1MQKH

Crystal structure of the unliganded fv-fragment of the anti-cytochrome c oxidase antibody 7e2
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
b'EVKLQESGGDLVQPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVASINNGGGRTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCVRHEYYYAMDYWGQGTTVTVSSAWRHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody 7E2 FV fragment, light chain
molecule tags Immune system
source organism Mus musculus
publication title 1.3 A X-ray structure of an antibody Fv fragment used for induced membrane-protein crystallization.
pubmed doi rcsb
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2002-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mqkH00
4KC3B 1NFDE 4OCYH 5KVDL 1OP5K 5C0IA 3TYGL 3SGKC 4PIRF 2QQQA 4X6DA 4KI5E 1T1ZA 1BQLL 5I6XC 5HGBA 2I9TA 1XCTA 5TE7L 4YHKL 4Q58C 3TCLA 1EV2E 4P5TA 5FYKU 1T3FB 3EYUH 1MCIA 3D6GA 5C0CD 4OZFG 3WE6A 4MA7L 3Q6FB 3WFZA 3O9WD 1C1EL 3L1OH 4PV9B 1FV1A 2Z93A 1HEZB 2J8UE 2A6DB 3IDXL 3K2MC 4XI5D 1MCBA 3X3FH 1IE5A 2YHGA 1R3LB 2O5ZL 5SWZD 4M43L 3TPKA 3JWDC 3RJQB 1MPAL 3U7AA 5F7UA 4Y5YB 2C1PA 3SY0A 3NGBC 2P7TA 1CFSA 4OM0L 4K71B 4U1GB 4R2GB 4WGWB 2C3GA 5HHQB 4HCRH 5CINL 3AAZB 4TULL 3RKPA 1II4E 1XGPB 2X89A 1GXEA 4BUGA 2EDKA 3H9SB 5EO1B 1DLFL 3RGVB 2VC2H 3QDJE 3WN5C 1DVFB 2AEQH 2NX5A 3D18B 4NFBA 4WO4C 4WI2A 2BOCB 1IC4L 1L4IA 1N64H 3IU4L 4OLUH 1N6VA 3IXAB 2VDPH 2CK0H 1KTDB 1WBXB 3N85L 4TNVF 5CEXB 3RZWA 3BH8A 1A3RH 3JWOL 1YNLL 4NKMA 4UQ2B 4FFYH 5ALCL 1DUZA 1MHHA 2D4FA 3O6KL 3CVHB 1EXUA 1A7BA 3I75A 5C2BH 2HJFA 2CD0A 2DS4A 3LQZA 4DN4H 4H88H 3AM8C 1R3KA 4K8RL 5LGKA 2AABL 1TVBB 4XHJD 3QXUA 5AUMB 1ZWIB 1C5CL 5HI5D 2H3NA 4YHKH 1Q9WB 5E5MA 4KPHH 4N5UA 1LE9B 1C5BL 3OKMA 1KFAH 1UM5L 4MA8L 3CX5K 4B5EA 3GJFA 2Z91B 2CRIA 3HAEH 3WLBA 2QADC 4EVNA 1CGVA 1YMHB 2APBA 2ZG3A 2BK8A 4OKVA 5ETUB 5A3ID 3QEUA 4QT5B 5SWZA 3KLDA 43CAA 4JJ5A 3STLA 1A7PL 1W0VB 4KQ3L 4IRJA 3SBWC 4XBEL 3X14A 4NBZB 1CDGA 5T1LB 5C07D 3MOQA 2FEDD 5F7DA 3LN5B 1JK8A 4U33A 5D93C 1HILB 2EEBA 1KB9J 5GGRY 3OG6B 4MX7B 1NMCB 2IWGA 4TVPE 1OD7A 4Z78B 3RWGA 1EAPA 3DOSA 1X5AA 1VADA 3TWCL 4TSBH 3BZEB 3RPKA 2BERA 3ISWA 4IIQC 5HHVH 3VFWB 2W92A 4JCMA 4BKLB 3JTSB 1XH3A 3IGAB 4DGIL 2IANB 2GJZA 4YXKH 3QIWD 4NJAH 2VKWA 4OV6F 3NCJL 4U1SB 2VSDA 1U93A 3OKYA 4KKCC 4XPAH 5J11C 3P4NA 3QQ9D 3BKJH 3HC4L 4NCC2 3AU1A 5C0BD 4R4ND 5D7IB 5FV2A 1ED3B 3VWKC 4RQQA 3MUGB 1G6RA 2IMNA 4TSAL 4UINH 5DVMA 3JVGA 4HT1L 3CGTA 3RHWK 4FQPA 1C5DA 2XNAA 4HKBB 5JDSA 4YHML 1IAIL 1HOCA 1DE4A 4Z7OF 4FQ1H 1KTLA 2E6QA 1UEMA 1J8HD 3UTQB 5K9KA 5MEOB 5JMRA 4M48L 4P5TB 4ODUB 3CVHH 1EBAA 4JO1H 5GS1B 5GXBB 15C8L 3QCVL 4KWUA 5IMLB 1UYWL 4U1MA 2AJUL 4DGVL 2R8SL 1KFAL 3DGGB 4MA8H 4F2MA 3EJJX 5EUOA 3QEHB 4K3DH 5HHMD 4GUPB 1G7JA 2HKHL 5D2LE 4LSPH 3G5XB 1ITCA 2HFFB 4X7SH 5IBLD 1ZA3A 5JNYA 5AD0B 3I2CL 4DVRL 2QADD 2NXYD 4Z7NF 3X3FL 2YC1B 3OGOE 5E70A 1T4KB 3CH8A 5ELIA 4ZSOB 1RSFA 1XEDA 4HPYH 1N0LA 4HUXA 5IUSA 1NANI 4PJIF 1S9VA 1A4KB 3OKEA 4HUWB 5MERB 3DX8B 5CD5C 3FQXB 2X9WA 4P9HL 4PS4L 1AQKL 3VI3F 2NTFA 4PJIA 1HKLL 3VMNA 4F7TB 3E6HA 1EHNA 5TDOA 1MUJB 4HWUA 5I1JL 1H5BC 5E95B 4QKXB 2A83A 4P4KC 2YMXH 5EZJA 4WENB 2FECI 4X7CC 3T0AA 3OX8B 5IEKA 5MI0B 5EUOF 4UMGA 5D5ME 5DFWH 4P2OB 4CADB 3K2UH 5JPNA 4YFLI 4CRPA 1JVKA 5CCKL 1X5FA 5GS0L 4XP5L 3D3VD 1HKLH 5CBEA 1J10A 4LHUG 1MCPL 5FM4A 4F57H 1XAUA 3CLFH 4TTDD 3NCFB 2R0KH 1RQ5A 2NLJB 4HXBL 3U79A 2B20A 1L6XA 4DW2L 1I85C 4RGMC 4UI2A 4NN7B 4WFFE 1JTPA 4TNWF 4NJAL 1CF8H 1KJ3L 1RJZB 4NQVB 3B6SA 3VGGA 3KLAA 