1MPHA

Pleckstrin homology domain from mouse beta-spectrin, nmr, 50 structures
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
MEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGIPYHSEVPVSLKEAICEVALDYKKKKHVFKLRLSDGNEYLFQAKDDEEMNTWIQAISSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA SPECTRIN
publication title Automated NOESY interpretation with ambiguous distance restraints: the refined NMR solution structure of the pleckstrin homology domain from beta-spectrin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signal transduction
total genus 23
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1997-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mphA00
4KHBB 4A6FB 4GMVA 2I5CA 1MKEA 1W1GA 3QIJA 1EVHA 2Y7BA 4IOYX 1IRSA 1MIXA 4MK0A 2K2UA 1BWNA 2KCJA 2P0FA 1RJ2A 1U2BA 1GG3A 3AU4A 1EGXA 2D10A 2I1KA 4WVFB 1OQNA 2M14A 1V88A 4PQ0A 2ADZA 2EJ8A 2AEHA 4HB0B 1BAKA 4Z2NA 2L1CA 5JHGA 2JP2A 4D0NB 2N0YA 1XODA 3F5RA 1EAZA 5HE3A 5D27A 5DI9B 3CXBB 1WG7A 1AQCA 3FSSA 1LB1A 4K17A 4A6FA 3TFMA 2I5FA 5HE2A 3UZTA 4HAYB 2PZ1A 3PVWA 1WJMA 1XR0B 3PG7A 1V5MA 4NSWA 1V61A 4IAPA 1SHCA 1ZM0A 5C5BB 2EMSA 2P0HA 1QC6A 2E2XA 5CLQB 1Y5OA 5KQ4A 3TCAA 1XX0A 4ZRKA 1DDMA 3D8DA 2K00A 1U5DA 4CYEA 2V76A 1UNQA 3TO1A 1DDVA 1FGZA 1J0WA 1RRPB 1W1DA 2QKLA 3VOQA 1U27A 3PZDA 2NZ8B 1FOEA 1UPQA 2DTCA 4BBKA 1NTVA 1WI1A 1M7RA 1EF1A 1U5EA 5D3WA 2BCJA 4HAXB 4GPTB 2IFSA 4Z2MB 1NTYA 1X05A 3V5WA 1UNRA 1ZSQA 1BTNA 5C5BA 3IVFA 5JHHA 3PVUA 4NY0A 2H7EA 2DHIA 2DX1A 4MT7A 4XWXA 2LULA 4A6HA 5C79A 4EMOA 2NMBA 2FJLA 2RLOA 3ZDTA 3U7DA 3P6AA 4F7GA 2RNRB 3AJ4A 1P6SA 2DYQA 2D4QA 2YS1A 1DROA 2M38A 3D8FA 5CLLB 2VKIA 4GN1A 1NI2A 2GCLA 1FGYA 3MDBC 2VSZA 1B55A 2YRYA 3AU5A 3KZ1A 2W2XD 3OANA 3TW1A 5C6RA 2R0DA 1TXDA 1OMWA 4HATB 3M1IB 2YSZA 3T06A 2I1JA 2G35A 2IYBA 1LW3A 1KZGA 1PFJA 1MPHA 2W2XC 5J3QA 1UNPA 2RGNB 1Y19B 5HE1A 2P0DA 2Y8FA 1GC7A 1TJ6A 3BINA 2LOXA 4MY6A 4YONA 3F0WA 3A8QA 2GJYA 1Q67A 4HB2B 4HDOA 4KHOA 4KVGB 4GXBA 3PSCA 2YVCA 2W2WA 2CRFA 4EJNA 1AWEA 1FHWA 2DX5A 1XD4A 3KY9A 2EC1A 1I2HA 3KRXA 3TVVA 2OTXA 3HK0A 1K5GB 1DYNA 4HAWB 2CY4A 2ROZB 2H7DA 1X1GA 2LKOA 4H8SA 4EKUA 1V89A 2OQBA 4DBBA 2HE7A 3ZVRA 3U8ZA 1TQZA 3WA0A 3FM8C 3MPXA 2GS0A 2KUPA 5J3TA 1H10A 5LOPB 4F7UP 2QKMA 3BJIA 3DXEA 5C16A 3DXDA 3DXCA 1V5UA 2ELBA 1SGHA 2MFQA 3ODXA 3SYXA 2AL6A 2Z0PA 2COCA 4YL8A 3PVLA 3PP2A 2D11A 1U5GA 4A5KA 2YT1A 4KHAA 4GMXB 3GYOA 2DKPA 4TKNA 3LJUX 1DBHA 4WSFA 4K2PA 3KSYA 2K2JA 5DHFB 1N3HA 1X1FA 2YT0A 3QWMA 3WYFB 1M7EA 4HAZB 1OY2A 4HDQA 1WGUA 2J0MA 5DHAB 4L6EA 5EFXA 3FEHA 1K5DB 2Z0OA 2LG1A 2DHKA 4K2OA 1MIZB 1WJ1A 5KCVA 2L2IA 2DN6A 2D9XA 1X11A 2CAYA 3X23A 3ODWA 4CHJA 2DKQA 3QBVB 2X18A 1U29A 2Y8GA 3PEGA 2DLWA 5HE0A 4DXAB 2XQNM 5DH9B 4ZRJA 2DYNA 4A6KA 1NU2A 3GYPA 2KGXB 5LONB 4F7HA 1E5WA 4HAUB 1PMSA 1BTKA 1I7AA 2VRWB 3A98B 1J19A 1GC6A 2ZPYA 2Z0QA 2COFA 5JP4A 2ROVA 1MK7B 2P8VA 3ULCA 2DFKA 4WJ7A 4PNKA 1XCGA 2HTHB 5FI0A 2DHJA 