1MPHA

Pleckstrin homology domain from mouse beta-spectrin, nmr, 50 structures
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
MEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGIPYHSEVPVSLKEAICEVALDYKKKKHVFKLRLSDGNEYLFQAKDDEEMNTWIQAISSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Automated NOESY interpretation with ambiguous distance restraints: the refined NMR solution structure of the pleckstrin homology domain from beta-spectrin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signal transduction
molecule keywords BETA SPECTRIN
total genus 23
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1997-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mphA00
1PLSA 2IYBA 2ELAA 1EVHA 1BWNA 1M7EA 1MAIA 4CYEA 5LOPB 2DHJA 1J0WA 1BAKA 1XKEA 1GC6A 1Z87A 5LONB 1QC6A 2W2WA 3ODWA 1N3HA 2Z0OA 3WYFB 1V88A 5D27A 1FGYA 2AL6A 3AU5A 3ULBA 1NI2A 2IFSA 5J3QA 2RUKB 3F0WA 2M14A 2ELBA 4KHOA 2YT1A 5CLQB 1XCGA 2PZ1A 3QIJA 3NSUA 2RSGA 3ULCA 2L1CA 3VIAA 1UNQA 3KZ1A 2COAA 5KQ4A 2ZPYA 1FHWA 2J0JA 3RCPA 2MFQA 1U5EA 2J0KA 4NSWA 2KGXB 2J0MA 5CLLB 1WVHA 1UNRA 2Z0PA 5D3VA 1GG3A 4CHJA 2CY4A 1LW3A 4HB4B 1ISNA 2FJLA 2Q13A 4KAXB 1IRSA 2OQBA 4A6FB 1NTVA 4HAVB 1FHXA 2DX5A 1KI1B 1LB1A 4A6HA 3BINA 4DBBA 2DLWA 2CODA 5L81A 1FGZA 1Q67A 1DBHA 2OTXA 4D0NB 4A5KA 1TXDA 1GC7A 1I7AA 2LOZA 4K2OA 4HHVA 2UVMA 4HAUB 2K2JA 4GMXB 1V61A 3WA0A 4F7HA 1UPQA 4EJNA 2CAYA 2DKPA 1Y19B 1E5WA 2RLOA 2X18A 2EMSA 2W2XC 2P0HA 2DKQA 2YS5A 1QQGA 5JHHA 1AWEA 2N23A 4GXBA 2MKRA 1NU2A 2N0YA 5DH9B 1XD4A 3SO6A 1B55A 1DDWA 4Z2NA 1XX0A 1XR0B 3HK0A 3LJUX 1PFJA 1OY2A 3VOQA 4EKUA 3ZDTA 2LULA 3PZDA 5HE2A 3AU4A 5FI0A 3BJIA 2DYQA 3PVLA 1U5FA 3ML4A 2L2IA 2I1KA 1TQZA 2DHIA 2NMBA 4HATB 2JP2A 1X1GA 5HE1A 3D8EA 2HTHB 2DFKA 5D3YA 1V5UA 3X23A 2Y8FA 2DHKA 1ZC3B 1P6SA 2H7DA 3MDBC 4B6HA 1FB8A 5EFXA 1ZVRA 3O96A 4A6KA 1BTKA 5D3XA 4CHMA 1W1DA 3D8DA 3IVFA 1OMWA 1SGHA 3FM8C 1U29A 2CY5A 3KY9A 2I1JA 5C5BB 1RJ2A 3KRXA 4YONA 5GOWB 2DYNA 4YL8A 4TKNA 1TJ6A 1MIZB 2LG1A 3QBVB 3KRWA 3DXCA 2KUPA 3DXDA 2I5FA 1WJ1A 2RNRB 1DROA 2EC1A 3PVWA 4H8SA 2NZ8B 3V5WA 1ZSQA 2ROZB 1KZGA 4NY0A 2VRWB 4DXAB 1UPRA 2I5CA 1K5DB 2COCA 1X86A 2D9VA 2DTCA 4HAWB 3U7DA 1WI1A 1ZC4B 3G9WA 1P5TA 5C5BA 3MPXA 5KCVA 1WGQA 3A8QA 1EF1A 4HDOA 4ZRIA 3ZVRA 2RVBB 4WSFA 3F5RA 2Z0QA 1DDVA 3PP2A 4K17A 4F7UP 2MDXA 4C0AA 1EGXA 5JLJB 4XWXA 4GMVA 4MY6A 2D2QA 2XQNM 2DX1A 3TVVA 4KHAA 4HB0B 4HB3B 2GCJA 5KQ1A 1W1HA 1U5GA 3GYOA 2D10A 2AEHA 2RGNB 4HAXB 2D9ZA 4PNKA 1WJMA 4L6EA 1MPHA 2BCJA 1OQNA 2V76A 1X11A 1MIXA 2COFA 1V5PA 4PQ0A 5JHGA 2KCJA 5C16A 1DDMA 2Y8GA 2P8VA 4EMOA 4IFSA 2D9WA 2CRFA 3SNHA 3ODOA 4WJ7A 3TO1A 3CIKA 2YVCA 2YSZA 1U5DA 4Z2MB 1AQCA 2QKLA 1U2BA 3CXBB 4MK0A 1PMSA 3M1IB 2DA0A 1KZ7A 1K5GB 4GN1A 2EJ8A 2LYDA 5DHFB 2W2XD 2G35A 5DIFB 2YRYA 3ODXA 1FHOA 3AJ4A 1ZM0A 2YS3A 4P7IA 4ZRJA 2UZSA 3SYXA 4HAZB 1M7RA 3U8ZA 4ZRKA 2YS1A 5HE3A 3T06A 4HAYB 2D9XA 2ROVA 3P7ZA 5C79A 3SV1A 2UZRA 2P0DA 