1MPHA

Pleckstrin homology domain from mouse beta-spectrin, nmr, 50 structures
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
b'MEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGIPYHSEVPVSLKEAICEVALDYKKKKHVFKLRLSDGNEYLFQAKDDEEMNTWIQAISSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA SPECTRIN
molecule tags Signal transduction
source organism Mus musculus
publication title Automated NOESY interpretation with ambiguous distance restraints: the refined NMR solution structure of the pleckstrin homology domain from beta-spectrin.
pubmed doi rcsb
total genus 23
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1997-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1mphA00
3X23A 2DX1A 1KZGA 4DXAB 3BINA 1X86A 2D2QA 5DH9B 1BTNA 2GCJA 4PQ0A 1U5FA 2CY4A 1P5TA 5CLLB 1WJMA 3QIJA 4C0AA 2K2UA 4A6HA 4CHMA 4K17A 1ZVRA 3KY9A 4F7GA 1KZ7A 3WYFB 3BJIA 2D11A 2DLWA 3LJUX 2L1CA 3ZVRA 1U5GA 4KAXB 5C5BB 1EF1A 1AWEA 2K2JA 2D9WA 1U29A 2DTCA 1MK9B 2DYQA 2Q13A 5DHAB 4ZRJA 2RLOA 1H4RA 2EMSA 3WA0A 1FOEA 3PZDA 5HE2A 1UEFA 1SGHA 3TO1A 4KHBB 3SNHA 2BCJA 2D9ZA 4HATB 1V89A 3PP2A 2YS3A 2QKMA 1XKEA 1NTVA 2DN6A 4H8SA 3MDBC 1U27A 1WI1A 2YS5A 1UNQA 4GN1A 1XX0A 2OQBA 2GS0A 3TW1A 3PVWA 1Q67A 2W2XD 1MK7B 1UPQA 3M1IB 3A98B 3P6AA 1NTYA 1U2BA 1XCGA 2M14A 1K5DB 5EFXA 1P3RA 3TCAA 1V5MA 1NI2A 2EMTA 1N3HA 2OTXA 3GYOA 3HK0A 5HE1A 2DA0A 2W2XC 2YS1A 5J3QA 1J19A 2DFKA 4TYZA 1XODA 5C6RA 3A8QA 4HDQA 2LYDA 4A6FB 2J59M 2RSGA 2YF0A 4HAYB 2D9YA 1Y19B 2LG1A 1E5WA 2Y7BA 3CXBB 3ODOA 2ROZB 1V61A 1U5EA 1J0WA 1WVHA 1I2HA 2N0YA 4HAVB 2Z0PA 1UNRA 1I7AA 3PEGA 2QKLA 3RCPA 3ULCA 5C5BA 5JP4A 3TFMA 2IYBA 4Y94A 2CODA 1SHCA 2COAA 4MK0A 2ZPYA 1IRSA 5LONB 2X18A 3PVUA 4MY6A 2I1JA 3AU4A 2R0DA 1UNPA 2YRYA 1NU2A 3QBVB 2EJ8A 2LKOA 3KSYA 2NZ8B 3F5RA 4BBKA 4B6HA 2VKIA 2K00A 2P8VA 4WSFA 1EAZA 1XD4A 1W1DA 4NSWA 2EC1A 2P0FA 5DI9B 2Y8FA 2L2IA 1PFJA 1P6SA 4GMVA 1DDMA 1W1GA 4HB4B 2RGNB 2KUPA 4KHAA 1WG7A 4F7UP 3AJ4A 4WVFB 1WGUA 5KQ4A 5HE0A 1OMWA 1LB1A 4EMOA 4PNKA 2ELBA 4GPTB 1WGQA 4DX8A 1H10A 2FJLA 1ISNA 4HB3B 1PLSA 4L6EA 1X05A 1ZC3B 2W2WA 1QC6A 2IFSA 3U7DA 3ODXA 2DKPA 3NSUA 2VRWB 4HDOA 1DBHA 4K2PA 1GC6A 1LW3A 1XR0B 3MPXA 2RNRB 4DX90 4HHVA 4YL8A 4CYEA 5LOPB 2AL6A 5C79A 1ZM0A 5DIFB 1FGZA 2COCA 3D8EA 3OANA 2D9XA 3N7CA 1RRPB 3ODWA 2LULA 5D3XA 4HAXB 3PSCA 3QWMA 1OQNA 3GYPA 2D9VA 1V88A 4HB2B 2DYNA 1V5UA 1DYNA 2DHKA 2Z0OA 2XQNM 3O96A 4KVGB 1FGYA 2I1KA 3FEHA 2COFA 4NY0A 2GJYA 1MIXA 4D0NB 2Z0QA 2DHJA 1ZC4B 3G9WA 3TVVA 2V76A 1FHOA 3V5WA 1PMSA 2E2XA 1X1FA 3SV1A 1DROA 1M7EA 1GC7A 1KI1B 4GXBA 4A6FA 2GCLA 5JHGA 4TKNA 1M7RA 1MPHA 2JP2A 5D3WA 2R09A 1K5GB 2LOZA 3SUZA 1ZSQA 3HW2B 4ZRIA 1EGXA 1MAIA 2UVMA 5JHHA 2HTHB 4K81A 4A6KA 4MT7A 3T06A 3F0WA 2LOXA 3ULBA 2RVBB 1WJ1A 3IVFA 5GOWB 2I5CA 2P0DA 2AEHA 1FHXA 4CHJA 4F7HA 3DXCA 1TJ6A 4HAWB 4DBBA 3SYXA 4Z2NA 1DDVA 1U5DA 1B55A 1Y5OA 1Z87A 3HQCA 5FI0A 3D8FA 1MIZB 2H7EA 1V5PA 3PVLA 5D3YA 5L81A 2DKQA 