1MPTA

Crystal structure of a new alkaline serine protease (m-protease) from bacillus sp. ksm-k16
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGVAALVKQKNPSWSNVQIRNHLKNTATGLGNTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M-PROTEASE
publication title Structure of a new alkaline serine protease (M-protease) from Bacillus sp. KSM-K16.
pubmed doi rcsb
source organism Bacillus clausii
molecule tags Serine proteinase
total genus 90
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1994-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1mptA00
5ARCA 2QTWB 2XRMA 3AJ8A 3A3OA 3BPSA 3Q40A 1Y3BE 3BX1A 2W2QA 1KE1A 1THMA 1SUEA 3QMPA 1PJ8A 2XTJA 5AVJA 1AH2A 4DWWA 1OYOA 1ZVKA 5ARBA 1GA4A 1BH6A 1SUPA 3VTAA 5AVKA 2SNIE 5FAXA 3EDYA 2ID8A 1A2QA 3VSBA 4H6XA 1IC6A 2B6NA 3PRKE 3WIUA 1BJRE 2IXTA 1SELA 1SH7A 1HT3A 3TI9A 1BFKA 2ZRQA 1T1GA 1KE2A 5CW1A 5JXHA 1WMDA 1P8JA 1SVNA 1Y9ZA 1GNVA 1GCIA 2WUWE 1TO1E 1GT91 1R0RE 3I37X 3QFHA 5K7SA 1AU9A 1WSDA 4JP8A 1UBNA 1S2NA 3BGOS 2ZWOA 1TM4E 3T41A 1ZVJA 2PWBA 3DVQX 1AK9A 1YJBA 1Y48E 2PWAA 2SECE 3VV2A 5JMOA 1PEKE 3I30X 1SBCA 4CG0A 4M1ZA 3GT3A 3WHIA 4WOBA 2Z30A 3Q5GA 3SQOA 1WMFA 1LW6E 3DVSX 3DE5X 4I0WB 4K8RB 4LVNA 3DE7X 1Y33E 1V5IA 4GI3A 4KG7A 3SICE 1PTKA 1XF1A 3CO0S 1AQNA 1ST3A 2TECE 1MEEA 5B1DA 2Z2ZA 1Q5PA 4H6WA 2V8BA 1BFUA 1OT5A 2SBTA 1TMGE 4C3UA 1SBIA 1BE8A 1R64A 1Y4AE 1GA1A 3VHQA 1C9MA 2G4VA 4NE9A 1SCBA 2DP4E 3D43A 2W2OA 1VSBA 3GCWA 3TECE 1Y4DE 1C9NA 1GNSA 1C9JA 3GT4A 3DDZX 4RYDA 5JXIA 5JXJA 5ARDA 5FBZA 1S02A 2W2PA 3DE3X 2GKOA 3L1KA 4MZDA 4AKSA 4J94A 3DW1X 1SIOA 1TO2E 2ST1A 4YN3A 1GTL1 4ZOQI 1DUIA 2PYZA 3I2YX 3ZXXA 1SBHA 3LPDA 2Z2XA 1KDVA 3LPCA 1R6VA 2WUVA 2PMWB 4KB5A 1SBNE 5SICE 3P5BA 1Y3DE 2PKCA 1WMEA 1SUBA 4HX2A 1T1EA 2WWTA 2DUJA 3ZXYA 1EA7A 1P7WA 1ST2A 1TM1E 2ID4A 1C3LA 3DE1X 4BWGA 3VYVA 2PQ2A 1GTG1 5I9SA 3GCXA 4DJ5X 1YU6A 3OSZA 3DE0X 1AVTA 3HJRA 4OMCA 1SIUA 1TK2A 2E1PA 1NDQA 1TM3E 1S01A 4NE7A 1SIBE 1DBIA 4DZTA 1MPTA 5AMXA 1SUAA 3A3NA 1SBTA 1GTJ1 1AF4A 1SCDA 2Z2YA 4ZARA 3H42B 3I34X 1GA6A 3TI7A 3LPAA 3DE2X 1OYVA 1TM5E 3A3PA 3UNXA 2WV7A 3DWEX 1SCJA 1BE6A 1SPBS 3F7OA 4OMDA 3WQBA 1WVMA 3EIFA 2HPZA 4CFYA 3F7MA 1TECE 1SUDA 1T1IA 1NDUA 2W2NA 3WIVA 1SCAA 4HVLA 5FFNA 2P4EA 4B5LA 3AFGA 1CNMA 3F49S 2ZWPA 3DE4X 3EE6A 1SCNE 2Z56A 1SUCA 3D9QX 3PTLA 4H6VA 1Y34E 4OV6B 3DYBA 1SN7A 4FONA 1PFGA 2DQKA 2W2MA 1KDZA 2SICE 2X8JB 4LVOA 3CNQS 4CFZA 1YJAA 3DE6X 2PRKA 1Y3FE 1KDYA 3DW3X 1TM7E 1AV7A 2IY9A 1EGQA 2HD4A 3QTLA 1YJCA 1Y1KE 1JEAA 1NLUA 3DVRX 1P7VA 3AJ9A 5B1EA 4KPGA 3VV3A 1IAVA 2Z57A 2X8JA 4NMXB 5AQEA 1Y3CE 4C3VA 5JXGA 2Z58A 4AKTA 4WOCA 4Z2AA 1CSEE 1V6CA 3LXUX
chains in the Genus database with same CATH superfamily
2GN9A 3IIMA 5ARCA 4BVJA 2JPDA 4RMIA 3STTA 1J5XA 3BRWA 5DOVA 2BRUC 2CC2A 3BT7A 4RKWA 1PGPA 4G5OA 3INNA 2XITA 1L1QA 4GRIA 3A11A 1DU4A 2CKDA 2PKWA 4N7RA 4Y9UA 4NFSA 1II9A 3COSA 3B38A 2WQ7A 2D13A 2Q6LA 1PJ8A 1D0IA 2IYEA 2DH5A 3H84A 4BO6A 1CIPA 2AN4A 2E4YA 4MI9A 2KQUA 3WNDA 1EIWA 1ONOA 4HNRA 1L3BA 4WK6A 3DD1A 1XZDA 1LF5A 4PFQA 5AOAA 2YFKA 3TSWA 4BE7B 3IUYA 4DWWA 4Z4CA 5JPCA 2QN2A 4Q3CA 1XZQA 3DBLA 4JSTA 3ZN2A 3K71B 5TMPA 1SVKA 3CT6A 4FC7A 2ZE8A 4JXKA 4ZMRA 3ICOA 3O8LA 1NQVA 5C52B 3UHAA 1NU6A 3CV3A 3RRMA 3KC2A 1IN4A 3T7EA 5FPPA 2MWMA 5JIBA 1R1DA 5CFZA 4ALNA 2I2AA 1TU0A 2W4IA 1G41A 1SKBA 1D0VA 2PKQP 3OUZA 3PRKE 5CLLA 3W5DA 2I34A 4PO8A 1JVNA 2RHRA 2WM3A 3M1IA 4HDKB 5CYFA 3VUFA 4AP6A 2JGJA 3G1WA 2YJZA 4FEEA 3MZ0A 2JHGA 3ZZ1A 4GT1A 3TTXA 1WO8A 3T7SA 1ISGA 4INPA 2O8BB 1BRMA 1NVDA 4GX1A 1UKEA 1AS3A 3ZHYA 1YRYE 1DIRA 1NXXA 2RGWA 4NWIA 5CW1A 1KHHA 3DF7A 1AKVA 1O6BA 1PWZA 2VS1A 1TT5A 4E3WA 3ETEA 1NGSA 1WMDA 3BL8A 3HJTA 1DQPA 3K0SA 3M49A 4WESB 1ZNYA 2Q0XA 1RI5A 1WABA 2WSMA 3UAGA 4BU0A 4E46A 4EJ0A 4G0QA 1QU2A 4MUGA 4GHWA 4NCIA 4PTLA 1KJ8A 5AQ1A 4MB2A 1HDEA 1MKYA 3GV0A 3OFKA 3W90A 3LQ1A 4DMLA 2JIDA 1GIAA 3NETA 3QIVA 3PQ8A 3IAEA 2PN1A 2QQ5A 4QSMA 3ZXSA 3PX7A 2PX3A 1X2BA 1RVDA 4MS1B 4XQ9A 4QYMA 3AEUA 1ZD9A 3N1UA 3ZS8A 1W59A 3NWPA 2BSXA 5KQSA 1HDGO 4NNJA 4B6QA 2WZQA 3EQ9A 3CUWA 4RDXA 4NX2A 3T1HB 3NATA 3H5AA 4I1UA 1GSIA 3OIVA 2EOAA 2PWYA 1FQJA 3C6MA 1IAQA 1N8SA 1A7JA 2VUHB 4JT4A 4V0LA 1SQSA 1COZA 1UXHA 3JWHA 5F7OA 3HCFA 4NMLA 1T5TA 2R9VA 3GU3A 5DNWA 5JRJA 3KHSA 1KYZA 2J3LA 2EGHA 3PHLA 1EEHA 1C4OA 1AK9A 3UHPA 4E2WA 1IOZA 1G8PA 2OCXA 1IXYA 2M9MA 3IDZA 4PPYA 5D87A 4R31A 1NG1A 4D9IA 3DO6A 3GLQA 1F2DA 1ADYA 5D7BA 5EE5B 2C1EA 3BZUA 4KJXA 5LN1A 1Z0DA 3KIPA 4IJWA 9LDTA 2AEEA 4TZ0A 4XPZA 3DLHA 1OBVA 1QBKC 2PWPA 1T9DA 3MA0A 1K3FA 4J1TC 3RTCA 2WV9A 5TPZA 2H3HA 2XEXA 4OJNA 4PPNA 2FRDA 1WF3A 3W5IA 1WUYA 4JC0A 2F1HA 1OFTA 2MTBA 4UDOA 4YWJA 3LLMA 3S0JA 4B8YA 2W9XA 3DBHA 3DMPA 5H9WA 3MINB 4Z9YA 5GZ6A 1JR3A 4RKFA 5AOVA 2HPVA 1RM0A 3JATB 5L3VA 1XTRA 5I4IA 3KKQA 2QRVA 3AVWA 1N6NA 2RGNC 3RW9A 3KKMA 2P65A 4KO2S 4X1IB 1R0SA 1JE0A 1TYZA 2AFIB 3BHJA 1DT3A 1T4CB 1TU4A 3NVMB 2WWXA 3QWIA 4WKBA 3AVYA 4DLXA 3R3UA 1WKVA 4PLTA 3Q87B 1COWD 2IXAA 3CX8A 4L5CA 4UOQA 3Q1KA 4WFKA 4X1OA 1IXKA 2XQJA 2LIVA 3A2MA 2QVCA 2QVGA 3MB8A 4LBVA 2YV4A 4ZOEA 5HUQA 1RPZA 