4WVFB 1RRPB 2VSZA 1Y5OA 1MK9B 4A6FA 3FEHA 4KVGB 1WGUA 2D11A 5C6RA 3GYPA 4GPTB 3PG7A 2YF0A 1H10A 1X1FA 1V89A 4MT7A 1UEFA 3P6AA 4HDQA 5JP4A 2MWNB 1J19A 4DX90 1X05A 2D4QA 3D8FA 1I2HA 5HE0A 5J3YA 3A8PA 4F7GA 3A98B 1FAOA 1P3RA 2K00A 3PVUA 2HE7A 3HW2B 5FI1A 1MK7B 2EMTA 3KSYA 2LOXA 5DI9B 5DHAB 2D9YA 2J59M 2ADZA 2DN6A 2LKOA 4K81A 1MKEA 3QWMA 2K2UA 3HQCA 5J3TA 1V5MA 3SUZA 1H4RA 3OANA 4GZUA 1NTYA 1W1GA 4Y94A 1BTNA 3N7CA 4DX8A 2QKMA 3TFMA 1DYNA 1U27A 2H7EA 2E2XA 2GCLA 1EAZA 4K2PA 2M38A 2Y7BA 2R09A 2GS0A 4TYZA 3FSSA 2P0FA 1UNPA 2YT0A 4IOYX 4HB2B 2GJYA 1XODA 1FOEA 4KHBB 3PSCA 5D3WA 3TCAA 3TW1A 1WG7A 4BBKA 4IAPA 3UZTA 3PEGA 1SHCA 2R0DA 3DXEA 2VKIA
chains in the Genus database with same CATH superfamily
1PLSA 2IYBA 2ELAA 1EVHA 1BWNA 1M7EA 1MAIA 4CYEA 5LOPB 2DHJA 1J0WA 1BAKA 1XKEA 1GC6A 1Z87A 1ZYIA 2ZKMX 2Z14A 5LONB 1QC6A 2W2WA 1T77A 3ODWA 1N3HA 2Z0OA 3WYFB 1V88A 5D27A 1FGYA 2AL6A 3AU5A 3ULBA 1NI2A 5I2SA 2IFSA 5J3QA 2RUKB 3F0WA 2M14A 2ELBA 4KHOA 2YT1A 5CLQB 1XCGA 2PZ1A 3QIJA 4GOUA 3NSUA 2RSGA 3ULCA 2L1CA 3VIAA 1UNQA 3KZ1A 2COAA 5KQ4A 2ZPYA 1FHWA 5IRSA 2J0JA 3RCPA 2MFQA 1U5EA 2J0KA 4NSWA 2KGXB 2J0MA 2KUQA 5CLLB 1WVHA 1UNRA 2Z0PA 5D3VA 3NWAA 1GG3A 4CHJA 2CY4A 1LW3A 4HB4B 4QJ5B 1ISNA 2FJLA 2Q13A 4KAXB 1IRSA 2R2YA 2OQBA 4A6FB 1NTVA 4HAVB 1FHXA 2DX5A 1KI1B 3U12A 1LB1A 4A6HA 3BINA 4DBBA 2DLWA 2CODA 5L81A 1FGZA 1Q67A 1DBHA 2Z13A 2OTXA 4D0NB 4A5KA 3HSAA 1TXDA 1GC7A 3NWFA 5M4YB 2NBVA 1I7AA 2LOZA 4K2OA 4HHVA 2UVMA 4HAUB 2K2JA 4GMXB 1V61A 3WA0A 4F7HA 1UPQA 4EJNA 2CAYA 2DKPA 1Y19B 1E5WA 3B77A 2RLOA 2X18A 2EMSA 2W2XC 2P0HA 2DKQA 2YS5A 1QQGA 5JHHA 1AWEA 2N23A 4GXBA 2MKRA 4OT1A 1NU2A 2N0YA 5DH9B 1XD4A 3SO6A 1B55A 1DDWA 4Z2NA 1XX0A 1XR0B 3HK0A 3LJUX 1PFJA 1OY2A 3VOQA 4EKUA 3ZDTA 4GNKB 2K49A 2LULA 3PZDA 5HE2A 3AU4A 5FI0A 3BJIA 2DYQA 3PVLA 1U5FA 4QJ4B 4HSIA 3ML4A 2L2IA 2I1KA 2GUMA 1TQZA 2DHIA 2NMBA 4HATB 2JP2A 1X1GA 5HE1A 3D8EA 2HTHB 2DFKA 5D3YA 4OSNA 1V5UA 3X23A 2Y8FA 2DHKA 1ZC3B 1P6SA 4L1RA 4QJ3B 2H7DA 3MDBC 4B6HA 1FB8A 5EFXA 1ZVRA 3O96A 4A6KA 1BTKA 5D3XA 4CHMA 1W1DA 3D8DA 3IVFA 1OMWA 1SGHA 3FM8C 1U29A 2CY5A 3KY9A 2I1JA 5C5BB 1RJ2A 3KRXA 4YONA 5GOWB 2DYNA 4YL8A 4TKNA 1TJ6A 1MIZB 2LG1A 3QBVB 3KRWA 3DXCA 2KUPA 3DXDA 2I5FA 1WJ1A 2RNRB 1DROA 2EC1A 3PVWA 4H8SA 2NZ8B 3V5WA 1ZSQA 2ROZB 1KZGA 3NWDA 4NY0A 2VRWB 4DXAB 1UPRA 2I5CA 1K5DB 2COCA 1X86A 2D9VA 2DTCA 4HAWB 3U7DA 1WI1A 1ZC4B 3G9WA 1P5TA 5C5BA 3MPXA 5KCVA 2K8EA 1WGQA 3A8QA 1EF1A 4HDOA 4ZRIA 3ZVRA 2RVBB 4WSFA 3F5RA 2Z0QA 1DDVA 3PP2A 4K17A 4F7UP 2MDXA 4C0AA 1EGXA 5JLJB 4XWXA 4GMVA 4MY6A 3DCXA 2D2QA 2XQNM 2DX1A 3TVVA 4KHAA 4HB0B 4HB3B 2GCJA 5KQ1A 1W1HA 4KHBA 1U5GA 3GYOA 2D10A 4D6WA 2AEHA 2RGNB 4HAXB 2D9ZA 4PNKA 1WJMA 4L6EA 1MPHA 2BCJA 1OQNA 2V76A 1X11A 1MIXA 2COFA 1V5PA 4PQ0A 5JHGA 2KCJA 5C16A 1DDMA 2Y8GA 2P8VA 4EMOA 4IFSA 2D9WA 2CRFA 2KIGA 3SNHA 3ODOA 4WJ7A 3TO1A 3CIKA 2YVCA 2YSZA 1U5DA 4Z2MB 1AQCA 2QKLA 1U2BA 3CXBB 4MK0A 1PMSA 3M1IB 2DA0A 