5FI1A 1QQGA 2D4QA 4IFSA 2KCJA 2ELAA 2VSZA 3ZDTA 3SO6A 4WJ7A 2D10A 2H7DA 4GZUA 3FM8C 2MFQA 5J3YA 5KQ1A 4IOYX 4A5KA 4KHOA 2HE7A 2MWNB 1TQZA 3VOQA 5KCVA 3DXDA 2YSZA 2CRFA 3KRWA 2YVCA 1DDWA 2MDXA 2MKRA 1BAKA 2CY5A 3KZ1A 2UZSA 4ZRKA 5C16A 4XWXA 4EJNA 2UZRA 1BTKA 5JLJB 2P0HA 1AQCA 2RUKB 4HAZB 1FB8A 1UPRA 3FSSA 4K2OA 3P7ZA 1FHWA 5HE3A 2J0KA 3DXEA 1MKEA 5D27A 1FAOA 2N23A 4GMXB 3KRXA 2G35A 1EVHA 4P7IA 4Z2MB 2NMBA 3AU5A 2ROVA 5CLQB 2Y8GA 3PG7A 1TXDA 3A8PA 3VIAA 2M38A 2J0JA 3UZTA 2DHIA 2ADZA 1X11A 2DX5A 4YONA 2KGXB 4HAUB 3U8ZA 1GG3A 3ML4A 5DHFB 4EKUA 1BWNA 2J0MA 4HB0B 2YT0A 1RJ2A 2I5FA 2CAYA 2YT1A 5D3VA 1X1GA 2PZ1A 5J3TA 4IAPA 3D8DA 1W1HA 1OY2A 3CIKA
chains in the Genus database with same CATH superfamily
3X23A 2DX1A 1KZGA 5I2MA 4DXAB 2FJUB 3BINA 1X86A 2D2QA 3HIEA 5DH9B 1BTNA 2GCJA 3NWFA 4PQ0A 1U5FA 2CY4A 1P5TA 5CLLB 1WJMA 3QIJA 4KHBA 4C0AA 2K2UA 4A6HA 4CHMA 4K17A 1ZVRA 3KY9A 4F7GA 1KZ7A 3WYFB 3BJIA 2D11A 3HSAA 2DLWA 3LJUX 2L1CA 3ZVRA 1U5GA 4KAXB 5C5BB 1EF1A 1AWEA 3A58A 2K2JA 2D9WA 1U29A 2DTCA 1MK9B 2DYQA 2Q13A 5DHAB 4ZRJA 3NWAA 2RLOA 1H4RA 2EMSA 3WA0A 1FOEA 3PZDA 5HE2A 1UEFA 1SGHA 3TO1A 4KHBB 3SNHA 2BCJA 2D9ZA 4HATB 1V89A 3PP2A 2YS3A 2QKMA 1XKEA 1NTVA 2KR0A 2DN6A 4H8SA 3U12A 3MDBC 1U27A 1WI1A 2YS5A 1UNQA 4GN1A 1XX0A 2OQBA 2GS0A 3TW1A 3PVWA 1Q67A 2W2XD 1MK7B 4OSNA 3P6AA 1UPQA 3A98B 3M1IB 1NTYA 1U2BA 1XCGA 2M14A 1K5DB 2NBVA 5EFXA 2KIEA 1P3RA 3TCAA 1V5MA 2K8EA 2Z59A 1NI2A 2EMTA 1N3HA 2OTXA 3GYOA 3HK0A 5HE1A 2DA0A 2W2XC 2YS1A 5J3QA 1J19A 4CSQA 2DFKA 4TYZA 4QJ4B 1XODA 5C6RA 3A8QA 4HDQA 2LYDA 4A6FB 2J59M 2RSGA 2YF0A 4HAYB 2D9YA 1Y19B 2LG1A 1E5WA 2Y7BA 3CXBB 3ODOA 2ROZB 1MI1A 4L1RA 1V61A 1U5EA 1J0WA 1WVHA 1I2HA 2N0YA 4HAVB 2Z14A 2Z0PA 1UNRA 1I7AA 3PEGA 2QKLA 3RCPA 3ULCA 5C5BA 5JP4A 3TFMA 2IYBA 4Y94A 2CODA 1SHCA 2COAA 4MK0A 2ZPYA 1IRSA 5LONB 2X18A 3PVUA 1T77A 4MY6A 2I1JA 3AU4A 2R0DA 2GUMA 1UNPA 2YRYA 1NU2A 3QBVB 2EJ8A 2LKOA 3KSYA 2NZ8B 3F5RA 4BBKA 4B6HA 2VKIA 2K00A 2P8VA 4WSFA 1EAZA 1XD4A 1W1DA 4NSWA 2EC1A 2P0FA 5DI9B 2Y8FA 2L2IA 4D6WA 1PFJA 1P6SA 4GMVA 1DDMA 1W1GA 4HB4B 2RGNB 2KUPA 4KHAA 4OT1A 1WG7A 4F7UP 3AJ4A 4WVFB 1WGUA 5KQ4A 5HE0A 1OMWA 1LB1A 4EMOA 4PNKA 2ELBA 4GPTB 1WGQA 4DX8A 1H10A 2FJLA 1ISNA 4HB3B 4GOUA 1PLSA 4L6EA 1X05A 1ZC3B 2W2WA 1QC6A 2IFSA 3U7DA 5I2SA 3ODXA 1ZYIA 2DKPA 2KUQA 3NSUA 2VRWB 4HDOA 1DBHA 4K2PA 1GC6A 1LW3A 1XR0B 3MPXA 2RNRB 4DX90 4HHVA 4YL8A 4CYEA 5LOPB 2AL6A 5C79A 1ZM0A 4QJ5B 5DIFB 1FGZA 4QXAB 2COCA 3D8EA 3OANA 3DCXA 2D9XA 3N7CA 1RRPB 3ODWA 2LULA 5M4YB 5D3XA 4HAXB 3PSCA 3QWMA 1OQNA 3GYPA 2D9VA 1V88A 4HB2B 2DYNA 1V5UA 1DYNA 2DHKA 2Z0OA 2XQNM 3O96A 4KVGB 1FGYA 2I1KA 3FEHA 2COFA 2R2YA 4NY0A 2GJYA 1MIXA 4D0NB 2Z0QA 2DHJA 2Z13A 1ZC4B 3G9WA 3TVVA 2V76A 1FHOA 3V5WA 1PMSA 2E2XA 1X1FA 3SV1A 1DROA 1M7EA 1GC7A 1KI1B 4GXBA 4A6FA 2GCLA 5JHGA 4TKNA 1M7RA 1MPHA 2JP2A 5D3WA 2R09A 3NWDA 1K5GB 4DIXA 2LOZA 3SUZA 1ZSQA 3HW2B 4ZRIA 1EGXA 1MAIA 2UVMA 5JHHA 2HTHB 4K81A 