2YS3A 3O96A 1FB8A 3RCPA 2UVMA 3CIKA 5DIFB 1FHXA 2CODA 2RUKB 1MK9B 4HB3B 3HQCA 1H4RA 4IFSA 3VIAA 2UZSA 3N7CA 4DX8A 3NSUA 3SO6A 1W1HA 2J0KA 2R09A 1WVHA 3ODOA 1QQGA 2EMTA 5GOWB 3P7ZA 2MWNB 2D9ZA 2MKRA 5D3VA 1ZVRA 1DDWA 1V5PA 5KQ1A 2ELAA 2D2QA 4HB4B 1P3RA 1UPRA 1FAOA 2RVBB 2LYDA 2DA0A 4Y94A 5J3YA 2Q13A 3A8PA 1KI1B 2COAA 2N23A 2YF0A 4TYZA 2LOZA 4KAXB 1KZ7A 2J0JA 3G9WA 2D9YA 4HAVB 1WGQA 3SNHA 1U5FA 5JLJB 3D8EA 4P7IA 1MAIA 1ZC4B 2YS5A 3KRWA 2RSGA 1FHOA 2D9WA 1UEFA 4HHVA 2MDXA 3ML4A 3HW2B 4B6HA 5D3YA 4K81A 1X86A 1ISNA 5L81A 4CHMA 5FI1A 1Z87A 1XKEA 1ZC3B 3ULBA 4DX90 2D9VA 2CY5A 3SUZA 1P5TA 2UZRA 5D3XA 3SV1A 2J59M 4C0AA 1PLSA 4GZUA 2GCJA 4ZRIA
chains in the Genus database with same CATH superfamily
4KHBB 4A6FB 4GMVA 2I5CA 1MKEA 1W1GA 3QIJA 1EVHA 2Y7BA 4IOYX 1IRSA 1MIXA 4MK0A 2K2UA 1BWNA 2KCJA 2P0FA 1RJ2A 1U2BA 1GG3A 3AU4A 1EGXA 2D10A 5I2SA 2I1KA 4WVFB 1OQNA 2M14A 1V88A 4PQ0A 2ADZA 2EJ8A 2AEHA 4HB0B 1BAKA 4Z2NA 2L1CA 5JHGA 2JP2A 4D0NB 2N0YA 1XODA 3F5RA 1EAZA 5HE3A 5D27A 5DI9B 3CXBB 1WG7A 1AQCA 3FSSA 1LB1A 4K17A 4A6FA 3TFMA 2I5FA 5HE2A 3UZTA 4HAYB 2PZ1A 3PVWA 3NW8A 1WJMA 1XR0B 3PG7A 1V5MA 4NSWA 1V61A 4IAPA 1SHCA 1ZM0A 5C5BB 2EMSA 2P0HA 1QC6A 2E2XA 5CLQB 1Y5OA 5KQ4A 3TCAA 1XX0A 4ZRKA 1DDMA 3D8DA 2K00A 1U5DA 2KIGA 4CYEA 2V76A 1UNQA 3TO1A 1DDVA 1FGZA 1J0WA 1RRPB 1W1DA 2QKLA 3VOQA 1U27A 3PZDA 2NZ8B 1FOEA 1UPQA 1ZYIA 2DTCA 4BBKA 1NTVA 1WI1A 1M7RA 1EF1A 1U5EA 5D3WA 2BCJA 4HAXB 4GPTB 2IFSA 4Z2MB 1NTYA 1X05A 3V5WA 1UNRA 1ZSQA 3FVCA 1BTNA 5C5BA 3IVFA 5JHHA 3PVUA 4NY0A 2H7EA 2DHIA 2DX1A 4MT7A 4XWXA 2LULA 4A6HA 5C79A 4EMOA 2NMBA 2FJLA 4HSIA 2RLOA 4GOUA 3ZDTA 3U7DA 3P6AA 4F7GA 2RNRB 3AJ4A 1P6SA 2Z59A 2DYQA 2D4QA 2YS1A 2ZKMX 1DROA 2M38A 3D8FA 5CLLB 4DIXA 2VKIA 4GN1A 1NI2A 2GCLA 1FGYA 3MDBC 2VSZA 1B55A 2YRYA 3AU5A 3KZ1A 2W2XD 3OANA 3TW1A 5C6RA 2R0DA 1TXDA 1OMWA 4HATB 3M1IB 2YSZA 3T06A 2I1JA 2G35A 2IYBA 1LW3A 1KZGA 1PFJA 4L1RA 1MPHA 2W2XC 5J3QA 1UNPA 2RGNB 1Y19B 5HE1A 2P0DA 2Y8FA 1GC7A 1TJ6A 3BINA 2LOXA 4MY6A 4YONA 3F0WA 4QJ5B 3A8QA 2GJYA 1Q67A 4HB2B 4HDOA 4KHOA 4KVGB 4GXBA 3PSCA 2FJUB 2W2WA 2YVCA 2CRFA 4EJNA 1AWEA 1FHWA 2DX5A 1XD4A 3KY9A 2EC1A 5M4YB 1I2HA 3DCXA 3KRXA 3TVVA 2OTXA 3HK0A 3HIEA 1K5GB 1DYNA 4HAWB 2CY4A 2ROZB 2H7DA 1X1GA 2R2YA 2LKOA 4H8SA 4EKUA 2Z4DA 1V89A 2OQBA 4DBBA 2HE7A 3ZVRA 3U8ZA 1TQZA 3WA0A 3FM8C 3MPXA 2GS0A 2KUPA 5J3TA 1H10A 5LOPB 4F7UP 2QKMA 3BJIA 3OHMB 2K8EA 3DXEA 5C16A 3DXDA 3DXCA 2YT2A 1V5UA 2ELBA 1SGHA 2MFQA 3ODXA 3SYXA 2AL6A 2Z0PA 2COCA 4YL8A 3PVLA 3PP2A 2D11A 1U5GA 4A5KA 2YT1A 4KHAA 4GMXB 3GYOA 2DKPA 4TKNA 3LJUX 1DBHA 4WSFA 4K2PA 2KIEA 3KSYA 2K2JA 5DHFB 1N3HA 1X1FA 2YT0A 3QWMA 4QJ3B 3WYFB 1M7EA 2KUQA 1OY2A 4HAZB 4HDQA 1WGUA 2GUMA 2J0MA 4L6EA 5DHAB 5EFXA 3FEHA 1K5DB 2Z0OA 2LG1A 2DHKA 4K2OA 1MIZB 1WJ1A 5KCVA 2L2IA 2DN6A 2D9XA 1X11A 2CAYA 3X23A 3ODWA 4CHJA 2DKQA 3QBVB 2X18A 1U29A 2Y8GA 2DLWA 3PEGA 5HE0A 4DXAB 3U12A 2XQNM 5DH9B 4ZRJA 5I2MA 2DYNA 4A6KA 1NU2A 