1KZ7A 1K5GB 4GN1A 2EJ8A 2LYDA 5DHFB 2W2XD 2G35A 5DIFB 2YRYA 3ODXA 5LG4B 1FHOA 3AJ4A 1ZM0A 2YS3A 4P7IA 4ZRJA 5I2MA 2UZSA 3SYXA 4HAZB 1M7RA 3U8ZA 4ZRKA 2YS1A 5HE3A 3T06A 3OHMB 4HAYB 2D9XA 2ROVA 3P7ZA 5C79A 3SV1A 2UZRA 2P0DA 4WVFB 1RRPB 2VSZA 3FVCA 1Y5OA 1MK9B 3A58A 4A6FA 3FEHA 4KVGB 4DIXA 1WGUA 2D11A 5C6RA 3GYPA 4GPTB 3PG7A 2YF0A 1H10A 1X1FA 1V89A 4MT7A 1UEFA 3P6AA 4HDQA 5JP4A 2MWNB 1J19A 2Z4DA 4DX90 1X05A 2RRFA 2D4QA 3D8FA 1I2HA 5HE0A 5J3YA 3A8PA 4F7GA 3A98B 1FAOA 1P3RA 2K00A 3PVUA 2HE7A 3HW2B 5FI1A 1MK7B 2EMTA 3KSYA 2LOXA 5DI9B 5DHAB 2D9YA 2J59M 2ADZA 2DN6A 2LKOA 4K81A 1MKEA 1MI1A 3QWMA 2K2UA 4CSQA 2Z59A 3NW8A 3HQCA 5J3TA 1V5MA 3SUZA 1H4RA 2YT2A 3OANA 4GZUA 1NTYA 1W1GA 4Y94A 2KR0A 1BTNA 3N7CA 4DX8A 2QKMA 3TFMA 1DYNA 1U27A 4QXAB 2H7EA 2E2XA 2GCLA 1EAZA 2KIEA 2M38A 4K2PA 2Y7BA 2R09A 2GS0A 4TYZA 3HIEA 3FSSA 2P0FA 1UNPA 2YT0A 4IOYX 4HB2B 2GJYA 1XODA 1FOEA 4KHBB 3PSCA 2FJUB 5D3WA 3TCAA 3TW1A 1WG7A 4BBKA 4IAPA 3UZTA 3PEGA 1SHCA 2R0DA 3DXEA 2VKIA
chains in the Genus database with same CATH topology
1PLSA 2IYBA 2ELAA 1EVHA 1BWNA 1M7EA 1MAIA 4CYEA 5LOPB 2DHJA 1J0WA 1BAKA 1XKEA 1GC6A 1Z87A 5LONB 1QC6A 2W2WA 3ODWA 1N3HA 2Z0OA 3WYFB 1V88A 5D27A 1FGYA 2AL6A 3AU5A 3ULBA 1NI2A 2IFSA 5J3QA 2RUKB 3F0WA 2M14A 2ELBA 4KHOA 2YT1A 5CLQB 1XCGA 2PZ1A 3QIJA 3NSUA 2RSGA 3ULCA 2L1CA 3VIAA 1UNQA 3KZ1A 2COAA 5KQ4A 2ZPYA 1FHWA 2J0JA 3RCPA 2MFQA 1U5EA 2J0KA 4NSWA 2KGXB 2J0MA 5CLLB 1WVHA 1UNRA 2Z0PA 5D3VA 1GG3A 4CHJA 2CY4A 1LW3A 4HB4B 1ISNA 2FJLA 2Q13A 4KAXB 1IRSA 2OQBA 4A6FB 1NTVA 4HAVB 1FHXA 2DX5A 1KI1B 1LB1A 4A6HA 3BINA 4DBBA 2DLWA 2CODA 5L81A 1FGZA 1Q67A 1DBHA 2OTXA 4D0NB 4A5KA 1TXDA 1GC7A 1I7AA 2LOZA 4K2OA 4HHVA 2UVMA 4HAUB 2K2JA 4GMXB 1V61A 3WA0A 4F7HA 1UPQA 4EJNA 2CAYA 2DKPA 1Y19B 1E5WA 2RLOA 2X18A 2EMSA 2W2XC 2P0HA 2DKQA 2YS5A 1QQGA 5JHHA 1AWEA 2N23A 4GXBA 2MKRA 1NU2A 2N0YA 5DH9B 1XD4A 3SO6A 1B55A 1DDWA 4Z2NA 1XX0A 1XR0B 3HK0A 3LJUX 1PFJA 1OY2A 3VOQA 4EKUA 3ZDTA 2LULA 3PZDA 5HE2A 3AU4A 5FI0A 3BJIA 2DYQA 3PVLA 1U5FA 3ML4A 2L2IA 2I1KA 1TQZA 2DHIA 2NMBA 4HATB 2JP2A 1X1GA 5HE1A 3D8EA 2HTHB 2DFKA 5D3YA 1V5UA 3X23A 2Y8FA 2DHKA 1ZC3B 1P6SA 2H7DA 3MDBC 4B6HA 1FB8A 5EFXA 1ZVRA 3O96A 4A6KA 1BTKA 5D3XA 4CHMA 1W1DA 3D8DA 3IVFA 1OMWA 1SGHA 3FM8C 1U29A 2CY5A 3KY9A 2I1JA 5C5BB 1RJ2A 3KRXA 4YONA 5GOWB 2DYNA 4YL8A 4TKNA 1TJ6A 1MIZB 2LG1A 3QBVB 3KRWA 3DXCA 2KUPA 3DXDA 2I5FA 1WJ1A 2RNRB 1DROA 2EC1A 3PVWA 4H8SA 2NZ8B 3V5WA 1ZSQA 2ROZB 1KZGA 4NY0A 2VRWB 4DXAB 1UPRA 2I5CA 1K5DB 2COCA 1X86A 2D9VA 2DTCA 4HAWB 3U7DA 1WI1A 1ZC4B 3G9WA 1P5TA 5C5BA 3MPXA 5KCVA 1WGQA 3A8QA 1EF1A 4HDOA 4ZRIA 3ZVRA 2RVBB 4WSFA 3F5RA 2Z0QA 1DDVA 3PP2A 4K17A 4F7UP 2MDXA 4C0AA 1EGXA 5JLJB 4XWXA 4GMVA 4MY6A 2D2QA 2XQNM 2DX1A 3TVVA 4KHAA 4HB0B 4HB3B 2GCJA 5KQ1A 1W1HA 1U5GA 3GYOA 2D10A 2AEHA 2RGNB 4HAXB 2D9ZA 4PNKA 1WJMA 4L6EA 1MPHA 2BCJA 1OQNA 2V76A 1X11A 1MIXA 2COFA 1V5PA 4PQ0A 5JHGA 2KCJA 5C16A 1DDMA 2Y8GA 2P8VA 4EMOA 4IFSA 