4A6KA 5LG4B 4MT7A 3T06A 3F0WA 2LOXA 3ULBA 2RVBB 1WJ1A 3IVFA 5GOWB 4HSIA 2I5CA 2P0DA 2AEHA 2ZKMX 3B77A 1FHXA 4CHJA 4F7HA 3DXCA 1TJ6A 4HAWB 3OHMB 4DBBA 3SYXA 4Z2NA 1DDVA 1U5DA 1B55A 1Y5OA 1Z87A 3HQCA 5FI0A 3D8FA 1MIZB 2H7EA 1V5PA 3PVLA 5D3YA 5L81A 2DKQA 5FI1A 1QQGA 2RRFA 2D4QA 4IFSA 2KCJA 2ELAA 2VSZA 3ZDTA 3SO6A 4WJ7A 2D10A 2H7DA 4GZUA 3FM8C 2MFQA 5J3YA 5KQ1A 4IOYX 4A5KA 4KHOA 2HE7A 2MWNB 1TQZA 3VOQA 5KCVA 3DXDA 2YSZA 2CRFA 3KRWA 2YVCA 1DDWA 2MDXA 2MKRA 1BAKA 2CY5A 3KZ1A 2UZSA 3NW8A 5IRSA 4ZRKA 5C16A 2Z4DA 4XWXA 2YT2A 4EJNA 2UZRA 1BTKA 5JLJB 2P0HA 1AQCA 2RUKB 1FB8A 3FSSA 1UPRA 4HAZB 4K2OA 3P7ZA 1FHWA 5HE3A 2J0KA 3DXEA 1MKEA 2KIGA 4GNKB 5D27A 1FAOA 2N23A 3FVCA 4GMXB 3KRXA 2G35A 1EVHA 4P7IA 4Z2MB 2NMBA 3AU5A 2ROVA 5CLQB 2Y8GA 3PG7A 1TXDA 3A8PA 3VIAA 2M38A 2J0JA 3UZTA 2DHIA 2ADZA 1X11A 2DX5A 4YONA 2KGXB 4HAUB 3U8ZA 1GG3A 3ML4A 5DHFB 4EKUA 1BWNA 2J0MA 4HB0B 2YT0A 1RJ2A 2K49A 2I5FA 2CAYA 2YT1A 5D3VA 1X1GA 2PZ1A 5J3TA 4IAPA 3D8DA 1W1HA 1OY2A 4QJ3B 3CIKA
chains in the Genus database with same CATH topology
3X23A 2DX1A 1KZGA 4DXAB 3BINA 1X86A 2D2QA 5DH9B 1BTNA 2GCJA 4PQ0A 1U5FA 2CY4A 1P5TA 5CLLB 1WJMA 3QIJA 4C0AA 2K2UA 4A6HA 4CHMA 4K17A 1ZVRA 3KY9A 4F7GA 1KZ7A 3WYFB 3BJIA 2D11A 2DLWA 3LJUX 2L1CA 3ZVRA 1U5GA 4KAXB 5C5BB 1EF1A 1AWEA 2K2JA 2D9WA 1U29A 2DTCA 1MK9B 2DYQA 2Q13A 5DHAB 4ZRJA 2RLOA 1H4RA 2EMSA 3WA0A 1FOEA 3PZDA 5HE2A 1UEFA 1SGHA 3TO1A 4KHBB 3SNHA 2BCJA 2D9ZA 4HATB 1V89A 3PP2A 2YS3A 2QKMA 1XKEA 1NTVA 2DN6A 4H8SA 3MDBC 1U27A 1WI1A 2YS5A 1UNQA 4GN1A 1XX0A 2OQBA 2GS0A 3TW1A 3PVWA 1Q67A 2W2XD 1MK7B 1UPQA 3M1IB 3A98B 3P6AA 1NTYA 1U2BA 1XCGA 2M14A 1K5DB 5EFXA 1P3RA 3TCAA 1V5MA 1NI2A 2EMTA 1N3HA 2OTXA 3GYOA 3HK0A 5HE1A 2DA0A 2W2XC 2YS1A 5J3QA 1J19A 2DFKA 4TYZA 1XODA 5C6RA 3A8QA 4HDQA 2LYDA 4A6FB 2J59M 2RSGA 2YF0A 4HAYB 2D9YA 1Y19B 2LG1A 1E5WA 2Y7BA 3CXBB 3ODOA 2ROZB 1V61A 1U5EA 1J0WA 1WVHA 1I2HA 2N0YA 4HAVB 2Z0PA 1UNRA 1I7AA 3PEGA 2QKLA 3RCPA 3ULCA 5C5BA 5JP4A 3TFMA 2IYBA 4Y94A 2CODA 1SHCA 2COAA 4MK0A 2ZPYA 1IRSA 5LONB 2X18A 3PVUA 4MY6A 2I1JA 3AU4A 2R0DA 1UNPA 2YRYA 1NU2A 3QBVB 2EJ8A 2LKOA 3KSYA 2NZ8B 3F5RA 4BBKA 4B6HA 2VKIA 2K00A 2P8VA 4WSFA 1EAZA 1XD4A 1W1DA 4NSWA 2EC1A 2P0FA 5DI9B 2Y8FA 2L2IA 1PFJA 1P6SA 4GMVA 1DDMA 1W1GA 4HB4B 2RGNB 2KUPA 4KHAA 1WG7A 4F7UP 3AJ4A 4WVFB 1WGUA 5KQ4A 5HE0A 1OMWA 1LB1A 4EMOA 4PNKA 2ELBA 4GPTB 1WGQA 4DX8A 1H10A 2FJLA 1ISNA 4HB3B 1PLSA 4L6EA 1X05A 1ZC3B 2W2WA 1QC6A 2IFSA 3U7DA 3ODXA 2DKPA 3NSUA 2VRWB 4HDOA 1DBHA 4K2PA 1GC6A 1LW3A 1XR0B 3MPXA 2RNRB 4DX90 4HHVA 4YL8A 4CYEA 5LOPB 2AL6A 5C79A 1ZM0A 5DIFB 1FGZA 2COCA 3D8EA 3OANA 2D9XA 3N7CA 1RRPB 3ODWA 2LULA 5D3XA 4HAXB 3PSCA 3QWMA 1OQNA 3GYPA 2D9VA 1V88A 4HB2B 2DYNA 1V5UA 1DYNA 2DHKA 2Z0OA 2XQNM 3O96A 4KVGB 1FGYA 2I1KA 3FEHA 2COFA 4NY0A 2GJYA 1MIXA 4D0NB 2Z0QA 2DHJA 1ZC4B 3G9WA 3TVVA 2V76A 1FHOA 3V5WA 1PMSA 2E2XA 1X1FA 3SV1A 1DROA 1M7EA 1GC7A 1KI1B 4GXBA 4A6FA 2GCLA 5JHGA 4TKNA 1M7RA 1MPHA 