1MI1A 3GYPA 2KGXB 5LONB 4OSNA 4F7HA 4CSQA 1E5WA 2Z14A 4HAUB 3A58A 1PMSA 1BTKA 1I7AA 2VRWB 3A98B 1J19A 1GC6A 2ZPYA 2Z0QA 2COFA 5JP4A 2ROVA 2NBVA 1MK7B 2P8VA 2Z13A 3ULCA 1T77A 2DFKA 4WJ7A 4PNKA 2K49A 1XCGA 2HTHB 3HSAA 5FI0A 2DHJA 2YS3A 3O96A 1FB8A 3RCPA 4KHBA 2UVMA 3CIKA 5DIFB 1FHXA 2CODA 2RUKB 1MK9B 4D6WA 4HB3B 3HQCA 1H4RA 4IFSA 3VIAA 2UZSA 3N7CA 4DX8A 3NSUA 3SO6A 1W1HA 2J0KA 2R09A 1WVHA 2KR0A 3ODOA 1QQGA 2EMTA 5GOWB 3P7ZA 2MWNB 2D9ZA 2MKRA 5D3VA 1ZVRA 1DDWA 1V5PA 5KQ1A 2ELAA 3NWDA 2D2QA 4HB4B 1P3RA 1UPRA 4QXAB 1FAOA 2RVBB 2LYDA 2DA0A 3NWAA 4Y94A 5J3YA 2Q13A 3A8PA 1KI1B 2COAA 2N23A 2YF0A 4TYZA 2LOZA 4KAXB 1KZ7A 4OT1A 2J0JA 3G9WA 4QJ4B 2D9YA 4HAVB 1WGQA 3SNHA 1U5FA 5JLJB 3D8EA 4P7IA 1MAIA 1ZC4B 2YS5A 3KRWA 2RSGA 1FHOA 2D9WA 1UEFA 4HHVA 2MDXA 3ML4A 3HW2B 4B6HA 5D3YA 4K81A 1X86A 1ISNA 5L81A 4CHMA 5FI1A 1Z87A 1XKEA 1ZC3B 3ULBA 4DX90 5IRSA 2D9VA 2CY5A 3SUZA 1P5TA 3NWFA 2UZRA 5D3XA 3B77A 3SV1A 2J59M 4C0AA 1PLSA 4GNKB 2RRFA 4GZUA 2GCJA 5LG4B 4ZRIA
chains in the Genus database with same CATH topology
4KHBB 4A6FB 4GMVA 2I5CA 1MKEA 1W1GA 3QIJA 1EVHA 2Y7BA 4IOYX 1IRSA 1MIXA 4MK0A 2K2UA 1BWNA 2KCJA 2P0FA 1RJ2A 1U2BA 1GG3A 3AU4A 1EGXA 2D10A 2I1KA 4WVFB 1OQNA 2M14A 1V88A 4PQ0A 2ADZA 2EJ8A 2AEHA 4HB0B 1BAKA 4Z2NA 2L1CA 5JHGA 2JP2A 4D0NB 2N0YA 1XODA 3F5RA 1EAZA 5HE3A 5D27A 5DI9B 3CXBB 1WG7A 1AQCA 3FSSA 1LB1A 4K17A 4A6FA 3TFMA 2I5FA 5HE2A 3UZTA 4HAYB 2PZ1A 3PVWA 1WJMA 1XR0B 3PG7A 1V5MA 4NSWA 1V61A 4IAPA 1SHCA 1ZM0A 5C5BB 2EMSA 2P0HA 1QC6A 2E2XA 5CLQB 1Y5OA 5KQ4A 3TCAA 1XX0A 4ZRKA 1DDMA 3D8DA 2K00A 1U5DA 4CYEA 2V76A 1UNQA 3TO1A 1DDVA 1FGZA 1J0WA 1RRPB 1W1DA 2QKLA 3VOQA 1U27A 3PZDA 2NZ8B 1FOEA 1UPQA 2DTCA 4BBKA 1NTVA 1WI1A 1M7RA 1EF1A 1U5EA 5D3WA 2BCJA 4HAXB 4GPTB 2IFSA 4Z2MB 1NTYA 1X05A 3V5WA 1UNRA 1ZSQA 1BTNA 5C5BA 3IVFA 5JHHA 3PVUA 4NY0A 2H7EA 2DHIA 2DX1A 4MT7A 4XWXA 2LULA 4A6HA 5C79A 4EMOA 2NMBA 2FJLA 2RLOA 3ZDTA 3U7DA 3P6AA 4F7GA 2RNRB 3AJ4A 1P6SA 2DYQA 2D4QA 2YS1A 1DROA 2M38A 3D8FA 5CLLB 2VKIA 4GN1A 1NI2A 2GCLA 1FGYA 3MDBC 2VSZA 1B55A 2YRYA 3AU5A 3KZ1A 2W2XD 3OANA 3TW1A 5C6RA 2R0DA 1TXDA 1OMWA 4HATB 3M1IB 2YSZA 3T06A 2I1JA 2G35A 2IYBA 1LW3A 1KZGA 1PFJA 1MPHA 2W2XC 5J3QA 1UNPA 2RGNB 1Y19B 5HE1A 2P0DA 2Y8FA 1GC7A 1TJ6A 3BINA 2LOXA 4MY6A 4YONA 3F0WA 3A8QA 2GJYA 1Q67A 4HB2B 4HDOA 4KHOA 4KVGB 4GXBA 3PSCA 2YVCA 2W2WA 2CRFA 4EJNA 1AWEA 1FHWA 2DX5A 1XD4A 3KY9A 2EC1A 1I2HA 3KRXA 3TVVA 2OTXA 3HK0A 1K5GB 1DYNA 4HAWB 2CY4A 2ROZB 2H7DA 1X1GA 2LKOA 4H8SA 4EKUA 1V89A 2OQBA 4DBBA 2HE7A 3ZVRA 3U8ZA 1TQZA 3WA0A 3FM8C 3MPXA 2GS0A 2KUPA 5J3TA 1H10A 5LOPB 4F7UP 2QKMA 3BJIA 3DXEA 5C16A 3DXDA 3DXCA 1V5UA 2ELBA 1SGHA 2MFQA 3ODXA 3SYXA 2AL6A 2Z0PA 2COCA 4YL8A 3PVLA 3PP2A 2D11A 1U5GA 4A5KA 2YT1A 4KHAA 4GMXB 3GYOA 2DKPA 4TKNA 3LJUX 1DBHA 4WSFA 4K2PA 3KSYA 2K2JA 5DHFB 1N3HA 1X1FA 2YT0A 3QWMA 3WYFB 1M7EA 4HAZB 1OY2A 4HDQA 1WGUA 2J0MA 5DHAB 4L6EA 5EFXA 3FEHA 1K5DB 2Z0OA 2LG1A 2DHKA 4K2OA 1MIZB 1WJ1A 