2O2JA 2GARA 5JATA 2C59A 4GLFA 3H3FA 2X9LA 5CVCA 1O94A 2A1UB 4K1LA 4UREA 2PLNA 4KYIB 1WW2A 5BMOA 4HDNA 4XYBA 3NTRA 3KLMX 4MX8A 3V2UA 4DR4B 3OP1A 3CRVA 3W8DA 1MJFA 2YVUA 3B1JA 1BJTA 3MILA 3UUGA 4KAJA 3K1YA 4QDOA 4TQUS 4G67A 3IKVA 1OGYA 3NHRA 1OCEA 2ZUTA 2EKZA 1PWEA 1ZISA 2VDNB 1E1MA 3EBPA 1A96A 2H31A 3QE2A 4X00A 4AQYB 3JXEA 3NASA 3FUTA 2XCSB 2NVUB 5EZQA 3PC7A 2J0EA 3B1WA 2PFKA 3GGDA 4K3VA 4KYTA 1P1HA 5DHQA 5CT6A 4DMRA 1LPBB 2Y1LA 3CH7A 4GR5A 5B1DA 4WDRA 1YRLA 5B5SA 4XW2A 5AKGA 2VJKA 5T57A 3WWEA 4DCJA 2UVDA 1ZW1A 3B13B 4H6WA 4KIUA 1GPUA 3I5XA 2SKDA 4QICA 5FOSA 4PYOA 4EVRA 4OLBA 1XZ8A 1T1JA 4H7JA 3I2GA 4MWSA 1FSFA 2QYTA 2HCTA 3LIIA 3T5GA 2VQSA 4D9MA 1SBIA 2FDRA 4Y67A 1JIXA 2VBGA 1YS7A 1R64A 3D6MA 1EUDB 3FPJA 4JSRA 1V16B 4LE1A 3VHQA 4C6SA 5H8WA 4RU1A 5JCPA 1E1QA 3JD3A 3B3JA 4CEIA 5H02A 4G5GA 4DYHA 4PAMA 4ZPJA 1XZBA 1AUXA 4NE9A 4M89A 3TLYA 4U7JA 3B7WA 4UMDA 3ROKA 4AECA 4AWXA 4GG1A 4W1PA 4JKOA 3LQYA 4BQPA 1V9CA 1HRDA 2G09A 2PUWA 2Y05A 3N6VA 1Y4DE 4NZZA 4Q3AA 5MGBA 4MDHA 5H68A 2N75A 3EFHA 3O7MA 1P7CA 3KQSA 4TVBA 3N8KA 4FIZA 4LRTB 4H15A 4LTMA 3IUEA 4JKIA 4PLHA 2YWXA 4WN3A 3R5SA 5BSFA 5FAKA 5A3SA 1PUXA 4HDQB 2JEZA 1WZCA 3EVZA 3G5LA 1JU9A 4HAXA 5K0GA 2UUOA 2WC1A 4GQIA 2Q5LA 4QBIA 2AFRA 1F06A 4CCAA 3NXSA 4P6VF 3PT5A 4D8YA 3R6DA 4YRPA 1NXVA 2AEFA 2NU6A 2HK7A 3U3OA 1QC5A 1R37A 1VKRA 4L07A 3WQQA 3UXMA 2CDAA 4HPJB 1G21E 5CT9A 4WXYB 4AQDA 4HEA6 4A91A 1V7QA 2WEKA 3QKRA 4WLUA 4JLOA 3ZJYA 4XUGB 3NEYA 5LBTA 4DR3B 3HMQA 1XPRA 1L4BA 4II7A 4F4JA 5PGMA 4G9EA 4Q4AB 1L5RA 3EIOA 1LDBA 4AF7A 1DBVO 1UM8A 2R6AA 5JCOC 1K63A 3VR5A 4JLMA 1YNOA 3DZHA 3PC4A 3E7WA 3A4YA 5GJWC 3L4SO 4AMVA 4BNXA 2MSCB 4F5ZA 3L0ZA 1I3CA 1YR3A 5KX5F 1KEEB 1Y3AA 1IM8A 1GG5A 1YFZA 4GWGA 4LOLA 2ETVA 3ZXUB 5IAEA 1TTQB 5CMLA 1EWYA 5FI0B 4B6RA 4EGJA 4Y2GA 2N47A 1V8OA 5EEHA 3UFXB 1SC6A 2QL5A 2Y6VA 3OE4A 4W7IA 1U9IA 3LBAA 3II6X 2RCYA 3HJHA 4ZOLF 4EFMA 2I4TA 3G0IA 3OJEA 4RVOA 1O8CA 4FQ7A 4PINA 3SYMA 5B6IA 4TLAA 4LYYA 5J4HA 4MCHA 4DBVO 3BSWA 4B3CA 1WSWA 4U9UA 3DLAA 5KYTA 3OH8A 2JGDB 2R11A 5IVIA 4Y1EA 4OXXA 2QIPA 1IQ0A 3D8SA 1GV1A 4TLLB 5BO5A 4M98A 1Z4OA 4BWGA 2ZIFA 1ZN7A 3WRYC 1XI2A 3VYVA 2AXPA 2G8NA 3LLSA 4F8JA 2BH2A 1Z73A 1J9GA 4L16A 4AX4A 5JNTA 2M6RA 4DJ5X 1CB7A 3SR4A 3VUEA 2RJOA 4UTZA 4ZVUA 4N3GA 2PUHA 1ZJZA 5KIAA 1TUBB 3IBTA 3V42A 2JK0A 1CUGA 4JBXA 1P2TA 4X90A 1P9NA 1EXMA 1A8PA 5TARA 1CUSA 1QYIA 4XDZA 1OX5A 5HXAA 5BNTA 4V3CA 1OFVA 2Y27A 1L7PA 2F64A 2FEWB 2GTHA 1DEAA 1H2XA 3QMMA 5T67A 3FSRA 2OLJA 1A2OA 2IKQA 2ZEJA 5AKKA 3S40A 5BR1A 1ND5A 2FP3A 3KOXA 4HWKA 2CVFA 4D8VA 4DZTA 1I0LA 2WLSA 3PYMA 3WK8A 5AMXA 3W6UA 5C8YF 3ZVNA 2P0YA 4BFYA 1KJIA 4EBFA 4Z53A 1JJBA 3O74A 4ALIA 4C20A 2R7MA 4OHFA 5I9BA 5IUNC 1UFVA 1QVAA 1T5HX 2OB1A 1NJ6A 2X5XA 2ZRPA 1HFJA 2NSYA 4XQEA 3I34X 1MB4A 3OEHD 3VKFA 5IAKA 3K8YA 1V95A 4JVLA 2PO7A 3ICPA 2NZ8A 3FH0A 2QVLA 13PKA 2A5DA 4ZO9A 4YIHA 5JBIA 1HLPA 3OY7A 4V3BA 5H82A 1TFUA 2WE7A 2ZIVB 2F4NA 3V4LA 1QLJA 4N7BA 3A6PC 2JFQA 1FDIA 1FMTA 3DZGA 3ZBPA 1BZYA 1D2MA 1RDFA 3TLMA 1NBIA 1FLDA 3OF2A 1XJ0A 1XQVA 2XA2A 4TXJA 3T34A 2UZ1A 3FDIA 1W88B 4MGZR 2X6TA 3E35A 3FCEA 3GRCA 3PHBE 1FFYA 1OWOA 1UFRA 2PZEA 3IXMA 5F2KA 2B36A 3X43A 2EDCA 1VFNA 1KU0A 1JJIA 2HPZA 3CZ5A 5LXTF 2ZYSA 3Q8MA 2Q6KA 3DL0A 1IPHA 3OO0A 2BHNA 1HNZB 5BMVA 1AK2A 2KM1A 2XGMA 3JQAA 4W5JA 2WW8A 5CFPA 5AHOA 1CQWA 2D1FA 2YX1A 3IIIA 4N39A 1U65A 1E18A 2B5OA 2QTLA 2ZI3A 3KLBA 4D8WA 3U3MA 3TD6A 1PGOA 2HIAA 3P97A 1SCAA 1WRBA 4H27A 4CDGA 3OOSA 1KFKB 1Z6YA 2P4EA 1N2CB 1KY5A 1O5IA 1GYPA 1FMJA 2JCSA 1XD2A 2O0JA 2PMBA 1QIMA 1E2NA 2YY5A 3ET4A 5FF9A 5JJ5A 1FUKA 3AZOA 2ASEA 1PKXA 2X0NA 2HLHA 3FETA 1NUUA 1KZ9A 3EQ7A 3IIJA 1CPYA 2PX0A 3OEWA 4RZUA 4YO8A 3EPKA 3W8EA 3WTBA 1YCDA 4LXGA 1VJ1A 2AUTA 3S28A 3OKPA 2Z2IA 3SX0A 1SUCA 2HYDA 1T3ZA 1YIDA 4N8EA 5FNVA 3EFEA 3SS8A 5TB5A 1NVVQ 4QHYA 4JVSB 2IYXA 4FCCA 1AGRA 1KAHA 2NV6A 3LW7A 3DO8A 5EPUA 4FN4A 5KNBH 3CN9A 4S1OA 1HTBA 1AQUA 1IM2A 1Q7CA 2P4SA 2R7LA 3A9SA 1LFDB 1NPYA 3RTGA 4A2CA 4EQ6B 4DV6B 3VVMA 5K8LA 2W00A 3WGUA 1AKMA 1S2LA 3ILVA 2ZK7A 1USUA 1PJSA 5JJBA 5I7VA 2VWQA 1DS6A 3N76A 5KSOA 3SE7A 3RRZA 1KR2A 1EK6A 2SICE 1U2EA 3CWCA 3I9KA 4HGOA 1H9AA 2R97A 4M0MA 2IBSA 2H59A 3ZIAD 3KUUA 5KPDA 2MYPA 3ZHBA 4FOTA 2QQEA 3SDSA 4LQCA 3S3TA 1ZMOA 3EUAA 2GVDC 4F45A 4YXFA 5IFLA 2QEQA 3VC7A 1TM7E 1SQ6A 3AZQA 4TWRA 3OZXA 3TLXA 5EKSA 4GNKA 3PZRA 3RC2A 2VA8A 4A27A 2WHYA 3KJZA 5EMHA 5EZYB 1KVRA 1A9ZA 3K96A 4QYXA 4RSGA 1Z56C 2I6UA 4R1UA 1EVJA 2G4LA 2JZOA 2VZEA 3X2SA 3A6JA 3QTLA 4PBRA 1DKQA 3WNZA 1KO1A 2QN9A 1KVTA 1S2MA 1ECJA 2QP9X 4G24A 4G4GA 4L15A 4BZXA 3OE5A 3DBRB 4TQ9A 3X1MA 1VE7A 4G97A 5KTNA 3QE9Y 2OFPA 2XDWA 2PMFA 4JU9A 1XVLA 1NLMA 3KAPA 1V9SA 5CB0A 5LMUB 1YDMA 4DXHA 3F73A 1E2BA 1Q74A 3W7AA 4V0QA 3UHFA 3NW9A 5TQ0A 3ZX5A 1ANKA 3LYLA 1NWHA 4HUJA 4UEOA 4AJNA 1MJNA 4FYHA 2HK9A 1T25A 4J7XA 2FMXA 4BN4A 2VP5A 1ORHA 2HJWA 4HDMB 4BB9A 3F4BA 4XE5A 2ORYA 2RGYA 3EPRA 3L1UA 4UXIA 4WLNA 1E79D 1EBUA 2Y93A 3BMNB 3EEYA 4GP6A 4U1RA 4H2DA 2I1LA 4N5MA 2WZBA 2ZJAA 3L49A 4ASUA 3IV6A 3BQNB 3OHPA 3VI3B 1WHSA 3L8ZA 3OZEA 4D3FA 2OP1A 4C0XA 5DLQC 