5KOMC 1F42A 2BNRB 4HC1A 4MCYA 3TIEA 4P3WA 1YN6B 2NW2A 4X6DE 4WW2B 4HWNA 5FOBB 4KTYA 5ICYB 1NCUA 2FX9H 5IKCB 4IIQA 4L8CA 5F7DB 4BH8B 1MJ8L 4LF3A 4XHJC 1EK3A 4RZCA 2V2TB 1J0JA 4PRIA 1A9EA 3RX5A 1IGYA 5I8OL 2AGJH 4JN1L 4QGYA 1H3PL 2G60H 5GSRA 2IALB 3HC0A 1DFBL 1YUHA 4ZO6A 2FJFB 4ZUUA 3MV9E 4NO3B 3VRJB 4DQOL 1QLFA 2IBZX 4KRLB 2IQ9H 3MZTA 1DSFH 1KSRA 5E1AB 2PO6B 5L9DH 3MJ9H 2E27L 1VB9A 3QEQB 4P3DB 3P4NB 3VH8B 5JR1L 2YK1L 3SE9L 2VL5B 4RNRB 5I9QB 1LE5B 3UO1H 4N1CA 4M8VA 3T09A 3TPUA 4XBGB 4YH6A 4YAQA 2CKBA 3QNXB 4U1LA 3C60D 6FABL 3B83A 4YZFE 1PSKL 4JFEB 5MEQA 3FOLA 5GHWL 4P59H 3W39A 3WSQL 4PJFB 1N64L 4OLUL 3NPSB 4F7MA 4ZOEA 4W4OC 3V7AE 5EN2A 5KW9L 5F9JB 4KK8C 2FL5A 1I7TB 1NSNH 4N0FA 2P5WE 4JDTH 4M6MH 1E6OH 1T7YA 2D31A 2ZCHL 3QIWB 3KXFA 1J5OH 1RMFH 5D1QD 3OBAA 4YGAB 4E5XB 5EO0B 1RIHL 5CMAA 3P11H 3J7HA 1HZHL 5B8CA 3TJHD 1I8LA 1VFOA 1XF3A 4HG4J 3RTQD 3FN3A 4XAKE 4G5ZH 4HAFA 3NFPA 1BP3B 4MQ7B 3RDTC 4EDXA 3V0WH 4L4TD 2Q8BL 2DQDL 3S5LB 2VXTH 1AGFA 5BS0A 1XGTA 1KACB 4I3SL 1T20B 4HCRL 4MSWA 4HZLB 2EXWC 5HPMA 2QLVB 3QRFM 4GAGH 4XVSH 3T2NH 1QBML 1FO0B 1EZVX 3TBSA 4XMKH 3BZFB 4FOMA 4AM0A 1JYNA 2UUDH 3VRIA 4P5KA 3WIHL 3U0WL 4U6XB 1F4YL 3M1BA 5J1TC 4D9RE 2AV1A 3SGDI 4NOFA 1DBJL 1A7QH 4YHNA 2DQCH 2IADA 3KHOA 4KKBC 3B9KC 3T3MF 2QADB 4XX1E 1C7SA 3VDAA 1V3LA 5TDNB 2FIRT 3UCRA 3MLXH 3KPNB 2MQCA 5C0EA 1UWGH 1YEGH 3FQRB 2EYRA 5CILL 3UPAA 4IMLA 5BCAA 1GGIL 4DVBA 5C92A 3QNYA 2NY4C 2F54E 1JV5A 2B0SL 2NY7L 1S9YB 3U0TA 1MRDH 3IDNB 3HAEA 4I13B 1C12B 2ZCLH 4G6KL 5FGSA 1KELH 3T0DA 3DMMB 5E2UH 4JDTL 5FA3B 1F3JB 4LDLB 2W0LA 4N8CH 1EFXD 2OJEB 3QWRD 4NQDD 4EI6B 1G9ML 1QA9A 2JE8A 5E6ZA 4JANB 4WTZA 5CHNB 4NCC1 4DKAA 3QUXB 4PRPD 5I1GH 2E7CA 3PJSB 4AJ0A 4HIJB 4XT1C 1A3LH 4R90L 3NCCB 3UTOA 4Y8DC 4IS6A 4HJJL 3HB3D 3TVMB 4HWZA 1MCCA 1T04B 4JREB 3LDBC 4WW1B 5FYKD 4ZTOH 3SE9H 1TENA 4Y5YA 4Y1AB 5KG9B 3HE7C 5EUOE 3V5HA 3GSNL 1MF2L 4JO4H 3ARFB 2OX5A 2V2XA 4F80A 3P4MA 1ZT7A 5CD5D 3FB7A 1JGEA 3KPRA 2WUCH 1QSEA 1FRGH 2N7BA 4PB9H 1G6RH 3T4YA 1MIEH 3EYQD 5EZLA 4LCUA 3P9MB 2FGWH 5I71C 5GPRA 4MAYA 1X5XA 3QBTB 3WBDA 1CFVL 4LDEB 4QHUA 4Y5XC 4MDJA 5HYJE 3UBXA 3VA2C 2DBLH 1CDYA 5EBWB 4H20L 2DD8L 3UO1L 4HIXL 2CLZB 4S1RL 3P73B 3UTTD 1JTTA 4O58L 1BEYL 4NO0D 1PKQB 3KNBA 4CNIB 3JTTA 1WEJL 4F8TA 1HWGB 3DROA 1VGKA 4IM8A 4JY5H 4L5FL 2JIXD 4U4BA 2BP3A 1DR9A 2R9HD 1DFBH 3WXWL 1MHEB 4K3EH 4PJ9C 4ODTL 1AGCA 2R1XB 1H15B 1ZT4A 4JFFB 2A6KA 3EHBD 3MROB 3P2TA 3FMGH 3E8UH 4YPGA 5E2TL 2ENSA 4Z7WA 1OF2A 2X1XR 4P9MH 5CD3A 1LK2B 4XP1L 2D4DA 1DDHB 2GEEA 4JG0L 3S36H 3GKWH 5H37G 1MFDH 2FR4A 4KDTA 3F7VA 1NGQL 4QHLB 3W9DA 3RTQC 2GTWB 3WJJA 1G7PB 3KPSE 4TTGA 3HPLA 1MRCH 3O3DA 3UBXG 3QXAB 4Q97A 3TA3D 2HJKA 4RFNC 5JOPE 3U9UA 3QH3A 1ZEAL 4GS7B 4HMEA 3SJVB 2YS4A 1N7MH 1BF2A 5MP6L 2PKDA 2DTMH 2ESVA 1SEBA 2ZUWA 1Y6MR 4GKZB 3UPRA 4ZQKB 4WW2F 5F96H 2LU7A 2JELL 3SE4C 4RQQB 3K1DA 4X7SL 3VFPA 3ULUL 5F89B 3TBTA 4PRAA 5E9DE 4AEHH 4X6DB 1WT5C 4M4RA 2UYLB 5EC2B 5ACZA 1Q0YH 1S7XB 4X6CF 1FFQA 5LWYL 3TBWA 1AGBA 3JXAA 3I3BA 1Z6JT 5CWSB 1E0OB 4UNUA 2V5MA 5JW5A 1FVDB 5T5NF 4ZPTA 4FXGA 2P43B 4B41A 4UB0H 5DSCA 3JV5A 4M6AA 1GAFH 4QRPD 5H2BA 4U6TA 5I15L 5TQ2H 2YD1A 2ZOKB 1NJ9B 1HQ4B 4JM2B 4HULB 3VA6A 5I1HH 1FG9C 5KANI 3TZVC 1L0YA 1A7PH 1N3NA 2J5LB 5BZDA 3L3OB 1C7TA 3KXFE 5IBUB 2E9BA 4FHBD 2F54B 2FZ3A 3GMOB 4WWKB 4Z7VB 1RZKC 1U91A 1QFWI 5EORH 4JRXB 3U36A 1KB9K 2XTJB 4A6YB 3ZDZE 3MXWL 3P9WB 4P3CL 1MOEA 3RDTD 3OAZH 2W9LA 4Q9QL 5I9QC 4PJGA 1JZ4A 4DAGL 3U1SL 1JZ7A 5FA4A 1A1NA 2DQEL 2VZOA 4LHQB 3AAZA 5DJ0A 