5KCVA 2L2IA 2DN6A 2D9XA 1X11A 2CAYA 3X23A 3ODWA 4CHJA 2DKQA 3QBVB 2X18A 1U29A 2Y8GA 3PEGA 2DLWA 5HE0A 4DXAB 2XQNM 5DH9B 4ZRJA 2DYNA 4A6KA 1NU2A 3GYPA 2KGXB 5LONB 4F7HA 1E5WA 4HAUB 1PMSA 1BTKA 1I7AA 2VRWB 3A98B 1J19A 1GC6A 2ZPYA 2Z0QA 2COFA 5JP4A 2ROVA 1MK7B 2P8VA 3ULCA 2DFKA 4WJ7A 4PNKA 1XCGA 2HTHB 5FI0A 2DHJA 2YS3A 3O96A 1FB8A 3RCPA 2UVMA 3CIKA 5DIFB 1FHXA 2CODA 2RUKB 1MK9B 4HB3B 3HQCA 1H4RA 4IFSA 3VIAA 2UZSA 3N7CA 4DX8A 3NSUA 3SO6A 1W1HA 2J0KA 2R09A 1WVHA 3ODOA 1QQGA 2EMTA 5GOWB 3P7ZA 2MWNB 2D9ZA 2MKRA 5D3VA 1ZVRA 1DDWA 1V5PA 5KQ1A 2ELAA 2D2QA 4HB4B 1P3RA 1UPRA 1FAOA 2RVBB 2LYDA 2DA0A 4Y94A 5J3YA 2Q13A 3A8PA 1KI1B 2COAA 2N23A 2YF0A 4TYZA 2LOZA 4KAXB 1KZ7A 2J0JA 3G9WA 2D9YA 4HAVB 1WGQA 3SNHA 1U5FA 5JLJB 3D8EA 4P7IA 1MAIA 1ZC4B 2YS5A 3KRWA 2RSGA 1FHOA 2D9WA 1UEFA 4HHVA 2MDXA 3ML4A 3HW2B 4B6HA 5D3YA 4K81A 1X86A 1ISNA 5L81A 4CHMA 5FI1A 1Z87A 1XKEA 1ZC3B 3ULBA 4DX90 2D9VA 2CY5A 3SUZA 1P5TA 2UZRA 5D3XA 3SV1A 2J59M 4C0AA 1PLSA 4GZUA 2GCJA 4ZRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHB B;  4A6F B;  4GMV A;  2I5C A;  1MKE A;  1W1G A;  3QIJ A;  1EVH A;  2Y7B A;  4IOY X;  1IRS A;  1MIX A;  4MK0 A;  2K2U A;  1BWN A;  2KCJ A;  2P0F A;  1RJ2 A;  1U2B A;  1GG3 A;  3AU4 A;  1EGX A;  2D10 A;  2I1K A;  4WVF B;  1OQN A;  2M14 A;  1V88 A;  4PQ0 A;  2ADZ A;  2EJ8 A;  2AEH A;  4HB0 B;  1BAK A;  4Z2N A;  2L1C A;  5JHG A;  2JP2 A;  4D0N B;  2N0Y A;  1XOD A;  3F5R A;  1EAZ A;  5HE3 A;  5D27 A;  5DI9 B;  3CXB B;  1WG7 A;  1AQC A;  3FSS A;  1LB1 A;  4K17 A;  4A6F A;  3TFM A;  2I5F A;  5HE2 A;  3UZT A;  4HAY B;  2PZ1 A;  3PVW A;  1WJM A;  1XR0 B;  3PG7 A;  1V5M A;  4NSW A;  1V61 A;  4IAP A;  1SHC A;  1ZM0 A;  5C5B B;  2EMS A;  2P0H A;  1QC6 A;  2E2X A;  5CLQ B;  1Y5O A;  5KQ4 A;  3TCA A;  1XX0 A;  4ZRK A;  1DDM A;  3D8D A;  2K00 A;  1U5D A;  4CYE A;  2V76 A;  1UNQ A;  3TO1 A;  1DDV A;  1FGZ A;  1J0W A;  1RRP B;  1W1D A;  2QKL A;  3VOQ A;  1U27 A;  3PZD A;  2NZ8 B;  1FOE A;  1UPQ A;  2DTC A;  4BBK A;  1NTV A;  1WI1 A;  1M7R A;  1EF1 A;  1U5E A;  5D3W A;  2BCJ A;  4HAX B;  4GPT B;  2IFS A;  4Z2M B;  1NTY A;  1X05 A;  3V5W A;  1UNR A;  1ZSQ A;  1BTN A;  5C5B A;  3IVF A;  5JHH A;  3PVU A;  4NY0 A;  2H7E A;  2DHI A;  2DX1 A;  4MT7 A;  4XWX A;  2LUL A;  4A6H A;  5C79 A;  4EMO A;  2NMB A;  2FJL A;  2RLO A;  3ZDT A;  3U7D A;  3P6A A;  4F7G A;  2RNR B;  3AJ4 A;  1P6S A;  2DYQ A;  2D4Q A;  2YS1 A;  1DRO A;  2M38 A;  3D8F A;  5CLL B;  2VKI A;  4GN1 A;  1NI2 A;  2GCL A;  1FGY A;  3MDB C;  2VSZ A;  1B55 A;  2YRY A;  3AU5 A;  3KZ1 A;  2W2X D;  3OAN A;  3TW1 A;  5C6R A;  2R0D A;  1TXD A;  1OMW A;  4HAT B;  3M1I B;  2YSZ A;  3T06 A;  2I1J A;  2G35 A;  2IYB A;  1LW3 A;  1KZG A;  1PFJ A;  1MPH A;  2W2X C;  5J3Q A;  1UNP A;  2RGN B;  1Y19 B;  5HE1 A;  2P0D A;  2Y8F A;  1GC7 A;  1TJ6 A;  3BIN A;  2LOX A;  4MY6 A;  4YON A;  3F0W A;  3A8Q A;  2GJY A;  1Q67 A;  4HB2 B;  4HDO A;  4KHO A;  