1MPAH

Bactericidal antibody against neisseria meningitidis
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
225
structure length
225
Chain Sequence
b'EVNLQQSGTVLARPGASVRMSCKASGYSFTSYWLHWIKQRPGQGLEWIGGIYPGNRDTRYTQRFKDKAKLTAVTSANTAYMELSSLTNEDSAVYYCSIIYFDYADFIMDYWGQGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bactericidal antibody recognition of a PorA epitope of Neisseria meningitidis: crystal structure of a Fab fragment in complex with a fluorescein-conjugated peptide.
pubmed doi rcsb
molecule keywords MN12H2 IGG2A-KAPPA
source organism Mus musculus
molecule tags Complex (immunoglobulin/peptide)
total genus 36
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 1997-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mpaH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mpaH02
3X3GH 4NQSB 3CVHA 5BV7H 2JK5B 3LH2H 4PJEF 4OKVB 4Y16C 3RWJB 3N1GC 4PR5B 2GK2A 3ARDC 5CKAA 2K9UA 3ZE0E 4NDMB 2X6MA 2YA0A 5HPMB 1U8QA 4ZOAA 5EFIA 1RUMH 3BZDA 4K7FA 4P2OB 4RX4D 12E8L 4TYUA 1E28A 5TQ0H 4J7RA 3L3KB 1V3KA 2ERJB 1I3GH 3FB8A 5IGXH 4YDIL 1AJ7L 4WFGD 4JFDD 3ZHKA 1F45A 3QZWG 2BFVL 2OL3H 2NNAA 1XZ0B 4FQCH 4XP1L 4L29B 5DI8A 1CGTA 3H2WA 1DQJB 1B0GA 1KF9B 3RY4A 2ZZUT 4F37K 5DRXB 1A6WH 1E6OL 1IGTB 1ZVSB 2P8MB 1YYMH 4EUPA 3LD8C 4DOHB 3VW3L 3MRBA 4KTYA 3D87B 1ODAA 4BUGA 4YC2C 1EFXA 5FA3A 4I0PA 2A0LC 5H2BB 3ZMRA 4FFVD 3ZE2F 1NAMB 5F3BA 3LEVL 3VXMD 2B1AL 1MAML 1MHHA 5BO1H 3K0WA 3WFEH 4YE4L 3WKML 3BPNB 1DE4A 3D85B 1RZ8A 3KLAB 3HMWH 2PCPB 3C9NA 1AGEB 5MENE 1S78D 1TITA 1U58A 2HKFH 4P49A 4YBHA 2D7PA 3T2NL 5L2JB 1RHHB 3F65A 4LMQE 2EE6A 3MMEB 4M6NL 5EU5A 3DUSB 4ODVH 1AE6L 5I76B 3HZYB 1R0AH 1J8HE 1JRHL 2YUZA 3L5WA 3GHEL 4LAQH 4CNIB 5TFSH 4OKDA 4JM2A 2HWZH 4U1IA 1K85A 1P4IH 2NX5E 4ONOA 2EXWD 3NZHH 1G0YR 3MBEA 3B9DA 4LLUB 4FZ8H 3GNMH 4L8CA 2EZ0C 5MEQA 3NIGF 4OGZA 5JOPE 4DN3H 5J11C 3FQXA 4KJPD 4NZDA 2HH0H 3Q5OA 5JW5B 4I4WB 3WUWG 3QDGA 3T0WA 3SO3B 4PTUA 3HAEB 4XMKH 3WNOA 1XF2B 3IU4H 4Q7DA 3FO0L 3TBSB 4JREB 1KELH 1IEBA 2VLJB 2OJEA 5AYUH 4YK4B 1A7NL 3D2UB 1EIBA 3NCFB 3MPCA 4EI6A 1BX2B 4FQJH 4L4VD 2P42B 3HE6B 2IEPA 1FVEA 1HILB 4NZUH 4JDVB 5EORH 4OFPA 1S7UA 5C09D 3RNQB 3MV9E 2X4NB 3DTXB 2CLZB 3C8DA 5JW4N 3MBXL 1GXEA 2HVKB 4PJ9D 4MCZA 3ISWA 4MQXD 1JF1B 2OR8A 4PJHB 4Z7NF 3VFGL 4AT6B 1JYVA 2AJVH 3R1GH 5DD5H 4ZO8A 3WDIA 3OZ9L 2VE6A 4LSPH 4JG1H 1INQB 2HRLA 4NFCA 3VXRA 1T66C 5ADOL 1A5FL 1F58H 1FRGH 4JO1L 1UM4H 3EFDL 4JFHD 3S37X 1LEKA 3FT3B 4CAGA 3CFCL 2F54A 4L1HA 4OD2B 43C9B 4N9GA 4P23C 3VFSB 3FRUB 3OJDB 1FSKB 3O6MH 3UAJC 3BW9A 4KZDH 4RFOH 1IQDB 5T3ZH 4P3WA 4P4KC 2R39A 3B9EA 2XTJB 4UI2A 3QIWC 3B5HA 1SQ2N 3OHXA 7CGTA 1Y0LA 2VAAB 4F7MA 2Y9RT 3DMMD 4JB9L 1A21A 3V0AC 5C0CA 2PO6A 3QUZD 2CKBL 3AY4C 3CZJA 4LSDA 1X5IA 1IEAB 1UZ6E 2BHZA 3MLVL 2ENYA 5LJYH 3WIHA 4GQ9L 3SE4A 2XG5A 2BOCA 2VQTA 2K3TA 4BH8A 2FLBT 1IMHC 2DL2A 4CU6A 4P4RB 1R5VB 4UTBL 5IMMA 2M26A 4OLXL 4MAYA 4Q6IC 1HDMB 4RMWA 2D31A 1Q72H 4LASH 3N85L 2APWA 3CGTA 1P6AB 1RVFH 3QWRA 5AZEL 2V7HA 2GCYB 1X5FA 4U7SA 3U0TB 4HKBA 3IKCA 3GIVB 4LARL 1HHJA 4JFED 4OLUL 3QISA 4S1QH 4KRPB 3BGAA 3BD3A 5IVNA 2VLKA 3I3BA 2V5MA 4DKFL 1BVKA 1JWMA 2RQ8A 4Y1AB 3QDJE 1KIRA 1ITBB 3BP7B 1KGCE 3C6LD 2GFBB 1QSFA 1MHCA 3ZE0F 5CEYA 3PGFH 3W39A 1KACB 4LCUA 1I8IB 5CJOH 5DQJA 5GS2H 2R0ZH 3HMXH 3RIAF 4CN4A 4KC3B 2DDQH 4ODWA 2FH6A 3U30B 1AQKL 1Q94A 4FQQA 2Z93A 3KWWB 2XOTA 4LNVA 1LD9A 5BXFB 5IEKA 5JHLL 2OTPA 4GKNB 1S9YA 1J1OL 2DTMH 2FEDC 3N0PB 3ARGC 5JUEL 3A6BH 1KCSH 3O8XA 3KJ6L 1RZJH 4MWFA 3CCHB 1SBSL 4N0UA 1IFHH 2VITB 4GAYA 4XZUB 2F19L 4EI5C 4WUUA 3CSYB 2VC2H 2A77H 1JFQL 4OT1H 5J06A 1DEDA 3SGDH 4RGOL 1X5ZA 2E6PA 4S1DC 4JN1L 3GSOB 3GM0A 4K3DL 2H32B 5EO9B 5HGBA 3E2HC 2AJXH 3TH3T 3W9DB 3P4LA 5IB1B 4G6FB 5FGBC 2X4OA 1JGDB 2UWEB 2DMCA 3C60C 1T20A 5ID0B 1PYWA 1XMWA 3N9GL 4PRAA 2A6IB 3QPQC 3OB0K 4Z76B 5FDWB 1VSCA 1OCWH 2UZIL 3OKMA 3QEUA 4MNHB 2IAMA 3VRJB 2HTKC 2QSCL 1BQSA 4O2CA 3K1KC 5T1DH 1MEXL 1MRCH 1UQSB 1OW0A 1YQVL 1KIQA 1BGXH 4ODBD 2Q3ZA 3QXTA 1MJUL 5E94B 4YPGB 2OK0H 1Q9LB 4WFED 4PB0L 5CJBA 1A6ZA 3OKDB 4YDJA 3V0WH 1RQ5A 2F53D 4Y89A 4G6AC 1A2YB 2FIKB 3VGDA 4PJ8D 4HLJA 3TH2T 1TCRA 2WINB 5BZWB 2JJUA 4OUOA 4DCQA 5GGRB 4BKLB 2EC8A 1CL7L 4ZYKA 2HJFB 5F1IB 4RMTA 3EO9L 1QBAA 1EJ6A 4LHUD 3BQUB 4PGDA 4P46C 5DS8A 5FECA 5DC9B 2WUCL 4RAUA 4ZOCA 4X4XA 4KQ3H 1ADQH 1CLYL 1XCQB 1W0VB 4G7YL 4OCXH 5CEZD 1FORL 4LKXB 3T3ME 3ZYJA 1OD7A 3FQRB 3KLDA 3HFMH 3O3AA 4YQXL 2R1XA 3EYFB 4PJIB 1RJYB 2GSIA 2X4TA 4P2OC 1WFTA 2VZ3A 1ACZA 1LO5A 2ZP0T 1MQKH 2E7LC 3BT2L 2ZOLB 4ELMF 3QUYD 4PLKC 3TJEH 1VGEL 3W0WA 4M93C 1AD0B 2A6JB 2KZWA 4P9HC 4ZAKD 3KYMA 4X0KA 5FGCB 1NFDE 4PJBA 1T1YA 4M3KB 4PJ5A 3NCJL 4G8FA 1PDKA 1LE5A 5DJCA 1U8KA 3HC4H 4NNPH 1FGNL 1EJOL 5CP3H 4DOHE 1QRNA 1UZ6F 1LK3L 1TVHB 3SOBH 1MREL 3OR7B 1FL6B 1FN4B 1YPZF 4NGHL 4S11A 1U41A 4LSSL 1FYTB 1U8IA 3QULB 4AG4L 5DD3H 1TQCB 3I6LE 4TVSa 5HYSG 2EDOA 1XGUB 1UADC 4MLSA 4P5MA 3MRLB 3TIEB 3V0VB 2E27H 3UTTB 5ID1B 3PQYB 4DZBB 3HNTL 1ROWA 2Z35B 1A3RL 3GO1H 1FVCA 4X9IA 3RIAK 2VLME 4HIIA 5GRUH 1FGVH 3CH1B 4S2SB 1T1ZB 1WBZA 3EOTL 4HMDA 4ZTPL 4M7KL 3VGFA 4UU9B 3IXTA 1V7NL 4PJAB 1OTSD 3A0OA 5HDBF 3QHZH 3QA3A 3U36A 5C0FB 1U36A 1S7WB 1T83A 2P24B 5AWNH 5IB2A 3LKOA 3K3QA 2R4SH 4OSUL 4CVZA 2ZUQB 4MQ7A 1H3TA 3O3BA 1RUQL 1ZGLM 5AD0A 4OGXL 1BJ8A 2ZCKH 3BXNA 3RAJL 4ZFOA 5FKPB 3QUML 1DN0A 5GJTH 5BS0A 3QUKB 3O41A 5C1MB 2CXGA 3T0EC 5L88H 3N1MC 3VGBA 2VDRL 3IVKA 2P5WA 1W72L 2VLJE 4JPIB 5IJKA 1GGBL 3NCCB 4JO4H 3ULSA 5JOFB 1JNNH 1LNUB 2R4RH 4L4VB 4PGJA 3AU1A 3VXUD 5C07B 1RJZB 1D6EB 5C09B 1AGFA 4M02A 4X8XA 3FOLA 2V7NB 1RUKH 4RGND 5HHNA 4DFHA 2WAHA 4JY4B 4NOFA 1C08A 1KENL 1ORQA 3B2VL 4PJHE 1H3PH 1NGZB 1R5WB 2BNRD 3VXTB 1XH3B 3MJ9H 3S36L 3TO4A 4R4NC 1MCQA 5DUBB 1FSKC 1S9WA 4K2UH 1Q1JL 1RULL 3PWPB 3EDEA 1PKQB 3G5YB 1WWWX 4I3RL 1JWUB 1FZJB 1VACB 1DCLA 1PLGH 2W60B 5ITBH 2A73A 4HUUB 1T1WB 1HCVA 1IVLA 1NUNB 5H35B 5J1TC 2XTJE 3U0PB 2CRYA 4RFEA 2CDGA 4JLRB 1MCIA 3HG1B 5HHOA 1MCOH 3MJ6A 4JN2B 3U9UA 1HE7A 5C0DB 3V5KA 5DFVD 1D5XB 4PRHA 4M00A 4X9BA 3RKDD 5IV2A 3G5ZB 3T8XB 2JE8A 1AGDA 1FYHB 2EDKA 3QO0A 4H0HB 5CHNB 5IK3A 1KJ3H 1HKFA 1RAMA 5FUZH 3TBWB 1T89C 4NYLA 5I1JL 2FJFA 3ZKXC 1KBGH 4YR6B 4GRWB 3CXDH 4OQTL 3ZDXF 3F7VA 5BRZB 5DD0L 1BEYL 2QKIA 4HJJL 3HB3C 2FX7L 1S7VB 5T3XH 3LQZB 1L4IA 1L0XA 1J0ZA 4KRPC 1U2CA 3I3EA 3BWAA 4DWHA 4IRSC 4AEHL 4XVTL 1OB1A 3IYLW 5C0IA 1YEHH 4JFEB 5SWZB 5B3JE 1DQTA 4TOYL 5FO8A 1EFXD 1BIIB 3BZ4B 3E3QE 2HTLC 2OL3A 5HVHC 4JQXA 1FL5A 2O61A 4UZGA 12E8H 4NM4L 1ZS8B 5CSZA 2ORBL 2HAZA 3P9MA 1NC2B 5D1QB 4X98B 3QDMD 4YXHL 4YDIH 4D0DB 5TQ2L 5D7IA 3BP5A 1KPUA 2D7OA 1OAQH 2BFVH 1IC5L 4TVPL 4ODXB 4PLOB 4YX2L 1RZKC 4GO6B 1QFUL 4Y4KD 4KK5D 5A1AA 5EC1B 1NFDF 3EDDA 2LVCA 1MCDA 3FQWB 2AJZB 3E6FB 5I8EA 1MJJB 3K7UA 5D1ZC 5I18L 3MBED 1ZLWH 3VW3H 5D7JB 1G7QB 3GSVB 3TA3D 2NZ9D 2QHRL 4HUVA 3LB6D 1F3JB 2G2RB 3T2PA 3X13B 1PEZA 3WNMA 3KG5A 3FL7A 4WWKC 2BVPA 3LEVH 2B1AH 1MAMH 3WO4B 2VIRA 1LEIB 1NEZA 2PTTB 4YE4H 5HTSA 3QDGD 3WKMH 1I8MB 4AMKH 5EU4B 1A1MB 4LHQB 3VXOB 4PJ7A 3REVA 1J9CT 1MJ8L 1NANI 3T2NH 4M9PA 1T04A 3BHBA 1S7SB 4QRUA 4M6NH 3IDYC 4QF1B 3QIBA 2DQTL 1AE6H 3PHQB 1A6TB 3TYFA 2CR3A 1JRHH 1W0WB 3GMQB 1T1XB 4I2XA 3GHEH 5CUSL 1H3GA 5LGJB 4ETYA 1DQDL 4F7EA 1T0MB 2UWEE 2Y5TA 3QO1B 1F6FB 2HG5A 1IAKB 1TQBC 2IJ0C 2IFFL 3OXRA 3MRQA 3RUGB 3HPJB 1KN2L 3VFRA 4X99B 3SPVB 3R0NA 1XCTA 3KYOA 1T6VN 5B4MC 1BFSA 5EBLA 4H1LH 1G7IB 2E6QA 3NN8B 4Z7UA 3EGSB 2XACC 5EIIA 2BMKA 3QJFB 3FO0H 1A4KA 4PP1C 4NQTA 2V5YA 4FFZL 5IBTL 2GHWB 4F15C 1A7NH 2F54D 4AJ0A 5ILTL 1RD6A 5E8OB 2CPCA 5FM5M 3DIFB 3TVMA 4NO3B 4E0RA 1CD0A 4K71C 1UJTA 3D3VA 4QHNB 4QHMA 5CZKA 3O4LD 1C5DA 2DBLL 1YY9D 5EUOB 5B39B 1ONQA 4U1MB 3NA4A 2DBJA 2VO5A 5IW6A 4ZFFA 3VFGH 3TPKA 4JFOB 3MRGA 4YDLC 1AHWB 1NJ9B 4FS0A 3MRCA 2X4RB 4NKMB 3WFZA 4PJIE 4DKAA 5AAMA 5KN5B 3MOBL 1DANT 5ADOH 2HFEB 1A5FH 4URTB 4E42B 4JO1H 3M1BB 3EFDH 4JQIL 1T7ZA 3CFCH 1U8LB 3BE1L 5D2LA 2AS5M 5C71A 3AXLA 4FQ1L 4ZD3L 2H9GB 1QRKA 2UYLB 3VFUA 3WEXB 1Z5LB 2Z4QA 1T03L 1S5IL 3ZL4L 1S7TA 2WLZA 5I8OL 3MJ7B 3QXAA 4PIRF 1FFOB 5I9QC 2DQHL 4KQ4L 2J88L 3RL2B 2OZ4A 4NKDB 3X14A 1M05A 1MWAH 2IBBA 2RB8A 4Z7QE 4N8PA 4JB9H 2VLKD 3MJ8A 5J1SC 4M7ZB 2CKBH 3DGGB 5DHXB 3PP3H 3P9LA 2OSLA 2CLVA 3MLVH 3OKOB 2NY0B 4FFVC 4GQ9H 4D9RD 4HXAL 3FB7B 4LNRB 1GC1L 1X5LA 4FHBD 2VQ1B 3BSZL 5MHSE 3IRZA 4UTBH 3SKMB 5I16A 2N4IA 4OLXH 1S78C 3S96B 4MNQA 3RPIA 4DEPB 3H42L 3UX9B 1FYTE 2EE9A 3HZKA 4UV4L 3N85H 2DQJL 4JQVA 3DV6A 5AZEH 1WITA 3UTTE 1J11A 3PQYE 5FK9A 1BJ1H 1MIEL 5I6XB 2FJHA 5INCB 1TZIA 3DHJA 1YEKL 3OR6B 4LARH 4X4ME 2EXWC 4OLUH 3BO8B 2EDXA 1EFQA 2RHEA 1MCWW 3U6RB 4UIMA 4W4NA 3HMXA 4DKFH 5IMOB 1G9NL 5F44A 3SGKC 5I2IA 3UPAA 4Y4HD 4LCWD 4PJAE 1L7IL 4KJPC 4QTHB 4LQ1A 1I4FB 2EKSA 4F7PB 3FT4B 2P8PA 4Z0BL 1UYWL 3DSFL 3CFBB 1AQKH 5JHLH 3DURA 5FGSA 1UB6A 5GGVY 2I60L 4HUXB 4LVNB 1CLOL 1NGXB 4IOIA 4GAGL 1J1OH 4WV1A 5JUEH 3WNPA 4JFYB 4MX7A 1U3HA 3KJ6H 5I17B 2PYEB 1SBSH 2B7DT 4U3XA 3VXUB 4L4VE 4EVNA 2W65B 4YJZL 2WANA 4JRYB 5C07E 4PGEB 4PJ9C 4YFLI 1IGYA 5F8RC 4Z77B 4MQXC 3IDGB 4XVJL 1JFQH 2UZXB 5C09E 2DMKA 3GMRA 1V5JA 4RGNB 1CQYA 1EEZB 2MJWA 4RGOH 4MA3A 3TM6A 4I48A 4ZQKB 4JN1H 2G9HB 3P4OA 5ADPH 3I3DA 4K3DH 4FP8L 2IBZX 5KSUB 2ITDA 1Q9WB 4G43A 4RMVA 2E6JA 2OX5A 4PV9A 3GSNL 4OZFB 4NRYB 2M1KA 5F7LB 3N9GH 2QR0A 2XI9A 2UZIH 1N8ZB 3QXVA 1EUTA 1CWVA 3AROA 4KDWA 4KHXL 3PWPE 2E3VA 2QSCH 4MJ5B 4WW2A 4ZXBB 1MEXH 1PKQE 1YQVH 3K4AA 2A74B 4NFBA 3V4PL 3UJJL 2H41A 5ESAA 1T7XA 5GS0H 3BN9C 1CU4L 3H9SA 3DMMC 2NLJB 4KV5F 4PB0H 3QUZC 1AD9A 3CVHB 1VFBA 5DDHA 4CADA 3HG1E 4H5SA 2XN9D 1ADQA 1CL7H 1K8DA 4QGYA 4DUWA 3BYYA 1U8QB 5DYOA 5EFIB 4K7FB 1QBML 5ALCL 2GJ6A 1JTOA 1E28B 1CZ8L 1OAXL 3MQIA 3FB8B 5H37G 4MQSB 3RDTA 5J1AA 1A3LL 2WUCH 5D7SL 4X6BA 4R7DA 4FTVA 3ARTA 2NNAB 1JZ4A 2XZCL 4UV7L 3O11A 4G7YH 4GRWE 2D7TL 5DI8B 1FORH 2MKWA 4JFFA 5BRZE 1B0GB 3AMKA 1G9ML 3AUVA 4YQXH 3WFBH 4J3SA 2V2TA 4EUPB 3BAEL 3MRBB 2NMSA 1NUFA 3KXFD 5BCAA 1EZVX 2OS7A 5ELIA 4JFEE 5SWZE 3C6LC 1EFXB 3ULUE 5FA3B 4I0PB 5F3BB 1GZPA 1DEEA 3BT2H 1MHHB 1UFUA 3VGEA 2DLEA 4IOFD 1DE4B 1RZ8B 2X05A 3S3SA 1X4XA 3C9NB 1U58B 2IADA 1UCBH 1RMFH 1EX0A 1RZ7L 5F8QC 4NO2A 5EU5B 3DHMA 5F7FA 3UZQA 1C5BL 1G7PA 1UC6A 5CP3A 3IJSA 1MQ8A 3L5WB 2Q6WB 1JN6A 4OV5A 1H15A 