IIEA 2FYYB 2J8HA 2YRZA 4MNQE 2F58L 4HLJA 2R2HB 5B22A 3A6OA 3TCLB 1Z3GL 3D2UA 2OS7A 5D7SL 2Q76A 5BQ7B 4MCYA 1XF4A 3F12A 3LRSB 3P0GB 3MBEC 4DWHA 3FRPA 4RFEA 1WUNT 2XQYG 3O11A 1KB5H 3TBSB 1J11A 1CDGA 4EBQH 5FECA 1FFQA 2PYFB 1KLGB 1TNMA 3C60D 2AQ3A 2JE8A 3T0AA 3S3SA 4XCCH 4ZXBD 3SY0B 1JZ2A 4NT6B 2UWEB 3F5WB 3Q2CA 4NOBA 1ZAGA 4WHTB 2EIBA 1ZT7B 3REWB 3MV9D 5DVLA 3IAQA 3OAUL 1F2QA 3QXAA 5DJYB 3S4SG 1GVIA 4JFZH 4KJYA 1A21A 3L5HA 1EO8H 2KKQA 3G9VA 5C0AB 1KIPA 3MFFB 2N56A 4UT9H 2HKFH 1X6LA 4TNVF 4PLJC 1KIRB 3EGSA 2GFBB 1RK1A 1KEML 2BHUA 3CVHB 4GRLA 2O93L 2GCYB 4FFYL 3OKKB 3O4LA 2X1QA 4LSQL 3C8DA 3H3PH 1X5FA 1JRHL 1AGBB 1XAUA 3EIFA 1WK0A 2W9EH 4PJ7E 3W5NA 1XGQB 3HMWL 1QR1B 4I0CC 4KDWA 3RNQB 4WWKD 1W0YT 1DVFB 2AVGA 3PJSA 4FXGA 3P4OB 4OZHE 3VXSB 5ERWA 2X4QB 3SPVA 1NANI 4CVWA 5I1LB 5J12B 3H42L 3S7GA 3LKSA 3QUZC 4MAYD 1CDBA 4JRXD 4PRHB 3RGVA 2VXVL 3MRDB 2R4SL 4UNUA 1XGUB 1MIML 3IDGB 1CVRA 2QV2A 4P2RB 5J13B 4G9FE 4K94H 1IT9H 1PBYA 3OL2A 4KQ4L 2IQ9L 4MVBC 3WDJA 2GJJA 1UKQA 3BIKA 4M1DH 2CXGA 2VDLH 4LCIL 4OZ4B 3LEYL 4NYLA 2NY5L 3G5YB 1XT5A 1YJDL 2EXWC 3R8QA 2EDDA 4X7FC 4U6TA 4ZFZA 4LSPH 4LU5H 4RDQG 5BS0A 5CGTA 1U8OB 2Y07H 4UUJB 1NEZG 1FNGA 1ZHNB 2Y5TB 3KG5A 4Y1AE 2YC1B 2DLTA 4Z0BL 3DI3B 3NZ8B 4JR9L 4Z7UB 3L3DB 4U6HA 4MMXC 1W0VB 4AH2A 1NUDA 3QT2A 3QYCA 3VFTB 4RWYH 3WJLC 3PDDA 4UDUA 1G7HA 4GG8A 5KSVA 3U1SL 4P9MH 3SCMC 1BBDL 1EIBA 4PRPB 3FOLA 2FDBP 4PJCF 1XIWB 3GKZA 5EZLA 7FABL 5T5NG 5CAYB 1B0WA 1IQDB 4UIMA 1NBYA 1LP9A 3EFFA 3LHPH 3P77A 4LVHB 4Z7NE 2FGZA 2Z35A 4OD1L 3VG0L 2F54A