4KVG B;  4GXB A;  3PSC A;  2YVC A;  2W2W A;  2CRF A;  4EJN A;  1AWE A;  1FHW A;  2DX5 A;  1XD4 A;  3KY9 A;  2EC1 A;  1I2H A;  3KRX A;  3TVV A;  2OTX A;  3HK0 A;  1K5G B;  1DYN A;  4HAW B;  2CY4 A;  2ROZ B;  2H7D A;  1X1G A;  2LKO A;  4H8S A;  4EKU A;  1V89 A;  2OQB A;  4DBB A;  2HE7 A;  3ZVR A;  3U8Z A;  1TQZ A;  3WA0 A;  3FM8 C;  3MPX A;  2GS0 A;  2KUP A;  5J3T A;  1H10 A;  5LOP B;  4F7U P;  2QKM A;  3BJI A;  3DXE A;  5C16 A;  3DXD A;  3DXC A;  1V5U A;  2ELB A;  1SGH A;  2MFQ A;  3ODX A;  3SYX A;  2AL6 A;  2Z0P A;  2COC A;  4YL8 A;  3PVL A;  3PP2 A;  2D11 A;  1U5G A;  4A5K A;  2YT1 A;  4KHA A;  4GMX B;  3GYO A;  2DKP A;  4TKN A;  3LJU X;  1DBH A;  4WSF A;  4K2P A;  3KSY A;  2K2J A;  5DHF B;  1N3H A;  1X1F A;  2YT0 A;  3QWM A;  3WYF B;  1M7E A;  4HAZ B;  1OY2 A;  4HDQ A;  1WGU A;  2J0M A;  5DHA B;  4L6E A;  5EFX A;  3FEH A;  1K5D B;  2Z0O A;  2LG1 A;  2DHK A;  4K2O A;  1MIZ B;  1WJ1 A;  5KCV A;  2L2I A;  2DN6 A;  2D9X A;  1X11 A;  2CAY A;  3X23 A;  3ODW A;  4CHJ A;  2DKQ A;  3QBV B;  2X18 A;  1U29 A;  2Y8G A;  3PEG A;  2DLW A;  5HE0 A;  4DXA B;  2XQN M;  5DH9 B;  4ZRJ A;  2DYN A;  4A6K A;  1NU2 A;  3GYP A;  2KGX B;  5LON B;  4F7H A;  1E5W A;  4HAU B;  1PMS A;  1BTK A;  1I7A A;  2VRW B;  3A98 B;  1J19 A;  1GC6 A;  2ZPY A;  2Z0Q A;  2COF A;  5JP4 A;  2ROV A;  1MK7 B;  2P8V A;  3ULC A;  2DFK A;  4WJ7 A;  4PNK A;  1XCG A;  2HTH B;  5FI0 A;  2DHJ A;  2YS3 A;  3O96 A;  1FB8 A;  3RCP A;  2UVM A;  3CIK A;  5DIF B;  1FHX A;  2COD A;  2RUK B;  1MK9 B;  4HB3 B;  3HQC A;  1H4R A;  4IFS A;  3VIA A;  2UZS A;  3N7C A;  4DX8 A;  3NSU A;  3SO6 A;  1W1H A;  2J0K A;  2R09 A;  1WVH A;  3ODO A;  1QQG A;  2EMT A;  5GOW B;  3P7Z A;  2MWN B;  2D9Z A;  2MKR A;  5D3V A;  1ZVR A;  1DDW A;  1V5P A;  5KQ1 A;  2ELA A;  2D2Q A;  4HB4 B;  1P3R A;  1UPR A;  1FAO A;  2RVB B;  2LYD A;  2DA0 A;  4Y94 A;  5J3Y A;  2Q13 A;  3A8P A;  1KI1 B;  2COA A;  2N23 A;  2YF0 A;  4TYZ A;  2LOZ A;  4KAX B;  1KZ7 A;  2J0J A;  3G9W A;  2D9Y A;  4HAV B;  1WGQ A;  3SNH A;  1U5F A;  5JLJ B;  3D8E A;  4P7I A;  1MAI A;  1ZC4 B;  2YS5 A;  3KRW A;  2RSG A;  1FHO A;  2D9W A;  1UEF A;  4HHV A;  2MDX A;  3ML4 A;  3HW2 B;  4B6H A;  5D3Y A;  4K81 A;  1X86 A;  1ISN A;  5L81 A;  4CHM A;  5FI1 A;  1Z87 A;  1XKE A;  1ZC3 B;  3ULB A;  4DX9 0;  2D9V A;  2CY5 A;  3SUZ A;  1P5T A;  2UZR A;  5D3X A;  3SV1 A;  2J59 M;  4C0A A;  1PLS A;  4GZU A;  2GCJ A;  4ZRI A; 
#chains in the Genus database with same CATH topology