4JM2B 4YHOL 1WC7A 3G6AA 4U1IB 4Z7QF 5IBUG 2NXYD 3MBEB 1FGNH 5B22A 5K93A 4D94A 3RX7A 1BOYA 2DWDA 4M5YL 2WW8A 4J3UA 4L8CB 4ZO6A 1MREH 1YNTA 5MEQB 1TTUA 4NGHH 4JY5L 4LSSH 2YOCA 3FQXB 4AG4H 4D0BA 3BPOC 4GLRH 3QDGB 4IMKA 3H6JA 3TJHC 4PTUB 4M8QA 4XNYH 2MTPA 4JKPL 1DJSA 3HNTH 2BY2A 2VXQH 1IEBB 2OJEB 4U7MA 1A3RH 4NHUA 4TSBH 1IKFL 4EI6B 1BQUA 2ADGA 5EOCL 1S9XA 2EE3A 1ZGLP 1FVEB 1JE6A 3QAZC 2FHCA 3S4SG 1VEOA 5CLWA 4ZTPH 4M7KH 2WV3A 3ESVF 3SE3C 1WT5C 4HPYL 2LAGB 1I9IL 1S7UB 3DNKA 4I8DA 2IGFL 2VDOL 1V7NH 3PNWA 5DUPL 3RUGE 1CXEA 1EHXA 1T21A 4KWUA 4MCZB 1RUQH 5DJZA 4PJAF 4PJ8C 1RIHH 2R29L 3LS4H 2K7QA 2XA3A 3VWJD 4OGXH 4M3JA 4GS7C 5TGBA 2VE6B 4WFEE 3RAJH 2APFA 1D5BA 2FH8A 3QUMH 3VXRB 4GRLD 2QQNL 2PNDA 1HINL 5D7KD 1LEKB 2ZCLL 2VDRH 1RIVL 3O4OC 1W72H 5C2UB 2F54B 1GGBH 3B9KD 4N9GB 5AG8A 3F7YA 3MOQA 4Y5XC 3BW9B 1CE1L 4FQHA 4J2XA 3OPZH 4OLWL 1AXTL 3OHXB 4YFDB 8FABA 2OXGA 3MJ9A 1Y0LB 3JV6A 4F7MB 2I9TA 5EUOE 2YD4A 3NA9L 4P59L 1J88A 5C0CB 3OJ2C 2PO6B 4PRHD 4PP2A 1KENH 3AB0B 3B2VH 2FNBA 3S36H 1VERA 2BOCB 2H45A 4BH8B 4N8CL 1UACL 3QUYC 3IDJA 3V4VL 4XB8A 2A6DA 4U1LA 5IMMB 4Y0GA 3DV4A 3SCMD 1Q1JH 1RULH 4MAYB 2MWCA 4FZEL 3ROLA 4WFFE 4ZAKC 2VDQL 2D31B 3ZKQD 1YYLL 1DBKL 2V7HB 3DX6A 3PL6A 4OM0L 3SGEH 4Z5RA 5DQ9A 2DIJA 4HKBB 3IKCB 4XPGL 4TSAL 2EC9U 1HHJB 2DKSA 3VFTA 2F5BH 2VLKB 2AK1L 3GJFK 1BVKB 1JWMB 1KIRB 1UXSA 2NY2D 5EDXA 5MERA 3I6GA 1EO7A 4NN5B 4K3JL 1QSFB 1MHCB 5CEYB 4UT6L 1JV5A 3W39B 4B50A 3DYPA 1MELA 4LCUB 1JI1A 5I1JH 4NP4H 5DQJB 4YXLL 1SY6H 2VDKL 4NSKA 4ODWB 4OQTH 2YXMA 3FQNA 5C0ND 2K1MA 1Q94B 4FQQB 2Z93B 5DD0H 5AAWA 1BEYH 1LD9B 5IEKB 3V8OA 3QIUA 4GRWF 3C09C 3QRGL 4X5WA 1PG7X 2FX7H 1DLHA 1S9YB 4KMTH 4R9HA 1H8SA 4HKXA 3CVIL 3P4NA 1JF5A 5EG6C 2YZ8A 2F8XC 4AEHH 3MLSL 3O8XB 4XVTH 3GSXA 4MWFB 5E2UL 5IOPA 5EZIL 4N0UB 4TOYH 1MCKA 1OTSC 4GAYB 3ZT5A 1QLRA 4XHJD 4JHWL 3WO3B 4WUUB 4LU5L 3DXAA 1UB5A 3DETD 2NTFA 2CIKA 4NM4H 1JRHI 1R3HA 2APVA 1DTUA 4YXHH 1UCTA 4HAFA 1I85A 1CE6A 5F1NA 1IC5H 2OBGA 5ISZD 5KSAA 5HGBB 4TVPH 3FTGA 2VLRA 5I74C 3T0XA 1QFUH 4ORZC 4QRQA 4AL8H 4KJYA 2X4OB 1T20B 1UM6L 4R8WL 1PYWB 4U6HA 5J12C 4PRAB 5AG9A 2E8ZA 4YHKL 3P0YL 3QI9A 3JWOC 3QEUB 3OKMB 4WU5A 2IAMB 5I18H 1OAZL 1QACA 4O2CB 2QHRH 1KIQB 3WN5A 1VKXA 3UYRL 2PYEE 2IBZY 5DJ8A 3VXUE 5HGHA 3CJJA 4JRYE 2EEBA 4M4PA 3CX5K 1F4HA 1A6ZB 5F70A 4YDJB 3LSOA 1J86A 1A22B 1TCRB 4RGNE 3THMH 4DCQB 1MJ8H 4GW1A 3M07A 4ZYKB 2FZ3A 3PHSA 4PJGA 4F3FA 1U2HA 3QPXL 2DQTH 3MNVA 2VXUL 4M6OL 1ZVYA 3OKEA 4PGDB 5I75B 1MFCL 4X4ZA 4F7CA 3MXWL 1I7RA 5CUSH 1RURL 3I9GL 4X80L 3L1OL 5DS8B 1DQDH 2IANA 2NY1D 5C9JA 5FECB 3RQ3A 3MLYL 4H1LA 4RAUB 4X4XB 1G6RL 1EPFA 2IFFH 1LILA 4I9WD 3CFJA 1MCHA 4GBXA 1H8OA 1KN2H 1GZQA 4JKLA 4X9GA 3O3AB 3SKNA 1OF2A 3C8KA 3WFCH 2R1XB 1H5BC 5DFVC 1L6XA 2VZUA 4WW1A 4BSWA 4MYWB 2GSIB 2X4TB 1I1YA 3RKDC 4JRWA 3H3BC 1AC0A 4JJ5A 4OFDA 2VZ1A 1CFNA 4V1DA 4Z18A 3UTOA 1MIML 1LO5B 1TJHL 3H7LA 5EU6A 4FFZH 5IBTH 1F11A 2B5IB 1IBGL 3NPSC 1CI5A 1ED3A 5ILTH 1GJIA 2DJ4A 2VXSL 4XCYA 3W0WB 2HMID 5BJTA 3KYMB 4X0KB 4LEXL 4HGWA 4QHKI 1EZVY 3G6DL 4HGKC 2DBLH 4PJBB 4X6DA 4H0GA 3SDXA 1T1YB 4PJ5B 1KG0A 2CUHA 1N3NA 4G8FB 1TNNA 1LE5B 1KJMA 1TDQA 5DJCB 3PWNA 4P9ML 1F3DH 1U8KB 1IE5A 4P2QD 2FYYA 5T5NF 3ABZA 5IVXF 1BBDL 2W9LA 4UAOB 4R97C 1QRNB 2P48B 3MOBH 1DVFD 3MV8A 3V7AE 4OLVL 4JQIH 5E95B 3GEWB 3B8SA 2JJWA 1U8IB 3BE1H 4N5UA 1HH6A 4W6WB 5FHBH 4P5MB 3SDDA 4L8SC 4ZD3H 2PW2A 4Y4KC 2CKBA 1HXYA 1EHAA 2Y7QA 1T03H 1AO7A 1D9KD 3ZL4H 3MRRA 1EHLH 5I8OH 3SDAD 3EYOA 1FVCB 2DQHH 4KQ4H 2J88H 3EYSL 4IDJL 4HIIB 2I24N 1WBZB 3TA3C 2NZ9C 2XIDA 1OM3L 1JZ2A 3LB6C 3IXTB 2NXYB 1TJIL 1B0RA 4HXAH 3QA3B 3U36B 5KW9L 1GC1H 5IB2B 2CDFA 3LKOB 3BSZH 4CVZB 4MQ7B 3O3BB 3KJ4C 5AD0B 2I26N 1GPOL 3H42H 3V6OA 4EIGB 3BXNB 3VD7A 4ZFOB 4UTAL 3RWDA 3QDGE 2DQJH 1DN0B 5BS0B 1ZOXA 3O41B 4LLMA 1HHHA 3WHE0 3IVKB 2P5WB 4U7KA 1MIEH 1UA6L 3QBTB 2VLLA 2GYSA 4J3TA 3DYMA 1YEKH 4PRIA 3ULSB 4MCYA 1KIPA 2X09A 3AU1B 4B41A 1QSVA 1MCLA 1YDPA 3SQBA 1AGFB 5EO1A 3FOLB 4N8VA 5HHNB 3JXAA 3T2OA 5INDA 2XKUA 5DSCA 1L7IH 3IT8D 4P2RA 1C08B 3S97C 1ORQB 4Z0BH 1K2DA 1UYWH 3DSFH 4M48L 3KPMA 3TO4B 4K23L 3VXRE 1CLOH 3ZHLA 1S9WB 2JJTA 5IMLA 4QY8A 4MJ6A 2BXZA 4OZ4A 5C3LD 2F54E 3JUZA 3FN9A 1YY9C 4PG9A 1YN6A 1H3XA 2QQKL 2A73B 4ZUUA 1NLBL 2HRPL 3O45A 1UT9A 1CL7I 3QCVL 5DT1L 1NGYA 4XVJH 5KBNC 3C5SA 1F6AA 4RFEB 2CDGB 3I2CL 5HHOB 3VD4A 2H3NA 3MCKA 4JKWA 3U9UB 3V5KB 1YZZA 3QUXD 5C0CE 5IVOA 4PRHB 1BWMA 4LCYA 5IV2B 4FP8H 1DLFL 1AGDB 3QO0B 4KK8D 5IK3B 4GSDL 5E4EC 3ALPA 3HAEG 3IFPA 5DJXA 5FYLE 2ZCHL 4NYLB 1A6UL 2FJFB 4MJ4A 4FTVD 2P5ED 1J0JA 3TO2A 5BV7B 3F7VB 4KHXH 1UEYA 2X7LA 2QKIB 3V4PH 3UJJH 3RVUD 1CU4H 3RBSA 3BWAB 5JZ7D 3Q1SL 5HYFA 1ETZA 1P69B 3O6FA 3QQ3A 4UT7H 1OB1B 4HUWA 5C0IB 4U1NA 1QSZA 1UJ3A 5FO8B 1NCWL 4EEEA 4G7VL 3RVXD 4GXVL 4U2ZA 2VLKE 4G6ML 3T09A 4DGYL 1DUYA 2OL3B 3ELAT 1FL5B 2NQCA 3AREA 2O61B 5ALCH 2YA1A 1M1SA 3UDWC 4D9RE 4JFQA 5CSZB 3P9MB 5KANI 1OAXH 4C55A 3JZ7A 3ZTJG 1ND0A 1CK0L 5D7IB 1A3LH 3BP5B 1KPUB 5D7SH 5JW4Q 2XZCH 4UV7H 5SX5K 3BZFA 1HQRA 2D7TH 2DAVA 4IJ3C 1G9MH 2JIXD 4FQXD 3T08A 3OXSA 5I8EB 1IGFL 4H20L 1OVZA 3UTQA 1ES0A 2R2BA 3BAEH 