1IE3A 1YU9A 3P96A 3R5HA 4OK5A 2B35A 5H80A 2R87A 2NXNA 5D51S 4O29A 1F0NA 2HJRA 2I6QA 3C3DA 1HDYA 1Z88A 1YK0A 3F5FA 1Z33A 1NI4B 1FCJA 3GBVA 3Q0TA 2YFYA 3OWHA 1E3SA 1K4KA 5DTRA 2BEVB 4DUGD 5KEIA 5LZ2A 3QX3A 4MV1A 2LXNA 4PCVA 1PS9A 5DI3B 1JDBB 5EJ6A 2G9QA 5HM6A 2WJPA 2X9QA 3D6HA 2MSKA 3IEIA 2FY8A 3FD8A 1QIJA 2A3NA 2FRVA 3PI6A 1PR1A 3BMOB 4G1CA 2QMHA 4K6MA 2PH5A 1U2SA 1WS6A 4MWOA 2GCPA 2E4ZA 2X4GA 5CNIA 5DULA 2V4UA 5CJJA 1B6GA 1PWHA 5DB4A 3ZHVA 5ITVA 5JJLA 2XMZA 2ZJ6A 3H0CA 3HY3A 4TKMA 2F1JA 1VKJA 3T9CA 3FPKA 1KQGA 4ITUA 4KFUA 5EG5A 2CMKA 3EA5A 4Q4HA 5D2CA 4KLRA 1OLUB 3EC2A 3U6KA 3MUEA 3EXFA 1J8YF 4B71A 5LLSA 1QNFA 1M2JA 3IEUA 3IV7A 3N58A 4UASA 5LQKA 4HYEA 1NMZA 2BH9A 2CL7X 3DTNA 3JASA 3VXKA 1XRJA 1UMBB 5DNVA 1NHGA 1RMYA 1MX3A 4HWPA 4JT9A 1YDEA 4P22A 1CU1A 1ADCA 4DNXA 1JWAB 2BM0A 4P82A 4Q66C 3EGDA 3T6KA 2ZRJA 1D2EA 4DMGA 3VJRA 2HSWA 3E53A 4IX9A 3I12A 3CZRA 3RVMA 1IMJA 3PGLA 1VYVA 3TI9A 1M9NA 3AERB 4FUTA 4FC6A 1KJYA 3BIFA 2O3TA 3WMWA 3ZDYB 3TL6A 3VH3A 3BDAA 5EHXA 3AEQA 3UV6A 2E6UX 5JSFA 3UK2A 1TT7A 1U0HC 2Q5CA 1RT9A 2WABA 4XCQA 2L17A 3KYCB 2AZDA 2INGX 2POCA 3ETGA 3Q98A 2ZCUA 4LJ5A 2DPYA 3FOWA 5DSTA 4DV2B 2JG3A 1FFSA 4UCWA 3WMFA 3WSTA 1JA0A 2AOTB 4DDWA 3HR4A 2VOEA 3L0DA 5GV8A 1QP4A 1DWPA 4E5NA 2NZJA 3E84A 4BX2A 3OFND 4BFVA 3MWGA 3S2IA 1GCOA 3MOSA 4ZI5A 3K30A 3VPXA 4OHVA 4BO7A 2IHKA 2KSQA 2TMKA 2V0NA 5EP1A 1O87A 1Z7WA 5EWLB 3QSYA 2CNOA 3V00A 3C4JA 5B7GA 1EG7A 3LDHA 3CE9A 4JP8A 3EXEA 1ONNA 4S05A 4PLFA 2P1RA 3CX6A 2V6BA 1TM4E 1TJ3A 3N0RA 4FFMA 4ZV9A 4ZTUB 2YINC 2GD6A 2CUNA 1M2FA 3F9RA 3JZDA 1N6RA 3H8WA 2OO5C 4UHDA 1W76A 4Y2YA 5JCZA 1RIIA 1I4TD 4J0HA 5TLSA 1EVEA 3L7NA 1OXTA 2X9NA 4E3ZA 4R8MA 1X19A 2PL1A 4DA8A 5TY0A 1GKLA 3C8DA 3EXHA 3WB0A 3TLJA 5BT8A 2CLHB 5AR1A 4CF3A 1B1CA 3KKOA 2Y0CA 3GMIA 3NVDA 1DKUA 1QRUA 1RPAA 3I9LA 4XAQA 1HZZC 1JAIA 4OK3A 4TZTA 3MTGA 5KWIA 2WF7A 4RFLA 1R6TA 1P44A 3I30X 3V8QA 4AJJA 1RAIA 3HC7A 3ZTWA 3UHJA 1C7EA 3OPYI 4LJ9A 4UTPA 4A8JB 4M0UA 2O2DA 4J9UE 3ECSA 3ISTA 3MIZA 2FN7A 5JJCA 1GWNA 5LA6A 5EN4A 3ERCA 3LIPA 3HZOA 4DY4A 3RFCA 1FL9A 5B36A 2WYOA 2Q6OA 4UNNA 5HILA 3RC1A 1GAQA 1QFXA 3MWLA 4G2NA 2CYAA 3EQ2A 1RRFA 3U4IA 1NYRA 3WKDA 1LPOA 4YRKA 4DEVA 2HXSA 2V7QD 3RABA 3L7OA 3DTVD 4XD7A 2GH1A 4OHZA 1NRIA 5A6SA 3EMVA 3P0JA 5LQSA 1F4LA 3G2QA 1QIKA 2NW6A 4XVRA 1WU8A 3SQOA 1Z8DA 4D97A 4TVKA 5IK2A 5HKKD 4YIKA 1XKTA 1X0VA 3CLTC 5AWFC 1VE9A 4B4OA 2C29D 4GR4A 1MDBA 1T5SA 3ETNA 4OOEA 1XZMA 2HRZA 3QLVA 4WEQA 4YO7A 1JLRA 4KPYA 2QN1A 1V41E 3DE7X 1Z0ZA 2JAWA 1E3JA 3VYWA 2ZJ3A 3MTAA 2R00A 3I1IA 3NALA 1LI7A 3CPJB 5FBWB 2X19A 4O4LB 5LQUA 2NGRA 2EYUA 2XE8A 1WUJS 1DXOA 4TL8A 3C8ZA 4PX5A 4A2QA 3KOOA 1VYUA 1NUQA 2GN2A 3WLOA 5ITSA 4J16A 2JJ2A 2HIMA 1G5FA 2P9QA 2OHIA 3AOEA 2RB5A 3GRKA 3ZU2A 4MYDA 2BGIA 4KX5A 1A2BA 1FDTA 4MS4B 1RADA 4ESOA 2OB2A 3L8FA 2HMUA 3P0FA 1DWQA 2EP8A 5JD4A 1CE8A 1X80B 2L0XA 4JBYA 3NVKI 2ECOA 3B20A 5DM2A 3K8ZA 4YP9A 1FFXB 3V7YA 1F14A 3RB8A 4D9HA 2FE4A 5CB6A 2ERYA 3GLKA 3QVMA 3ESBA 2RGCA 3TLGB 3IPAA 2ZQYA 3HM9A 1BVRA 1O9HA 2IF0A 3X2FA 1TJYA 3ROEA 1QS0A 3HLKA 3U2QA 3N2ZB 3LQFA 3OESA 1GPDG 3OQIB 4Q7KA 4A4DA 3NTUA 1ZL0A 1JSXA 4XWOA 4GXTA 4WNCA 5C35A 3KJNA 4YLGA 3U4AA 1E6WA 3ESXA 4PF1A 3RS9A 2IU4A 4P4SB 5ECDA 4LV5B 9ATCA 1NVKA 3CLTD 1UDAA 2GRJA 3E82A 5I7HA 4ZCPA 3C3YA 3PP8A 1W73A 2BZ0A 1VL6A 1PCXA 4L8VA 1JPNA 4WASA 5H7XA 1FFEA 4FE7A 1IBSA 2QF7A 2QMQA 3BDIA 1FNCA 2ZBQA 4ZO7A 2BDUA 4WFJA 4BVGA 1U3CA 1SCKA 1ZGBA 4QT4A 3HB7A 4KL8S 2QZ4A 3HV2A 1F1JA 3O84A 1QVZA 1N1DA 2X5JO 3B2QA 3DULA 2VHCA 4O2BF 2DAPA 1EEXB 3AR9A 5CA0A 3WLAA 3U3KA 4JB0A 2C2ZA 3WRYA 1DX9A 1T2UA 4Q03A 5D5QA 1IQPA 4LZZA 3LVQE 3OBIA 1FMCA 1HG1A 3QBDA 3HY6A 4URWR 4W7HA 2TRSB 3ESRA 1SC3A 1VL2A 5DI9A 1ZUIA 3TOXA 1JG6A 2QAGC 1YULA 2B21A 5DW3A 1DQSA 4IJMA 4PNPA 3WHPA 2C1ZA 3KK0A 4Q37A 4GOKA 4HPXB 2H7VA 1GUDA 4FR0A 1XSEA 1NWCA 4MUJA 3C1OA 5CVUA 4YS6A 3HYRA 3T15A 2HV9A 2FX2A 3H65A 3LKZA 4ZYUA 3FDXA 4RVGA 5LPNA 4G1EB 8AT1A 3T3OA 5FL7D 3HBMA 1DMSA 4UDXX 1JKIA 3CW2A 1NHWA 1SXJA 3VSCA 5H4GA 3NP9A 1Y37A 4YR7A 4B7XA 5KYNA 4ZQCB 4BP1A 2A88A 4FUQA 1IDN1 4YV7A 3IEKA 3IP6A 4WDQA 4ZRNA 3FHJA 5LDDC 4L78A 3CZPA 3VR4D 5B2ZA 1IJEA 2NO0A 1V2HE 5IT0A 4JHXA 2UUBB 1ESMA 4DCGA 3IKJA 4TOIA 2HWWA 1BW9B 2XA1A 2JGNA 4H0NA 3K32A 4IPTA 1I32A 2OZLA 1DEOA 1PR4A 1S96A 4RV9A 2RD2A 3BCRA 4RADA 4WA8A 5LYJF 2I7CA 3W6ZA 4KAFA 3C74A 4UMFA 4YRRA 4BHTA 1GQFA 2BHRA 3Q10A 1KDPA 4WLOA 1K97A 5SYMA 3OCVA 4AULA 3L06A 2I78A 5G3YA 1AHNA 4HX2A 4U63A 5G0VA 4CIWA 3AL0C 4IVQA 1T1EA 2LTAA 2UYQA 4KQMA 2P2DA 3B52X 3F98A 1XYVA 3HB1A 1P7WA 4DLWA 1TUEA 5BR4A 2PH7A 3E8SA 1PJ4A 1H94A 1E7RA 3TZBA 1UANA 3L4BC 3OX3A 4HGPA 3F46A 3EGIA 1MT3A 1YIAA 4FOSA 4D79A 1MD9A 1WPGA 4NOJA 4P1ZA 4DV3B 3SNHA 1U6JA 1W4BA 2OFWA 3PSHA 1S1MA 1M8JA 5DKFA 3WSVA 4C78A 1BVYF 1B0UA 2YVKA 3EIHA 4Q7QA 5E6UB 3GLGA 1XGKA 1C1DA 3I6IA 4JR1A 1VRWA 4IV5A 3DB2A 2WNIA 2KE5A 4C0LA 3BMCA 5DGIA 3I2IA 3VKVA 4L72A 4R2IA 1P45A 3FYUC 4IGEA 4MWCA 1EBBA 4C2AA 2I4LA 3K2EA 3N0VA 1ZRHA 4NBLA 1DBIA 4BE9A 1U11A 1NMSA 3MG9A 4FSXA 4BNGA 1EU1A 4ER5A 4ZIRB 3MM4A 1E5LA 1WXDA 3TLBA 5IM4F 