2D9WA 2CRFA 3SNHA 3ODOA 4WJ7A 3TO1A 3CIKA 2YVCA 2YSZA 1U5DA 4Z2MB 1AQCA 2QKLA 1U2BA 3CXBB 4MK0A 1PMSA 3M1IB 2DA0A 1KZ7A 1K5GB 4GN1A 2EJ8A 2LYDA 5DHFB 2W2XD 2G35A 5DIFB 2YRYA 3ODXA 1FHOA 3AJ4A 1ZM0A 2YS3A 4P7IA 4ZRJA 2UZSA 3SYXA 4HAZB 1M7RA 3U8ZA 4ZRKA 2YS1A 5HE3A 3T06A 4HAYB 2D9XA 2ROVA 3P7ZA 5C79A 3SV1A 2UZRA 2P0DA 4WVFB 1RRPB 2VSZA 1Y5OA 1MK9B 4A6FA 3FEHA 4KVGB 1WGUA 2D11A 5C6RA 3GYPA 4GPTB 3PG7A 2YF0A 1H10A 1X1FA 1V89A 4MT7A 1UEFA 3P6AA 4HDQA 5JP4A 2MWNB 1J19A 4DX90 1X05A 2D4QA 3D8FA 1I2HA 5HE0A 5J3YA 3A8PA 4F7GA 3A98B 1FAOA 1P3RA 2K00A 3PVUA 2HE7A 3HW2B 5FI1A 1MK7B 2EMTA 3KSYA 2LOXA 5DI9B 5DHAB 2D9YA 2J59M 2ADZA 2DN6A 2LKOA 4K81A 1MKEA 3QWMA 2K2UA 3HQCA 5J3TA 1V5MA 3SUZA 1H4RA 3OANA 4GZUA 1NTYA 1W1GA 4Y94A 1BTNA 3N7CA 4DX8A 2QKMA 3TFMA 1DYNA 1U27A 2H7EA 2E2XA 2GCLA 1EAZA 4K2PA 2M38A 2Y7BA 2R09A 2GS0A 4TYZA 3FSSA 2P0FA 1UNPA 2YT0A 4IOYX 4HB2B 2GJYA 1XODA 1FOEA 4KHBB 3PSCA 5D3WA 3TCAA 3TW1A 1WG7A 4BBKA 4IAPA 3UZTA 3PEGA 1SHCA 2R0DA 3DXEA 2VKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PLS A;  2IYB A;  2ELA A;  1EVH A;  1BWN A;  1M7E A;  1MAI A;  4CYE A;  5LOP B;  2DHJ A;  1J0W A;  1BAK A;  1XKE A;  1GC6 A;  1Z87 A;  5LON B;  1QC6 A;  2W2W A;  3ODW A;  1N3H A;  2Z0O A;  3WYF B;  1V88 A;  5D27 A;  1FGY A;  2AL6 A;  3AU5 A;  3ULB A;  1NI2 A;  2IFS A;  5J3Q A;  2RUK B;  3F0W A;  2M14 A;  2ELB A;  4KHO A;  2YT1 A;  5CLQ B;  1XCG A;  2PZ1 A;  3QIJ A;  3NSU A;  2RSG A;  3ULC A;  2L1C A;  3VIA A;  1UNQ A;  3KZ1 A;  2COA A;  5KQ4 A;  2ZPY A;  1FHW A;  2J0J A;  3RCP A;  2MFQ A;  1U5E A;  2J0K A;  4NSW A;  2KGX B;  2J0M A;  5CLL B;  1WVH A;  1UNR A;  2Z0P A;  5D3V A;  1GG3 A;  4CHJ A;  2CY4 A;  1LW3 A;  4HB4 B;  1ISN A;  2FJL A;  2Q13 A;  4KAX B;  1IRS A;  2OQB A;  4A6F B;  1NTV A;  4HAV B;  1FHX A;  2DX5 A;  1KI1 B;  1LB1 A;  4A6H A;  3BIN A;  4DBB A;  2DLW A;  2COD A;  5L81 A;  1FGZ A;  1Q67 A;  1DBH A;  2OTX A;  4D0N B;  4A5K A;  1TXD A;  1GC7 A;  1I7A A;  2LOZ A;  4K2O A;  4HHV A;  2UVM A;  4HAU B;  2K2J A;  4GMX B;  1V61 A;  3WA0 A;  4F7H A;  1UPQ A;  4EJN A;  2CAY A;  2DKP A;  1Y19 B;  1E5W A;  2RLO A;  2X18 A;  2EMS A;  2W2X C;  2P0H A;  2DKQ A;  2YS5 A;  1QQG A;  5JHH A;  1AWE A;  2N23 A;  4GXB A;  2MKR A;  1NU2 A;  2N0Y A;  5DH9 B;  1XD4 A;  3SO6 A;  1B55 A;  1DDW A;  4Z2N A;  1XX0 A;  1XR0 B;  3HK0 A;  3LJU X;  1PFJ A;  1OY2 A;  3VOQ A;  4EKU A;  3ZDT A;  2LUL A;  3PZD A;  5HE2 A;  3AU4 A;  5FI0 A;  3BJI A;  2DYQ A;  3PVL A;  1U5F A;  3ML4 A;  2L2I A;  2I1K A;  1TQZ A;  2DHI A;  2NMB A;  4HAT B;  2JP2 A;  1X1G A;  5HE1 A;  3D8E A;  2HTH B;  2DFK A;  5D3Y A;  1V5U A;  3X23 A;  2Y8F A;  2DHK A;  1ZC3 B;  1P6S A;  2H7D A;  3MDB C;  4B6H A;  1FB8 A;  5EFX A;  1ZVR A;  3O96 A;  4A6K A;  1BTK A;  5D3X A;  4CHM A;  1W1D A;  3D8D A;  3IVF A;  1OMW A;  1SGH A;  3FM8 C;  1U29 A;  2CY5 A;  3KY9 A;  2I1J A;  5C5B B;  1RJ2 A;  3KRX A;  4YON A;  5GOW B;  2DYN