3FFCA 5F88A 4QNPF 1ZA6A 4GLRI 3BKCL 3SDYL 4HUVB 2WBJD 4GAJL 4WVRA 4Y4HC 1NL0L 2AXFA 4N0UE 4M8VA 2EDWA 2BVPB 3S35H 4B0MM 4WUUE 2VIRB 4XPHH 1NEZB 4M62L 5HHQA 9CGTA 1XAUA 4LQFL 4Y2DD 3TZVD 1DQML 4Z7VF 4PJ7B 4OI9A 1Z9OA 4H26A 3REVB 3UZEA 1T04B 1RZ7H 3BHBB 4RSVA 4QRUB 3UTSA 1MFAL 3QIBB 1C5BH 3TYFB 5MEOA 1M7DA 2X10A 3HPLA 5I71B 4I2XB 4C56A 1P7QA 3UPRA 1JPSL 3VD5A 2NXZB 1CF8L 4F7EB 1OW0C 2Y5TB 4YHOH 2HG5B 1XGQA 3LRHA 2A38A 4C83A 3HE7D 3BH9A 3OXRB 4FFWD 5E00A 3MRQB 1NMCC 2GK0A 3TH4T 5JXAL 4OF3A 3VFRB 2E8YA 1XCTB 3KYOB 2BY1A 5ECJE 1KSRA 5EBLB 2WIMA 4HWEL 1UM5L 3AS0A 1FFRA 4NN6B 4Z7UB 2ILLA 3AS1A 5EIIB 1NGQH 2BMKB 4JKPH 1A4KB 1LE9A 5DTFA 2D9QB 3BDBA 4CW1A 1QBBA 1AXIB 1GGTA 4KJWD 5EOCH 1MLCA 3KPRA 1FLRL 4XNMA 4JEGB 4OCLC 2D4DA 3TVMB 4ISVA 2V17H 5DVKA 4E0RB 1YEIL 5DRWA 3CDFA 3D3VB 2VR9A 4QHMB 3P2TA 4HPYH 1I9IH 1C5DB 2IGFH 2VDOH 4JZNA 2CR6A 4YH6A 1ONQB 3VI3F 5DUPH 3T2QA 3QUMA 4JZJA 1S9KC 4PJFF 5HVFB 3BD4A 5IW6B 4ZFFB 3G5VA 4P9HL 2R29H 3MRGB 1KLGA 2Y06L 1W72A 4D8PA 3NIFE 4U1SA 1N6UA 1E27A 3MRCB 4LGPB 5D2NC 5GS1A 2QSQA 1JPFA 4TPRL 2QQNH 2J1KA 1HINH 2Z31A 2ED7A 3SGEI 2ZCLH 2ZNXA 5D2LB 4WHTA 4APQD 3BKML 3AXLB 5T33L 5GGTL 2YC1A 3V6ZA 2XKSA 1CE1H 1MY5A 4KKNA 3VFUB 3NH7L 5EIQA 4J4PA 2Z4QB 3W0WE 4OLWH 3HR6A 1AXTH 3FRPA 1S7TB 2B4CC 3QXAB 3E0GA 5IP4A 3MACL 4PJBE 4X7TA 3X14B 1M05B 4EOWH 4P59H 3D39D 3MJ8B 4PJ5E 4UAOC 1MRFL 4G8GD 3BMWA 1AFVL 3P9LB 4NJAL 2OSLB 3NCYP 3MA9L 2CLVB 3TN0A 3VGGA 5KS9A 3D25A 1VENA 1VFUA 5HJ3A 5M7QA 3QEQA 3DO3A 3P3YA 3E6HA 4N8CH 1UACH 1QRNE 1G7JA 4IOFC 4HSQA 5I16B 1L0YA 4MNQB 4FZEH 3RPIB 5B8CA 3LDBB 2VDQH 3HZKB 5EULV 3DV6B 4XT1C 1YYLH 2BVOA 1DBKH 4OM0H 4KK9D 4FFYL 2PKDA 1QBLL 3NABH 2J5LB 4LSQL 4QRPD 3RZCD 5FK9B 5KVFL 2FJHB 1TZIB 4XPGH 1MY7A 4TSAH 2NXYC 1CXFA 4LRNH 2DL9A 2GIYA 2CMRL 1PFCA 4UIMB 2AK1H 3MFGB 4O58L 5DQDL 3DXAD 5DMYA 3G9AB 4OQTA 5I2IB 1IC4L 1XF5A 3MRIA 3GKWL 4K3JH 4OGAD 4UT6H 1OLLA 3FN3A 2V5TA 1A6AA 4WIQA 1CDGA 4KH2A 5F9OL 2EKSB 5DRZA 1F5WA 1ZANL 2P8PB 2VDKH 4NC1E 5KSAD 5TDPA 4XPBL 1P4BL 1L0QA 2PXYA 3LKSA 3DURB 3NACL 1UB6B 3QRGH 2A9MH 5BS0E 4IOIB 4WV1B 3CVIH 3QI9D 1N5YH 5HHXL 4DJMA 2P5WE 5IW1A 4MX7B 5KVGL 1A64A 3MLSH 2J8UA 1U3HB 2A1WL 1H3WM 5E2UH 5HHPA 1PD6A 5EZIH 4EVNB 1F4WL 1I1FA 3BGFC 1CGSL 4BQCA 1QSED 4JHWH 4RMSA 4EJ1C 3RTQD 1IGYB 4JHAH 3Q5YA 1U91A 4LU5H 4BQ6A 1ZGLA 5FOJA 1O0VA 4L5FL 3GMRB 4Y5VC 3VWJC 1YEEL 2YD6A 4MA3B 3O2WH 4I48B 5D96C 2EDEA 3P4OB 3MO1A 1X44A 2NY5C 3MTRA 2JJSA 3AAZA 4GRLC 1XR8A 2PYFA 2ITDB 4LSRL 4G43B 4X8JA 4MHHI 1JNHA 4KI5D 1MNUL 4PV9B 1TLKA 2LU7A 2IAND 3B9KC 1UM6H 4R8WH 3RGVA 3I02A 3WXVL 1X9QA 2QR0B 4YHKH 3P0YH 4Z8FL 2YRPA 4O02H 1YMMA 1OAZH 4WW2B 1CDIA 2AQ1A 1EK3A 5ESAB 3UYRH 5DUML 3H9SB 1ZHLA 5HDOA 1I9JH 4BZ2L 1S3KL 5DZOA 2N7AA 2AEPL 4BSJA 1AD9B 4HIHA 3WNKA 1VFBB 1MI5D 1JF6A 5DDHB 1FAKT 5HHVL 4CADB 5AEAA 4LRIC 4Y5YC 1HKLL 2CSPA 4H5SB 2ICWI 5IWLC 5F93C 2CUMA 3O9WA 5D6CA 2YBRA 1K8DB 4PRHE 1WFOA 3QPXH 3PP4L 5DYOB 2VXUH 2XYCA 4J1UA 3WCYA 4M6OH 2I07A 2X89A 3SCMC 2GJ6B 2X1XR 4YO0A 3E8UL 4XAKD 1RURH 3I9GH 3L1OH 4EKXA 2IWGA 5CGYD 3RDTB 3MLYH 5J1AB 4X6BB 4R7DB 1RZIA 4FTVB 2HT2D 4U49A 1SM3L 3O11B 4DKEL 3TWCH 3X11A 3C2SA 4JFFB 1PKOA 3UJIL 4LLAA 2V2TB 2IH1A 2DS4A 3DBXA 3KDMA 3ARBD 5I15L 3C6SA 5E9DA 4JQXC 1FDLL 1RZKL 2NY2C 2ICWA 1MIMH 1TJHH 2N56A 3DUUA 1GZPB 1DEEB 4L9LA 2ZUSA 3MUY1 4HF5L 4ZUTA 5GZND 1RJLA 1IBGH 2BSSA 2KQMA 3AM8A 3WS6A 2VXSH 3SE8L 5B21A 3ORJA 2E7CA 1KFAL 2IADB 5C0NC 4XVUD 4NO2B 2R56L 2F74A 4LEXH 1G1YA 5D7IE 1D7FA 1G7PB 3G6DH 4NQCA 5IHUL 3IJSB 3BGMA 3DVFA 3MOAH 4F8TA 1JHTA 3QSKB 4ENED 1JN6B 4OV5B 1H15B 1RJCA 3K2UL 1WC7B 3G6AB 3BUYA 1P4LA 4WEBL 4P9MH 4XMLL 4XMPL 4U31A 4XHJC 4YHYC 2QL1A 4K8RD 1BBDH 4XPFL 2DWDB 4C57C 4CN6A 3MRHA 2DTSA 3DETC 1E0OB 1YNTB 4PBWD 1MCNA 2ZUTA 5DVNA 3OKYA 4RNRA 3EO0A 4C4KT 5FEBA 4D0BB 3QNXA 2ZJSL 3AC0A 1FBIL 3REWA 2HFGL 5L6YL 3QWOA 2OJZL 4HMEA 1U8MA 3DPBA 2NY6D 4M8QB 1N0LA 3OB8A 4GRMA 4PJ7E 1P7KA 2FIRT 3DX7A 3T3PE 3UTPE 1HYRC 3DRTA 3SEPA 3VE0A 4ALAL 2VKXA 2XXMB 4NHUB 2VL4A 1P53A 2ADGB 3KPOA 1S9XB 3H7BA 4IDJH 2YWZA 4DTGL 4I2XE 2CLRA 1OTUD 4WGWB 1OM3H 3SDCA 4M1DL 3DWTA 1TJIH 4M61A 4WHYG 3PNWB 5KW9H 3O2VL 1X5HA 1T21B 2XWJA 3TT1H 2Q7NA 3B4NA 4MXVF 2DJSA 5KVMC 2UUDK 5DJZB 5E8DL 2AV7A 4OLZH 3P9WB 5I1KL 5MEND 1ZK9A 1GPOH 1IM3A 5TGBB 1FCGA 3C5ZD 4UTAH 4RISL 1D5BB 2FBOJ 4Z7UE 5IHBA 4XBEL 1N6QL 5DJ2A 2NY1C 1UA6H 3F62A 4KZEL 3F7YB 1NGWA 4FQHB 1FC2D 4KKCD 4I18C 3BISA 3MUZ1 4NN7C 2MOVA 1TCMA 3D3VE 8FABB 5CD3A 3JV6B 5JOPD 2I9TB 4I9WE 1QLEL 4CGTA 5HVGB 3RIFF 3ZE1E 1ZE3C 3CFKA 3X12A 4KKAD 4Z78A 1K5NA 2HJKA 4PP2B 5IMKA 1TIUA 4CMMA 4WHCA 2V9TA 4DK6A 4M48H 3MLTA 3SGJA 2NY4D 4K23H 1J10A 3MRPA 3IDJB 5GS0D 4EBQL 1KUMA 5T3ZE 2A6DB 4U1LB 3WHXA 1SVZA 3DV4B 3NGBC 2HMIC 3FCTA 3ROLB 3HRZA 1NC4D 4J3WA 5D2LE 4KDTC 3DX6B 3PL6B 2QQKH 3KHOA 2CD0A 1NLBH 1A7BA 2HRPH 4H88L 4Z5RB 4IRZL 5DQ9B 5DT1H 2C3GA 4J6RL 4E41A 1MH5A 3O6FD 3Q6GL 4O9HL 5ACMA 2BOBA 3I2CH 4WEUD 5I1GL 3HI6L 3VFTB 3GSNA 4OZGF 5IB5A 1KLFA 2W1NA 2V5RA 3BDYL 1DVFC 1UXSB 2EYSA 5FYJL 4YHIA 5MERB 1DLFH 3I6GB 1G1CA 2J3SA 1V3LA 5ACZA 4OV6F 4GSDH 1JV5B 3MLUH 4HZLA 3QFDA 