 4KHB B;  4A6F B;  4GMV A;  2I5C A;  1MKE A;  1W1G A;  3QIJ A;  1EVH A;  2Y7B A;  4IOY X;  1IRS A;  1MIX A;  4MK0 A;  2K2U A;  1BWN A;  2KCJ A;  2P0F A;  1RJ2 A;  1U2B A;  1GG3 A;  3AU4 A;  1EGX A;  2D10 A;  5I2S A;  2I1K A;  4WVF B;  1OQN A;  2M14 A;  1V88 A;  4PQ0 A;  2ADZ A;  2EJ8 A;  2AEH A;  4HB0 B;  1BAK A;  4Z2N A;  2L1C A;  5JHG A;  2JP2 A;  4D0N B;  2N0Y A;  1XOD A;  3F5R A;  1EAZ A;  5HE3 A;  5D27 A;  5DI9 B;  3CXB B;  1WG7 A;  1AQC A;  3FSS A;  1LB1 A;  4K17 A;  4A6F A;  3TFM A;  2I5F A;  5HE2 A;  3UZT A;  4HAY B;  2PZ1 A;  3PVW A;  3NW8 A;  1WJM A;  1XR0 B;  3PG7 A;  1V5M A;  4NSW A;  1V61 A;  4IAP A;  1SHC A;  1ZM0 A;  5C5B B;  2EMS A;  2P0H A;  1QC6 A;  2E2X A;  5CLQ B;  1Y5O A;  5KQ4 A;  3TCA A;  1XX0 A;  4ZRK A;  1DDM A;  3D8D A;  2K00 A;  1U5D A;  2KIG A;  4CYE A;  2V76 A;  1UNQ A;  3TO1 A;  1DDV A;  1FGZ A;  1J0W A;  1RRP B;  1W1D A;  2QKL A;  3VOQ A;  1U27 A;  3PZD A;  2NZ8 B;  1FOE A;  1UPQ A;  1ZYI A;  2DTC A;  4BBK A;  1NTV A;  1WI1 A;  1M7R A;  1EF1 A;  1U5E A;  5D3W A;  2BCJ A;  4HAX B;  4GPT B;  2IFS A;  4Z2M B;  1NTY A;  1X05 A;  3V5W A;  1UNR A;  1ZSQ A;  3FVC A;  1BTN A;  5C5B A;  3IVF A;  5JHH A;  3PVU A;  4NY0 A;  2H7E A;  2DHI A;  2DX1 A;  4MT7 A;  4XWX A;  2LUL A;  4A6H A;  5C79 A;  4EMO A;  2NMB A;  2FJL A;  4HSI A;  2RLO A;  4GOU A;  3ZDT A;  3U7D A;  3P6A A;  4F7G A;  2RNR B;  3AJ4 A;  1P6S A;  2Z59 A;  2DYQ A;  2D4Q A;  2YS1 A;  2ZKM X;  1DRO A;  2M38 A;  3D8F A;  5CLL B;  4DIX A;  2VKI A;  4GN1 A;  1NI2 A;  2GCL A;  1FGY A;  3MDB C;  2VSZ A;  1B55 A;  2YRY A;  3AU5 A;  3KZ1 A;  2W2X D;  3OAN A;  3TW1 A;  5C6R A;  2R0D A;  1TXD A;  1OMW A;  4HAT B;  3M1I B;  2YSZ A;  3T06 A;  2I1J A;  2G35 A;  2IYB A;  1LW3 A;  1KZG A;  1PFJ A;  4L1R A;  1MPH A;  2W2X C;  5J3Q A;  1UNP A;  2RGN B;  1Y19 B;  5HE1 A;  2P0D A;  2Y8F A;  1GC7 A;  1TJ6 A;  3BIN A;  2LOX A;  4MY6 A;  4YON A;  3F0W A;  4QJ5 B;  3A8Q A;  2GJY A;  1Q67 A;  4HB2 B;  4HDO A;  4KHO A;  4KVG B;  4GXB A;  3PSC A;  2FJU B;  2W2W A;  2YVC A;  2CRF A;  4EJN A;  1AWE A;  1FHW A;  2DX5 A;  1XD4 A;  3KY9 A;  2EC1 A;  5M4Y B;  1I2H A;  3DCX A;  3KRX A;  3TVV A;  2OTX A;  3HK0 A;  3HIE A;  1K5G B;  1DYN A;  4HAW B;  2CY4 A;  2ROZ B;  2H7D A;  1X1G A;  2R2Y A;  2LKO A;  4H8S A;  4EKU A;  2Z4D A;  1V89 A;  2OQB A;  4DBB A;  2HE7 A;  3ZVR A;  3U8Z A;  1TQZ A;  3WA0 A;  3FM8 C;  3MPX A;  2GS0 A;  2KUP A;  5J3T A;  1H10 A;  5LOP B;  4F7U P;  2QKM A;  3BJI A;  3OHM B;  2K8E A;  3DXE A;  5C16 A;  3DXD A;  3DXC A;  2YT2 A;  1V5U A;  2ELB A;  1SGH A;  2MFQ A;  3ODX A;  3SYX A;  2AL6 A;  2Z0P A;  2COC A;  4YL8 A;  3PVL A;  3PP2 A;  2D11 A;  1U5G A;  4A5K A;  2YT1 A;  4KHA A;  4GMX B;  3GYO A;  2DKP A;  4TKN A;  3LJU X;  1DBH A;  4WSF A;  4K2P A;  2KIE A;  3KSY A;  2K2J A;  5DHF B;  1N3H A;  1X1F A;  2YT0 A;  3QWM A;  4QJ3 B;  3WYF B;  1M7E A;  2KUQ A;  1OY2 A;  4HAZ B;  4HDQ A;  1WGU A;  2GUM A;  2J0M A;  4L6E A;  5DHA B;  5EFX A;  3FEH A;  1K5D B;  2Z0O A;  2LG1 A;  2DHK A;  4K2O A;  1MIZ B;  1WJ1 A;  5KCV A;  2L2I A;  2DN6 A;  2D9X A;  1X11 A;  2CAY A;  3X23 A;  3ODW A;  4CHJ A;  2DKQ A;  3QBV B;  2X18 A;  1U29 A;  2Y8G A;  2DLW A;  3PEG A;  5HE0 A;  4DXA B;  3U12 A;  2XQN M;  5DH9 B;  4ZRJ A;  5I2M A;  2DYN A;  4A6K A;  1NU2 A;  1MI1 A;  3GYP A;  2KGX B;  5LON B;  4OSN A;  4F7H A;  4CSQ A;  1E5W A;  2Z14 A;  4HAU B;  3A58 A;  1PMS A;  1BTK A;  1I7A A;  2VRW B;  3A98 B;  1J19 A;  1GC6 A;  2ZPY A;  2Z0Q A;  2COF A;  5JP4 A;  2ROV A;  2NBV A;  1MK7 B;  2P8V A;  2Z13 A;  3ULC A;  1T77 A;  2DFK A;  4WJ7 A;  4PNK A;  2K49 A;  1XCG A;  2HTH B;  3HSA A;  5FI0 A;  2DHJ A;  2YS3 A;  3O96 A;  1FB8 A;  3RCP A;  4KHB A;  2UVM A;  3CIK A;  5DIF B;  1FHX A;  2COD A;  2RUK B;  1MK9 B;  4D6W A;  4HB3 B;  3HQC A;  1H4R A;  4IFS A;  3VIA A;  2UZS A;  3N7C A;  4DX8 A;  3NSU A;  3SO6 A;  1W1H A;  2J0K A;  2R09 A;  1WVH A;  2KR0 A;  3ODO A;  1QQG A;  2EMT A;  5GOW B;  3P7Z A;  2MWN B;  2D9Z A;  2MKR A;  5D3V A;  1ZVR A;  1DDW A;  1V5P A;  5KQ1 A;  2ELA A;  3NWD A;  2D2Q A;  4HB4 B;  1P3R A;  1UPR A;  4QXA B;  1FAO A;  2RVB B;  2LYD A;  2DA0 A;  3NWA A;  4Y94 A;  5J3Y A;  2Q13 A;  3A8P A;  1KI1 B;  2COA A;  2N23 A;  2YF0 A;  4TYZ A;  2LOZ A;  4KAX B;  1KZ7 A;  4OT1 A;  2J0J A;  3G9W A;  4QJ4 B;  2D9Y A;  4HAV B;  1WGQ A;  3SNH A;  1U5F A;  5JLJ B;  3D8E A;  4P7I A;  1MAI A;  1ZC4 B;  2YS5 A;  3KRW A;  2RSG A;  1FHO A;  2D9W A;  1UEF A;  4HHV A;  2MDX A;  3ML4 A;  3HW2 B;  4B6H A;  5D3Y A;  4K81 A;  1X86 A;  1ISN A;  5L81 A;  4CHM A;  5FI1 A;  1Z87 A;  1XKE A;  1ZC3 B;  3ULB A;  4DX9 0;  5IRS A;  2D9V A;  2CY5 A;  3SUZ A;  1P5T A;  3NWF A;  2UZR A;  5D3X A;  3B77 A;  3SV1 A;  2J59 M;  4C0A A;  1PLS A;  4GNK B;  2RRF A;  4GZU A;  2GCJ A;  5LG4 B;  4ZRI A; 
#chains in the Genus database with same CATH homology
 4KHB B;  4A6F B;  4GMV A;  2I5C A;  1MKE A;  1W1G A;  3QIJ A;  1EVH A;  2Y7B A;  4IOY X;  1IRS A;  1MIX A;  4MK0 A;  2K2U A;  1BWN A;  2KCJ A;  2P0F A;  1RJ2 A;  1U2B A;  1GG3 A;  3AU4 A;  1EGX A;  2D10 A;  2I1K A;  4WVF B;  1OQN A;  2M14 A;  1V88 A;  4PQ0 A;  2ADZ A;  2EJ8 A;  2AEH A;  4HB0 B;  1BAK A;  4Z2N A;  2L1C A;  5JHG A;  2JP2 A;  4D0N B;  2N0Y A;  1XOD A;  3F5R A;  1EAZ A;  5HE3 A;  5D27 A;  5DI9 B;  3CXB B;  1WG7 A;  1AQC A;  3FSS A;  1LB1 A;  4K17 A;  4A6F A;  3TFM A;  2I5F A;  5HE2 A;  3UZT A;  4HAY B;  2PZ1 A;  3PVW A;  1WJM A;  1XR0 B;  3PG7 A;  1V5M A;  4NSW A;  1V61 A;  4IAP A;  1SHC A;  1ZM0 A;  5C5B B;  2EMS A;  2P0H A;  1QC6 A;  2E2X A;  5CLQ B;  1Y5O A;  5KQ4 A;  3TCA A;  1XX0 A;  4ZRK A;  1DDM A;  3D8D A;  2K00 A;  1U5D A;  4CYE A;  2V76 A;  1UNQ A;  3TO1 A;  1DDV A;  1FGZ A;  1J0W A;  1RRP B;  1W1D A;  2QKL A;  3VOQ A;  1U27 A;  3PZD A;  2NZ8 B;  1FOE A;  1UPQ A;  2DTC A;  4BBK A;  1NTV A;  1WI1 A;  1M7R A;  1EF1 A;  1U5E A;  5D3W A;  2BCJ A;  4HAX B;  4GPT B;  2IFS A;  4Z2M B;  1NTY A;  1X05 A;  3V5W A;  1UNR A;  1ZSQ A;  1BTN A;  5C5B A;  3IVF A;  5JHH A;  3PVU A;  4NY0 A;  2H7E A;  2DHI A;  2DX1 A;  4MT7 A;  4XWX A;  2LUL A;  4A6H A;  5C79 A;  4EMO A;  2NMB A;  2FJL A;  2RLO A;  3ZDT A;  3U7D A;  3P6A A;  4F7G A;  2RNR B;  3AJ4 A;  1P6S A;  2DYQ A;  2D4Q A;  2YS1 A;  1DRO A;  2M38 A;  3D8F A;  5CLL B;  2VKI A;  4GN1 A;  1NI2 A;  