5B39B 3P0VH 2ICWB 3CXDL 5IOPA 1MFDL 1IC1A 4KRPB 1ZVHA 3BDYL 3BP7B 4ODVH 2EDFA 4JFEE 1KJVB 2NY5L 4ZAKA 3VFUA 2B0SH 1T1YB 2NY7H 5D2LA 5TGBA 3PV6A 2XQBL 2GK0A 1RZIA 1SJXA 4M8QA 4GKOA 4FZ8L 3MOAH 4OV5B 3T4YB 4OF5A 1WZ1H 3ZDYF 3LKOA 3V6FA 3QDHA 3QXDB 3ZHKA 3DETC 4JZJB 3GSOB 4GOSA 4EIZC 3IDYB 3VXSA 1DQDL 1E4KA 3BH8B 2X1PA 4ODSH 4JKKA 5D5MF 1HH9B 2LU4A 1J1XH 5JZ7C 1BZQK 1DVFC 2NZ9C 2ZG1A 2LAAA 1I1CA 3HTLX 3HNSL 4YIQB 1JGVH 2ARJA 1KIQA 3MC0A 3ARFD 1H0DB 1M6OA 1TNMA 1EFQA 5IQ9B 1TPXB 2W0PA 2KUTA 1G7HA 4LOUD 5K59F 4OLYH 4QHNA 4OCMC 3O4LB 5JQ6H 1TZGH 4E0RA 2R2HB 5I76B 4BZ1L 1INQB 3C6LB 4F9LA 3IVKB 1BJ1H 3KPOB 5IFHH 2FHFA 5F7LB 3X12A 4PV8A 5DR5H 1DBBH 1I3GL 4KDTC 2ZPKH 3TIEB 1K6QL 1OPGL 1FVEB 3VJ6A 4HFWB 4KUCD 4BK4A 4KQ3H 3UTPE 3ZT6A 3PDOB 4J4PC 5E24E 3LN5A 4AT6A 3MLYL 5I66B 2YXMA 1LK3L 5CS7A 2HYMA 3ZDXF 2VH5H 4JHZA 1MI5E 5LKNA 1ODAA 2VL4A 5ESVA 3DIFB 5I1CL 4YDVB 3RI5F 4X5LA 5HVWA 2AXFB 1P6FA 4PP2B 4OLXH 4F3FA 3GO1L 4Y2DD 4J12A 1AI1L 4UAOB 3GGWB 3G5VB 3BP6B 2NY5H 4ZFFA 2XWTA 3CSYB 1H8NA 1TVDA 1X5JA 4QTHB 3U0PA 5IB3B 4KMQA 1MIMH 4MA3B 1JJUA 2L7UA 2ESVB 1IC7L 1UJ3C 3IDIA 5JXED 4IDJL 4LBEA 1YPZB 4F8QA 5BXFB 2X4SB 2JCCA 4JFHE 1JHKL 3QRGL 3WFCH 3QULB 2P8MB 4Z8FL 2CPCA 2O5ZH 4F57L 1AD9A 2R15A 1VFBA 3TH2T 5HYSG 1J05A 5DVLA 1N6QL 5EZOH 3TZVA 1LHZA 3MR9A 4R3SB 3V52L 1OGAA 3IB4A 1HYSD 3GM0A 3EYSH 5C6TH 3ARPA 3FN0H 3OXRA 4I2XE 3RPIB 1X7QA 5I2IA 3WL9B 3HRPA 4TULH 1Q0XH 1AGDB 2ICES 5IB4A 3C5ZD 4H1LH 2EIBA 1BQLH 3BAEH 2HFFA 1YY8B 2E8YA 4YWGL 3QO1B 4A6YA 4E41D 3DXAD 2A1WL 3SKMB 2OQJB 2X2YA 5C6TL 4U6HA 2WIIA 4JZNB 2Z31D 1A1OA 2O5YL 4G6FD 3NCMA 5M7QA 1XZ0B 5HYJB 2HT4C 3S88L 3U9PH 3ULSB 1UVQA 2NZ9D 4PRBB 1JNNH 4YQXH 3MLVH 1DQJA 2FWOA 4ELMF 1QFWH 4F9LC 4M8QB 2Q8BH 4JFXA 4X6BA 2BRQA 4BSVB 2ICCA 4FA8A 1MJJB 3PL6B 5BVJB 5MHSE 3L5IA 1NGQH 2GK2A 4AIXA 4L3EE 2IF7A 2BOCA 2OZ4H 3G08B 4NQCE 5DTFB 5HI5C 1BVLA 3OHXB 4ACPA 4PGCB 4P4RB 4JFPA 4YHIA 5IB1A 1YNKH 3HG1D 4QOKB 4PB9L 2C3WA 3W5MA 1ZSDA 3HCVB 4YLQT 1F97A 4AL8L 3KYOA 3LPFA 4RMQA 4D0DA 5J8OA 2QR0B 3T2OA 1H3GA 1H5BB 1CLZL 2E3VA 3Q6GL 5C0EB 2HFGH 5KSUA 3DYPA 5I19L 1INDL 1IT9H 2GJ6D 4C4KO 4LP5A 4MNGA 1MF2H 1A7NL 4KTDL 4S2SB 3B5HA 1DQQA 4I9WD 4V1DE 2XA8L 4WO4A 3MCLH 4UDUB 4B50A 3KLHD 1RK1B 1UXSA 4KJPC 4BZ2H 4NZTL 2VABA 2N1KA 1YYML 3KPOA 4PJ8A 4KJWD 2ZJSL 5F93C 1MCNA 3OR6B 5FCSH 4FQCL 3QEUB 3A6CH 4N1EA 3QDMD 5JPMB 4HQQL 4H1LB 5FEBA 5BO1H 4H8WC 3QJHB 3HR5A 4YBLB 3MACH 3UTTE 3L95B 4U7KA 4ZXBB 3SKOA 3H0TA 1G9NC 2VQTA 4Y1AA 3PWUA 4OD2B 3DX7B 4WI9A 1AGEB 1I1AB 3E2HB 2NYYD 4NO3A 4PY8I 5KJRL 1KIRA 4GO6B 3LKNA 3QFJA 2XRAL 3WFBL 4Q6IA 3S37X 2LE9A 1WCBB 5B3NA 1JN6B 3CX5J 4XNXH 4CMHB 4IRJC 2ICWI 5CFHA 1JPGB 4H0HB 1RZGA 3HUJA 3O3AB 4GKSA 2X4QA 3BXNB 3SKUD 2O61A 4FQ2H 3WUWA 1KGCD 2IQAB 3SDAD 1BECA 1LO5B 4JB9H 4XNMB 2CJUL 2X1OA 3FOLB 5TE6L 4UT6L 4UNVA 1UH2A 4I0PD 2VWEE 4LCCC 3FT2A 3RWDB 4ZD3L 4GQ9L 3KPPB 2VLKB 1KCSH 2SEBB 2DLIA 3KNBB 4CNIA 3TH4T 2C26A 1N2RB 3VXRD 5ALCH 5F6HI 1A3LL 3SDXA 1JZ5A 1DLHA 25C8H 5JLZB 5KAQG 2LABA 3STZB 2BNQD 4LCIH 1BOGA 3E1F1 3QZWG 1F6LL 1Q9KA 2OTUB 5MEPA 3GSNA 2WBJD 1SM3L 1IGCL 5F9AC 5ID0B 3DGGA 2GY5A 3NPSC 5EDXA 1OTSC 4F2MB 5D7KD 5CSZB 4JY6A 1H9VA 3O2VL 1DQTA 3K2UL 1MCLA 2AJZA 1LD9B 1KN2L 4HAGA 4OM1H 2AJYL 3S37H 1KPVB 5GGTL 2BVOB 3UTZA 2YC1A 1I9RL 1OF2B 3IDYC 4WDIB 2GT9A 2OZ4L 3GBNL 5IW1B 4HUVA 3BUTA 1HHGB 5F21B 1Q1JL 4FTVB 4KPHL 4P5MA 4X4ZA 4WRLA 5KW9H 2X41A 1J1OL 1OL0A 3RNQA 3ZYZA 3LPGA 3G6DH 3NCBB 3C9NA 1LVEA 3GBML 2R1WA 3MV8A 3RY6C 4K8RH 3AC0A 5C0FB 3VRIB 4UIKH 4CVZA 