2ZCHH 1P9MC 1G7LA 1A6UH 2MMXA 5T1KD 1CDUA 4NSKB 1AC6A 3IKKA 1RPQA 1T2JA 4Y8DC 5DK0A 4MNQE 4Y4FA 1D9KC 3FQNB 5EWIL 4ZS6D 5GSRA 3SDAC 3QIUB 4X6CA 3GMMA 4X5WB 4HULB 1DLHB 2AV1A 4MJIA 4HKXB 3UC0L 3ZYZA 1I8LC 5IW3A 3P4NB 5B39G 2EDDA 3Q1SH 3BJLA 3MGTA 1I1AA 4X5LA 3GSXB 5CAYB 4OUUA 5DK3A 4S1SL 3L95A 5IOPB 1LK2A 2XNAA 1ZV5A 1NCWH 3KVQA 3T04D 1N0XL 4G7VH 1QLRB 5JO5A 1VFMA 3T1WA 1EDQA 4G6MH 4OCNC 4DGYH 3UTZA 2C26A 1CBVL 4NBXB 3DXAB 5GIRA 1UB5B 4QOKA 2NTFB 3OAUL 2CIKB 1DBAH 1F00I 3PDOA 5C7XL 5E4IA 1L7TL 1R3HB 1RUAL 4YWGH 4BK5A 3U0WL 1FFQA 3MRDA 5D5MF 2DLFL 35C8H 25C8L 1CK0H 5DZNA 1CE6B 5F1NB 1ZLUH 4XCFL 5KSAB 3DI3B 4EN3D 3FTGB 2VLRB 5D7IF 3A6CL 4QRQB 4KJYB 5F7WC 4GW4A 2X41A 5JXEA 2FX8L 4R0LA 4U6HB 3B9VA 1GOFA 5HYQA 1IGFH 1UKSA 4H20H 4DAGL 3QI9B 4GOSA 1X4ZA 5EA0H 4WU5B 2ESVA 3QDJD 4LP5A 3BKCH 3SDYH 3WN5B 1VKXB 3K81A 1KGCD 4GAJH 5T1LD 1NL0H 1NSNL 4U0QB 5DJ8B 5HGHB 4JM4L 4WI2A 3LSOB 1LP9A 4M62H 4CVUA 2H26A 4LQFH 5IFJA 4ZODA 1DQMH 4WI5A 4LDEB 2E7MA 4GW1B 2OMNA 4PYGA 2FZ3B 3MUHL 2DQEL 4PJGB 4F3FB 1MFAH 1EUUA 2AW2A 3QH3A 5DJ0A 3MNVB 5FF6A 2O93L 3OKEB 5D70L 5DA4A 4F7CB 1I7RB 4OZIA 3ME0A 4LCCA 1JPSH 1MHEA 2CO6B 2IANB 4CUCA 5C9JB 1CF8H 4H1LB 2DLHA 4JVWA 2VDPL 3CFJB 4GBXB 3SY0A 1CDBA 5JXAH 1GZQB 3ZDZF 1A7OL 2VAJA 1BREA 2WIIA 5IVZA 3SKNB 3H9SE 2X4UA 1OF2B 3C8KB 1UM5H 4RRPG 4HWEH 4QHUA 2PETA 3QUXC 4WW1B 4BSWB 2J6EL 1I1YB 2DQUL 4JJ5B 4M7LT 1CFNB 4V1DB 5CINL 5KVDL 4KK8C 3VXQA 3QEHA 3VH8A 3GDBA 5BZDA 5EU6B 3CLEH 1F11B 3RIFK 1PY9A 3UBXA 3VFMA 3VXSA 4XH2A 3N06B 1ED3B 3ARFA 1FLRH 4RBPH 2GJ6E 5FHAL 2C1OA 4HK3N 4GQPH 4KY1L 4XCYB 5BJTB 4J4PD 1YEIH 2DD8L 1FQ9C 4HGWB 3RVUC 1CICD 1UXWA 1MCBA 4KGJA 4Q97A 4FTVE 1BJ1J 3K74B 1ZHBA 4X6DB 5JZ7C 3SDXB 1FPTL 1Y6NR 4ZOEA 4K7PX 1KG0B 4JFFE 1N3NB 4UDUA 1KJMB 1UKQA 4I0KA 2Q8AL 1E4KA 3PWNB 4P9HH 2FYYB 2Y06H 5FM4A 3RVXC 3KLHD 3VWKA 2B2XL 4KTEL 3PJSA 4TPRH 3HLAA 1Z9SA 5F9WC 2GAZA 3MV8B 3WJLA 4WI7A 3WUZA 4DN4L 3BESR 4ZNEA 1BAFL 4ZMAT 3CC5A 1HH6B 3IS0X 1TZHA 5T33H 5GGTH 3SDDB 4OZFG 4U4BA 2EKJA 4NJ9L 3R06A 2PW2B 2B20A 5D2LF 5E08L 2CKBB 1HXYB 4O2FA 2Y7QB 2X1PA 4OCSL 1AO7B 1KT2A 3MRRB 4FQXC 1C7SA 3EYOB 1BMGA 2Z8VC 1DDHA 3MACH 1F2QA 3S35X 3GK8L 1OTTD 4O51A 4ZO7A 4HAGA 1MRFH 4G8IA 1AFVH 2ZKHL 3QHFL 2WBJC 4NJAH 4JPKL 2O5ZL 3MA9H 4BQ9A 1B0RB 3BEWA 2J12B 4YHML 2CDFB 1PSKL 2NY3B 4IMKC 2R69L 3QNZA 4Y2DC 3TZVC 4Z0XA 1J1PL 2VZTA 1QP1A 4XXCC 3SBWC 1YY8A 2XZZA 3V5DA 3R4DA 4WENB 3Q5TA 2PXYD 3RWDB 1HHGA 4LLMB 1HHHB 1KJ2L 4FFYH 3GSRA 1SEQL 4LSQH 5KVFH 2EDBA 2VLLB 4PRIB 3HE7C 5CIPH 4MCYB 4FFWC 1KIPB 3GSUA 2CMRH 2OP4H 2BK8A 4O58H 1MFEL 4H8WC 5E2TL 4EUPG 5DQDH 1RUPL 1YDPB 3CFIC 4TVPD 1IC4H 5EO1B 5HYIA 4N8VB 1U3JA 3GKWH 3V7AG 3KPSA 5INDB 5DSCB 3I6LD 4P2RB 5FUOL 5CEZL 4YDKL 5F9OH 1V8HA 3D85D 1ZANH 3BPLB 4I3GA 4XB7A 1K2DB 3KPMB 4XPBH 1P4BH 2R0LL 2AEQH 2R2EA 3A67L 3E1F1 4X6FA 5DZLA 3R8BB 4HUMB 1PZUB 4KJWC 3P11H 2V6HA 1KB9J 5IMLB 2VLMD 5FCUL 1J5OL 4QY8B 5HHXH 4HS6A 3VI4F 4MJ6B 1PX3A 1SJEA 4OZ4B 5KVGH 2DMBA 5I1AA 5LWYL 3VG9B 3IGAA 4PG9B 1YN6B 2P8LA 2AQ2A 1QQDA 1F4WH 4ZUUB 1CGSH 3PIQA 4L3CA 3O45B 1NGYB 4WRLA 2D7MA 1II4E 3C5SB 1F6AB 1DFBL 4L5FH 4W81A 2H3NB 1EAJA 1RIUL 3MCKB 1YEEH 3Q3GA 4WWID 4A2LA 4M5ZL 1YUHA 5GQBA 5DEZA 1YEJL 2QADD 1IKNC 4GG6E 4LCYB 2MQ3A 4LSRH 2X89D 4N1EA 4RDQF 1X5JA 2D4FA 1CD8A 2DYPA 3NTCL 4M6AA 3CDGA 3IFPB 1MNUH 5DJXB 2IMNA 4APQC 3D2UD 3AFLA 3K4ZA 4JDZA 1QUNA 3LQAC 3WXVH 4Z8FH 4QRSA 3HE6D 3TO2B 2CRMA 1KCRL 5MI0C 3BKYL 2X7LB 1FO0L 5DUMH 5EO0A 4R3SA 4HH9A 3DECA 1H0DA 2CH8A 1S3KH 4KAQL 4BZ2H 2AEPH 1ETZB 4HC1L 4IBLT 3O6FB 3QQ3B 5E9DD 4HUWB 4G9FA 1I3UA 4U1NB 3TBYA 4LL9A 1UJ3B 2YR3A 4Y16A 1HKLH 3ARDA 5DWUL 4LSTL 5ICXA 5J6GA 1N5AA 3DARA 3N50A 2FO4A 1DUYB 4G8GE 2DM3A 3AREB 4M6ML 5B38A 3PP4H 1MAKA 4JFQB 3E8UH 1U0QA 1WCQA 1ND0B 3PF2A 5SX4I 5T3XE 1PBYA 3BZFB 1HQRB 1SM3H 4DKEH 5EZJA 3RZCC 1J18A 2XTJD 1T0NA 3K2MC 3UJIH 4BFEA 4QO1A 3OXSB 4XGZA 4JKMA 5E6YA 4K9EL 3STLA 3UTQB 5FCSH 3CU1A 1ES0B 5I15H 2R2BB 1QLFA 1PX4A 3FFCB 5F88B 1ZA6B 1FDLH 1OGAA 1RZKH 2EH8L 3JV0A 4AENA 2AXFB 2VB5A 4OGAC 5CZXD 4PGCA 4HF5H 3JWOL 2EYRA 1M71A 3ES6A 3DXAE 3MV01 5HHQB 1J8HA 3CK0L 5IUSA 1X7QA 3SE8H 5KSAC 2EIZA 4YBLB 4H26B 3LOWA 2R0WH 2HVJA 4JRXA 5FOBA 1R3KA 2R56H 3UTSB 4PBVC 4J23A 4N90E 2LVEA 1JTTA 2NX5A 1W8NA 4XBGA 5IHUH 3T4AA 5MEPA 5MEOB 1M7DB 3HPLB 3QI9C 2MNUA 4C56B 2CRIA 4M4RA 1LO3L 2BZDA 1P7QB 3UPRB 4ZSOA 1AIFA 3GBML 3MRJA 3WN5C 1XGQB 4JAMA 4WEBH 1CXIA 3BH9B 4XMPH 5E00B 2YRZA 3ZKMD 2GK0B 2RFXA 4Y2OA 5ICZA 3WJJC 4NC0B 4XPFH 3RTQC 4BELD 3TCXA 1K4CA 4Y1AD 1F42A 3J8F7 4IS6A 2CO7B 2DJUA 1F4XH 5EU7E 1RV6X 1JIBA 4G3YL 2ZJSH 1FBIH 2HFGH 5A2IH 5L6YH 3VMOA 2OJZH 4NQDA 5IB4A 4NHCL 3RHWK 3HR5A 1LE9B 4KI5C 2EDQA 5DTFB 1DL7L 4ALAH 4CW1B 4PJGE 1MLCB 1BF2A 3KPRB 4XNMB 4DTGH 4QXUL 4ISVB 1NAKL 4KI5E 5DRWB 1DUZA 5FXCH 3S37L 2IANE 3PUCA 5CCKL 4QXWA 3S88L 4M1DH 1QYGL 2C4FT 1NKRA 3GJFH 4JZNB 5E2VL 3NIDE 3QUMB 4JZJB 3O2VH 1B2WL 2QBWA 2FLRT 4GFTB 5E8DH 4ELMA 3G5VB 5A16A 1KLGB 2VUYA 5I1KH 3EKCA 1W72B 4D8PB 4U1SB 1E27B 5HI5D 2IPKA 5GS1B 1PW3A 4RISH 1DSFL 5C6TH 1JPFB 5DC4B 1ZVHA 4MA1B 1SJHA 4V1DE 5C0AA 4F9LC 3M8OL 2Z31B 