3WLLA 3S68A 4BXOB 3HYCA 2AXNA 5CD1A 2YTZA 2O7VA 1KAQA 4IXTA 2B1QA 4O33A 3H7IA 1AF4A 2NV0A 3ZZTA 4ZARA 1R0BA 4E2FA 1ODSA 1S7GA 2HBQA 3ROPA 4A2PA 4ZALA 1ZK4A 4YRBA 2ZUCA 1QGUB 1M1YA 3EIQA 4L6CA 1QPZA 1FU8A 1W0CA 1Z4IA 2RAPA 3H9CA 1IHDA 2EKBA 4IDGA 2VSYA 4WLFA 4NAUA 3MJEA 3UPDA 3PB3A 3BFJA 1L5WA 1M1UA 5HFJA 1UQRA 2Q3LA 1SJ9A 3WADA 2D54A 1KA9H 2CKMA 3I6QA 4L4SA 4O63O 3FB1A 4RHTA 4F8YA 1HE1C 1F51E 2J3DA 4KXUA 3DT9A 1GILA 1IEVA 3K09C 4MV0A 1R5JA 2ZATA 5GP1A 4B48A 1H5QA 1KAMA 3PNMA 2CHFA 2G9UA 2QLNA 4H16A 5IXYA 1JSLA 3M4JA 1R8XA 1VIYA 1P2VA 2WRZA 3RAJA 4XI9A 4X1KA 4B44A 1MOZA 4P83A 4CR6A 5BOSA 2Q49A 3LRXA 4BVHA 4NICA 1NF2A 2O8DA 2EJUA 2VNSA 2FUNB 4NOKA 4QYIB 4JP2A 5BURA 4N41A 1KEUA 2XSZD 3BFKA 3HPQA 3K4PA 4NEHB 1ZMRA 3V34A 2WPDA 2VAPA 3QUTA 3ZNPA 2EGUA 2W48A 1HK7A 2WUDA 1NDUA 5SY4A 3VYRB 1KC1A 3GFBA 3LUAA 3H5NA 5A7HA 4ZDKA 2OBBA 3ZHOA 3HZHA 3UCXA 1BKSB 2A5FA 2K6GA 2WJ6A 3EMBA 1A72A 1QHSA 4MVJD 1U2PA 2JIMA 2FOXA 4GGPA 5JAIA 1E1KA 2C2KA 3G2LA 1NZDA 3PK0A 1P0FA 1PFVA 3EGVA 5DHTA 4OSPA 1YI8A 4C21A 2A5JA 2JA1A 1EXVA 4PRKA 5K3OA 2ACVA 4M6WA 1CP2A 4G26A 5AVVA 1GNPA 1WU7A 3ZZUA 2O20A 2OD2A 4UOZA 2DTEA 1QR6A 1RE0A 4AYXA 1SVWA 2QAJA 3FPLA 4HUQA 2ZXUA 1CYEA 5CT5A 3G0DA 5LLTA 1M66A 1G5PA 2W7TA 3BWDD 3D3WA 3ELUA 4AJ2A 2VK4A 4O25A 4C07A 4BECA 1AUPA 2I4NA 3KTAA 5LP6F 2XPCA 4WZAB 3JQDA 3T12A 2XCIA 4EYGA 1E2MA 3BSSA 1E6EA 2JLUA 4FQ5A 2Q27A 2XUIA 3DZBA 3O90A 1JIQA 3AO0B 3I83A 4GOJA 5EHQA 2M6KA 3TB4A 4CQMA 4Y6RA 2W2XA 3A4IA 3NLLA 1EK2A 4FMPA 3M5WA 4CLRB 1NV8A 3GAMA 2EX0A 3FNGA 4KI7A 5JDIC 2NACA 5I7FA 5J2TB 1PZFA 1EDEA 2Q8PA 3PPWA 2P6UA 3KTOA 3QF4B 4FE4A 3C3AA 1GAEO 4J0CA 5EJ5A 1WPXA 1ELOA 3KVVA 1WOMA 4X97A 3W2TA 2OENG 2NV2B 3EZXA 1W36B 1E0KA 4YPVA 2OBNA 2H52A 3CIFA 1KDYA 1QYRA 1T8RA 1T8YA 2WOJA 1C1XB 4HQFA 4PX9A 5IEBA 5B57C 2XY4A 1ZNXA 5BRJA 3L7AA 2FEXA 5E0OA 5JHGB 3I6ZA 4QL3A 1IRXA 4PY2A 1TZMA 2MINB 1QRSA 4V24A 3O75A 2RMKA 4IRXA 4OAOA 4AJ4A 2RGGA 1JMYA 3DQZA 4R2JA 3ODPA 5AK0A 4BFZA 1U28C 4RSRA 1K86A 2WJIA 3F2IA 3DVRX 4DTIA 3FAKA 3IJRA 4GBED 4HD8A 4CYMA 5M04A 4CQJA 1K68A 1QMGA 3D31A 2ILTA 1LI5A 3MTJA 1K75A 2RAFA 4ES6A 2J59A 5ESXA 1NZJA 2BONA 4P32A 3NTLA 1P61B 3GRYA 3GJYA 4XYMA 2EHJA 1FXUA 3UVEA 2W6JD 3OZCA 2EFEB 2NUAA 4BNIA 4F97A 1R0WA 1CUBA 1GQ2A 3RJTA 2ZSIA 3FBTA 2IHVA 4MVXA 4BMZA 3ND5A 5FORA 4BCDA 3KB8A 3QXHA 4EQZA 1QZUA 5DN9A 1EGAA 1SHJA 3SBEA 3LP8A 2ZT7A 1W2HA 1NFRA 2P1ZA 3IUQA 4JH0A 4PC6A 1OE0A 2J45A 3NWOA 1XDBA 1J25A 2ECKA 3LUKA 3R3WA 2FKNA 4EA7A 1V45E 4ZKDA 3BQMB 1NVGA 2F00A 2ZE6A 3IQIX 1USIA 4GXQA 4TWIA 4ZEOA 3QTTA 1K6JA 4LDRA 3ZGVA 2PUJA 3DGEC 2P41A 4G0PA 1KK1A 1Z2OX 2C4NA 4JR0A 3H18A 1K7XB 1VXRA 3Q3IA 4PYNA 1A2KC 1CKEA 1WDKA 2XUKA 4KBFA 2AI1A 1UDXA 3DVAB 1Y3BE 4HK4A 1J0XO 5FDFA 4L02A 1RIFA 3Q3JB 1HZJA 4MDYA 4PO9A 3GN1A 1LEHA 3L92A 4M8NE 3R76A 2CJFA 1E3MA 1WZUA 3E0QA 3T3EA 2NSDA 1VCHA 1UPAA 3GXBA 2HIHA 3QUAA 4JQYA 1NW9B 3FIUA 4DARA 4II3A 1JR6A 2J8ZA 3DKIA 5KNLA 1ZKMA 2Y1WA 1HMPA 1DHTA 2AG1A 2GEUA 5DYWA 2H06A 4GX0A 3STXA 2ZZMA 1QE0A 1JT9A 2O9JA 2XQIA 3PNVA 1VMDA 6REQB 4QOHA 2PFSA 2R8EA 4HTFB 4HGQA 3RYHB 1ZEJA 1JFVA 1JXAA 1XFAA 4DIDA 2OAQ1 3R7SA 1VDMA 1J2YA 2ZM5A 1EIZA 5FAXA 2Q29A 1GTVA 3VYUB 4AZ3A 3CX7A 4WPGA 1ZGCA 2YWBA 3CNBA 4LF4B 2HCRA 3KJQA 3TE7A 4A0FA 1EAMA 4OB7A 2HWYA 2AOVA 3JAMA 4QFMA 1CHNA 1Q20A 4H6XA 4HATA 2PZJA 2IX3A 1HZZA 3ITDA 3STHA 5DRTA 3WRWA 4IO0A 3S5JA 1X86B 1GPWB 2QP4A 2CDRA 3GUVA 4S2EA 1DXQA 3TIGA 2H1RA 1M6EX 3DDUA 2AD1A 2ZRQA 4TTRA 1CJMA 1MC4A 4TT3A 4EFDA 4C7KA 5JBNA 5C32A 3DCIA 4IQ0A 4IFIA 1NE7A 1N0VC 3K0CC 3TKAA 2IKSA 5KX5B 5LU9A 3OOJA 1C4KA 3EWNA 3I92A 4TV9A 3MPUA 1A77A 1MEJA 1R8YA 1VJTA 3DONA 4MQBA 4YT2A 3WGNA 2B7LA 3CUVA 3M8KA 3UGTA 1H05A 2GN1A 3FG9A 1H2WA 3RYCA 3J81A 3IT2A 4KQ9A 3D81A 5BN4B 4XUCA 4DNPA 4F11A 1E61A 1R0RE 1P73A 4S1PA 3JAWA 1L5YA 1WSDA 2BGTA 3SX4A 3WBKA 2CXSA 4C0KA 2DT8A 2A59A 2PBRA 4X93A 1TZ2A 1BDMA 4F46A 1PF7E 2QD5A 2BBSA 1E3WA 1UBNA 1SZPA 3ZWPA 5LYYA 1E2EA 4MWDA 2WYHA 3UH1A 3WGTA 4W5RA 4B3TB 2EBHX 5DYTA 2GVZC 2DWOA 2VH1A 1KAEA 2YZKA 4B4VA 2BL4A 2K7FA 5KJCA 1DTSA 2AMVA 3IODA 1T3GA 4G5QA 3QY9A 1WZNA 1KIFA 3QEAZ 4XYGA 5F7ZA 1U0OC 3E3MA 4C4YA 1R4AA 1BGVA 3D3EA 3VJLA 1ISIA 5C7IO 1GLVA 1PZXA 2N1BA 4JROA 1R16A 3KXLA 1HYGA 2GK7A 2AI3A 1I33A 5TPWB 3VFDA 2Q4RA 2BKXA 2GVNA 4UU7A 4BZZA 4G63A 3G1TA 1OD6A 4DR5B 4H59A 5AYVA 3WIEA 1FSZA 2BR3A 4KWHA 4WFIA 3AR3A 3SLKA 2GF0A 1FUIA 2W0MA 2WD7A 2A8YA 2XUFA 3BOSA 4UHKA 2ZIUB 3GXOA 1O03A 1PEKE 3GX1A 2CVZA 3X3HA 2ZZNA 1J90A 5E1OA 4MWBA 2X1MA 1W87A 1K0FA 2EZ8A 4ARVA 2W2KB 4H1HA 4X3CA 2DULA 1DRKA 1SKQA 5C8YB 5DEOA 2P4HX 1UWCA 3GLHB 5A5GA 4TMYA 3LY8A 1JQAA 1YGYA 5CR9A 1D1TA 4E6PA 1NL3A 2GWHA 3BRSA 1Q1EA 5BN1A 3FZGA 4LKRA 1NKTA 4PSCA 3M5DA 5EXXA 3SS7X 1QO0A 2Q9AA 3GGOA 3DSRA 3OLVA 3TNJA 4OLJA 2BJWA 1WDMA 1BAPA 1IN8A 2XJ4A 5JD6A 2G9ZA 3JVVA 2WSIA 2JH8A 4C0BA 4OGGA 4LHZA 2B37A 1XRSB 4KXMA 3PE4A 2BP7B 3WGIA 2O2HA 3C3CA 5F64A 3ZE7A 2WHQA 1ZM3A 3LDFA 3OT4A 1KYYA 4W9RA 4JDPA 2VDJA 5BR7A 2QYSA 1CV2A 2PKRA 1QAOA 3HXMA 2VXBA 1UOOA 1P4GA 4RZQA 5E1MA 2Q3DA 3OD1A 4KFSA 4NBNA 5TGDA 2H4ZA 4FDTA 4MW7A 