2JP2A 5D3WA 2R09A 1K5GB 2LOZA 3SUZA 1ZSQA 3HW2B 4ZRIA 1EGXA 1MAIA 2UVMA 5JHHA 2HTHB 4K81A 4A6KA 4MT7A 3T06A 3F0WA 2LOXA 3ULBA 2RVBB 1WJ1A 3IVFA 5GOWB 2I5CA 2P0DA 2AEHA 1FHXA 4CHJA 4F7HA 3DXCA 1TJ6A 4HAWB 4DBBA 3SYXA 4Z2NA 1DDVA 1U5DA 1B55A 1Y5OA 1Z87A 3HQCA 5FI0A 3D8FA 1MIZB 2H7EA 1V5PA 3PVLA 5D3YA 5L81A 2DKQA 5FI1A 1QQGA 2D4QA 4IFSA 2KCJA 2ELAA 2VSZA 3ZDTA 3SO6A 4WJ7A 2D10A 2H7DA 4GZUA 3FM8C 2MFQA 5J3YA 5KQ1A 4IOYX 4A5KA 4KHOA 2HE7A 2MWNB 1TQZA 3VOQA 5KCVA 3DXDA 2YSZA 2CRFA 3KRWA 2YVCA 1DDWA 2MDXA 2MKRA 1BAKA 2CY5A 3KZ1A 2UZSA 4ZRKA 5C16A 4XWXA 4EJNA 2UZRA 1BTKA 5JLJB 2P0HA 1AQCA 2RUKB 4HAZB 1FB8A 1UPRA 3FSSA 4K2OA 3P7ZA 1FHWA 5HE3A 2J0KA 3DXEA 1MKEA 5D27A 1FAOA 2N23A 4GMXB 3KRXA 2G35A 1EVHA 4P7IA 4Z2MB 2NMBA 3AU5A 2ROVA 5CLQB 2Y8GA 3PG7A 1TXDA 3A8PA 3VIAA 2M38A 2J0JA 3UZTA 2DHIA 2ADZA 1X11A 2DX5A 4YONA 2KGXB 4HAUB 3U8ZA 1GG3A 3ML4A 5DHFB 4EKUA 1BWNA 2J0MA 4HB0B 2YT0A 1RJ2A 2I5FA 2CAYA 2YT1A 5D3VA 1X1GA 2PZ1A 5J3TA 4IAPA 3D8DA 1W1HA 1OY2A 3CIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X23 A;  2DX1 A;  1KZG A;  4DXA B;  3BIN A;  1X86 A;  2D2Q A;  5DH9 B;  1BTN A;  2GCJ A;  4PQ0 A;  1U5F A;  2CY4 A;  1P5T A;  5CLL B;  1WJM A;  3QIJ A;  4C0A A;  2K2U A;  4A6H A;  4CHM A;  4K17 A;  1ZVR A;  3KY9 A;  4F7G A;  1KZ7 A;  3WYF B;  3BJI A;  2D11 A;  2DLW A;  3LJU X;  2L1C A;  3ZVR A;  1U5G A;  4KAX B;  5C5B B;  1EF1 A;  1AWE A;  2K2J A;  2D9W A;  1U29 A;  2DTC A;  1MK9 B;  2DYQ A;  2Q13 A;  5DHA B;  4ZRJ A;  2RLO A;  1H4R A;  2EMS A;  3WA0 A;  1FOE A;  3PZD A;  5HE2 A;  1UEF A;  1SGH A;  3TO1 A;  4KHB B;  3SNH A;  2BCJ A;  2D9Z A;  4HAT B;  1V89 A;  3PP2 A;  2YS3 A;  2QKM A;  1XKE A;  1NTV A;  2DN6 A;  4H8S A;  3MDB C;  1U27 A;  1WI1 A;  2YS5 A;  1UNQ A;  4GN1 A;  1XX0 A;  2OQB A;  2GS0 A;  3TW1 A;  3PVW A;  1Q67 A;  2W2X D;  1MK7 B;  1UPQ A;  3M1I B;  3A98 B;  3P6A A;  1NTY A;  1U2B A;  1XCG A;  2M14 A;  1K5D B;  5EFX A;  1P3R A;  3TCA A;  1V5M A;  1NI2 A;  2EMT A;  1N3H A;  2OTX A;  3GYO A;  3HK0 A;  5HE1 A;  2DA0 A;  2W2X C;  2YS1 A;  5J3Q A;  1J19 A;  2DFK A;  4TYZ A;  1XOD A;  5C6R A;  3A8Q A;  4HDQ A;  2LYD A;  4A6F B;  2J59 M;  2RSG A;  2YF0 A;  4HAY B;  2D9Y A;  1Y19 B;  2LG1 A;  1E5W A;  2Y7B A;  3CXB B;  3ODO A;  2ROZ B;  1V61 A;  1U5E A;  1J0W A;  1WVH A;  1I2H A;  2N0Y A;  4HAV B;  2Z0P A;  1UNR A;  1I7A A;  3PEG A;  2QKL A;  3RCP A;  3ULC A;  5C5B A;  5JP4 A;  3TFM A;  2IYB A;  4Y94 A;  2COD A;  1SHC A;  2COA A;  4MK0 A;  2ZPY A;  1IRS A;  5LON B;  2X18 A;  3PVU A;  4MY6 A;  2I1J A;  3AU4 A;  2R0D A;  1UNP A;  2YRY A;  1NU2 A;  3QBV B;  2EJ8 A;  2LKO A;  3KSY A;  2NZ8 B;  3F5R A;  4BBK A;  4B6H A;  2VKI A;  2K00 A;  2P8V A;  4WSF A;  1EAZ A;  1XD4 A;  1W1D A;  4NSW A;  2EC1 A;  2P0F A;  5DI9 B;  2Y8F A;  2L2I A;  1PFJ A;  1P6S A;  4GMV A;  1DDM A;  1W1G A;  4HB4 B;  2RGN B;  2KUP A;  4KHA A;  1WG7 A;  4F7U P;  3AJ4 A;  4WVF B;  1WGU A;  