2EDHA 4XBEH 5EU6E 1N6QH 4X6EA 4G6FD 1KPRA 2RCSL 3LKQA 5CGYC 4WHTB 1MCJA 2HT2C 2YC1B 1BIHA 3V6ZB 4KZEH 1S5HA 4XAKE 3RRQA 4P4KA 4BFIA 4N0YL 1VPOL 2W0PA 1VDGA 2G75A 1S7QA 4H25A 3QIWA 1T5WA 1UVQA 3LEYL 4JFPA 1Q8MA 1V7ML 4X6DE 1FZOA 4X7TB 3ARBC 5BVPL 1YPZA 2MSPA 3LN5A 3AY4A 4OFYD 1F3RB 3DX9A 4FQIL 1E6JL 4C54A 3TN0B 5KS9B 5JHDA 3D25B 5LCVL 3QNYA 5HJ3B 2FECL 5GSVA 3GJEA 3QEQB 4GG6F 5GZNC 1RSFA 3E6HB 1FV1A 2EDYA 3V4UL 1G7JB 4EBQH 2K7PA 1KTKE 2ED9A 3S34L 5JOEA 2A6KA 3MV8E 1UGNA 4PJXA 3BQUD 4HT1L 4G5ZL 4FMFA 4Q6IA 4PRNA 5B8CB 3O2DL 4XVUC 2Y5EA 4XP6L 4OF6A 1AKJA 4NUJA 2BVOB 4AYFA 2AXJA 4H88H 4ENEC 1JGVL 4GMTH 2FJGA 4IRZH 1AO7E 4J6RH 1RI8A 2IC2A 3Q6GH 4O9HH 4JJHA 3PWJA 2LTQC 4MD4A 4LF3A 1L9NA 3HI6H 4LVHB 4K8RC 3BDYH 2BJML 5FYJH 1XF5B 4YHNA 3MRIB 5C3TA 1KYOK 2ED8A 1A6AB 2YPVL 4WFHD 5TE7L 5DRZB 4RGMC 5DHVH 1HHKA 5TJWK 5CJ5A 2CK0L 2NY6C 5TDPB 2VR4A 4OTXL 5EWIH 3VFNA 3V6OE 2PXYB 3LKSB 5L0QC 5GGSA 5JXED 3IDNA 2J2ZA 3DSNA 2EO9A 3UC0H 4OQ1A 4HLZH 3ARGA 4P2CG 1OTUC 2ESVD 3P0VL 5IW1B 3FB6A 3VA2C 2J8UB 5CEXA 3FQUA 3FZUD 4NKOA 4S1SH 5HHPB 2FHBA 4PRIE 2W91A 1VFAA 1I1FB 1ZT7A 1NMAL 3JUYA 4JFZL 5MHSD 3MGAA 1CBVH 1U91B 1NUGA 1ZGLB 2JCCA 4LPWA 3OAUH 5I73B 5E0QA 5C7XH 5IQ7L 3QG7L 1L7TH 3OAYH 1TTGA 3BIBX 2RIKA 1RUAH 4Z7WF 3U0WH 5F72S 3SJVA 1FYTD 2DLFH 2KH2B 2WBWB 3C5ZC 25C8H 3MO1B 3D9AL 3AAZB 2P45B 1XR8B 2PYFB 4XCFH 3UTTD 4Z6AT 3PQYD 3LAFA 4X8JB 2OI9B 1JNHB 3A6CH 5FGBA 5FO9A 1CIDA 3WIHL 3C60A 6CGTA 2ICWJ 5J89A 2FX8H 3RGVB 2ADIA 3I02B 1LO4H 5DMIL 4KKCC 3L3DA 3RZWA 2GQHA 4DAGH 1WJ3A 1YMMB 3VFOA 4O2EA 2Q1EA 3RWHA 2NTSP 5FIEA 3U9PL 3X3FL 2WP3T 2YD5A 1RZFL 1NDGA 4HQQH 2YD8A 4U6VL 1ZHLB 3WE6A 1NSNH 3VGAB 1R6VA 1JPTL 1R5IA 3SE9L 2BVTA 5DURD 1F3DJ 3MRKA 4JM4H 4KKAC 4HIHB 3TNMA 4OZHA 3DROA 2DQIH 1GGIL 3IETA 1M4KA 1IEHA 3O9WB 5D6CB 5GJSL 2YBRB 2NY4C 2QADB 3VXSD 2DQEH 5GS0C 3BUTA 3RWIA 4J1UB 2I07B 2OR9L 5D70H 1KTLA 4YO0B 1MFNA 4PY8I 1T4KA 2WWKO 4JGUA 4PJGF 3W11C 4P46A 5SWSA 3I50L 1HQ4A 2Y07L 1RZIB 3MV7A 2MCG1 4KI5F 1NANH 1MVUA 2VDPH 5C07D 3X11B 2QEJA 1Q0YL 3O6FC 1N7ML 1MCPL 2YPKA 1A7OH 2ADJA 3NIDF 1JBJA 1INEL 3U4BH 2IH1B 4ZG1A 4R6UA 1KLUA 3DBXB 3KDMB 1UG9A 3C6SB 3H3KA 1WIOA 2J6EH 5E9DB 4CBPA 2DQUH 4M43L 2ICWB 5JPMA 1OAKL 5CINH 5GGQL 5KVDH 1SEBA 3G9VA 3DUUB 4L9LB 4ZUTB 2E7LA 3UYOD 1RJLB 2BSSB 5DVLA 5C0EA 2W9EL 4WU7A 1NFDA 4HG4J 4MSWA 5FHAH 4KY1H 2D2OA 3PWPD 4PV8A 4KVCL 5ERWA 4HFUL 4N0FA 2GY5A 1QTYT 4ZS6C 2DD8H 3H8NA 2F74B 4PJCF 4Z7OE 1P7HL 4NQCB 5A2KH 4V2CB 2OCFD 3BGMB 5F7NC 1FPTH 4U6XA 1JHTB 4AIXA 1A9EA 5F6HJ 3BUYB 2Q8AH 1P4LB 3HG1D 2PR4L 2MFNA 3N1QC 5ALBL 4E9LA 4TNVF 1EVUA 1QNZL 3I6KA 3HUJA 2B2XH 1U8OA 4KTEH 4R2GB 5GGTA 3FFCE 3MRHB 4Q6YA 1WEJL 1BFVL 3LIZL 1ZAGA 4CVXA 1A3QA 4RNRB 4DN4H 3EO0B 1BAFH 2OZ4H 3QNXB 3DX8A 3REWB 4D9QD 3QWOB 1JNLL 4PLNC 1UWXH 1F8TL 1U8MB 4EN3C 2VWEE 5E08H 4GRMB 1P7KB 4OCSH 3DX7B 5BRZD 5IEHA 3DRTB 3VE0B 4IHOA 5KTEL 3WNLA 3GK8H 3KPOB 4ZO9A 3H7BB 2BY0A 2AK4A 2YHGA 4C56E 2CLRB 1DQLL 5E99L 4UINL 5IHLB 5JR1L 2ZKHH 5SWZD 3SDCB 3ULUD 4HPOL 1A7PL 2O5ZH 4JPKH 4M61B 5D71L 1UWEL 3KPSD 3U7AA 4YHMH 1PSKH 2XWJB 3L5JA 4PS4L 3P0GB 2LV4A 3TNNA 5JA8B 2P49B 2AV7B 2R9HD 2R23A 1J1PH 1IM3B 5D1QD 4CMHC 1NC2D 4U3CA 2YD7A 2YS4A 5FM5O 5CIPA 1HSBA 1VESA 4XNZB 2DQGH 3OQ3B 4P0DA 1R3LA 4U0RB 4KJQD 3HZVA 3T0EA 1KJ2H 1SEQH 2BCKA 5DJ2B 1NGWB 5JA9A 4HV8A 3KPRE 1AR2A 4JHBA 1BM3L 5D7JD 1RU9L 1MFEH 5E2TH 1RUPH 2X40A 1ZLWK 1MUJA 5CD3B 3T65A 3EAKA 1JYNA 1BHGA 4A6YL 1T5XA 3CFKB 3X12B 4EQ2A 5FUOH 5CEZH 2BNQA 4Z78B 1K5NB 2HJKB 1NEZG 4KMLB 4Y19A 5IMKB 2DOCA 4OGYL 2VJXA 2B4CL 4QHLA 4RFNC 1EBAA 4CMMB 1BQHA 5C2BH 2GSGA 3MLTB 1M7IA 5C0RL 2EECA 2R0LH 3C5JA 3A67H 4MXQD 3MRPB 5SX5H 3ULVH 1MFDL 5M95B 5MP6H 3ZHDA 3M17A 2WMPA 3WHXB 2RAMA 5FCUH 3FCTB 4J4PC 3HRZB 2H1PL 5GRYA 3EO1A 4N68A 1CICC 4LK4A 4U1KA 1KPVA 5SV4A 5C0BA 5GXBB 3NFNA 3WD5L 4E41B 1MH5B 2BOBB 4PGZA 1N59A 1RIUH 3KLHC 3GSNB 1OSPH 1AGBA 3ARVA 4YIQA 5IB5B 1YEJH 4PTTA 3WDHA 3JV4A 2EYSB 4YHIB 3TV3L 5ACZB 1RFDL 5KS9E 4TUOA 1OAUL 3NTCH 5F7UA 3QEQE 4JY6A 5B8CC 4HZLB 3QFDB 4D0CA 1T89A 1G7LB 4KROB 4U1GB 4X7FC 5DK0B 4Y4FB 1KCRH 1O7SA 1ZT4A 3BKYH 4DUVA 1FVDA 5D93B 3ZT6A 5GSRB 4X6CB 3GMMB 1FO0H 2AV1B 3NAAL 1YC8A 1OTTC 3QFJA 4MJIB 4CL7A 5CP7A 4KAQH 4NWUL 5IM7A 4IRSA 3KYAA 4HC1H 3MGTB 5FB8A 1I1AB 3BYTA 1HXMA 1FNAA 4OUUB 3L95B 5F7DA 1LK2B 2XNAB 4F7TA 1J7VR 2CUIA 5DWUH 3GBNL 4LSTH 5JO5B 1CLZL 3PDDA 3UTZB 1P2CA 3N1PC 4M6MH 5GIRB 3S5LA 4QOKB 3GGWA 5F96L 3PDOB 1LGVA 2ERJC 4WFFD 4TNVK 3MRDB 2BVUA 3WLBA 4BQBA 1LDPL 4LPXA 4TTDD 1CDHA 4GXUM 3GZKA 3L3GA 5EOCJ 2JELL 4GW4B 4R0LB 2Z91A 3T0AA 5HYQB 3HA0A 5D1ZA 5K33A 4K9EH 3UEZA 2NY5L 1UKTA 3B43A 2ESVB 4ODTL 5J8OA 2J8UE 2EH8H 2HFTA 5F6IB 3FB5A 2E7BA 1NCBL 2EH7L 2NY0D 1YEDA 4WWKA 3PP3K 1NH6A 5JDSA 4LPCA 4PGBA 3JWOH 3BPNC 3U83A 1LP9B 4J12A 4TVPE 5BW7C 2H26B 5IFJB 3BRDA 3MXVL 2FD6L 4Z95L 3WNNA 4QRRA 1KXVC 5DA0B 1QA9A 4G42A 2O5YH 1JPGA 3EYUL 4POZD 1F6LL 5FA4A 3QH3B 1QHPA 5DJ0B 3EOBA 2YEZA 1GRWA 5FF6B 1U42A 4AK1A 3EDKA 2VZSA 4OZIB 1LO3H 4LCCB 4XP4H 1T80A 1MHEB 1ZHNA 3GBMH 2V2WA 3MZTA 1ITCA 4XPAL 2FBJL 1YMME 2BSRA 3QCTH 5T5FH 3SY0B 3WIIL 2IMMA 