A;  4YL8 A;  4TKN A;  1TJ6 A;  1MIZ B;  2LG1 A;  3QBV B;  3KRW A;  3DXC A;  2KUP A;  3DXD A;  2I5F A;  1WJ1 A;  2RNR B;  1DRO A;  2EC1 A;  3PVW A;  4H8S A;  2NZ8 B;  3V5W A;  1ZSQ A;  2ROZ B;  1KZG A;  4NY0 A;  2VRW B;  4DXA B;  1UPR A;  2I5C A;  1K5D B;  2COC A;  1X86 A;  2D9V A;  2DTC A;  4HAW B;  3U7D A;  1WI1 A;  1ZC4 B;  3G9W A;  1P5T A;  5C5B A;  3MPX A;  5KCV A;  1WGQ A;  3A8Q A;  1EF1 A;  4HDO A;  4ZRI A;  3ZVR A;  2RVB B;  4WSF A;  3F5R A;  2Z0Q A;  1DDV A;  3PP2 A;  4K17 A;  4F7U P;  2MDX A;  4C0A A;  1EGX A;  5JLJ B;  4XWX A;  4GMV A;  4MY6 A;  2D2Q A;  2XQN M;  2DX1 A;  3TVV A;  4KHA A;  4HB0 B;  4HB3 B;  2GCJ A;  5KQ1 A;  1W1H A;  1U5G A;  3GYO A;  2D10 A;  2AEH A;  2RGN B;  4HAX B;  2D9Z A;  4PNK A;  1WJM A;  4L6E A;  1MPH A;  2BCJ A;  1OQN A;  2V76 A;  1X11 A;  1MIX A;  2COF A;  1V5P A;  4PQ0 A;  5JHG A;  2KCJ A;  5C16 A;  1DDM A;  2Y8G A;  2P8V A;  4EMO A;  4IFS A;  2D9W A;  2CRF A;  3SNH A;  3ODO A;  4WJ7 A;  3TO1 A;  3CIK A;  2YVC A;  2YSZ A;  1U5D A;  4Z2M B;  1AQC A;  2QKL A;  1U2B A;  3CXB B;  4MK0 A;  1PMS A;  3M1I B;  2DA0 A;  1KZ7 A;  1K5G B;  4GN1 A;  2EJ8 A;  2LYD A;  5DHF B;  2W2X D;  2G35 A;  5DIF B;  2YRY A;  3ODX A;  1FHO A;  3AJ4 A;  1ZM0 A;  2YS3 A;  4P7I A;  4ZRJ A;  2UZS A;  3SYX A;  4HAZ B;  1M7R A;  3U8Z A;  4ZRK A;  2YS1 A;  5HE3 A;  3T06 A;  4HAY B;  2D9X A;  2ROV A;  3P7Z A;  5C79 A;  3SV1 A;  2UZR A;  2P0D A;  4WVF B;  1RRP B;  2VSZ A;  1Y5O A;  1MK9 B;  4A6F A;  3FEH A;  4KVG B;  1WGU A;  2D11 A;  5C6R A;  3GYP A;  4GPT B;  3PG7 A;  2YF0 A;  1H10 A;  1X1F A;  1V89 A;  4MT7 A;  1UEF A;  3P6A A;  4HDQ A;  5JP4 A;  2MWN B;  1J19 A;  4DX9 0;  1X05 A;  2D4Q A;  3D8F A;  1I2H A;  5HE0 A;  5J3Y A;  3A8P A;  4F7G A;  3A98 B;  1FAO A;  1P3R A;  2K00 A;  3PVU A;  2HE7 A;  3HW2 B;  5FI1 A;  1MK7 B;  2EMT A;  3KSY A;  2LOX A;  5DI9 B;  5DHA B;  2D9Y A;  2J59 M;  2ADZ A;  2DN6 A;  2LKO A;  4K81 A;  1MKE A;  3QWM A;  2K2U A;  3HQC A;  5J3T A;  1V5M A;  3SUZ A;  1H4R A;  3OAN A;  4GZU A;  1NTY A;  1W1G A;  4Y94 A;  1BTN A;  3N7C A;  4DX8 A;  2QKM A;  3TFM A;  1DYN A;  1U27 A;  2H7E A;  2E2X A;  2GCL A;  1EAZ A;  4K2P A;  2M38 A;  2Y7B A;  2R09 A;  2GS0 A;  4TYZ A;  3FSS A;  2P0F A;  1UNP A;  2YT0 A;  4IOY X;  4HB2 B;  2GJY A;  1XOD A;  1FOE A;  4KHB B;  3PSC A;  5D3W A;  3TCA A;  3TW1 A;  1WG7 A;  4BBK A;  4IAP A;  3UZT A;  3PEG A;  1SHC A;  2R0D A;  3DXE A;  2VKI A; 
#chains in the Genus database with same CATH topology