5KQ4 A;  5HE0 A;  1OMW A;  1LB1 A;  4EMO A;  4PNK A;  2ELB A;  4GPT B;  1WGQ A;  4DX8 A;  1H10 A;  2FJL A;  1ISN A;  4HB3 B;  1PLS A;  4L6E A;  1X05 A;  1ZC3 B;  2W2W A;  1QC6 A;  2IFS A;  3U7D A;  3ODX A;  2DKP A;  3NSU A;  2VRW B;  4HDO A;  1DBH A;  4K2P A;  1GC6 A;  1LW3 A;  1XR0 B;  3MPX A;  2RNR B;  4DX9 0;  4HHV A;  4YL8 A;  4CYE A;  5LOP B;  2AL6 A;  5C79 A;  1ZM0 A;  5DIF B;  1FGZ A;  2COC A;  3D8E A;  3OAN A;  2D9X A;  3N7C A;  1RRP B;  3ODW A;  2LUL A;  5D3X A;  4HAX B;  3PSC A;  3QWM A;  1OQN A;  3GYP A;  2D9V A;  1V88 A;  4HB2 B;  2DYN A;  1V5U A;  1DYN A;  2DHK A;  2Z0O A;  2XQN M;  3O96 A;  4KVG B;  1FGY A;  2I1K A;  3FEH A;  2COF A;  4NY0 A;  2GJY A;  1MIX A;  4D0N B;  2Z0Q A;  2DHJ A;  1ZC4 B;  3G9W A;  3TVV A;  2V76 A;  1FHO A;  3V5W A;  1PMS A;  2E2X A;  1X1F A;  3SV1 A;  1DRO A;  1M7E A;  1GC7 A;  1KI1 B;  4GXB A;  4A6F A;  2GCL A;  5JHG A;  4TKN A;  1M7R A;  1MPH A;  2JP2 A;  5D3W A;  2R09 A;  1K5G B;  2LOZ A;  3SUZ A;  1ZSQ A;  3HW2 B;  4ZRI A;  1EGX A;  1MAI A;  2UVM A;  5JHH A;  2HTH B;  4K81 A;  4A6K A;  4MT7 A;  3T06 A;  3F0W A;  2LOX A;  3ULB A;  2RVB B;  1WJ1 A;  3IVF A;  5GOW B;  2I5C A;  2P0D A;  2AEH A;  1FHX A;  4CHJ A;  4F7H A;  3DXC A;  1TJ6 A;  4HAW B;  4DBB A;  3SYX A;  4Z2N A;  1DDV A;  1U5D A;  1B55 A;  1Y5O A;  1Z87 A;  3HQC A;  5FI0 A;  3D8F A;  1MIZ B;  2H7E A;  1V5P A;  3PVL A;  5D3Y A;  5L81 A;  2DKQ A;  5FI1 A;  1QQG A;  2D4Q A;  4IFS A;  2KCJ A;  2ELA A;  2VSZ A;  3ZDT A;  3SO6 A;  4WJ7 A;  2D10 A;  2H7D A;  4GZU A;  3FM8 C;  2MFQ A;  5J3Y A;  5KQ1 A;  4IOY X;  4A5K A;  4KHO A;  2HE7 A;  2MWN B;  1TQZ A;  3VOQ A;  5KCV A;  3DXD A;  2YSZ A;  2CRF A;  3KRW A;  2YVC A;  1DDW A;  2MDX A;  2MKR A;  1BAK A;  2CY5 A;  3KZ1 A;  2UZS A;  4ZRK A;  5C16 A;  4XWX A;  4EJN A;  2UZR A;  1BTK A;  5JLJ B;  2P0H A;  1AQC A;  2RUK B;  4HAZ B;  1FB8 A;  1UPR A;  3FSS A;  4K2O A;  3P7Z A;  1FHW A;  5HE3 A;  2J0K A;  3DXE A;  1MKE A;  5D27 A;  1FAO A;  2N23 A;  4GMX B;  3KRX A;  2G35 A;  1EVH A;  4P7I A;  4Z2M B;  2NMB A;  3AU5 A;  2ROV A;  5CLQ B;  2Y8G A;  3PG7 A;  1TXD A;  3A8P A;  3VIA A;  2M38 A;  2J0J A;  3UZT A;  2DHI A;  2ADZ A;  1X11 A;  2DX5 A;  4YON A;  2KGX B;  4HAU B;  3U8Z A;  1GG3 A;  3ML4 A;  5DHF B;  4EKU A;  1BWN A;  2J0M A;  4HB0 B;  2YT0 A;  1RJ2 A;  2I5F A;  2CAY A;  2YT1 A;  5D3V A;  1X1G A;  2PZ1 A;  5J3T A;  4IAP A;  3D8D A;  1W1H A;  1OY2 A;  3CIK A; 
#chains in the Genus database with same CATH topology