3FB5A 1QSFA 3V9FA 4D0BB 2OK0H 3O6FC 5FGBA 1JBJA 3WEXA 1N8ZA 1QOKA 4F15B 4JRWA 4E42B 3GIVA 3VI4F 3F7RA 3WIHH 3ALPA 3U9UB 2J2ZA 5HYIA 3O4LE 4N0UE 4Z7QF 4M1DL 1A6VL 4NM8L 2FH8A 1LP9F 3Q5OA 4MS8D 4MCZB 2VXTL 1I7RA 2A74B 2C5DC 1DP0A 1DEEB 4Y1AE 5C07A 1B3JA 5EO9A 1P53A 5SWZE 1JV5B 4R97B 2Z92B 3FFDA 4TUOA 5DYOB 5ITFA 2XXMB 5DS8B 4QRRD 1DQQB 5JOFB 1QP1A 4YHMH 3I6GB 5KN5A 4TQEH 4NQSB 1BAFH 5C0JA 1UKTA 3QI9C 3C2AL 5FKAA 3PXHA 5CWSA 1F4WL 1SY6L 4QOKE 5IEHB 2OJEA 2PYEB 4N8VB 3T0VA 1N6QH 3S4SB 3D9AH 5TPWH 3BFOA 4X0KA 4ZUWB 5IB2A 5HYEA 3F65A 1NDGA 4AG4H 2PW1B 3GIZL 2EKSA 4V1DB 3K4AA 4MNHB 1KEGL 2FRGP 1UENA 4FFZH 1O7VA 2ZCKL 2FH6A 4GQ9H 4L3ED 2GJ6B 3MRGB 1FNFA 2NY1D 2ZOLB 3HMXH 1ZT7B 5EU3B 5DRNA 1WT5A 2E27H 1BLNA 2BHYA 3U30B 1MCPH 4U1NA 1WAAF 3NOIA 4EI5A 5E6ID 3MRPA 2NY0C 3O41A 1LWRA 2R69L 5KSVB 2VXUH 5HXMA 1T1YA 1QFUH 1P7HL 2WBKA 4HH9A 3OKNA 1WBYB 4MAYB 5FYLD 2QTEA 1FNEB 3MGTB 1QRNE 1U8MB 3HUJB 4PG2C 1CBVH 2FHBA 2VDNH 1Y0LB 1YEHL 5DJZA 5C9KA 3ELAT 1NFKA 4D2NA 1D5MB 1UM5H 5I1HL 3LSOA 4YAQB 3GK8L 1C5BH 2ENYA 4OCSL 1FCCA 5KSBA 5CZVL 1HHIA 5GRUL 4JFHD 3FT2B 1OCWH 3MJ8B 5J6GB 3BQUD 1AQKH 1WK0A 2I9TB 1RU9H 1A0QL 3ARGC 5EA0H 5GRYA 5M95B 3KPSB 4ZO7A 4QRRA 2EDOA 1PLGL 1B6DA 1I8IA 1OGAD 4JPIB 2QSVA 3QDME 4FZEL 3K0WA 3TO2B 1NEZG 4JPVL 3UZVB 2RBLA 4RMRA 1F6AB 3D39D 2EXYC 5C8JB 4R7NA 5GZOD 2BRRH 5BOZG 5F96L 4A6YH 5FAAA 1ULVA 4XMKL 1FORH 1CVSC 4I0PC 1JGVL 3HZVA 1NC2A 1FZJB 2BHUA 4N9OB 4HGKC 1YNLH 3WS6A 1NFDA 4RDQG 1JMXA 1RUAL 1NGPH 5DZOA 1FVEA 1I9IL 4PJGE 5JHDB 2X1QA 5T33H 1HDMA 2XY1A 4KMTL 3TNNB 3ET9F 2FR4B 2A6IB 3D3VA 3CH1B 4UU9B 1YECL 1L6ZA 1X3DA 1ZTXL 1TDQA 3V6BR 1NUDA 4JKPH 2OI9C 4J4PA 4WU7B 3RKDD 4XVJH 3KAAA 2WBWB 4JZOA 3IDXH 1BAFL 4PBVC 4NNYB 3RTQB 1G9MC 2VTFA 5J1SC 4NZJA 4AEEA 5D6CB 5DD3L 3ORJA 3HLAB 5C0AB 4P9HH 3QNZB 4NRXA 1DBAL 4ZOBA 1FZOB 5JW4M 3U9PL 3O0RL 5IVXB 3QULA 2A77H 5IESL 1EEUA 3HI1B 3AXLA 2HKHH 4LPWA 3UYPA 2ZUXA 4LHJB 1JTOA 4N1HB 5BJTB 4P2QD 3MJGX 4KKLD 4N8PA 1I8KB 3O6LH 3HAEB 4DZBB 1LE9A 1WVZA 4MA1C 4NRYA 2X4RA 4XAKD 4AEIL 5GISH 1FNGB 1SYSB 2ADGB 1YPZF 4IRSA 1FDLH 4KK6D 1S5HA 2P24A 5SWZB 3U7WL 4NGHH 4P46D 3OSKA 3PABB 3HE7A 2QQKL 1UJ3A 1KLGA 5CZXC 2R0LL 2EKSB 4V1DA 4R2GD 4GG8B 2WLZA 5CEZH 3I6KA 4Y19E 2R9HC 1HILA 5I75C 5JZ7D 2AV7A 4HWEL 2WUBH 5CJOL 5JOEA 3O4OC 3PWPD 1JHKH 3WFCL 4HXAL 3T04D 3H9SA 4FNLL 1YEEH 3SN6N 5FB8B 1S7WA 4HCRA 4BKLA 3IGAA 4S10A 1CLOH 1EIBA 2I5YH 5IT2H 1BJ1J 1BZ7B 3NZ8A 3QCUL 5ANMA 1EMTL 3RQ3A 3ZTNL 2YEZB 3D39E 3MUGA 5D96C 3MRCA 2NCMA 4L4VA 2F5AL 3PGCA 1GZQB 4UT9L 3UTSB 1L9MA 4NO2B 4NO5A 3FMGL 4LLAA 2GYSA 2XN9B 4I0KA 4JZJC 2QR0A 3V6OC 3WNPA 1H8SA 2VQUA 3V0AC 1YEIL 2OJZH 2MCG1 3O4LA 1FH5H 4KHXH 1U8PB 1KPUA 1UA6L 1GGIH 1TETH 4QRQA 5F9WB 2V9QA 1WCQA 2VWEC 1EAJA 4OB5H 3K8LA 3OAYH 4WO4B 5C09D 1RK1A 1UXSB 4FFWD 4OQ1A 2AABH 1JPSL 3K1KC 2VQ1A 4L8BA 1YYLL 3V7MA 4BUHA 2BVQA 4U49A 5D7SL 2J88L 4RFOH 1KG0B 5D8JL 3BPOC 3EYOB 4Z7WB 3R1GL 5K59E 5EOQH 3P4OA 4H88L 4B7IA 1JNHB 1M1SA 3U4EA 4OF3A 3MBEB 1IC5L 4D9LH 3BGMB 3GB7B 2FECL 1HXYB 5C0RH 1MCRA 1LNUB 3CFJB 1L9NA 1ZOXA 1EX0A 2C3VA 4WU7A 1EUUA 4LP4A 5KZCB 1KIPA 1YEFL 3CD4A 1IAOB 3JTSA 2DQDH 5I1DA 4ZODA 2X4TA 2OS7A 1F2XK 5DWUL 2WWMD 3SGEI 1FJ1A 2BY3A 4LBEB 5ERWB 3DHJA 4M5YL 1JWUB 1GGYA 1RVFL 2BFVH 5GGVH 5D6CA 4K3GA 4KQ4L 1BQHA 4XGZA 1RMFL 1F4AA 4RMVA 3ZDYE 5I1KL 1NMCC 4GT7A 4IRZH 1N5YL 4DN3L 3BRGC 1J05B 4R8WH 4R3SA 1S7UB 4MJ6A 4R96A 4PJIE 2VDLL 3PG2A 2YSSB 4HW6A 2CRMA 2E7HA 3AY4C 4G9FD 4O02L 4DVRH 3C8KA 4NKDB 1SVZA 3O8XB 5I18H 2BVPA 1KTRL 5C0CE 1AE6H 