3WNQA 1W96A 1G5HA 4JUCA 4BAUA 5DT2A 1Z25A 2XF8A 4GD3Q 4YRGA 5D84A 4N48A 3WV5A 4LRUA 5MDHA 3U7EB 4W9NC 1JYFA 3B2EA 4R2LA 4RZ3A 1HWYA 1JV2B 5FHQA 1L7QA 5LXTB 1G4HA 4XWYA 5EXEA 3U37A 4R8SA 2W6NA 2J5RA 2IYOA 3R40A 3C5HA 3NP7A 3IVXA 4JHLA 3WXBA 4M1WA 1TKCA 2VYCA 1U4NA 3U44B 1MEEA 1DB3A 3D3NA 4EO7A 4AF6A 1BQ3A 2Q5QA 4PLWA 1ZPDA 1A1SA 3NDPA 5KWJA 1RKVA 4EUSA 2C4TA 4IIYA 4BNKA 4DLYA 2DR0A 3O95A 4R98A 3RLIA 4ZK2A 5G40A 3B48A 1T8SA 2JGAA 2V8BA 1PT7A 1U3UA 2AYYA 4CLEA 1FFWA 3SOZA 3LWDA 4UNQA 5G02A 1JLLA 4EY8A 5HG0A 2BI8A 1VTKA 1BXGA 2CN1A 4IGKA 4OD0A 2AKEA 2XX3A 4HJRA 1ZU4A 4LC0A 5JJIA 1I1HA 5IPFA 1RW4A 1S2GA 1SCIA 3ZWKA 3KWFA 1CY0A 4B4KA 4TUYA 3NAQA 2JVJA 2LW7A 4I55F 4JEHA 2Q7OE 5JC1A 2YKGA 3UA3A 2IS6A 1OC2A 3LZDA 5FRDA 1Q0TA 1G21A 3HCBA 3LCUA 4KDFA 4WE3A 1SCBA 4UAGA 1KGDA 3CH5A 1MQ9A 4MP3A 2CFRA 2G7MC 3B12A 2FSFA 3ZWQA 4V02A 3E9CA 2ZRFA 4KQCA 3SMQA 5IABA 1TEZA 2VSXA 3EGXA 2Z95A 3NHAA 5E6SA 2VSOA 3E7PA 1UBOS 5DO9A 4YT4A 2XMCA 4IIUA 4WXEA 1SVLA 3AKYA 3P9RA 4MYCA 4NZPA 1NMEA 1U1FA 4DWOA 4FHCA 4ZCMA 3K70C 1UDCA 1E9DA 2UZIR 4H3SA 1QH0A 2P77A 2VNHA 1NSTA 5JXIA 1OZHA 4NH4A 5ARDA 4Q1BA 1Q0ZA 3GHHA 1ISFA 2XMPA 3P9KA 4MWGA 3ZBUA 4YCCA 5JI3E 4ZAVA 5BSHA 3O8OB 1VL1A 5C5EA 1KMQA 4P7JA 4C4XA 2HDWA 2GKOA 3ZDEA 4NJMB 2PPLA 2J87A 3AESA 3T0IA 5BWNA 2YWCA 2VBCA 3PR3A 5JFOA 1C9DB 3ZDBA 1NJ2A 1BHJA 3T35A 3R3XA 3OCCA 1W0JA 2IYQA 1OGJA 2IYNA 1YQUA 1TW3A 3DWFA 4NZMA 5E7MA 4ZYVA 3HXPA 4FHEA 1VBFA 4LNUA 4HR7A 1LCIA 2B69A 5HYVA 2ZTHA 3M4ZA 4LCBA 1Y9DA 1ZYUA 2ST1A 3BFPA 3REQB 4BFWA 1UAGA 4DPLA 4QRHA 1V3TA 1RU3A 1PSZA 5E7QA 3DH0A 1KFJB 4Y2TA 4M3NA 5AVSA 2BZSA 4NQRA 2V6GA 4V03A 4MMYB 3GZNB 4M8LA 3OQ1A 3AUYA 2CNLA 2IYTA 1SR8A 1A7UA 4NKRA 3LPCA 1XV5A 3IEPA 3NGMA 1YJXA 3KXDA 1SAYA 3CPEA 2NO7A 5ENDA 3RG2A 3RS5A 4EZBA 1M0SA 4B6OA 2GCGA 5AUQA 4GAEA 3UCFA 1L7EA 3PC2A 3E4CA 3RDPA 3K70D 1XMIA 3CSUA 5K51A 3TIIA 4M7RA 3P5BA 5FA6A 4RZIA 1E0AA 2JGRA 2OXRA 4WI1A 2QBYB 5CB4F 2YHIB 3OU7A 4RTSA 3BXPA 2VNJA 4HGNA 1RI2A 4Z7OB 1INLA 1X9HA 1E4EA 1Y89A 1ZBDA 1YCHA 4HWRA 3MUOA 4ZQBA 4TYMA 4DRZA 2O48X 1ZN2A 3KT8A 3LPLA 2OG2A 4P92A 2WDPA 3K09A 5JRZA 3IO5A 3CLVA 5I5EA 4QUIA 1XL1A 3WQRA 2I9KA 1HX7A 4U0JA 1BE1A 5IULC 4DDUA 2GBLC 8MHTA 2R1TA 2C2OA 5I3CA 1ZIOA 1DAOA 4AG5A 5I9SA 2PYIA 1Q0RA 3CEJA 4DA6A 5EE1A 5KWEA 1GFIA 1QPBA 1DKPA 1F8XA 4IBOA 4LIPD 4LZPA 5ALRA 5FBHA 4D44A 5K3BA 3MBOA 1AVTA 2B82A 4JLJA 4WNIA 2ORVA 2QD2A 1PJTA 2VHWA 1DWOA 2FP4A 3TIVA 4LF5B 1U8UA 2V8OA 4UDNA 2QPLA 4R2MA 2H4XA 2VAMA 4XUDA 3E8XA 2XUGA 4KH0A 2RFLA 2H2HA 3AVXA 1Z6ZA 2X5KO 4OGKA 5B1SA 1PZHA 3AR7A 1IOWA 4LOKA 3JQ9C 1RD4A 2DBZA 4DV5B 1KBOA 1QFSA 1KO8A 2XVXA 3FPHA 3ONEA 3R3VA 2P78A 3LL7A 4K5QA 4MICA 5COBA 5FIUA 3RRXA 1Z07A 3PGA1 3SF8B 1W35A 1SXIA 2X5NA 4QO8A 2W11A 3WMEA 4AJEA 2HTEA 2IZ6A 4CU5A 1R66A 2F1IA 5KWSA 4BRWA 2YASA 1H9BA 1YO6A 2D0DA 4XWKA 4EG7A 3H0KA 3HCCA 1P9LA 1N5MA 4K6GA 2X5OA 3V1KA 3HWX1 1N3YA 4COOA 5JTUA 4XYEA 3O9ZA 4MRRA 3PHIA 2C84A 3FLMA 3P9YA 1H85A 2FUEA 3VPCA 2AJ8A 4TTQA 1XCPA 1A9QA 4OUDB 1UPUA 4PLGA 2AQIA 4I4TF 3TFOA 2R8BA 4MLZA 4R0VA 5MGNA 3LYAA 3H8JA 1RYYA 4FEAA 5TEVA 1W9HA 3WGLA 3ZY4A 3MS2A 1WPQA 3QFRA 4C0AC 1KSJA 1R4NA 2C07A 4PHCA 3SM9A 1Q1AA 3VSDA 1S8NA 2ZT8A 2ECQA 1TJ5A 4YJFA 4KR7A 1K08A 3AY0A 4WT7A 3DAOA 3DWEX 4LJ8A 2E48A 4D57A 1ZNQO 1BE6A 1E6LA 3PYXA 4ALMA 4KUEA 3MXOA 3HBLA 4UAJA 1JIKA 3A6HA 3H87A 1VB5A 3W2IA 1P31A 1Y8RA 4HX9A 1N6LA 1KJJA 2GLUA 2YYZA 3HXLA 1DZIA 2BGRA 3GJXC 1MO3A 3QVKA 4FDLA 3QBTA 1F2VA 1P81A 1DXHA 4AY5A 3PNQA 1J5PA 4EEZA 4MQFA 1AGXA 3HJUA 2VQDA 4OHYA 2FG6C 1OZFA 3G68A 2ZUUA 4RA9B 1P1RA 1V7ZA 4QJ5A 3IR6A 3OA2A 2E4XA 4JCOA 3MGGA 4L0QA 2HC9A 3S2UA 2FPKA 1JQEA 1PV2A 4BB0A 4B5LA 4HVLA 4FSHA 4H7KA 1RRVA 1ULUA 3ITEA 4F38A 1DRJA 3OWOA 1YQGA 3AMVA 4M86A 3UUWA 5I4KA 2CL6X 5GVSA 3ODGA 4QIHA 4XJXA 4UFPA 2KW5A 2VAXA 4M1MA 2X58A 4G89A 1X3LA 4LY3A 2OV4A 2FOLA 1KZYC 2RDMA 3C70A 4IIHA 4OO3A 4RHUA 3V4PB 4E5PA 1IUPA 5J43A 5IP5A 3STYA 3PEEA 1QVWA 2QRJA 2OCYC 2GN6A 3L4EA 2SHKA 2B3DA 1GAJA 4RIFA 5B53A 1F4VA 2F2TA 2ZYVX 2P75A 2I67A 3R6LA 2GRUA 3AT1A 3JALA 2VRNA 3QEMB 3WZLA 1Z3CA 1FUYB 4AM8A 2X23A 4L50A 1IONA 1LLFA 4E5MA 1NF8A 1IUOA 4P4GA 3NBFA 5SZHB 1H2YA 1MRSA 1MX1A 1WTAA 2FA9A 5LBUA 2G07A 2GPAA 4Q3LA 5HM8A 1L3CA 3DPIA 4B17A 1M67A 4WCVA 4CMAA 2BIFA 4MUIA 3H5OA 1QYCA 5DHFA 4DDTA 2NT4A 3W7BA 2WMNB 2GPYA 2Q9CA 3LSTA 4V1CI 1V8ZA 2EQAA 2G0TA 1PVDA 3D3QA 1ATZA 3G9ZA 4JX8A 4ZEXA 3CKKA 1UJNA 3KU1A 4JT8A 2ZU0C 4OMFG 3WO0A 2W2TA 1WUHS 2ZQ5A 4OVKA 4CFZA 1YE5A 4CG3A 1E6CA 3VHXB 5I3ZA 2UU9B 2H48A 2JKZA 2QTZA 3OCWA 4WLEA 2J9FB 3EXIB 2PSHA 1LNZA 2PAFA 3WRXA 4BKMA 5BN3A 3ESYA 3L1HA 1X94A 2RIRA 5JO9A 2ZVDA 3E1SA 3F1LA 1W29A 2IY9A 3IVMA 4Z0HO 1MTOA 1PI3A 3KTDA 1KWKA 2E49A 3E9RA 4TTAA 3RYIA 1ML3A 2XQKA 2O1WA 1MV8A 2G7ZA 5DGTA 4ECAA 1HNNA 5CVEA 4ISBA 1IZYA 1JEAA 1IHUA 4JP5A 4O4JA 2FKAA 2OV8A 4WN9B 4WV3A 1LY1A 1QFMA 4H3HB 2CXOA 3P2KA 1TVKB 2YRWA 3OPYA 4O2LA 5BV1A 3WLEA 5KNBD 3TRKA 2A9KA 2CFSA 821PA 1ZVVA 2VK2A 3K1AA 3QU7A 1SCUB 2WWRA 3C7KA 3K53A 3WYNA 3NHSA 3KOYA 3KCQA 1IWBB 1P2UA 1XWWA 2YWEA 5AI6A 1HRKA 1Y5NA 3K2IA 4AJ1A 