1MLBA 1DBBL 2WIIB 4G9DA 5IVZB 2X4UB 1OLZA 4QHUB 5KOMC 5DURB 5F7KC 4G3YH 2QADC 3U7YH 4F33A 1T2QL 1YN7A 3SO3C 3U4AA 4NT6A 2ICES 4NHCH 1DP0A 3QEHB 3VXQB 3VH8B 5BZDB 4JREC 1ZLSL 1J87A 2FB4L 2HYMA 3MLZL 3UBXB 3BVNA 3VFMB 3VXSB 4YK4C 1DL7H 3K8KA 3GJFA 2D0FA 4XH2B 1SYVA 2HLAA 3IDXL 3SKJH 3ARZA 3ARFB 2OL3L 4FQCL 1XF3A 2IPUK 3HE6C 2X1OA 1JUFA 2C1OB 3GHBL 4F9PA 4QXUH 2QTEA 3DJ9A 2COQA 2AQ3A 3GIZL 5CCKH 4OI8A 1UXWB 2PYED 3S88H 1QYGH 4HK3J 1ZHBB 1A6WL 5E2VH 3J7HA 3T0VA 3JWDC 5GGUA 5TPWL 4JRYD 3NCYS 5JIPA 4ZPTA 2BXYA 1B2WH 3IU3A 4UDUB 1BFOA 5E03A 5D6DC 4LPUA 5DMKA 2C9AA 4FN0A 3VWKB 1U8PA 3PJSB 1KCUH 4RDQG 5E9DE 1DSFH 5LGKA 3RNKA 1HHIA 4RX4A 3HLAB 3AM8C 2GAZB 3WS6C 2ARJA 3M8OH 3I85A 4MA8L 1U95A 5A2LH 2RCSH 3CC5B 3OF6A 1B6UA 4JFDA 1TZHB 4PUBL 1AKJD 2X9WA 4XVSH 3QJHA 3R06B 5ETUA 4XX1E 2L4OA 4O2FB 1KT2B 2XTJC 4N0YH 4ZXBD 1VPOH 1BD2A 3WMSA 2BSED 2HWZL 2AGJL 3ARSA 1DDHB 4NQCE 2UY7A 3LEYH 2JB6A 1Q9KA 1V7MH 4O51B 5J13B 4RA0C 4G8IB 3A6OA 4FQIH 3FN0L 1E6JH 2L7JA 5CJ8A 4CU7A 5LCVH 4JE4B 5CZXC 4DN3L 3ARWA 3BEWB 3VXMA 2HH0L 3TC9A 5HDLA 3L9RA 5KS9F 3QNZB 3S34H 4Z0XB 1OP5H 4HT1H 4G5ZH 1GAFL 3V5DB 1YY8B 1CT8A 2GITA 1KELL 3O2DH 2WM0A 4IOSD 4X7EC 4XP6H 1FFPA 1HHGB 5HGDA 1DBJL 1A9BA 2GY7B 3CFDA 3GSRB 4FQJL 1JGVH 4HWBH 2VQUA 3GSQA 3S7GA 4LVOB 4LHJB 3TPUA 2OLDA 3T3MF 4DQOL 4LSUL 3ZKMC 3E3QC 3GSUB 4EDXA 5DHVA 5KAQG 5FYKL 2VDML 2BJMH 3SGKA 4HCRL 4I0PD 1GHFL 1JL8A 1QFHA 3KPSB 2DB8A 2YPVH 3BMVA 4Y1AE 3BWUC 3LV3A 3NFSL 4PJDA 5TE7H 2VZOA 2CK0H 2W92A 3U30C 3PGDA 4OTXH 3G5XA 4EIZC 1AJ7H 3I84A 2R2EB 4IMLA 4X6FB 4R4BA 5E1HB 3TT3L 3KGRA 4XP1H 4EZMA 4CKVX 3K8LA 4HS6B 3WIFA 2P43B 3AVEA 3P0VH 1SJEB 4JM2D 5I1AB 3PXHA 5I1CL 4MZ3A 1E6OH 3IGAB 2P8LB 1QQDB 5JMRA 4PLJD 1NMAH 3PIQB 4L3CB 4PJ9A 5CFHA 4JFZH 4X5XA 4U6YA 3R8QA 7FABL 4KHTL 5IQ7H 3QG7H 1FZMA 3Q3GB 1AXSA 5HI5C 3MODL 1LO2L 3SGJC 1YUHB 5I1LA 5KVEL 3C08L 1EO8L 4UOW0 5BOZG 3MJGX 1EBPA 4BFBD 5C6PB 2I9LA 1GGYA 2DYPB 1MFBL 3CDGB 3G08A 4XNQA 4BA8A 1CG9A 4JDZB 5DMIH 3ZZ1A 4BQ8A 3PV7A 3PWVA 4QRSB 1RZGA 1VEPA 3U9PH 3X3FH 2ATKA 1RZFH 2PTVA 5EH1A 4HJ0D 4U6VH 5CS7A 4AIZA 3WLWD 5EO0B 4R3SB 3DMMA 4HDIA 1JPTH 4HH9B 1H0DB 5LXGL 2XQYK 3QUZA 4F58L 1A6VL 4E41E 2KZ1B 4G9FB 3MZGB 3TBYB 4Y16B 3B6SA 1PAMA 1GGIH 2MPAL 3ARDB 1AH1A 3HKFA 5H94A 3JVGC 4N0RA 5ICXB 5J6GB 1N5AB 5GJSH 2FO4B 2Q76A 5CJOL 3VXRD 5B38B 5IBLD 3RWEA 3HMXL 3T77A 3IDMA 2OR9H 3BQUC 5J56B 5FGRA 3BKJL 4CDGC 4R90L 4GW5A 3U4EA 2Y07H 2YXFA 2J6EA 3CMOL 5EZJB 1LHZA 5DMJB 1Q0YH 3WFDL 1KCSL 1N7MH 1MCPH 1T0NB 2X70A 4X6CE 4XGZB 3MBXH 4MJIE 4ORGA 1QPXA 3STLB 2UUDH 1FCCA 4PRPA 5C0CD 1QLFB 4M1GL 2PO6D 1OGAB 4JCLA 4M43H 1Z3GL 3C6LA 4AENB 3MRMA 5GGQH 3OZ9H 1AGCA 4PGCB 1C5CL 4PJHF 5FYLD 2EYRB 1M71B 2X9XA 5I1DA 3ES6B 2W9EH 2D0GA 4QOKE 1J8HB 1U8HA 5DVOA 1X7QB 5GRVL 2EIZB 2AJXL 4MAYD 5HHMB 4KVCH 2NR6D 2HVJB 4HFUH 4JRXB 2VERN 3V7MA 1XR9A 5CSBA 5FOBB 2A2QT 1R3KB 4WFHE 5JXEC 5C8JA 3QWRD 3T4AB 2NX5B 4XBGB 5MEPB 5K9QG 5GZOD 3L3OA 4WCYL 4ZSOB 1AIFB 1MRCL 32C2A 3FZUC 3MRJB 4R7NA 4JAMB 2PR4H 5FGCE 1T3FA 5ALBH 4UILL 1QNZH 2W0KA 2RFXB 4PREA 2WNGA 5ICZB 2ADFL 2ESVE 4TQEL 1K4CB 3LQMA 3L5HA 1WEJH 1BFVH 3LIZH 4IS6B 1QSFD 2DQCL 1KCVL 4F80A 1TQCC 4N0CD 3CDYA 5E8NA 1JNLH 5ESQA 1LP9E 5JPNA 4NQDB 5CILL 1F8TH 5ICYA 4LLDA 5IB4B 5L8JB 3HR5B 4K94C 2AXGA 4B7IA 4TN9A 3WS3A 5KTEH 1K3ZA 1X6NA 1WGOA 4OZIE 2AJUL 5DD1L 3U2SA 1DQLH 1DUZB 5E99H 5JTWA 5ACLA 3O8XD 4UINH 3SE3A 5JR1H 1WT5A 4HPOH 1A7PH 4NZJA 3W82A 5D71H 1UWEH 3WHE1 1MCWM 5B3JF 4WUUD 4PS4H 3FOMA 2ZUQC 4XTRD 2VDNL 3FO2A 1KJ2A 2F53A 2BNQD 4NRZA 4UDTA 3W81A 3GUTA 4PJ8A 4ELMB 5A16B 1NBVL 1Q38A 3NCBB 3N1FC 3EZJB 4ERSL 4PRBA 2H8PA 2IPKB 2XZQL 5EZOL 1PQZA 2YSSA 1CGVA 4HBCL 4LHUA 1SJHB 5C0AB 4TULL 3LHPL 2NW2A 4W6XB 4X6EB 3ROOA 1KPRB 3LKQB 3LS5L 3VXSE 2EDTA 5JQ6L 4MD0A 1KV3A 4Y5XA 5I1EL 1S5HB 4P4KB 2BVEA 2IAMD 2SEBA 4BFIB 1BM3H 4O00A 1RU9H 2G75B 1S7QB 4H25B 3QIWB 1T5WB 5IVXA 5FUCE 4D3CL 1UVQB 4JFPB 3HI1A 1FZOB 4Q9BA 2F19H 1YPZB 4A6YH 4P57A 1ZA3A 3LN5B 1T7WA 1TVDA 3ZE2E 3DX9B 4XP5L 1A1NA 5JW4R 4OGYH 2B4CH 5JHDB 3QNYB 2DWEA 5GSVB 3GJEB 5C0RH 1FV1B 3RL1A 3QUYA 1MFDH 5D72L 2A6KB 1H3VA 4PG2C 4PJXB 5H8DA 1FNGA 3IFNL 4Q6IB 4PRNB 4ZNEE 4ZAKA 4BH7A 2PTUA 1AKJB 4NUJB 1MVFA 4H1LG 4KRMB 1GL4B 4HUKB 2UWEF 2Q8BL 2GT9A 1QO3A 1CVRA 2IQ9L 2FJGB 2GJZA 3RVVD 3VFPA 5CJXC 4HMCA 3WD5H 3D48R 1I1RA 1MCEA 3P77A 3PWJB 3NPZB 3QQ4A 4MD4B 3MLPA 1EMTL 1CS6A 2GUOA 4LF3B 1MJUH 2Z8RA 1JYWA 1PG7L 4L8DA 3I75A 5I66A 3NIGE 3HC0A 4ONHA 3BPCA 4YHNB 3TV3H 1RFDH 1OAUH 1CFSA 3F5WA 1OL0A 3R0MA 1MF2L 4V2BA 3TCLA 1JNJA 4P99A 1FO0A 4TTGA 3EO9H 3LKRA 1HHKB 4H8WL 1A47A 1NBYA 2R1WA 4HC1A 1EEUA 2XKNA 3W0WD 3VFNB 3VD3A 1CQKA 4HGMA 4D9QE 4WO4A 4LVOC 5GGSB 4OBRA 3IDNB 1T6WA 1CLYH 5HYJA 2P47B 5JIHA 3NAAH 4FXKA 2C4XA 1OWRM 4NWUH 5F7YC 3ARGB 4PJ5D 3FB6B 5CEXB 3ULUC 3FQUB 4NKOB 4HFWA 2YUWA 1VFAB 4GKOA 3GBNH 1ZT7B 4Z7NE 1CLZH 1QRND 3UZVB 1EO5A 2JCCB 2R9HC 4PJIF 5F96H 5D1QC 3KPSE 3SJVB 5DLML 4Q74A 1WIPA 2L7UA 3OKNA 3C87A 4KJQC 1VGEH 2VR5A 1LDPH 4K2UL 3C8HA 3E2HB 1B4JL 4XXDA 1H9VA 4UIKL 3VU2A 1AY1L 5FO9B 2JELH 3C60B 4QYOA 5FYJU 2ADIB 4KXZH 4Q9CA 4MLIA 3L3DB 3RWFA 