1T0MA 1WFUA 5DGRA 1NFIA 1PQZB 1RJYB 4FFVD 5IMOB 3CMOH 3SPVA 1VESA 1S9XB 2AK4E 4JEGB 3ZKMC 3SGKA 3HMXA 4YX2L 4XCEB 3CCHA 1JFQL 4FQXA 4NO0A 5GSRB 1WQVT 3CMGA 2YBRB 5TFSH 4DZ8A 1CLCA 1J0IA 1OPGH 1OTTD 3ULSA 3FQNA 1CR9H 4LQFL 2DI9A 4EI5D 3UYRL 1GOFA 1KC5L 3OZ9H 3IFOA 3PP4L 4IMKC 4ODXB 2YUWA 3RGVA 4BQ6A 2VZUA 2NX5B 5L7XH 5D7LD 4DCQA 1CDUA 3BP5A 4PJ7E 2F54D 1H3WM 4WWKD 5HJ3B 1A7OL 2C4FT 1E27B 1WZLA 1A6TB 1U3HC 4D0DB 1KTDA 1WBXA 4R4BA 4HK0B 1J1PL 5HVHB 3GIZH 1K5NB 4K2UL 3T8XA 2E9WA 1QG3A 1OGTB 3MYZA 4MXVE 1FFNB 1EGJH 1IFHL 1YEDB 5DC4B 3WNMA 4N0YH 5HY9A 2G9HA 5A2JH 4CVWA 1OB1B 3WN5A 1ND0B 4XAWH 1T2XA 2A73B 2AERT 5AYQA 4M6ML 1C8PA 5KN5B 1P84K 1SJEA 3HZMB 3T0EE 4X7FC 1B0RB 1DVFD 5IEHA 3IKCA 3T65B 5CZKA 5GIRA 3GJFB 4S1DD 4M03A 1OAYH 1JPST 1TCRB 5TH2A 4M61B 2NR6D 3KPMA 4FRWA 3GMPB 4JY5L 3VJ6B 3DURB 1EZVY 1XGYH 4JR9L 4DAGH 1RIVH 5LCVH 3T0BA 5B38G 5ICZA 5T1LA 5E2VH 1MPAH 1EEYB 3O3EB 4HV8A 5DMJB 3RA7L 3QA3A 5GGSY 4Y4FB 1CL7L 4Y19A 3T4AA 4F3FB 4RIRA 2DBLL 4Y4KC 3RZCC 1VA9A 3EUUA 4OTXH 1QSFE 1LGVA 1JWSB 3C5ZC 5TE4L 2DLHA 3NCYS 4DGYL 5FUCE 3D25A 1MFEL 2EC9T 1XGYL 2G60L 3U0PB 4ENED 2FDBP 4WI8A 1BQHB 2C3HA 4U05A 1JNJA 1Q1JH 5EU6B 4L9LC 4EN3A 1GGCL 2CKBB 2JCCB 4PJXF 4LSRH 3IFLL 1F00I 1LEGA 3RWDA 1P4BH 1QR4A 2AQ3A 4PJBA 4PTUB 3WHE0 4OGXL 4NQEB 2SEBA 3HFML 1XGQB 1NBZB 1I7ZB 3CJJA 1X5GA 1E4WL 2WLYA 4LKCB 3CDYA 5IHLB 1I7TA 5MP6H 3U82B 4JE4B 4JFDE 4IMKA 4C83B 1BOGB 4QXTA 5B4MC 3O2DH 5F8QC 3G5YA 3GSNB 4NKDA 1NCAL 1Q94B 5I1GL 3N9GH 3T08A 4LCIL 3HAEG 5CMAB 4S1SH 3BHBB 2XQBH 4PRHB 1H3UA 3O2DL 4PY8J 3RY4A 3BSZH 2I26N 3HI6L 1ONQA 2VDRL 3HNVL 1BBDL 3L3KB 4APQD 5TE6H 4DK3A 2VLJE 3BYYA 3CUPA 2DLFH 4MDIB 1PYWA 4YXHL 3CDFA 2WIIB 4UOJA 3CPLB 4JRYA 5C2UB 3M8OL 1IKFL 2DYPD 3QIUA 4Y19D 5EC1A 4YFLF 4NQTA 2YRZA 1TJGH 4QXGH 4XPHH 4O00A 3FN9A 1UZ8A 4CMMA 3H3PL 1Y18A 4P5TD 1G7LB 2XN9E 2P4AB 5ISZA 4G8FA 2X4PB 1YNTB 3QG6A 3BP5B 3DYOA 1EA9C 4GAYA 4J3XA 2CIIA 5HGAA 2EDTA 1U0QA 4QHUB 3SQOH 3PF2A 3VGAC 1TJGL 2F53E 1NUFA 1MCWM 3WIIH 1P7QD 1T5XA 1BD2B 2ED7A 3CU1A 3O6FB 3FQRA 2EDJA 4NZDA 3V8OA 5F7WC 4IHOB 3LH2H 5HY9B 3K4DA 4HJGB 3SJVE 2D0HA 1GH7A 3KPQB 5H37H 1I3UA 4UDUA 3ZYIA 3PP3K 1JZ6A 3OR7B 4HS8L 3O81A 3W2DH 4H26B 4M62L 1NCAH 1WWCA 1LDSA 3B9KB 4XH2B 3S3JA 3QISA 3PJSA 3ULVL 3GSNH 4JO4L 3QI9B 4HGWA 4OZ4B 4HKJB 4KJWC 4Y4KA 3VD5A 5DJ8B 4XZUA 1WF5A 2NY4B 4G42A 5E8DH 4UNTA 1OWWA 1P4BL 3IRZA 4IOFD 4LK4A 1ZLWK 2X42A 4P9ML 3VGBA 3ARBC 4LL9A 5EPMB 2CKBL 2ZKHL 2HVKB 4WTZG 4GBXD 5C9JB 5F6IC 4H0GA 5JIKA 4WFED 3ARGD 1WWWX 5GGQH 3PV7A 4OF8A 4APQC 4OQTA 1XH3B 5ID1B 2DM7A 1K4CA 5TDPA 4LKXA 4LLWB 4LRIC 4PJHF 1MH5B 4OCXH 5DT1L 3I85A 4D9QD 2MNUA 3L3JA 5T3ZL 3S6CA 5FUOL 3TC9A 2IFGA 2VXSH 3F8UB 3VH8A 3W11C 1RK0A 2YD2A 3B8SA 2DKUA 5D7SH 5DRZB 4N0UA 1P7QA 4XPGH 1DUYB 4NT6B 4XWGH 3VFPB 3WUWB 2ZSWB 4IOFC 3IU3B 3MJ8A 2OR9L 4PJDF 1DQMH 3BOVA 2C1OB 2AKRA 2QHRL 3G9VA 4I3GA 2J1KA 2XWJB 1HHJB 3UTPD 3LS5L 1UA6H 4KK5C 3VXMD 1KB5H 4TUKL 3CAFA 3S4SG 3S9DB 3NABL 3V95A 4ISVB 3BH9A 1IAII 1MHPL 4JFYB 5EU6E 2D31B 5BV7B 2F9BT 2W0FB 1AJ7L 5C08E 3LQAL 3VG9B 1S7SB 3MNWA 5DVNA 5KTEH 4XRCB 5EU6D 3VFTB 4Z7UF 1HN1A 1IGIH 3C60C 4X6FB 3HZKA 1F4XH 2C9AA 4X7TB 3GSVB 1FL3A 43C9A 2GT9B 1TFHA 4I0PB 4OFDA 1B0GB 2VZVA 3V0WL 5HVHC 3MX0A 4MJ2A 4QGTA 4S1QH 3QIBD 3RHWF 4AQOA 4L3CA 5TGBB 1FYTD 5F70A 2VDLH 2XICA 3PV6B 3CFJA 1IVLA 2IPUK 5IV2B 4PRNB 1NPUA 5L7XL 4KGJA 2AVGA 2ATKA 4G7VL 1U8LA 4PRHD 2X4PA 3WO4C 3D18A 4O4YH 2W9EH 5ADOH 3AVEA 3PQYB 2DQCL 1SY6H 3HFMH 1UEYA 1I9JL 1NLDH 2X4TB 4UTAH 4LARH 2VAAA 1U9KA 