5GTDA 4ZI7A 3LUGA 5KBYA 2XDAA 5EJ4A 3JZAA 1DDOA 2X86A 4CEHA 3QA3E 1DFIA 5TT0A 2W93A 1HC7A 2XVZA 3I2FA 4ESEA 1IG3A 3I6BA 1E7YA 1Z13A 2N1MA 4FZ5A 2PU5A 3GP5A 3OZIA 3PNOA 4CT4B 4AY6A 3X44A 5EUQB 2XMBA 3BCSA 3DEAA 4R2XA 4C06A 1CEEA 3QKIA 1B93A 1PNQA 4XWTA 2V9CA 2IEYA 1A9YA 3MJSA 2ZWMA 3MGBA 4URYR 3VBEA 1B23P 3T4UA 1JKXA 3A3OA 2RKOA 1P5ZB 4O02B 2XNDD 3NNSA 4BQOA 2ZB4A 4RZXA 1O57A 2J46A 3QFCA 1I6KA 2ZUBA 2FI1A 3E9DA 4PM4A 1CVRA 1RLOA 3ZHXA 1YR2A 4N0DA 1KE1A 4J4TA 4J8PA 2IDMA 4B40A 4BMDA 1GXSA 2B4QA 2ZR0A 3DDOA 4OXRA 3U3RA 2ODPA 5GONF 3CE6A 4ENTA 1QCYA 5ESWA 5K3FA 1NNLA 2CCJA 1E3IA 1YMUA 1P33A 2ATXA 3B6IA 3VU9A 4WVFA 2C5FA 4B31A 5TS2A 4I66A 1MOQA 4DEXA 3BKXA 2VRCD 5AI8A 2AN3A 2MDTA 3KAQA 3HUDA 1JNXX 2XT0A 1QMPA 4M0KA 1ZJJA 1L4YA 4HDSB 2PIAA 2WIDA 2BTOA 3KLNA 3CCFA 2BMFA 5AUPB 5IAOA 1VSVA 1XU9A 1Z3IX 2PJDA 4LWOA 2OZKA 2L69A 4XIJA 5EMNA 3HZZA 1J0CA 1CHDA 2RI6A 2WE8A 1H5UA 4R1TA 4WMLA 2PUDA 3E9QA 1LF0A 1JR4A 3PWSA 1H6BA 3QF7A 2YYYA 2X42A 5B7PA 3OQOA 1ZOOA 5I9TA 1VQ1A 2I55A 2A9PA 3QPAA 3EWSA 3ENZA 3WYFA 4AMUA 3S2YA 4N0MA 4ND8A 1Q1BA 4UBIA 4EB3A 4AQ7A 2YN0A 3I5UA 2AMLA 1SC1A 2AIRA 3G0CA 3RSGA 1TLLA 3LO8A 1QF6A 1LX7A 1Y3HA 4P80A 1HT3A 3MJ4A 1FC0A 3CPHA 4OKNA 3WQSB 4CKEA 3L6CA 1G19A 2TMYA 3DFMA 3FB4A 2BEUB 5D7NA 2YMMA 4DRXA 4EZIA 2C8JA 3EVNA 1JEQB 5ABPA 4EJ2A 1ZQ9A 1XA0A 1T9CA 4EHAA 2ZBVA 3K16A 2GA8A 5DU2A 1PZGA 3N9IA 4GVLA 3PRHA 5LYJB 3OOWA 2GAAA 1G7CA 2WUWE 2NZVG 4GI5A 2XIQA 2YJ4A 4G0UA 2PL9A 3SZ3A 1N2XA 2H4YA 1I2AA 4AUKA 5DOZA 4D42A 4FBGA 4GZLA 4YAFA 5TXGA 4DBZA 3BB4A 4IW3B 4L27A 3T0GA 4BLTA 5LR6A 3IQDB 2HL6A 4UM7A 2YZ7A 4FR5A 5EXDA 1TW2A 1L5HA 4LN1A 3R6WA 3U7QB 5CA1A 2BEJA 3IALA 3PF9A 5KSWB 1VG0B 3UHOA 2H00A 1DQYA 2WIBA 4BYGA 1G8SA 3HKBA 3OPXA 1X13A 2GFQA 3EGEA 4BGIA 4EHHA 4IDBA 5C8ZA 2JBAB 2PTHA 3TSAA 1TADA 5HDBB 4MPPA 3ELBA 3NHWA 2I62A 4NECA 1KOLA 4GGOA 1RXSA 4GMGA 1QGED 3P9XA 3CF0A 3R5FA 4MRVA 1G9SA 5KCMA 3TL2A 1S8OA 1BH2A 2DQYA 4D6XA 4DUPA 5ERXA 2VPXA 1YE8A 1J7KA 2ATIA 1GGEA 2ETXA 1BCRB 3NV7A 4HAUA 3K9WA 4QD3A 4S35A 1PJQA 2PKYX 4QQKA 4ETIA 1JFSA 2P8JA 1NSYA 2H85A 4HTAA 4PAGA 3CVWA 2TS1A 2QJFA 3BJIC 4WCDA 3VNBA 5LOVF 4GZ5A 1NQWA 2DY1A 3RFTA 3UYLA 1O96B 1H6CA 4BV2A 1PDVA 2XYHA 4JAVC 1B00A 1YDWA 4IICA 2PGDA 7MDHA 1R6DA 2JJYA 1RS0A 1V6AA 3GP3A 4KGZA 2XYQA 3TTWA 2YZNA 5K0EA 5BSGA 1BYUA 4FHDA 3SXUA 1ZM2A 3AF6A 1Z8NA 2W8BB 3GCDA 4CW7A 5J2UF 3E3OA 3EX7C 2LCIA 2GM3A 3S2EA 2G9NA 4NMMA 4PZ0A 3VDMA 3W5CA 2VDUE 2EC5A 2O7RA 2O2CA 3K0FA 1NSFA 5I8ZA 4B8WA 4LZAA 2LDXA 3ASZA 3KB2A 4V0RA 1M0EA 1DIAA 3IRUA 2X0DA 1JDPA 1PQPA 2WU8A 2HX1A 4MGEA 4XQCA 5G4KA 1PZMA 1N7HA 1P7ZA 2DBQA 3S7TA 1FYEA 3H83A 5FB3A 5T64A 4IZHA 3PI7A 4YCLA 1SA0B 2R8YA 4FYMA 4NYMQ 5HGXA 3I5AA 1JMVA 2GSDA 3WLTA 3EZYA 2PZFA 3IE2A 2ID7A 4RCZA 5LQRA 4GBGA 5FWDA 2C2GA 3USZA 2FK8A 5JROA 1R10A 2E18A 5F7XA 4KWCA 1MHTA 3KE9A 1UZAA 1LZLA 4R9SA 4GI3A 4WZBB 3NOQA 4EELA 1F8UA 1KSHA 2FWPA 2P0EA 2P9TA 3FY4A 3OEED 5DBHX 3U39A 1EBFA 2ECPA 3IMEA 4HFJA 1VHDA 2HSEA 3IC5A 2NUPA 4XXHA 4DM7A 2WVHA 1FDUA 5A03A 5K01A 2CEKA 4Y7DA 1AQNA 2H0QA 1ST3A 4W5HA 4ZYXA 4HZUA 1NULA 4UNPA 2Z6UA 1XROA 3EZ6A 4OQNA 3I4LA 4F3RA 1EA5A 4QXMA 2OO7A 1M8PA 1R2QA 4KFRA 4KX3A 5EMMA 3D2AA 1RBMA 1P1BA 2PMEA 4BVAA 2PUFA 2YHAA 1RAFA 1DELA 2J3MA 1QX4A 4TV8A 1X70A 3BWMA 2JLRA 5BUCA 2TYSB 2JH9A 1TMGE 2PT7A 4F4DA 4MUBA 4FYYA 1IXRC 2JBWA 4RFSB 3ORRA 1Y4AE 3K5WA 4EY3A 1C7RA 2HEGA 2IIPA 1RC1A 1ISRA 3L8CA 1ENZA 2VT6A 2RHHA 1I6WA 1OUMA 3Q15C 1X9GA 3ZQKA 3U09A 3CRQA 5JR3A 2JIZA 1OI3A 3CSSA 4IFBA 2EG5A 5F5NA 2VPIA 6NULA 1V11A 3GDGA 1CEXA 4Z1OA 2XW6A 3DV9A 1FRZA 3FNQA 4XA8A 5DN6D 5LP6B 1E5DA 2GZMA 4IQGA 1Q1NA 4H1UA 1CDOA 1P17A 3EVDA 3SXJA 5IH7A 4BFXA 4RF4A 3K72B 2ZBPA 4DA9A 3PJRA 5ALWA 1NV9A 2C2HA 3V1MA 5I6DA 1G9XA 5EE9A 2RGDA 2WT8A 5JDCC 4RYDA 2FR8C 1N57A 1VSTA 2UZ0A 1JNYA 5FBZA 1VPDA 4QEKA 1J00A 2WHPA 3SJ7A 3KHUA 2QLBA 3SJCA 3AEXA 2KX7A 1JLKA 2WINI 4GX2A 3S1AA 4O0LA 3TBHA 1KNQA 2GSWA 2W2PA 3NS7A 3FNRA 2VWHA 5BNWA 3RASA 1DL5A 3L1KA 1RAAA 2ZIGA 2MYTA 4FXPA 3IVAA 1O0BA 1GTRA 4QNNA 4X62B 4RCVA 5M7EA 2DBVO 4EFNA 2HJVA 3RVBA 3B9QA 2D4AA 1NLFA 1OFIA 1AZWA 3LKDA 4MROA 1YZLA 3OETA 4DLAA 4DUZB 3O26A 2I29A 1Z4LA 1U1DA 1KI4A 2QHXA 2QM7A 1L8QA 1XTIA 2O2YA 3CU5A 4UTOA 5ALUA 1DG1G 1JLHA 2PGIA 4ZOAA 4ENRA 5TJHA 2WTXA 1UMDA 3LGAA 3G9XA 4M8SA 3TMYA 2A86A 3O91A 3V8MA 2NYRA 4PYKA 3IXQA 4TKUB 4D98A 4KVAA 2PU7A 4Q9IA 1VFPA 2EQBA 3JAKA 2C8KA 4NDAA 2JGLA 2EATA 1KK0A 3G2KA 4ECEA 3K5HA 5JAPA 4DIUA 1JDTA 1K5DA 1AKTA 5EWJB 5JQGF 1MVLA 1OKKD 3UWSA 1BQ4A 1H4TA 2FN8A 4F2WA 1ZP6A 1UK7A 3GFOA 1T36B 2ZJ2A 3AC0A 4QOGA 5HMLA 1A04A 3R2JA 3PFCA 4TTIA 5GY7A 3HKEB 3U4MA 4NF2A 4N3AA 3FWZA 1P8AA 4YMWA 4S12A 1G5IA 4JXXA 3TQRA 4YUZA 3FWHA 3B89A 5EP2A 4R1LA 1SUBA 2CNKA 5C1DA 4HNUA 2GCOB 5I7EA 4BKQA 3DEZA 4NH0A 1JDBC 3WBBA 3JZMA 4RJJA 2ZQZA 3KKNA 1N5RA 2Z6VA 1SG9A 4WBXC 2F1OA 4RK4A 1C3LA 2WG0A 3EA0A 1OASA 5IN5A 3D7MA 3JQPA 4WCFB 2FWAA 2JKYA 1E69A 1U2GC 1P80A 1XYGA 4LF8B 2P90A 3DYIA 2XKJE 3IMGA 3LP6A 3KO8A 3UC5A 2GN4A 2W6PA 3SR3A 3JD0A 1LNSA 4PEVA 3F7NA 5EP4A 2JC3A 1Q14A 2Y4NA 1L5MA 1M72A 3ZHUA 1SVUA 