3VFOB 4MNGA 4O2EB 5D7JC 3RWHB 3NCJH 4MAUL 3P73A 4AH2A 2B39A 1HEZA 1NDGB 2Z0BA 4NQXA 1WIUA 5ITFA 3S9DB 1T7VA 4PY8J 3BRFA 4LPTA 3L5XL 4LSVL 4HWZA 2EH7H 3WE6B 4NQEA 1R5IB 1EJOH 3LQAL 3WO4C 3MRKB 1U3ZA 1LK3H 4W70A 1F2XK 3S8WA 2DF3A 3TNMB 4OZHB 1J0YA 1SJXA 3MXVH 2BNRA 2FD6H 2XZAL 1Q9OA 3DROB 4Z95H 3IETB 1OP3K 2QV2A 2KKQA 1IZJA 4Q9QL 1YJDC 3EYUH 4MXQC 2FSEA 1A4JA 5BS0D 3DVIA 3RWIB 5HPOA 4HG4K 2LE9A 1J1XL 1KTLB 5KJRL 3RPKA 1T4KB 1OSZA 3O0RL 5E6IA 2P5WD 4P46B 5SWSB 1HQ4B 3MV7B 5K59E 4OCRL 3LKNA 3RA7L 4OF0A 1MVUB 1VADA 3MYZA 2FBJH 4QWWD 1D5ZA 3EOTH 3WIIH 3V6BR 1INDL 2YPKB 1OQOA 5TF1L 2ADJB 1DBBH 1YEHL 1ACYL 4L1DA 1KLUB 2A83A 4N8VG 1H5BA 3FFDA 2FDBP 4OSUH 2IPUG 3EOYG 1CYGA 5IHZA 1CCZA 1T2QH 5JPMB 4G9FE 1OP9A 3EYQD 4J3VA 3RY6C 1SEBB 4Q0XL 5EBMA 1ZLSH 3TO4D 2FB4H 3MLZH 4KRLB 5C0EB 1QHOA 4X9HA 3RX5A 3OF6D 3IDXH 4UBDD 3DGCR 1KC5L 1OAQL 4WU7B 1NFDB 4FNLL 4MSWB 1LQSR 1BVZA 3GHBH 4PV8B 5ERWB 3GMPA 1F97A 3HC3L 4N0FB 1TZGL 1UENA 4M93B 4O4YL 3W5MA 1BD2D 3GIZH 2X4SA 5DC0A 3CU7A 2FECI 4U6XB 5TPWH 3RWGA 5K9JL 4FABL 5LGHL 5DD6A 4PPTA 1A9EB 5HHOD 1AHWC 3I6KB 3HUJB 2EXYD 1U8JA 3T0DA 1U8OB 3MRFA 4Z7VA 1FNFA 4K3EL 1MOEA 1OGAE 2XFXA 4JVUA 1HCFX 3IDIA 2VH5L 4AMKL 5F3HA 4CVXB 2RR3A 2DLGA 3QDAA 4MA8H 3QDMA 4KDVA 5DJAA 3GRWL 2BERA 3DX8B 4PUBH 1BZ7A 4L8SA 1HNGA 2CIIA 4TTDC 4Y4KA 1CGWA 5HHME 4AZ8A 3RVWD 4I77L 4JRXE 5FYJD 5IEHB 2Q6WA 4EQ3A 2YWYA 4I3RH 1JHKL 4IHOB 2AGJH 4PY7A 1K3IA 3MLWL 5F7HA 4W4OA 4F57L 5I1IL 2AK4B 4WDIA 4HJGA 3BX7C 4M7ZC 3TA3A 4ZSOE 5EZLA 5CGTA 1WCBA 3FN0H 2NY0C 3O2DA 1HIML 5HYEA 4DK3A 4ESKA 5HGAA 2E7HA 3TNNB 2E5EA 4NQUA 3EHBD 2R23B 4HWBA 4DEPC 1GAFH 3EYVA 3ALXA 2V9RA 4K55A 2Z8WC 3TYGL 4POZC 5CIPB 3DVGA 1HSBB 1R3LB 4NQDE 1DBJH 3HZVB 3T0EB 2BCKB 2N7BA 5I6XC 1BJMA 4HJJH 2ZUUA 3QYCA 4PJFA 3ZT7A 4DQOH 3MUGA 3CSGA 4LSUH 4HV8B 3ZLQC 4LBEA 1PGRB 2G60L 2Y72A 4LGSB 1EXUA 5GHWL 5FYKH 2VDMH 4NQVA 3IJYA 1MUJB 1P84J 4HCRH 4XBPA 2DKMA 3T65B 3VDCA 1GHFH 4KUCD 2C7UA 5DFTA 3GI8L 1T5XB 1W0YT 5IR1A 4K3GA 3ULUF 1GGUA 5TDNA 4UNUA 2BNQB 3NFSH 2NYYD 4Y19B 4ELME 4QHLB 5KANG 5EU3A 1BQHB 2ORBH 1M7XA 2GSGB 3UTPD 5C0GA 5TQ2H 1M7IB 3RKPA 4IIQA 3LPGA 3C5JB 2XPGA 3OGCA 3TT3H 3QIBD 2R2CA 4LVNC 1IC1A 3M17B 4LLYA 1EERB 4RWHA 5EIVA 5C0AE 4YX2H 4XCNA 1QKZL 3ARQA 3MNZA 4QKXB 2XWBA 3EO1B 2NXZD 5I1CH 2YK1L 3O4LA 5IKCA 4U1KB 4LIQL 3BN9D 1KPVB 4NOBA 1CDYA 3ZKSD 1MWAL 5C0BB 3NFNB 1WISA 1IGCL 1OT2A 3NCMA 4AY0A 4JG0L 1W2KT 4RGNC 3PWUA 7FABH 4KHTH 1N59B 5DEFA 2BY3A 1N2RA 3MODH 3LRGA 1AGBB 1LO2H 1YPZE 4YIQB 3OBAA 3DOSA 5KVEH 4PTTB 3C08H 1EO8H 3JV4B 2D0HA 5SWQA 1HYSD 4D9LL 5BOPA 4YFEA 3VFWA 4TRPL 4TUOB 5JHDE 2XT1B 4HD9A 3ZO0A 1MFBH 4JY6B 5M94B 4D0CB 3EIFA 1EVTC 3G6JA 3PGCA 3MLRL 4K8RL 4FA8A 5EUKA 2XQYG 6FABL 3ZKXB 5IROC 3OMZA 1OHQA 4PJXE 3TVMD 1UWGL 4ZXBC 5KSVA 3HRPA 2DM2A 1ZT4B 1FVDB 5K59F 3D3VD 3TGXA 3HTLX 3D0VA 4JANA 3QFJB 3W9EA 4EXPX 4NRXA 3WV0A 5CP7B 3NFPA 3LRSA 3CUPA 5IM7B 4IRSB 5E70A 5LXGH 4PRPD 4IRJA 5FB8B 5HDBE 4XHQA 4F58H 1A6VH 1HXMB 3RUGF 3V2AR 5F7DB 4F7TB 2MPAH 1Z9LA 1U6AL 1E4WL 1N26A 5HVHB 4NPYA 2H6PA 1P2CB 3S5LB 5T3ZD 3GGWB 1C12A 3PABA 2ZG2A 3UDWA 2RBLA 3OSKA 5CBAA 3IJHA 5I8KL 3BKJH 4WTZA 4R90H 3WLBB 4G6JL 3JTSA 3CMOH 2WP3O 3WFDH 3L3GB 3MR9A 4AEEA 1MAJA 2BSTA 3FRPG 4UQ2A 3W2DL 2Z91B 5D1ZB 3BJ91 2CRZA 3O6KL 2B1HL 1X3DA 5F9JA 3EDJA 1J8KA 4M1GH 5EUOF 5DVMA 3TFKD 3JTTA 4LFHG 2DQFA 1IAMA 3FB5B 3K4DA 1Z3GH 4I0PC 1QZ1A 4Y4HA 5HSFA 4LCWA 1YEDB 4WWKB 1RHFA 5JDSB 1C5CH 4PGBB 2D03L 5ADPL 4HEME 2JCCE 4AM0A 4N5ED 3DO7A 3TJHD 4QRRB 4MNQD 5DXWA 4PFEA 1QA9B 4S1RL 4G42B 3SJVE 1WTLA 1JPGB 1NCNA 1IAIM 3LZFL 3IDYB 5FA4B 4FQ1H 2C3WA 3EOBB 2YEZB 1MCFA 4OF7A 4KK5C 1KCLA 1S5IH 4WCYH 4JM2C 1XGRA 1ZHNB 4HIJA 3S3JA 1TQBB 4NNYA 5GS0L 3PHOA 2V2WB 1CGXA 3KNBA 4PLJC 3MBEC 4UILH 4CRPA 5GS2D 2BSRB 2ADFH 3MCG1 5I0ZA 3D5OF 2Z9TA 4TQEH 4F2MA 2EYTA 2J8OA 4YPJA 1MLBB 1NEUA 5T1MA 4S0TD 4G9DB 2CXKA 2DM4A 5J57B 1IGML 4KUZL 2DQCH 1KCVH 4F33B 3ILQD 1YN7B 4C59B 4OZHE 5CILH 3OG6B 4GUPA 4NT6B 4Q2ZA 5A2FA 1OPGL 5CWSA 3BVNB 4F15B 4UV4H 3GJFB 3ZDXE 1SYVB 2HLAB 5ESVA 5L7XL 1XF4A 4AQ1B 1XF3B 1TPXB 1JUFB 3QG6A 3BZEA 1NUDA 2B8OT 3L7FA 2AJUH 1U9KA 2NPLX 4KKLD 5DD1H 5SWSE 4FQPA 4K71B 4M7LL 1U3HD 3UROR 4HJ0C 2YUXA 3WFBL 1G84A 3WLWC 3MV7E 5TH2A 4WJ5A 3T4YA 2EC9T 4RMQA 1B0WA 1SYSA 5GGUB 1K8IA 3ULVD 3BEVA 4ZPTB 1G9NH 3QCUL 3IU3B 4HKJA 4JFXA 2VDNH 3CX5J 4JGMA 4BZ1L 3MA7A 1BFOB 1A6PA 5DMKB 1NBVH 2XN9A 4YDLB 2NW3A 4RAVA 5J7CC 2OYPA 4ERSH 1U8PB 3INUL 3TBTA 2XZQH 5D2NA 3IAPA 5IBLC 5EZOH 3RNKB 1HHIB 3D1MC 4HBCH 4GG8A 4HW6A 2ARJB 2F8OA 5TE4L 4TULH 3LHPH 1U95B 1UCBL 1RMFL 3QZWA 3LS5H 4LOUD 4JFDB 1NCUA 2I60H 5JQ6H 3KPNA 4GAGH 5I1EH 4A6YA 3QJHB 5CZVL 1U8NA 5ETUB 1MRDL 2C3XA 3FQTA 1BLNA 1OAYL 2JJVA 1BD2B 1D5MA 1VA9A 4CJ1A 3Q0HA 4D3CH 5I9QB 3H9SD 2FCBA 2FL5A 2JB6B 1Q9KB 3H0TA 4WI8A 4LEOA 4ZPVA 3GSWA 2DN7A 2FGWL 2PO6C 2VOTA 3KXFA 2YKLL 3AB0C 4XP5H 3L3JA 3F6IA 1J0KA 3ALWA 3SE4C 2VSDA 3QDHA 3CMGA 3UCRA 4QXGL 3VXMB 4P3CL 5FO7A 3HUJE 1IC7L 1ZTXL 3MFFA 3L9RB 1J05A 4U6TA 5D72H 4XCCL 1NMBL 1ZT1A 2GJ6D 4M7JL 4MHHG 4MAYC 3IFNH 4XNYL 2VYRE 1SHMA 2NR6C 1CT8B 2GITB 2VXQL 3GSNH 4BSVA