2FSEB 3RX8A 5IB5A 5GRVL 2E7LA 3QNZA 4NRXB 3TJHC 4PJEA 2VH5L 3OJDA 1E4XH 4FQIH 5CEXA 2E9IA 3BVNA 3LN9A 5HYQB 3CFDA 3BKYL 1DCLA 3QO0A 1J8HE 3UC0L 1M6OB 3FO1B 1R5WB 2D7NA 3HE6B 5KSBE 2F19L 2D0FA 4R6UA 3WYRA 1NL0L 3TYFA 5IFHL 2EE6A 3UAJC 5C0JB 4PLJC 3IJYB 4GRMB 4JFQA 4K55A 1QR1B 3EO0B 4IBLT 1T3FA 4PLNC 1MRFL 2NY6D 1HXMB 4KV5F 1UXWA 4XPBH 4XH2A 4S11A 1KB5B 5F1IA 3D2UA 4DGVH 5FKPB 5LAXB 5K33A 2F54A 3GMOA 4OCYL 4WWKA 3VFGH 5KVDH 4HFWA 4JO2L 3RL2B 1CT8A 5DK0A 1K2DA 1RIVL 3CX2A 4LPTA 5FF6B 5LCVL 4ZFOA 5IP4A 4NNPH 1I8MA 4KRMB 3LS4H 3PHOB 3EZJB 1BZ9B 4HDIA 1M71A 2FNBA 2ZCHH 5CAYB 3UXFA 4XC3H 5JORB 2IALA 4PRDA 1XR9B 1ROWA 4MZ2A 4PP2A 4FQXB 4NRZA 2GTZA 4JDZA 2GCYA 4KRPD 1NC4D 1A22B 3MQIA 4Q74A 5DMKA 5IVOA 3SDDC 3LB6C 2W91A 1MFNA 5ID1A 3OMZA 5D2LB 3RUGE 5DWUH 2EDRA 2O5XH 2MCPH 4DKEH 4XAWL 5IT2L 3L3IA 4WUKL 2GITB 2XTJC 5HHNA 4XP6H 1NSNL 5HVGB 2VLLA 3ROOA 1IEBB 4Q0XL 5T1DH 4U1LB 1E28A 2VLME 3B5GA 3R8QA 2HMIC 1P7KB 3L7FA 1T1WA 4YO0B 2DRUA 4KVNL 2WSKA 3TVMD 1W0WA 1DTUA 2Z8RA 1KCRH 2BRRL 2CMRH 3P73A 3BPCA 4QNPF 3TJEL 1H0DA 3FO0L 3VWKA 3C08H 1QHOA 4UIMA 3KPSA 4XI5C 3O4LD 4GAJH 3REWB 5JHLH 2DQGL 4UTBH 5GGRB 1UGNA 2V6HA 2Y36H 1KNOA 4HSQA 3VFRB 3CIQA 1SEQH 5DFTA 1UC6A 5E99H 5DD0H 3V4PH 5L9DL 3X17A 1GOHA 1YMMB 3TFKC 5C0CA 3VXNB 5D5MB 4XNUL 1SJEB 2VDQH 3HZMA 2XPGA 4YDIH 3QUZA 5FV1L 1G7IA 2I60L 3NMEA 5SWSA 1QEWA 1BWWA 4KXZI 4OLWH 2WWKO 1B0WA 3WDIA 5F6HJ 4U1IA 3CSPA 3S5LA 2VDNL 4L8SA 1HQRA 2QEJA 3IFNL 4OBRA 4Q2ZB 3BQUC 4HC1H 4OFPA 1CN4A 3H42H 3U0WH 1K3IA 2KH2B 3VGAB 2BSTA 3DURA 5IQ7L 5IGXL 1HXYA 3QPXH 5LVEA 4M3KB 1DDHA 3U4BL 3OXSB 2A6JB 1NLBL 1GGBH 4WHYG 2WNGA 2PR4L 2VLRE 5A2IH 3FHAA 2NNAB 3T3ME 2VYRE 5D7KE 2EH8H 4KVCL 1MREL 1T21B 3L6FB 4OUUB 5KVFH 1U8KB 3DJ9A 5E7FA 3NFSH 2HN7B 2ED9A 2GUOA 5ISZD 2N7AA 3HC3H 4ZDHB 4KKAC 5TJWK 5A16A 4P2YA 3NIDF 4QTHA 5IESH 3V4VH 1GPOH 1EVTC 5EH1A 4JFFD 4Z7VF 3F5WB 5E2JA 1NBVL 1NMAL 3VRLF 4ORZC 5L2KB 5DUBB 2Y4SA 5BVPL 4FQ1L 3OJDB 1UQSB 3RIAK 3MYJA 3P11L 1RJCA 1IT9L 2EYRB 4ONHA 4YR6B 3G9AB 5IVXA 4UDTB 1BIIA 1YQ2A 2BXYA 1EVUA 5FYKE 4JRYD 2R0LH 1HOCB 5DXWA 4FG6C 1FBIL 4ZOAA 2FGZA 3V4VL 1QYGH 3FOMB 3IXTA 4PR5B 4WWKC 4NGHL 5I73C 1K8DB 1Q9OB 4O51A 1U8QB 1CICA 5HHMB 3GFUA 1ZS8B 3MPCA 4HK3J 4L4TE 4QRSA 5E8OA 4EZMA 3DXAB 4QXUH 3SCMA 4ODWB 1GGTA 5KS9A 3QUYB 3B2UD 4BFGA 3VD4A 3U36B 3SQOL 3CCHB 4L8CB 3VGDA 4R0LA 2PYFA 2Z35A 3O0RH 2J6EA 3BPLB 3QWOB 5INDB 3HE6D 3RKDC 3MLPA 2AV7B 1YJDL 1N6UA 4OQTH 4FMKA 1KLFA 3IJHB 2BHZA 5F8RC 5CLTA 3TH3T 3H3PH 3BWAB 1D9KD 3QUKB 4U1JB 2EDEA 3MV9D 2PN5A 3KHQA 2MPAH 2NY6B 1DQJB 1S7WB 3LN4A 3ZDZF 1FH5L 4KHXL 3FAWA 5HHXH 4QCIB 5DD5H 2DQGH 2QSCH 4UTBL 4YXHH 3REVB 3QIUC 3BKJL 3HC4H 4TVPH 3MBXH 3W81A 2ADFH 5BV7C 2YKLH 1GC1C 3OGCB 4KROB 4MDJB 2UWEF 3T0EC 2YEZA 4JFPB 4NM4H 5IB1B 1UM6H 2BMKB 1BF8A 1OY3B 1YECH 4AEFA 1D5BB 4M6NH 5T3XL 1AY1L 4ODHH 1HH9A 1TJIH 1R3JA 1ZLVK 1JGDA 1YN7A 4P49A 3N85H 1NC4B 3WUWG 5KSUB 3O11A 1NCCL 1QVOA 3SKNB 2OBGA 1KN4H 3IU4H 1TJHL 3SGEH 5CP7B 2IANE 5DMGD 2K3TA 3ZKXC 3U4BH 5LG1A 2R2BB 2JB5L 3L9RA 5C0GA 1U8IA 3C6SB 2ZCLL 4G6KH 3OR7A 4PJDB 1NBYB 1N5AA 2BNRD 4PFEA 5GS2H 4ZPVB 2XA3A 4K7FB 2CDEB 4L8SB 2JCCE 1VACA 3GJEA 2B4CL 5JW3H 3UTZB 2R0WL 4YEFA 2VLJA 3QI9A 4WU5B 3BN3B 2LVEA 4X4XB 4OLZL 5F3HB 1DQML 4MQTB 1J0ZA 1BVZA 1G6VK 3IDJB 3OXSA 1N26A 3TZVD 3LEYH 2VDKL 5BRZD 3DX7A 1YJDH 5DD1L 2PTUA 1PVHA 3CDGA 3LS4L 5C9JA 3QDJB 2P48B 4KY1L 5DJYA 1Z3GH 4AM0B 1BBJA 3FO9B 4MA7H 4O2CB 5F1NB 5DHYB 2OZ4A 3GSUB 3MACL 4DUWA 1OP3K 1WBZA 2XZZA 3C6LD 4GRLC 1FIGL 4K3JH 3U46B 3NN8A 