1Y42X 2GJ8A 2H7CA 2C5BA 3BERA 4F1WA 5AK3A 4M99A 1G3IA 1T26A 2QLMA 4WBNF 2IE8A 3B9PA 2PX5A 3WS7A 4HYYA 5C1OA 4Q1CA 4BQIA 4HCJA 2Y1FA 4BS9A 3C3JA 2KBFA 4WKGA 4J7CA 4UBKA 2V96A 4YJ3A 1H1LA 3ANSA 3I73A 2ZI6A 2ZJYA 4LECA 2QGZA 3CBGA 1S0UA 1SIBE 3PL5A 4FZRA 2EU8A 3G17A 4RD3A 5FPQA 4LZOA 5FUYA 3EVEA 3OECA 3K3PA 4YFVA 2GCNA 1B4DA 1P3Y1 1JDNA 3MT0A 5CBKA 2YH2A 2BKAA 4GI7A 3X1ZA 3R44A 4X0EA 2FPWA 5HZKA 4NZNA 5KOJA 3JYHA 1U8FO 3B60A 1T4CA 5CLQA 1EGHA 1GU7A 3ICVA 2CK3A 4G5XA 2V9ZA 2A7XA 4K6OA 4GKAA 1KVUA 5CUQA 3CZ4A 3BFVA 1NNSA 1TQ6A 4LI0A 1G20E 4XFKA 3CUTA 1X1SA 4CM4A 4PQGA 3MAJA 3U48A 5KQPA 2Y76A 3AEYA 4D9KA 5H3HA 3WRVA 2GXUA 4B0PA 3EUEA 2ZT5A 5BXYA 1DOHA 2ZSUA 3TJZA 1Z82A 3JQCA 7REQB 4U7GA 1EVIA 1H65A 2ZPUA 3EXG1 4IQFA 1OIXA 5IDXA 2W6ZA 1ICIA 3IV9A 3TEFA 3N2KB 2HGZA 2HHAA 3CZMA 1JXMA 1N1EA 4M1EA 3Q72A 3ZHQA 1JFFB 1TPZA 4KNWA 4D3YA 2GZRA 2I03A 3HVHA 4IDEA 3FCSB 5AHKA 1MAHA 3B1XA 4G1VA 3ZEAA 3GLHE 2FOIA 2YRXA 5KU1A 2IE0A 4DV7B 1M5RA 4UTXA 1XHEA 1MJGM 1XA3A 3CA8A 1F2UB 3DHWC 1MDFA 2HA0A 4E09A 5K8CA 1UIRA 1FIUA 1SUDA 1Q11A 1QDEA 2A9RA 3OTIA 4DQKA 5ALIA 4Z49A 3PJGA 2GJSA 3D6NB 3M2TA 3QOWA 3ELDA 2JHFA 4KE8A 5F12A 4ZANA 1L7MA 3CRMA 1VG1A 2VPQA 1MHPA 1CZHA 4HQ0A 5IBPA 4IDDA 5C51B 1IM5A 2WWGA 4EPRA 1J1UA 3IJEB 2OBXA 1VCOA 1WMBA 1VE1A 4MUEA 3MJDA 3BZWA 5EIXA 1GJRA 3FWYA 3LVBA 4A8JC 5ADHA 2OHJA 3S27A 1YDHA 1TLTA 1ZUNB 1Q12A 3CLUC 2O2GA 3F3SA 4W8HA 4F9GA 2CHVA 3CPSA 3QGMA 1I1OA 2H65A 3H11B 2Q1XA 3R4VA 4ZAFA 4F04A 4GGMX 1IZ7A 1E9FA 5AW3A 1OAKA 4WLVA 1KP3A 5REQB 3SHTA 3UKJA 1C81A 1M6WA 2J4FA 2P5YA 1AGYA 3CSDA 3EHDA 5L4NA 1ZJYA 3KVRA 1RWVA 2BJVA 4N5IX 1M1ZA 1U0BB 3NCHA 5A3VA 1EHIA 4R1PA 4UNIA 4MR8A 2BEWA 1KO7A 2KB0A 3BK7A 4XKJA 5K20A 3L9WA 5MF6A 5ECWA 7ADHA 5TS3A 2ONYA 2G72A 4EJSA 2PUVA 3ESCA 3LFTA 4BIMA 2GZ2A 3FFXA 2I4IA 2Y66A 3O0DA 4P3OA 4RENA 3GELA 4X85A 5HKOA 1K8QA 2UV8A 2JAHA 1C0IA 3GPBA 4YQYA 5EJ9A 1XTUA 2D3WA 2WKPA 2OGZA 4TTVA 4RH0A 3ZTYA 4ENSA 1XEXB 3HI4A 5EIAA 5AHXA 2WYUA 1NYTA 1B43A 1TIBA 4LDAA 3LC7O 1H2BA 2WYIA 3CNHA 2PGOA 4EB6A 4KR3A 2PRKA 3LTNC 1R9NA 1QUFA 2OXFA 2W58A 3P27A 3ZZNA 2CLEB 3DV0B 3ZWVA 4P0PB 1SU8A 1Z2EA 3MELA 1YZHA 1NR7A 3HJGA 1HI9A 2VH5R 4W63A 4JI2B 1X0XA 4RC9A 4XJSA 3EJ6A 1J23A 4L4RA 1PTJC 1R4MA 3CLUD 4XWGA 2FPIB 3M33A 2OM6A 4DNOA 4JP1A 3GJQA 4IIGA 2VDWB 4V0KA 3MMNA 4YP5A 2QG9A 3CVVA 1QTQA 2OOKA 1EFPA 4R51A 4RPLA 1QGDA 2ZJZA 4JNCA 1KH1A 1X2EA 3RS7A 3D5EA 5EFZA 3DLCA 4YVFA 1U2DC 3RUCA 1OWMA 2NP6A 1U8YA 2J7PA 5B30A 2Q4EA 3RYFB 4KE7A 4M7OA 4CIDA 4TN1A 3FF1A 4LZJA 3RVSA 3FA2A 1OSNA 1IJBA 3PFKA 1U3DA 1VJDA 3DOEA 3FTNA 3IHKA 3A9UA 4WXMA 4PZPA 3RO7A 5FO1A 5IXSA 5AM0A 2GZHA 5FA8A 3AB8A 1CDDA 2CLOB 3KXPA 3K2BA 2ZJ8A 1Y3CE 1RP7A 5U9CA 3L41A 1FPQA 2GERA 4CQLA 1SUWA 5I48A 1W48A 4CKBA 1E2LA 1FFDA 1HF3A 2P2YA 5ITZA 3ZE1B 4F4IA 2O19A 2H6EA 4K2HA 1CSEE 4I55B 2P2SA 1WV0A 1ORWA 1CJSA 1YS4A 1X6VA 2IW3A 2D6FA 3CJRA 3R7LA 3P0HA 5GPBA 4PNEA 3BPSA 3HM2A 3W3AD 1OI4A 1EE9A 2CDNA 4JB2A 4CF7A 3PVZA 4DEYA 4NPAA 4ZT2A 1RLMA 4OM8A 3K9NA 3ME5A 1XB2A 4JFAA 4E5VA 2V45A 3FSGA 5CDSA 5JSZA 3GAFA 3N87A 5LB4A 1EZZA 1NP7A 1XEFA 4H7DA 2GK3A 4UD2A 4DLNA 2EZ9A 2QWXA 3QUBA 4CPDA 4YDQA 1JHQA 1TQ2A 1NJ1A 2CF5A 1FYDA 1FX0A 3G8BA 3UO8B 1E1CA 4CCYB 5JFTA 2PS9A 3IERA 2ZYHA 1A4XA 2YXDA 4HQOA 3UT5B 5A1JA 1Z4KA 2EIHA 3O4HA 3AR5A 1H23A 4ZRMA 3F4LA 4JLVA 3MBKA 1TF5A 3OTHA 5HK9A 1EKXA 1C4WA 1JG3A 4JIGA 2SNIE 1QHGA 2IIQA 4QTTB 1JYSA 4LDQA 2X8LA 2JFZA 4G4JA 1EE1A 4M1YA 4XB1A 3W7VA 3WNBA 4C0SA 1V26A 3U1TA 3OFSA 5FPTA 4JA2A 1RC8A 1YRWA 3VOAA 3JPWA 5H5JA 5JHHB 2OM2A 2ZKIA 4NTZA 1XZIA 5I4BA 2JRCA 1UDBA 4XLZA 3HTXA 1TCCA 4ND7A 4XVHA 4GECA 1ZGAA 1M74A 5IDQA 5JS8A 3RS0A 1WP9A 2DETA 5KOHB 1OA1A 2I4OA 1OLXA 2XOXA 3PJDA 5AI9A 3TUIC 4LSGA 1W6UA 4ZVPA 2QJWA 1BKYA 3N0XA 4BGUA 2IYYA 3ZCVA 5LNK6 5BQOA 4D82A 2AZTA 2CGEA 4ZI2A 2XOKA 1E92A 3T1TA 3ADBA 4OUKX 2OUKA 2UYYA 1PSWA 4ESVA 3X1DA 1BDIA 5KYUB 1K06A 4P2BA 1W5EA 2GO1A 2R1VA 2W2LA 4IIDA 2PUCA 3QVVA 4ARCA 1QANA 3OUTA 1JYEA 4FVTA 3F67A 3GFSA 4B1FA 4GXRA 5CB4B 3C3BA 3TTYA 4F0JA 1XNQB 4GDFA 3BICA 3WJ7A 4CL2A 3X0DA 4LDZA 1DX6A 5IJ0B 2IPLA 4Z86A 1QGZA 1VA5A 4FOPA 3OIGA 4HB4A 4AW9A 4KIJA 2WIGA 4JOQA 1D07A 4HHEA 4QXAA 1Z4NA 3PFFA 3WL8A 2ZSDA 2C2XA 2AKAB 1FSSA 2CXNA 4G6ZA 3NM5A 1DBRA 2CB0A 2SCUB 1XDZA 1WHTB 2PT9A 3KZ1E 4M60A 4RXUA 3RSCA 4ZDJA 1MJ5A 5K6TA 4JYZA 2IYZA 1AS2A 1N7JA 1WXQA 1USVA 4MRMA 5JSHA 1GQQA 1ZZEA 2HPAA 4C76A 1WP4A 5BSMA 1KDOA 5MHTA 3PQ3A 4A0RA 1KEZA 4MVJF 1C3JA 1XIVA 3D4OA 4FS8A 2NSJA 3FHOA 3JSAA 1BEUB 4U2KA 1XMSA 3COVA 1FK8A 3LDUA 4PSVA 5DM60 3EOZA 4F4CA 1RQRA 3L7DA 1KU6A 1IG0A 1Z2DA 4KZKA 1DNPA 2ZFUA 4NK4A 4HWSA 2F62A 4O4HA 2XQFA 2VNIA 5EEGA 1BDBA 2TSYB 4BUCA 5FWNA 1VI6A 4LJ7A 3D4NA 4KR6A 1L2TA 2ZB7A 2QT1A 1C2TA 3C2QA 1MJGA 2X7XA 2GJKA 3ZV7A 5I7SA 1N2OA 4Z1MA 3F47A 3EZNA 1LS1A 1J70A 1EM8B 3KL4A 5EIWA 3T06B 2JH3A 3SFZA 1E94E 4P3XA 4XX0A 1BU5A 3GJ5A 1VKOA 3KOWA 4YLYA 2HEIA 3L5OA 1RMTA 1D7AA 3K5IA 3MUFA 2VOJA 3BC1A 4RYLA 4DQDA 3VO1A 3I61A 1QB7A 5G41A 1MIHA 3IUBA 1XNHA 4ZK6A 3LH5A 3Q88A 2NSHA 2WDZA 4DSAA 4XARA 2IEZA 5LDGA 1GPAA 1B0PA 3PF8A 