 3X23 A;  2DX1 A;  1KZG A;  5I2M A;  4DXA B;  2FJU B;  3BIN A;  1X86 A;  2D2Q A;  3HIE A;  5DH9 B;  1BTN A;  2GCJ A;  3NWF A;  4PQ0 A;  1U5F A;  2CY4 A;  1P5T A;  5CLL B;  1WJM A;  3QIJ A;  4KHB A;  4C0A A;  2K2U A;  4A6H A;  4CHM A;  4K17 A;  1ZVR A;  3KY9 A;  4F7G A;  1KZ7 A;  3WYF B;  3BJI A;  2D11 A;  3HSA A;  2DLW A;  3LJU X;  2L1C A;  3ZVR A;  1U5G A;  4KAX B;  5C5B B;  1EF1 A;  1AWE A;  3A58 A;  2K2J A;  2D9W A;  1U29 A;  2DTC A;  1MK9 B;  2DYQ A;  2Q13 A;  5DHA B;  4ZRJ A;  3NWA A;  2RLO A;  1H4R A;  2EMS A;  3WA0 A;  1FOE A;  3PZD A;  5HE2 A;  1UEF A;  1SGH A;  3TO1 A;  4KHB B;  3SNH A;  2BCJ A;  2D9Z A;  4HAT B;  1V89 A;  3PP2 A;  2YS3 A;  2QKM A;  1XKE A;  1NTV A;  2KR0 A;  2DN6 A;  4H8S A;  3U12 A;  3MDB C;  1U27 A;  1WI1 A;  2YS5 A;  1UNQ A;  4GN1 A;  1XX0 A;  2OQB A;  2GS0 A;  3TW1 A;  3PVW A;  1Q67 A;  2W2X D;  1MK7 B;  4OSN A;  3P6A A;  1UPQ A;  3A98 B;  3M1I B;  1NTY A;  1U2B A;  1XCG A;  2M14 A;  1K5D B;  2NBV A;  5EFX A;  2KIE A;  1P3R A;  3TCA A;  1V5M A;  2K8E A;  2Z59 A;  1NI2 A;  2EMT A;  1N3H A;  2OTX A;  3GYO A;  3HK0 A;  5HE1 A;  2DA0 A;  2W2X C;  2YS1 A;  5J3Q A;  1J19 A;  4CSQ A;  2DFK A;  4TYZ A;  4QJ4 B;  1XOD A;  5C6R A;  3A8Q A;  4HDQ A;  2LYD A;  4A6F B;  2J59 M;  2RSG A;  2YF0 A;  4HAY B;  2D9Y A;  1Y19 B;  2LG1 A;  1E5W A;  2Y7B A;  3CXB B;  3ODO A;  2ROZ B;  1MI1 A;  4L1R A;  1V61 A;  1U5E A;  1J0W A;  1WVH A;  1I2H A;  2N0Y A;  4HAV B;  2Z14 A;  2Z0P A;  1UNR A;  1I7A A;  3PEG A;  2QKL A;  3RCP A;  3ULC A;  5C5B A;  5JP4 A;  3TFM A;  2IYB A;  4Y94 A;  2COD A;  1SHC A;  2COA A;  4MK0 A;  2ZPY A;  1IRS A;  5LON B;  2X18 A;  3PVU A;  1T77 A;  4MY6 A;  2I1J A;  3AU4 A;  2R0D A;  2GUM A;  1UNP A;  2YRY A;  1NU2 A;  3QBV B;  2EJ8 A;  2LKO A;  3KSY A;  2NZ8 B;  3F5R A;  4BBK A;  4B6H A;  2VKI A;  2K00 A;  2P8V A;  4WSF A;  1EAZ A;  1XD4 A;  1W1D A;  4NSW A;  2EC1 A;  2P0F A;  5DI9 B;  2Y8F A;  2L2I A;  4D6W A;  1PFJ A;  1P6S A;  4GMV A;  1DDM A;  1W1G A;  4HB4 B;  2RGN B;  2KUP A;  4KHA A;  4OT1 A;  1WG7 A;  4F7U P;  3AJ4 A;  4WVF B;  1WGU A;  5KQ4 A;  5HE0 A;  1OMW A;  1LB1 A;  4EMO A;  4PNK A;  2ELB A;  4GPT B;  1WGQ A;  4DX8 A;  1H10 A;  2FJL A;  1ISN A;  4HB3 B;  4GOU A;  1PLS A;  4L6E A;  1X05 A;  1ZC3 B;  2W2W A;  1QC6 A;  2IFS A;  3U7D A;  5I2S A;  3ODX A;  1ZYI A;  2DKP A;  2KUQ A;  3NSU A;  2VRW B;  4HDO A;  1DBH A;  4K2P A;  1GC6 A;  1LW3 A;  1XR0 B;  3MPX A;  2RNR B;  4DX9 0;  4HHV A;  4YL8 A;  4CYE A;  5LOP B;  2AL6 A;  5C79 A;  1ZM0 A;  4QJ5 B;  5DIF B;  1FGZ A;  4QXA B;  2COC A;  3D8E A;  3OAN A;  3DCX A;  2D9X A;  3N7C A;  1RRP B;  3ODW A;  2LUL A;  5M4Y B;  5D3X A;  4HAX B;  3PSC A;  3QWM A;  1OQN A;  3GYP A;  2D9V A;  1V88 A;  4HB2 B;  2DYN A;  1V5U A;  1DYN A;  2DHK A;  2Z0O A;  2XQN M;  3O96 A;  4KVG B;  1FGY A;  2I1K A;  3FEH A;  2COF A;  2R2Y A;  4NY0 A;  2GJY A;  1MIX A;  4D0N B;  2Z0Q A;  2DHJ A;  2Z13 A;  1ZC4 B;  3G9W A;  3TVV A;  2V76 A;  1FHO A;  3V5W A;  1PMS A;  2E2X A;  1X1F A;  3SV1 A;  1DRO A;  1M7E A;  1GC7 A;  1KI1 B;  4GXB A;  4A6F A;  2GCL A;  5JHG A;  4TKN A;  1M7R A;  1MPH A;  2JP2 A;  5D3W A;  2R09 A;  3NWD A;  1K5G B;  4DIX A;  2LOZ A;  3SUZ A;  1ZSQ A;  3HW2 B;  4ZRI A;  1EGX A;  1MAI A;  2UVM A;  5JHH A;  2HTH B;  4K81 A;  4A6K A;  5LG4 B;  4MT7 A;  3T06 A;  3F0W A;  2LOX A;  3ULB A;  2RVB