4WEBH 4M1GL 5I18L 3T2PA 1FYTE 4OSUL 3OB0H 4J8RB 5ILTH 2CDGA 2EE9A 2ITCA 1SJHA 2R4SL 2HTLD 3BPNB 5DHVB 2FLRT 1Z3GL 2QSQA 4PGBA 5HGHB 3S35X 2D03L 1I7ZA 4HUKB 1CD9B 3QZWA 5FOJA 4Z76A 5AG8A 2AK4A 5IHZA 4OD1L 1QFWM 3LKPA 3PWVA 3I6LE 1KYOK 3D85B 2DN7A 5IW6B 3H9HB 1X7QB 5I2IB 4NCDA 4J3OC 1R5IB 1D5IL 1FSKC 2MQ0A 4LAJH 4HIHB 5JXAH 4ZUWA 1GRWA 1S7SA 4LSDA 5FYJU 2E7BA 3L3KA 1NEZB 3MCKA 3QO1A 3INUH 4E41E 2VLJD 3LH2L 3CUPB 3RRQA 3S7GA 4X7DC 1ES0A 2VDRH 3HNVH 4OF6A 2P8PA 4DGIH 3H8NA 3IAGC 6FABH 2IGFH 3VXTB 1LO4L 3VXUA 2DIBA 5DJ0B 1HHGA 43C9B 5LGHH 1JGUL 1EEZB 2EDHA 4C55A 3KJ4C 1HI6A 1NCDL 1ZKAA 2X4NB 5DZLA 1UZ8B 4YDLC 5HI4D 4CMMB 4FFWC 5T3XD 4M1DH 3PP3H 2V5YA 1QO3B 3TLRA 2DJ4A 3VRLE 1RZIB 5C0FA 4Y5YC 5INCA 5DFVC 4K71C 1QSZA 1J8KA 3S96A 4YK4C 5DJAB 1VEOA 4OUOA 1YEJH 4XXDA 5GRUH 1UACH 3RIAF 3LSOB 2VXVL 1FN4A 4MD4B 4WTWA 3DI2B 2IG2H 2DLEA 5EBWA 1CTOA 3C60A 3CFBB 3K8MA 1JGLL 4O5LL 4NHCL 4OF7A 3LMJL 1INEL 2HRPL 3E3QC 4X80L 4RFEB 3SDCC 3D0VA 4IJ3C 3P0YL 1IEAB 4OD3L 4Y5XA 4QRRB 3LRHA 5IHUH 1TZHB 2MKLC 3BO8B 2LV4A 4PJAE 4X83A 5F44A 2UY6A 1KJ3H 4KU1A 5DHVH 5EZOL 2R2BA 1INQA 2PYED 4CJ0A 2O93L 1YYMH 5KBNC 4POYA 1EFXB 3RWJA 2ED8A 5FYKL 4GRMA 1QR1A 3EO0A 5BOPA 4P4KA 5H35B 5IVXE 2QJDA 1RIUH 4G6JH 2DBJA 3QUZD 4ZFOL 2D0GA 5F72S 2CUIA 4H8WL 3HA0A 4RWYL 4YHLL 3FQWA 4EBQH 3IETB 4AT6B 4ZO8A 2ARWA 4M5YH 4QTIL 1B4JL 5BS0D 5E00B 2HT2D 1QBLL 1BFOA 3HNTL 5CKGA 2EIEA 1A5FL 1EUTA 2NY3D 4UV4H 3HR5B 5HGDA 1BOYA 5TPWL 3T0WA 1U8OB 3ZE0F 1PD6A 1Q9LB 4PRDB 1F2QA 2HLAB 1X4XA 1OQOA 3MNZA 4N90E 3RWCB 3WLWD 5DHYA 4UQ3B 2HWZH 1KIRB 2Q6WB 5IB3A 2H9GA 1RZJC 3OAZK 5AYUL 1IJ9A 1IC5H 3ARRA 5IBTH 2ZSVA 4LIQL 1MLCB 3ZT5A 1M7XA 4XNZC 1T0PB 2WV3A 5EBMB 5I6XB 4BSWA 2BVYA 5LJYH 5C0ND 5ACMA 1D5MA 2WP3O 2PW2B 3KJ6L 3S35L 1AFVL 2YPLA 3FB8B 1RHHA 4HPYL 2EYTB 4LQ1A 4HKZA 1TMCB 4FQLH 2VZ3A 1E28B 4PP1C 1EJ6A 1CD1A 3HI1A 3H9ZA 2DMKA 4XPBL 3U30C 5ACZB 4ZXBD 4Y8AA 3CVIL 1K8IA 1OGAB 5D7LE 3WNNA 1KJMB 4DZBA 1PKOA 2IGFL 2JIXB 3UJIL 5GS1A 4Y16B 4LNVA 1CDIA 2FYYA 3CSGA 3STZA 5H2BB 1A8JH 3PQYE 2O5YH 3G6JB 1QYGL 3FB6B 2BOBA 5EU7E 1S8DB 1YY8A 4R2GC 4F7EA 5MENA 2PO6D 3PABA 4OLWL 2ID5A 3M8OH 2E5EA 2EO1A 1FV1B 4ZUSB 3MLRH 1LO3H 4EIGB 3DSFL 4X5XB 3RWIA 4X7TA 3TEUA 1QNZL 3FFCA 1EGJL 2ADIB 4GMSH 1HDMB 3SDAB 5BVPH 4RX4D 1IQWH 1PYWB 5C0DA 1AE6L 2R23A 4HUWA 1AP2A 1FVCB 1P9MC 4MB4A 3EYVA 4JQVA 4PGJA 2VR5A 2XT1B 3RUGA 1MIML 1Y18B 3UJTH 1KCRL 2QQNH 5GJTH 3NZ8B 4AIOA 2YA2A 4OUUA 3KPRD 2A38A 3OKKB 2HJKB 3VFNB 4OV5A 4ZSOE 5D7JB 2ZUQC 3GSXB 1XF5B 5KTEL 2G2RB 4R97C 3FKUS 3GHEL 2BDNH 5B39G 3ME0A 5C0AD 1IL1A 1VDGA 3RU8H 5B38B 2Q8AH 5FYLH 4P2OA 4OD1H 3WO4B 3IRPX 5DQJB 2LAGB 2YUXA 4YBQC 2Y23A 4PLOB 1TXKA 3I75B 4ONGH 5E4IA 2G75B 2I60H 3OKOA 2A1WH 4I18C 3GSWB 4FTVD 8FABB 4LSRL 3TBWB 1YEKH 1S5IH 2FO4B 4QHNB 2GY7B 5DS8A 1FYTA 1OTSD 4XCNA 4CW1B 1YDPA 4KUZH 3TCLB 4PJFF 5DRXA 2W38A 4NJ9H 4NQDE 2XYCA 1KB5A 3B6SB 3VWJD 1HQ4A 2VAJA 4JM2A 5FKPA 5LAXA 5D7IF 3X12B 3SOBL 1FL5B 4HD9A 2P44B 1DEDA 3JWDH 4GSDH 3C5SA 4OCXL 5DT1H 3EYOA 4H1LA 3DXAA 3KJ6H 3TESA 2O26U 2J8UB 3P4OB 3V8CA 4HKJA 4IIQB 1A6ZB 5D2NB 4NFCA 4NYLB 5I66A 1A9EB 1TJHH 2PW1A 2IEPA 2OL3H 2YR3A 1IAKB 5ESVB 1AKJA 1N0XH 2P7TB 2CRZA 3IF1A 5D9SB 3HMXL 3VE0B 5C7XL 12E8H 4FQQB 4DEPB 1S7VB 2C3VB 4JGJA 5F7FA 2JKXA 5IOPB 3G5VA 1NGWA 2CK2A 5L8LB 3BUYB 1XGPA 3OJMB 4M6OL 5T1KD 4XB8A 4JVWA 3BKMH 3DMMD 4I9WE 1RIHH 5T3ZE 4KTDH 1KJ2L 4MQSB 3LN4B 3MBXL 4GRWE 1WFNA 4F7PA 4J1UB 4NQDB 4M7JH 3ILQD 3V6FB 4M6OH 2DWEB 4OZIB 3ZKQD 3GHEH 2P5WA 3QUXD 4PRPB 1F90H 5D7IA 3IKKA 