2GCL A;  1FGY A;  3MDB C;  2VSZ A;  1B55 A;  2YRY A;  3AU5 A;  3KZ1 A;  2W2X D;  3OAN A;  3TW1 A;  5C6R A;  2R0D A;  1TXD A;  1OMW A;  4HAT B;  3M1I B;  2YSZ A;  3T06 A;  2I1J A;  2G35 A;  2IYB A;  1LW3 A;  1KZG A;  1PFJ A;  1MPH A;  2W2X C;  5J3Q A;  1UNP A;  2RGN B;  1Y19 B;  5HE1 A;  2P0D A;  2Y8F A;  1GC7 A;  1TJ6 A;  3BIN A;  2LOX A;  4MY6 A;  4YON A;  3F0W A;  3A8Q A;  2GJY A;  1Q67 A;  4HB2 B;  4HDO A;  4KHO A;  4KVG B;  4GXB A;  3PSC A;  2YVC A;  2W2W A;  2CRF A;  4EJN A;  1AWE A;  1FHW A;  2DX5 A;  1XD4 A;  3KY9 A;  2EC1 A;  1I2H A;  3KRX A;  3TVV A;  2OTX A;  3HK0 A;  1K5G B;  1DYN A;  4HAW B;  2CY4 A;  2ROZ B;  2H7D A;  1X1G A;  2LKO A;  4H8S A;  4EKU A;  1V89 A;  2OQB A;  4DBB A;  2HE7 A;  3ZVR A;  3U8Z A;  1TQZ A;  3WA0 A;  3FM8 C;  3MPX A;  2GS0 A;  2KUP A;  5J3T A;  1H10 A;  5LOP B;  4F7U P;  2QKM A;  3BJI A;  3DXE A;  5C16 A;  3DXD A;  3DXC A;  1V5U A;  2ELB A;  1SGH A;  2MFQ A;  3ODX A;  3SYX A;  2AL6 A;  2Z0P A;  2COC A;  4YL8 A;  3PVL A;  3PP2 A;  2D11 A;  1U5G A;  4A5K A;  2YT1 A;  4KHA A;  4GMX B;  3GYO A;  2DKP A;  4TKN A;  3LJU X;  1DBH A;  4WSF A;  4K2P A;  3KSY A;  2K2J A;  5DHF B;  1N3H A;  1X1F A;  2YT0 A;  3QWM A;  3WYF B;  1M7E A;  4HAZ B;  1OY2 A;  4HDQ A;  1WGU A;  2J0M A;  5DHA B;  4L6E A;  5EFX A;  3FEH A;  1K5D B;  2Z0O A;  2LG1 A;  2DHK A;  4K2O A;  1MIZ B;  1WJ1 A;  5KCV A;  2L2I A;  2DN6 A;  2D9X A;  1X11 A;  2CAY A;  3X23 A;  3ODW A;  4CHJ A;  2DKQ A;  3QBV B;  2X18 A;  1U29 A;  2Y8G A;  3PEG A;  2DLW A;  5HE0 A;  4DXA B;  2XQN M;  5DH9 B;  4ZRJ A;  2DYN A;  4A6K A;  1NU2 A;  3GYP A;  2KGX B;  5LON B;  4F7H A;  1E5W A;  4HAU B;  1PMS A;  1BTK A;  1I7A A;  2VRW B;  3A98 B;  1J19 A;  1GC6 A;  2ZPY A;  2Z0Q A;  2COF A;  5JP4 A;  2ROV A;  1MK7 B;  2P8V A;  3ULC A;  2DFK A;  4WJ7 A;  4PNK A;  1XCG A;  2HTH B;  5FI0 A;  2DHJ A;  2YS3 A;  3O96 A;  1FB8 A;  3RCP A;  2UVM A;  3CIK A;  5DIF B;  1FHX A;  2COD A;  2RUK B;  1MK9 B;  4HB3 B;  3HQC A;  1H4R A;  4IFS A;  3VIA A;  2UZS A;  3N7C A;  4DX8 A;  3NSU A;  3SO6 A;  1W1H A;  2J0K A;  2R09 A;  1WVH A;  3ODO A;  1QQG A;  2EMT A;  5GOW B;  3P7Z A;  2MWN B;  2D9Z A;  2MKR A;  5D3V A;  1ZVR A;  1DDW A;  1V5P A;  5KQ1 A;  2ELA A;  2D2Q A;  4HB4 B;  1P3R A;  1UPR A;  1FAO A;  2RVB B;  2LYD A;  2DA0 A;  4Y94 A;  5J3Y A;  2Q13 A;  3A8P A;  1KI1 B;  2COA A;  2N23 A;  2YF0 A;  4TYZ A;  2LOZ A;  4KAX B;  1KZ7 A;  2J0J A;  3G9W A;  2D9Y A;  4HAV B;  1WGQ A;  3SNH A;  1U5F A;  5JLJ B;  3D8E A;  4P7I A;  1MAI A;  1ZC4 B;  2YS5 A;  3KRW A;  2RSG A;  1FHO A;  2D9W A;  1UEF A;  4HHV A;  2MDX A;  3ML4 A;  3HW2 B;  4B6H A;  5D3Y A;  4K81 A;  1X86 A;  1ISN A;  5L81 A;  4CHM A;  5FI1 A;  1Z87 A;  1XKE A;  1ZC3 B;  3ULB A;  4DX9 0;  2D9V A;  2CY5 A;  3SUZ A;  1P5T A;  2UZR A;  5D3X A;  3SV1 A;  2J59 M;  4C0A A;  1PLS A;  4GZU A;  2GCJ A;  4ZRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...