 1PLS A;  2IYB A;  2ELA A;  1EVH A;  1BWN A;  1M7E A;  1MAI A;  4CYE A;  5LOP B;  2DHJ A;  1J0W A;  1BAK A;  1XKE A;  1GC6 A;  1Z87 A;  1ZYI A;  2ZKM X;  2Z14 A;  5LON B;  1QC6 A;  2W2W A;  1T77 A;  3ODW A;  1N3H A;  2Z0O A;  3WYF B;  1V88 A;  5D27 A;  1FGY A;  2AL6 A;  3AU5 A;  3ULB A;  1NI2 A;  5I2S A;  2IFS A;  5J3Q A;  2RUK B;  3F0W A;  2M14 A;  2ELB A;  4KHO A;  2YT1 A;  5CLQ B;  1XCG A;  2PZ1 A;  3QIJ A;  4GOU A;  3NSU A;  2RSG A;  3ULC A;  2L1C A;  3VIA A;  1UNQ A;  3KZ1 A;  2COA A;  5KQ4 A;  2ZPY A;  1FHW A;  5IRS A;  2J0J A;  3RCP A;  2MFQ A;  1U5E A;  2J0K A;  4NSW A;  2KGX B;  2J0M A;  2KUQ A;  5CLL B;  1WVH A;  1UNR A;  2Z0P A;  5D3V A;  3NWA A;  1GG3 A;  4CHJ A;  2CY4 A;  1LW3 A;  4HB4 B;  4QJ5 B;  1ISN A;  2FJL A;  2Q13 A;  4KAX B;  1IRS A;  2R2Y A;  2OQB A;  4A6F B;  1NTV A;  4HAV B;  1FHX A;  2DX5 A;  1KI1 B;  3U12 A;  1LB1 A;  4A6H A;  3BIN A;  4DBB A;  2DLW A;  2COD A;  5L81 A;  1FGZ A;  1Q67 A;  1DBH A;  2Z13 A;  2OTX A;  4D0N B;  4A5K A;  3HSA A;  1TXD A;  1GC7 A;  3NWF A;  5M4Y B;  2NBV A;  1I7A A;  2LOZ A;  4K2O A;  4HHV A;  2UVM A;  4HAU B;  2K2J A;  4GMX B;  1V61 A;  3WA0 A;  4F7H A;  1UPQ A;  4EJN A;  2CAY A;  2DKP A;  1Y19 B;  1E5W A;  3B77 A;  2RLO A;  2X18 A;  2EMS A;  2W2X C;  2P0H A;  2DKQ A;  2YS5 A;  1QQG A;  5JHH A;  1AWE A;  2N23 A;  4GXB A;  2MKR A;  4OT1 A;  1NU2 A;  2N0Y A;  5DH9 B;  1XD4 A;  3SO6 A;  1B55 A;  1DDW A;  4Z2N A;  1XX0 A;  1XR0 B;  3HK0 A;  3LJU X;  1PFJ A;  1OY2 A;  3VOQ A;  4EKU A;  3ZDT A;  4GNK B;  2K49 A;  2LUL A;  3PZD A;  5HE2 A;  3AU4 A;  5FI0 A;  3BJI A;  2DYQ A;  3PVL A;  1U5F A;  4QJ4 B;  4HSI A;  3ML4 A;  2L2I A;  2I1K A;  2GUM A;  1TQZ A;  2DHI A;  2NMB A;  4HAT B;  2JP2 A;  1X1G A;  5HE1 A;  3D8E A;  2HTH B;  2DFK A;  5D3Y A;  4OSN A;  1V5U A;  3X23 A;  2Y8F A;  2DHK A;  1ZC3 B;  1P6S A;  4L1R A;  4QJ3 B;  2H7D A;  3MDB C;  4B6H A;  1FB8 A;  5EFX A;  1ZVR A;  3O96 A;  4A6K A;  1BTK A;  5D3X A;  4CHM A;  1W1D A;  3D8D A;  3IVF A;  1OMW A;  1SGH A;  3FM8 C;  1U29 A;  2CY5 A;  3KY9 A;  2I1J A;  5C5B B;  1RJ2 A;  3KRX A;  4YON A;  5GOW B;  2DYN A;  4YL8 A;  4TKN A;  1TJ6 A;  1MIZ B;  2LG1 A;  3QBV B;  3KRW A;  3DXC A;  2KUP A;  3DXD A;  2I5F A;  1WJ1 A;  2RNR B;  1DRO A;  2EC1 A;  3PVW A;  4H8S A;  2NZ8 B;  3V5W A;  1ZSQ A;  2ROZ B;  1KZG A;  3NWD A;  4NY0 A;  2VRW B;  4DXA B;  1UPR A;  2I5C A;  1K5D B;  2COC A;  1X86 A;  2D9V A;  2DTC A;  4HAW B;  3U7D A;  1WI1 A;  1ZC4 B;  3G9W A;  1P5T A;  5C5B A;  3MPX A;  5KCV A;  2K8E A;  1WGQ A;  3A8Q A;  1EF1 A;  4HDO A;  4ZRI A;  3ZVR A;  2RVB B;  4WSF A;  3F5R A;  2Z0Q A;  1DDV A;  3PP2 A;  4K17 A;  4F7U P;  2MDX A;  4C0A A;  1EGX A;  5JLJ B;  4XWX A;  4GMV A;  4MY6 A;  3DCX A;  2D2Q A;  2XQN M;  2DX1 A;  3TVV A;  4KHA A;  4HB0 B;  4HB3 B;  2GCJ A;  5KQ1 A;  1W1H A;  4KHB A;  1U5G A;  3GYO A;  2D10 A;  4D6W A;  2AEH A;  2RGN B;  4HAX B;  2D9Z A;  4PNK A;  1WJM A;  4L6E A;  1MPH A;  2BCJ A;  1OQN A;  2V76 A;  1X11 A;  1MIX A;  2COF A;  1V5P A;  4PQ0 A;  5JHG A;  2KCJ A;  5C16 A;  1DDM A;  2Y8G A;  2P8V A;  4EMO A;  4IFS A;  2D9W A;  2CRF A;  2KIG A;  3SNH A;  3ODO A;  4WJ7 A;  3TO1 A;  3CIK A;  2YVC A;  2YSZ A;  1U5D A;  4Z2M B;  1AQC A;  2QKL A;  1U2B A;  3CXB B;  4MK0 A;  1PMS A;  3M1I B;  2DA0 A;  1KZ7 A;  1K5G B;  4GN1 A;  2EJ8 A;  2LYD A;  5DHF B;  2W2X