B;  1WJ1 A;  3IVF A;  5GOW B;  4HSI A;  2I5C A;  2P0D A;  2AEH A;  2ZKM X;  3B77 A;  1FHX A;  4CHJ A;  4F7H A;  3DXC A;  1TJ6 A;  4HAW B;  3OHM B;  4DBB A;  3SYX A;  4Z2N A;  1DDV A;  1U5D A;  1B55 A;  1Y5O A;  1Z87 A;  3HQC A;  5FI0 A;  3D8F A;  1MIZ B;  2H7E A;  1V5P A;  3PVL A;  5D3Y A;  5L81 A;  2DKQ A;  5FI1 A;  1QQG A;  2RRF A;  2D4Q A;  4IFS A;  2KCJ A;  2ELA A;  2VSZ A;  3ZDT A;  3SO6 A;  4WJ7 A;  2D10 A;  2H7D A;  4GZU A;  3FM8 C;  2MFQ A;  5J3Y A;  5KQ1 A;  4IOY X;  4A5K A;  4KHO A;  2HE7 A;  2MWN B;  1TQZ A;  3VOQ A;  5KCV A;  3DXD A;  2YSZ A;  2CRF A;  3KRW A;  2YVC A;  1DDW A;  2MDX A;  2MKR A;  1BAK A;  2CY5 A;  3KZ1 A;  2UZS A;  3NW8 A;  5IRS A;  4ZRK A;  5C16 A;  2Z4D A;  4XWX A;  2YT2 A;  4EJN A;  2UZR A;  1BTK A;  5JLJ B;  2P0H A;  1AQC A;  2RUK B;  1FB8 A;  3FSS A;  1UPR A;  4HAZ B;  4K2O A;  3P7Z A;  1FHW A;  5HE3 A;  2J0K A;  3DXE A;  1MKE A;  2KIG A;  4GNK B;  5D27 A;  1FAO A;  2N23 A;  3FVC A;  4GMX B;  3KRX A;  2G35 A;  1EVH A;  4P7I A;  4Z2M B;  2NMB A;  3AU5 A;  2ROV A;  5CLQ B;  2Y8G A;  3PG7 A;  1TXD A;  3A8P A;  3VIA A;  2M38 A;  2J0J A;  3UZT A;  2DHI A;  2ADZ A;  1X11 A;  2DX5 A;  4YON A;  2KGX B;  4HAU B;  3U8Z A;  1GG3 A;  3ML4 A;  5DHF B;  4EKU A;  1BWN A;  2J0M A;  4HB0 B;  2YT0 A;  1RJ2 A;  2K49 A;  2I5F A;  2CAY A;  2YT1 A;  5D3V A;  1X1G A;  2PZ1 A;  5J3T A;  4IAP A;  3D8D A;  1W1H A;  1OY2 A;  4QJ3 B;  3CIK A; 
#chains in the Genus database with same CATH homology
 3X23 A;  2DX1 A;  1KZG A;  4DXA B;  3BIN A;  1X86 A;  2D2Q A;  5DH9 B;  1BTN A;  2GCJ A;  4PQ0 A;  1U5F A;  2CY4 A;  1P5T A;  5CLL B;  1WJM A;  3QIJ A;  4C0A A;  2K2U A;  4A6H A;  4CHM A;  4K17 A;  1ZVR A;  3KY9 A;  4F7G A;  1KZ7 A;  3WYF B;  3BJI A;  2D11 A;  2DLW A;  3LJU X;  2L1C A;  3ZVR A;  1U5G A;  4KAX B;  5C5B B;  1EF1 A;  1AWE A;  2K2J A;  2D9W A;  1U29 A;  2DTC A;  1MK9 B;  2DYQ A;  2Q13 A;  5DHA B;  4ZRJ A;  2RLO A;  1H4R A;  2EMS A;  3WA0 A;  1FOE A;  3PZD A;  5HE2 A;  1UEF A;  1SGH A;  3TO1 A;  4KHB B;  3SNH A;  2BCJ A;  2D9Z A;  4HAT B;  1V89 A;  3PP2 A;  2YS3 A;  2QKM A;  1XKE A;  1NTV A;  2DN6 A;  4H8S A;  3MDB C;  1U27 A;  1WI1 A;  2YS5 A;  1UNQ A;  4GN1 A;  1XX0 A;  2OQB A;  2GS0 A;  3TW1 A;  3PVW A;  1Q67 A;  2W2X D;  1MK7 B;  1UPQ A;  3M1I B;  3A98 B;  3P6A A;  1NTY A;  1U2B A;  1XCG A;  2M14 A;  1K5D B;  5EFX A;  1P3R A;  3TCA A;  1V5M A;  1NI2 A;  2EMT A;  1N3H A;  2OTX A;  3GYO A;  3HK0 A;  5HE1 A;  2DA0 A;  2W2X C;  2YS1 A;  5J3Q A;  1J19 A;  2DFK A;  4TYZ A;  1XOD A;  5C6R A;  3A8Q A;  4HDQ A;  2LYD A;  4A6F B;  2J59 M;  2RSG A;  2YF0 A;  4HAY B;  2D9Y A;  1Y19 B;  2LG1 A;  1E5W A;  2Y7B A;  3CXB B;  3ODO A;  2ROZ B;  1V61 A;  1U5E A;  1J0W A;  1WVH A;  1I2H A;  2N0Y A;  4HAV B;  2Z0P A;  1UNR A;  1I7A A;  3PEG A;  2QKL A;  3RCP A;  3ULC A;  5C5B A;  5JP4 A;  3TFM A;  2IYB A;  4Y94 A;  2COD A;  1SHC A;  2COA A;  4MK0 A;  2ZPY A;  