4RTMA 3I2HA 4HQKA 3FPBA 5H70A 3ZWCA 4TWBA 4F4UA 4URZR 2QN3A 3WE7A 3H2SA 3Q7PA 1VECA 1WCIB 1P72A 3BJMA 1SRRA 1XDGA 2FR8A 1V1RB 3PGKA 3RTBA 1U9JA 2FPXA 4UD6A 3MLAA 1E2JA 1S8FA 1TQHA 4XPIA 3N2GA 2Q2OA 2ZBUA 2VKTA 3NEAA 4KODA 1U0FA 1JILA 4G8DA 4NE2A 3ZJ5A 4B3JA 3P1JA 1CQXA 3A6GA 4JLDA 5FWXA 5IH3A 1E6UA 5NULA 1L5GB 4E5SA 3JU3A 5JALA 2OZVA 2O2XA 4F86A 3KP1A 3PC8A 5HQ3B 4FEGA 3E3AA 5TGZA 3V4VB 1EB8A 4R1OA 2EAUA 1FP2A 3PDHA 5KTMA 3QU5A 1YR6A 5HR5A 4OKIA 4Q3BA 2OSVA 4TWAA 5ALLA 5BVHA 4Y2SA 4N5HX 3A8TA 2R6GA 4ZAZA 3NV9A 1C7QA 2XZPA 2LBPA 2DR3A 4RNDB 5DWQA 2Y3IA 4OJYA 4D8TA 4UVGA 1ZMXA 5A02A 1BE8A 4FNMA 3I58A 1RR6A 2PLAA 2D2IA 3BQ9A 3FCCA 3GMTA 5JZ9A 3BDVA 1OI7A 5F51A 4O1MA 5CVDA 5ENVA 1GCGA 1GTZA 1C3OB 3FCXA 1LJ8A 3NOOA 3GFTA 3EA4A 5A9TA 2GUGA 5B55A 1E1YA 3CTPA 1JH8A 1ZAKA 2L19A 1B26A 2XYGA 1XX6A 2Q3JA 2W2OA 2ZSFA 3EIUA 3OIFA 4ILEA 5E4TA 1DG9A 2FF5A 2ZTLA 3VNSA 3LLVA 1XMVA 3RARA 2IFTA 3EW7A 1R3DA 1RJGA 2AG8A 4JS0A 1FTQA 5CD9A 2QE7A 3RD5A 3VPHA 2KBEA 2ZIZA 3LZ6A 1W36C 3D1LA 1F8FA 1JTFA 1CJVC 1LPPA 2QDKA 2FNAA 2W5UA 1EFCA 3H4MA 1JHDA 5TDHA 1XZEA 3KDPA 3ORYA 4AY3A 1A82A 5LL6P 4QGHA 5KNDH 3AWIA 1OH8A 1YC2A 3DTTA 4KNVA 1C3XA 1Z0UA 2O8FB 2FSSA 1GRVA 1AXEA 1V4BA 4KPUB 3T9BA 3SC4A 4PS0A 1N9GB 1V43A 4Z8XA 2KS6A 2ZRMA 5J23A 1UBLS 3NC0C 4A23A 1OH7A 1W0KA 4F9FA 2B9EA 2PUAA 2BI7A 2PD6A 3RTDA 3UENA 1D2NA 1GRRA 2XXBA 3OM8A 1U3GA 1BHO1 1J7JA 4DJJA 3QKSB 4Q4JB 2V74B 3GEIA 1M1NB 2JKVA 3IPCA 3SLRA 3N8DA 5HHTA 5ISMA 1U0EA 2ADOA 4OHKA 4CMIA 4ZOQI 2I3BA 1PX0A 4NI5A 3GJ4A 3GEDA 5ALMA 2VZLA 3AW9A 2O3RA 1EDZA 1KDVA 1RRPA 3VSEA 3AERA 5I5GA 5C3MA 4J0IA 3E6AA 4XM1A 2ASVA 1E1NA 2E4WA 3F2VA 3VPAA 4EHKA 1UR5A 1V3QE 1FNMA 3ZI7A 4ZT7A 1DZ3A 1W36D 1SBNE 1V96A 2PQ6A 4MYUA 3FFWA 2I91A 1K4YA 4QGAA 1Q1QA 5E0KB 2GK6A 3AG6A 1TKAA 1L6RA 4UTVA 1SNYA 5HIMA 2ZAGA 4V1CA 4MWZA 2JFYA 1LBEA 4LVUA 5JPIA 1G8HA 1PNTA 4F8EA 3T4EA 2JFWA 4JBGA 3F78A 1GVNB 1NNEA 2DWUA 1IEXA 2VDVE 1WPRA 3HSKA 4J4BA 3H2HA 4C4PA 2PE5A 2OD7A 1RRKA 2W6MA 2GPWA 1WBBA 5KSYA 1P18A 2GWRA 1J2UA 3P9ZA 4IAOA 1VLZA 5AIAA 3L8MA 5B64A 1MC1A 1DFGA 1KVQA 3M6AA 5ESDA 2OC4A 2JHPA 3HKDA 4I81A 1J0AA 1N25A 4TKZA 2WF9A 4RJ2A 2FSGA 2A0UA 5H9VA 1E2UA 3U17A 4XVCA 4WXPA 4WD3A 5GONB 1L5SA 1I4WA 2FFJA 5G0SA 3F3KA 4NJEA 5CG1A 1X9IA 4Q19A 1F6DA 3OPNA 1FBTA 5LZ5A 3UWDA 4R01A 3Q12A 3FI0A 4EX7A 4GVXA 1PR2A 4BUZA 3HGQA 4F71A 3EEFA 5U4XA 4R3NA 2YFHA 3M3DA 1RHMA 5HW0A 1VPVA 3ZV5A 3K6SB 1CEQA 1XL0A 1KQ3A 1PFYA 3P2JA 3QLJA 5P8WA 3C15C 3BD9A 5EZ5A 3URKA 4EENA 4CXMA 1ADFA 2RBEA 3H7AA 2BUBA 1SUAA 4L8YA 4MQ5A 5MN6A 3UGKA 3G49A 1ZVQA 1SEVA 1JP7A 3ENKA 1HE3A 1H1DA 2NYUA 3O94A 1TKBA 3SWWA 4OI0A 4RH1A 1GNRA 4H7PA 2VBFA 3V7WA 2Z2YA 3SHQA 1T34A 2CLCX 2HMWA 2PZAA 2BC9A 3G2MA 4BMNA 1ADBA 3T3NA 1UINA 5E9JA 4NBWA 5IAGA 3LPAA 1EVZA 3SEFA 3TI7A 4EKYA 2YUIA 2BYTA 2H08A 5IUJC 5J1SB 5HA5A 1DCMA 2IK8A 3AZPA 4JB8A 1TM5E 1Z29A 4QQNA 2SKEA 2X2FA 3HL4A 1V25A 2CLMB 3HP1A 3MTDA 2WV7A 5L4SA 4ZTZB 5DASA 1HDOA 3G02A 3FR8A 1FQWA 1QHHB 2Y0BA 1OU0A 3WLKX 3ZLVA 4CMEC 4LWZA 1NONA 3P5SA 3EVTA 1SK9A 4PC7A 1W19A 1LNQA 2C2BA 4EW1A 1FDSA 3QVWA 5HE8A 3H3JA 2VQEB 1AQ6A 5IZCC 1QKIA 4KN6A 4X1YB 1XOIA 2H4HA 4PG4A 4AS2A 4Z7JA 2WU1A 1TECE 1A27A 4FI3F 5L7TA 1Z0JA 4K3UA 1PUJA 1T1IA 2RH9B 4MPTA 3AHFA 5FH9A 3U0VA 2FUCA 4D5GA 3QFSA 4A0HA 5KYGA 4HLNA 4Q4LA 1XJQA 2A9OA 5J4LA 1FFXA 4H17A 2RGAA 2ZS9A 2ZDQA 1EXNA 2GHQA 3AHDA 3DZIA 3THRA 4IMPA 4D9FA 2DVMA 2IEBA 1L6IA 4MOWA 4N7MA 3OOHA 2GEJA 3IP8A 3DE4X 4LOHA 5FTWA 5BWCA 1XRRA 1LK5A 2XCOA 4KRGA 4WZBE 5LOVB 2X22A 3NG1A 2WJYA 2Q2VA 4CVNA 2JLWA 2FPGA 3WYCA 4REMA 4CEJB 1T1RA 4TZKA 5IWAB 1MIOB 5CM2Z 1RWOA 4EY7A 1ZITA 1JG7A 5C5DA 1AURA 5LKAA 1RYMA 4LZLA 1P2BA 1OXMA 3ZWXA 1Z7GA 4U02A 4KNYA 3ER6A 3VR0A 3LDGA 5CFOA 5J2UB 2R6JA 2QK4A 3B6JA 3FUCA 5A1TA 2XE6A 4YRMA 1GGVA 1F7VA 1PN3A 1VL5A 3PIIA 3PRYA 4RHEA 1WCYA 3DD5A 3E0XA 3RIHA 3HDQA 5CXUA 5ILQA 1K66A 2X8JB 2ZYWX 2AE1A 1GDDA 3TQCA 3SXPA 4FYPA 1NDHA 3RNOA 4AX8A 2M2IA 1JQLB 1PQ4A 2J32A 4QU0A 1XCGB 4Z4QA 1ZEMA 1CBUA 2BW0A 3L40A 1CR2A 1OAAA 1DKMA 1E0DA 3DW3X 3TLAA 5GQSA 2OP0A 1DAKA 3PVCA 1O0CA 3PHHA 4ZQIA 3W2GA 2AZXA 1Z68A 3C14C 3DBOB 2E5LB 1JSRA 3FKSA 3PA8A 5LQNA 2HD4A 3RC3A 3ZKAA 2WU0A 3THYB 5TT1A 4ZGGA 1G64A 1ZONA 1EFDN 5I9LA 4DF3A 2IH4A 1MABA 5C8DA 1V1MA 1IH8A 2CJXA 4JBLA 2GUWA 3LWNA 2X1LA 5CDGA 1Z6XA 1P0CA 2QJTA 3LG2A 2DUWA 3MOIA 2XNKA 3OURA 1F12A 1L5LA 3MWEB 2AR9A 1U5AA 2DMRA 4XRRA 4ITVA 1OFUX 1KJNA 4JD5A 4NK5A 4U7WA 5E9WA 4KPGA 5EJ7A 2ZAIA 4DSTA 1Q3HA 1Q3TA 4FZVA 4H7EA 4MRPA 1WDWB 4J43A 3BM5A 4NENA 4RF5A 3TGWA 1GGFA 1QGOA 4NFLA 3KR9A 4NMXB 1L4HA 5EHGA 1FB5A 1JH9A 4UHCA 3OZFA 4DJTA 2UXCB 1LDMA 3I09A 3IOYA 4IIXA 4GIBA 5D8DA 3BL6A 4LHWA 3VU0A 1RYNA 1Y5LA 3U80A 2IEGA 5HJ5A 2AR7A 4OA5A 4IIFA 5BW4A 5K05A 3EWIA 2QPOA 3X1WA 2I2CA 5K3SA 2WWVD 1U5BA 3L6UA 3KYDB 5J3JA 4BYMA 3GLFB 2I7XA 1NBMD 4IVNA 4NR0A 4YDSA 3DAYA 1OZAA 3WB1A 1UXKA 1YJQA 5DXJA 2ISQA 4G36A 1XD9A 1ZY2A 2B6HA 2OECA 2QD3A 4BJ6A 1KAGA 3NWEA 3TS1A 5EIEA 1NVVR 4X8MA 5FTLA 2G6TA 4DTCA 1ZSVA 4QBHA 4U3JB 3F71A 1BC5A 3IP7A 1SGWA 3A06A 1VHQA 3K1JA 3O8QA 3U40A 5AW7A 2WB4A