D;  2G35 A;  5DIF B;  2YRY A;  3ODX A;  5LG4 B;  1FHO A;  3AJ4 A;  1ZM0 A;  2YS3 A;  4P7I A;  4ZRJ A;  5I2M A;  2UZS A;  3SYX A;  4HAZ B;  1M7R A;  3U8Z A;  4ZRK A;  2YS1 A;  5HE3 A;  3T06 A;  3OHM B;  4HAY B;  2D9X A;  2ROV A;  3P7Z A;  5C79 A;  3SV1 A;  2UZR A;  2P0D A;  4WVF B;  1RRP B;  2VSZ A;  3FVC A;  1Y5O A;  1MK9 B;  3A58 A;  4A6F A;  3FEH A;  4KVG B;  4DIX A;  1WGU A;  2D11 A;  5C6R A;  3GYP A;  4GPT B;  3PG7 A;  2YF0 A;  1H10 A;  1X1F A;  1V89 A;  4MT7 A;  1UEF A;  3P6A A;  4HDQ A;  5JP4 A;  2MWN B;  1J19 A;  2Z4D A;  4DX9 0;  1X05 A;  2RRF A;  2D4Q A;  3D8F A;  1I2H A;  5HE0 A;  5J3Y A;  3A8P A;  4F7G A;  3A98 B;  1FAO A;  1P3R A;  2K00 A;  3PVU A;  2HE7 A;  3HW2 B;  5FI1 A;  1MK7 B;  2EMT A;  3KSY A;  2LOX A;  5DI9 B;  5DHA B;  2D9Y A;  2J59 M;  2ADZ A;  2DN6 A;  2LKO A;  4K81 A;  1MKE A;  1MI1 A;  3QWM A;  2K2U A;  4CSQ A;  2Z59 A;  3NW8 A;  3HQC A;  5J3T A;  1V5M A;  3SUZ A;  1H4R A;  2YT2 A;  3OAN A;  4GZU A;  1NTY A;  1W1G A;  4Y94 A;  2KR0 A;  1BTN A;  3N7C A;  4DX8 A;  2QKM A;  3TFM A;  1DYN A;  1U27 A;  4QXA B;  2H7E A;  2E2X A;  2GCL A;  1EAZ A;  2KIE A;  2M38 A;  4K2P A;  2Y7B A;  2R09 A;  2GS0 A;  4TYZ A;  3HIE A;  3FSS A;  2P0F A;  1UNP A;  2YT0 A;  4IOY X;  4HB2 B;  2GJY A;  1XOD A;  1FOE A;  4KHB B;  3PSC A;  2FJU B;  5D3W A;  3TCA A;  3TW1 A;  1WG7 A;  4BBK A;  4IAP A;  3UZT A;  3PEG A;  1SHC A;  2R0D A;  3DXE A;  2VKI A; 
#chains in the Genus database with same CATH homology
 1PLS A;  2IYB A;  2ELA A;  1EVH A;  1BWN A;  1M7E A;  1MAI A;  4CYE A;  5LOP B;  2DHJ A;  1J0W A;  1BAK A;  1XKE A;  1GC6 A;  1Z87 A;  5LON B;  1QC6 A;  2W2W A;  3ODW A;  1N3H A;  2Z0O A;  3WYF B;  1V88 A;  5D27 A;  1FGY A;  2AL6 A;  3AU5 A;  3ULB A;  1NI2 A;  2IFS A;  5J3Q A;  2RUK B;  3F0W A;  2M14 A;  2ELB A;  4KHO A;  2YT1 A;  5CLQ B;  1XCG A;  2PZ1 A;  3QIJ A;  3NSU A;  2RSG A;  3ULC A;  2L1C A;  3VIA A;  1UNQ A;  3KZ1 A;  2COA A;  5KQ4 A;  2ZPY A;  1FHW A;  2J0J A;  3RCP A;  2MFQ A;  1U5E A;  2J0K A;  4NSW A;  2KGX B;  2J0M A;  5CLL B;  1WVH A;  1UNR A;  2Z0P A;  5D3V A;  1GG3 A;  4CHJ A;  2CY4 A;  1LW3 A;  4HB4 B;  1ISN A;  2FJL A;  2Q13 A;  4KAX B;  1IRS A;  2OQB A;  4A6F B;  1NTV A;  4HAV B;  1FHX A;  2DX5 A;  1KI1 B;  1LB1 A;  4A6H A;  3BIN A;  4DBB A;  2DLW A;  2COD A;  5L81 A;  1FGZ A;  1Q67 A;  1DBH A;  2OTX A;  4D0N B;  4A5K A;  1TXD A;  1GC7 A;  1I7A A;  2LOZ A;  4K2O A;  4HHV A;  2UVM A;  4HAU B;  2K2J A;  4GMX B;  1V61 A;  3WA0 A;  4F7H A;  1UPQ A;  4EJN A;  2CAY A;  2DKP A;  1Y19 B;  1E5W A;  2RLO A;  2X18 A;  2EMS A;  2W2X C;  2P0H A;  2DKQ A;  2YS5 A;  1QQG A;  5JHH A;  1AWE A;  2N23 A;  4GXB A;  2MKR A;  1NU2 A;  2N0Y A;  5DH9 B;  1XD4 A;  3SO6 A;  1B55 A;  1DDW A;  4Z2N A;  1XX0 A;  1XR0 B;  3HK0 A;  3LJU X;  1PFJ A;  1OY2 A;  3VOQ A;  4EKU A;  3ZDT A;  2LUL A;  3PZD A;  5HE2 A;  3AU4 A;  5FI0 A;  3BJI A;  2DYQ A;  3PVL A;  1U5F A;  