1IRS A;  5LON B;  2X18 A;  3PVU A;  4MY6 A;  2I1J A;  3AU4 A;  2R0D A;  1UNP A;  2YRY A;  1NU2 A;  3QBV B;  2EJ8 A;  2LKO A;  3KSY A;  2NZ8 B;  3F5R A;  4BBK A;  4B6H A;  2VKI A;  2K00 A;  2P8V A;  4WSF A;  1EAZ A;  1XD4 A;  1W1D A;  4NSW A;  2EC1 A;  2P0F A;  5DI9 B;  2Y8F A;  2L2I A;  1PFJ A;  1P6S A;  4GMV A;  1DDM A;  1W1G A;  4HB4 B;  2RGN B;  2KUP A;  4KHA A;  1WG7 A;  4F7U P;  3AJ4 A;  4WVF B;  1WGU A;  5KQ4 A;  5HE0 A;  1OMW A;  1LB1 A;  4EMO A;  4PNK A;  2ELB A;  4GPT B;  1WGQ A;  4DX8 A;  1H10 A;  2FJL A;  1ISN A;  4HB3 B;  1PLS A;  4L6E A;  1X05 A;  1ZC3 B;  2W2W A;  1QC6 A;  2IFS A;  3U7D A;  3ODX A;  2DKP A;  3NSU A;  2VRW B;  4HDO A;  1DBH A;  4K2P A;  1GC6 A;  1LW3 A;  1XR0 B;  3MPX A;  2RNR B;  4DX9 0;  4HHV A;  4YL8 A;  4CYE A;  5LOP B;  2AL6 A;  5C79 A;  1ZM0 A;  5DIF B;  1FGZ A;  2COC A;  3D8E A;  3OAN A;  2D9X A;  3N7C A;  1RRP B;  3ODW A;  2LUL A;  5D3X A;  4HAX B;  3PSC A;  3QWM A;  1OQN A;  3GYP A;  2D9V A;  1V88 A;  4HB2 B;  2DYN A;  1V5U A;  1DYN A;  2DHK A;  2Z0O A;  2XQN M;  3O96 A;  4KVG B;  1FGY A;  2I1K A;  3FEH A;  2COF A;  4NY0 A;  2GJY A;  1MIX A;  4D0N B;  2Z0Q A;  2DHJ A;  1ZC4 B;  3G9W A;  3TVV A;  2V76 A;  1FHO A;  3V5W A;  1PMS A;  2E2X A;  1X1F A;  3SV1 A;  1DRO A;  1M7E A;  1GC7 A;  1KI1 B;  4GXB A;  4A6F A;  2GCL A;  5JHG A;  4TKN A;  1M7R A;  1MPH A;  2JP2 A;  5D3W A;  2R09 A;  1K5G B;  2LOZ A;  3SUZ A;  1ZSQ A;  3HW2 B;  4ZRI A;  1EGX A;  1MAI A;  2UVM A;  5JHH A;  2HTH B;  4K81 A;  4A6K A;  4MT7 A;  3T06 A;  3F0W A;  2LOX A;  3ULB A;  2RVB B;  1WJ1 A;  3IVF A;  5GOW B;  2I5C A;  2P0D A;  2AEH A;  1FHX A;  4CHJ A;  4F7H A;  3DXC A;  1TJ6 A;  4HAW B;  4DBB A;  3SYX A;  4Z2N A;  1DDV A;  1U5D A;  1B55 A;  1Y5O A;  1Z87 A;  3HQC A;  5FI0 A;  3D8F A;  1MIZ B;  2H7E A;  1V5P A;  3PVL A;  5D3Y A;  5L81 A;  2DKQ A;  5FI1 A;  1QQG A;  2D4Q A;  4IFS A;  2KCJ A;  2ELA A;  2VSZ A;  3ZDT A;  3SO6 A;  4WJ7 A;  2D10 A;  2H7D A;  4GZU A;  3FM8 C;  2MFQ A;  5J3Y A;  5KQ1 A;  4IOY X;  4A5K A;  4KHO A;  2HE7 A;  2MWN B;  1TQZ A;  3VOQ A;  5KCV A;  3DXD A;  2YSZ A;  2CRF A;  3KRW A;  2YVC A;  1DDW A;  2MDX A;  2MKR A;  1BAK A;  2CY5 A;  3KZ1 A;  2UZS A;  4ZRK A;  5C16 A;  4XWX A;  4EJN A;  2UZR A;  1BTK A;  5JLJ B;  2P0H A;  1AQC A;  2RUK B;  4HAZ B;  1FB8 A;  1UPR A;  3FSS A;  4K2O A;  3P7Z A;  1FHW A;  5HE3 A;  2J0K A;  3DXE A;  1MKE A;  5D27 A;  1FAO A;  2N23 A;  4GMX B;  3KRX A;  2G35 A;  1EVH A;  4P7I A;  4Z2M B;  2NMB A;  3AU5 A;  2ROV A;  5CLQ B;  2Y8G A;  3PG7 A;  1TXD A;  3A8P A;  3VIA A;  2M38 A;  2J0J A;  3UZT A;  2DHI A;  2ADZ A;  1X11 A;  2DX5 A;  4YON A;  2KGX B;  4HAU B;  3U8Z A;  1GG3 A;  3ML4 A;  5DHF B;  4EKU A;  1BWN A;  2J0M A;  4HB0 B;  2YT0 A;  1RJ2 A;  2I5F A;  2CAY A;  2YT1 A;  5D3V A;  1X1G A;  2PZ1 A;  5J3T A;  4IAP A;  3D8D A;  1W1H A;  1OY2 A;  3CIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...