3ML4 A;  2L2I A;  2I1K A;  1TQZ A;  2DHI A;  2NMB A;  4HAT B;  2JP2 A;  1X1G A;  5HE1 A;  3D8E A;  2HTH B;  2DFK A;  5D3Y A;  1V5U A;  3X23 A;  2Y8F A;  2DHK A;  1ZC3 B;  1P6S A;  2H7D A;  3MDB C;  4B6H A;  1FB8 A;  5EFX A;  1ZVR A;  3O96 A;  4A6K A;  1BTK A;  5D3X A;  4CHM A;  1W1D A;  3D8D A;  3IVF A;  1OMW A;  1SGH A;  3FM8 C;  1U29 A;  2CY5 A;  3KY9 A;  2I1J A;  5C5B B;  1RJ2 A;  3KRX A;  4YON A;  5GOW B;  2DYN A;  4YL8 A;  4TKN A;  1TJ6 A;  1MIZ B;  2LG1 A;  3QBV B;  3KRW A;  3DXC A;  2KUP A;  3DXD A;  2I5F A;  1WJ1 A;  2RNR B;  1DRO A;  2EC1 A;  3PVW A;  4H8S A;  2NZ8 B;  3V5W A;  1ZSQ A;  2ROZ B;  1KZG A;  4NY0 A;  2VRW B;  4DXA B;  1UPR A;  2I5C A;  1K5D B;  2COC A;  1X86 A;  2D9V A;  2DTC A;  4HAW B;  3U7D A;  1WI1 A;  1ZC4 B;  3G9W A;  1P5T A;  5C5B A;  3MPX A;  5KCV A;  1WGQ A;  3A8Q A;  1EF1 A;  4HDO A;  4ZRI A;  3ZVR A;  2RVB B;  4WSF A;  3F5R A;  2Z0Q A;  1DDV A;  3PP2 A;  4K17 A;  4F7U P;  2MDX A;  4C0A A;  1EGX A;  5JLJ B;  4XWX A;  4GMV A;  4MY6 A;  2D2Q A;  2XQN M;  2DX1 A;  3TVV A;  4KHA A;  4HB0 B;  4HB3 B;  2GCJ A;  5KQ1 A;  1W1H A;  1U5G A;  3GYO A;  2D10 A;  2AEH A;  2RGN B;  4HAX B;  2D9Z A;  4PNK A;  1WJM A;  4L6E A;  1MPH A;  2BCJ A;  1OQN A;  2V76 A;  1X11 A;  1MIX A;  2COF A;  1V5P A;  4PQ0 A;  5JHG A;  2KCJ A;  5C16 A;  1DDM A;  2Y8G A;  2P8V A;  4EMO A;  4IFS A;  2D9W A;  2CRF A;  3SNH A;  3ODO A;  4WJ7 A;  3TO1 A;  3CIK A;  2YVC A;  2YSZ A;  1U5D A;  4Z2M B;  1AQC A;  2QKL A;  1U2B A;  3CXB B;  4MK0 A;  1PMS A;  3M1I B;  2DA0 A;  1KZ7 A;  1K5G B;  4GN1 A;  2EJ8 A;  2LYD A;  5DHF B;  2W2X D;  2G35 A;  5DIF B;  2YRY A;  3ODX A;  1FHO A;  3AJ4 A;  1ZM0 A;  2YS3 A;  4P7I A;  4ZRJ A;  2UZS A;  3SYX A;  4HAZ B;  1M7R A;  3U8Z A;  4ZRK A;  2YS1 A;  5HE3 A;  3T06 A;  4HAY B;  2D9X A;  2ROV A;  3P7Z A;  5C79 A;  3SV1 A;  2UZR A;  2P0D A;  4WVF B;  1RRP B;  2VSZ A;  1Y5O A;  1MK9 B;  4A6F A;  3FEH A;  4KVG B;  1WGU A;  2D11 A;  5C6R A;  3GYP A;  4GPT B;  3PG7 A;  2YF0 A;  1H10 A;  1X1F A;  1V89 A;  4MT7 A;  1UEF A;  3P6A A;  4HDQ A;  5JP4 A;  2MWN B;  1J19 A;  4DX9 0;  1X05 A;  2D4Q A;  3D8F A;  1I2H A;  5HE0 A;  5J3Y A;  3A8P A;  4F7G A;  3A98 B;  1FAO A;  1P3R A;  2K00 A;  3PVU A;  2HE7 A;  3HW2 B;  5FI1 A;  1MK7 B;  2EMT A;  3KSY A;  2LOX A;  5DI9 B;  5DHA B;  2D9Y A;  2J59 M;  2ADZ A;  2DN6 A;  2LKO A;  4K81 A;  1MKE A;  3QWM A;  2K2U A;  3HQC A;  5J3T A;  1V5M A;  3SUZ A;  1H4R A;  3OAN A;  4GZU A;  1NTY A;  1W1G A;  4Y94 A;  1BTN A;  3N7C A;  4DX8 A;  2QKM A;  3TFM A;  1DYN A;  1U27 A;  2H7E A;  2E2X A;  2GCL A;  1EAZ A;  4K2P A;  2M38 A;  2Y7B A;  2R09 A;  2GS0 A;  4TYZ A;  3FSS A;  2P0F A;  1UNP A;  2YT0 A;  4IOY X;  4HB2 B;  2GJY A;  1XOD A;  1FOE A;  4KHB B;  3PSC A;  5D3W A;  3TCA A;  3TW1 A;  1WG7 A;  4BBK A;  4IAP A;  3UZT A;  3PEG A;  1SHC A;  2R0D A;  3DXE A;  2VKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...