4NT6A 1SY6A 2F5BL 5I30L 3RNKA 2M1KA 3ULVC 2IC2A 5KSAD 2NW3B 2VLMD 1CI5A 1NCCH 1LEKA 1HHIB 3O4OB 4JG1L 2NY1B 2EECA 1DBML 3X11A 4UT7H 4ONFL 4D9RD 5C0NC 4HX1A 4LDOB 3D69B 3RWHB 2R2CA 3DVGA 3O6MH 5E6IB 3DVFA 3IDUA 3WL9A 1A0QH 5JMOC 3FB6A 3ARQA 5CEYA 1F6AA 4QXUL 2AW2A 4O58H 2MHAB 5L8KB 2VDMH 3I50H 1AR2A 1UCBH 2A9ML 4XP4H 3AREC 4I77H 3MA9H 1FZJA 1D5XA 1WFOA 2R39A 3UAJD 43CAB 3NZHH 3L3DB 5I16A 4LQFH 3RVUD 4HC1L 2F8OA 4HHAA 5DEGA 5DI8B 4I18A 2F8XC 2HT2C 1G7MA 3QQ4B 1JFQH 4P2RA 5HYJA 3DYMA 3N1FC 4UU9A 2W9EL 5ADOL 2PTTB 4JM4H 2H6PB 2XI9A 1FGVL 7FABL 5KZCD 4Z78A 3IFOB 4CVZB 1MEXL 1MQKH 2A0LC 2BNQA 3HZYA 1Q0YL 2RAMA 3RJDA 2HT3C 4OIIL 3QPQD 3GSXA 3UZEA 2PNDA 2RB8A 4NQCD 2VXSL 4R90H 4YBQD 3SQBA 1A6UH 2FSEA 3PWLA 3U46A 3HE7D 2Z31C 5EFIB 5I1AA 1S78C 4Y2OA 3PNWB 4KV5E 4LIQE 2N56A 5DVOA 1NLBH 3PE9A 5DHVA 4Q0XH 3MRJB 3QIBB 3ULUF 3FOMA 1CU4H 2FO4A 4JFOB 2XQYG 2VN7A 3GMRB 3MA7B 3UTQA 4EN3C 5K9KB 3N06B 3PWVB 1AI1H 1XGUA 3PQYD 3GMMB 2IAMC 3GKZA 1GPOL 1HYSC 5IBLC 4X9HA 1PW3A 1FC1A 3V4UL 3GMPA 4HIHA 3MLSH 4ZFOB 5ANME 2PYFB 3BDBA 4YUEH 3VFOA 4U6HB 4Z5RA 3MMEB 4GAJL 1FIGH 4K3JL 4B0MM 3F12B 2K9UA 1T4KA 4DZ8B 5EU3A 3LHPL 1ZVSA 3VFGL 4PY7A 4PLKD 2GCYB 4C56E 5JXEC 2D9QB 4HJ0C 1RZJL 2EZ0D 3MJ9A 1DN0B 4D0CB 5D96B 4XCCL 3SO3C 1A64A 3N1PC 4HH9B 3MODL 4XXCC 3VWJB 2NTFB 4YUEL 3KYMA 1OAQL 1AO7E 3B4NA 1GVIA 1CDHA 5INCB 2XWBA 5I1KH 2EEDA 1RUKH 2J12B 3MRFA 4PJ7F 2CKBH 3CZFA 3VW3L 3WHE1 1VKXB 5TQ0L 2VIRA 1JRHH 1LE5A 1F3DJ 3VDBA 1MI5B 4NDMB 1TCMA 4XP1H 4AIZA 3RDTB 3KPLA 1HWHB 3JWNC 1WTLA 1OGTA 3NFSL 1E6OL 1JE6A 5GSVA 1J7VR 4UIMB 3EFDH 4JO3H 1IEAA 4Y5XB 1FGNL 2R69H 2OTPA 2AXJA 3QEGL 4S2SA 2X89D 4G43A 3P4LA 1EGJA 4G6MH 1LO4H 5J7CC 4YDJA 4U2YA 3IKCB 1BBDH 4PLJD 3T65A 4JDVB 4E5XA 1JHLH 1S7QB 3PWNA 3INUL 3EDFA 1KEGH 3MJ6A 3P0YH 1MRDL 5B21A 1D5XB 4YEEA 5JR1H 4OIIH 4L4TA 3RAJH 1K85A 3H2WA 1F3DH 1OCWL 2VDQL 1F8TH 1G9MH 4P57A 2R1YB 3RY5A 3S34H 4R7DA 3BGMA 3GB7A 1DN2A 4QF1B 3T2QA 3BE1H 2NQCA 4LLUA 3T4AB 3QXWA 1RI8A 2NNAA 2J6EH 1GAFL 5JHLL 3ULUD 4UB0L 1U8KA 3MLUL 1GHFH 1OLZA 3LKNB 1Z9MA 5KVGL 3DRQA 2L4OA 5D1ZC 2PO6A 5ADPL 2AV1B 3LS5H 4QYOA 4M1GH 2RGSA 3DO7A 1ZLVH 2GJJA 5FO7B 4GKSB 4MCZA 3ZKSD 2ZP0T 4V2CB 2F74A 5IVZA 1EO8H 3QUXC 5GRZA 3NPZB 1JPFB 1FNLA 4NQED 3ALXA 2EYTA 4JFED 1I1FA 4NKOB 4GLRH 2XOTA 2VLKD 3V7AG 2W65A 3BD4A 4Z76B 2MCPL 4Z95L 1CICC 1BM3H 3DI3B 4MJ6B 4HIEA 5D2NE 1G9EA 3TN0B 3DLQR 1N5YH 1ZA6B 4C83A 2X4RB 4QXTB 2AI0H 1QBBA 5GRXG 2VUYA 5F88B 2P42B 5I1LA 5JTWA 3NTCH 1MWAA 4OZGB 1Z9LA 3TVMC 4J3WA 4WCYL 1RHFA 3S4SA 3UX9B 4HKXA 4CVUA 5T5FH 3GBNH 4G8GD 3HE7B 2DL9A 1ONQB 3SCMB 2OL3A 1IGTA 4G3YH 4OCWH 4NFDA 2AJXH 3L5JA 3VFOB 5IFAL 1RUAH 5DRWA 2VE6A 2YA0A 4EXPX 1AKJD 4PUBH 3GI9H 4JRYB 4XXCA 3MLXL 5INDA 1AR1D 1P1ZA 1KT2A 3IJSB 2ZG2A 1EH9A 3NCEB 5I1CH 4LPUA 4FTVA 5C0DB 5D72L 2L7JA 4U1NB 3BP7A 3ZTJG 4JRXE 2UY7A 4WUUD 2JJSA 2XG4A 1GGBL 3UC0H 3MSPA 4OZGE 5CLWA 2GSGB 4YNYB 1XIWD 5IWLC 2VXQH 5FCUH 3IXAA 3WKMH 4OLZH 4ELKA 4O9HL 2BMKA 2LTQC 4LSUH 4DKFL 1ACYH 2B4CC 3FO2A 3KPLB 4RFEA 4N0CD 1CFNB 4HK0A 2BSSB 3H3KA 3H9SE 4L29A 3R0MA 4PJ9B 2PCPB 2QHRH 5F7YC 4GRLD 4DVBB 3RIFF 3CXHJ 3BMWA 3HNSH 4H5SB 4G6FB 3JV4A 5BV7H 3GSWA 3MV9B 3MRKA 4G7YH 1H3XA 1HZHH 3MJ7A 3CSBA 5DMYA 3TT1L 4L4JA 3OKMB 3G5ZB 5K9QG 5IF0B 3B9KD 3C6SA 4DW2H 3MNWB 3GBLA 4CKVX 2P47B 2Y07L 4WFHE 1QZ1A 1UFUA 3MRDA 3QQNA 3TNMA 3PL6D 2E9JA 2UWEA 5BO1L 5EIVA 3AROA 4Y4FC 5IMMA 4HS8H 3OKLB 4JJ5B 3QUXA 2H8PA 3STLB 4EN3D 1JNHA 4OCRL 4Y4KB 4XPAL 4EUPB 1ZHBA 1Q72H 4RFNB 4YDVA 3WFHA 3ARZA 4MWFA 1CZ8H 4D3CH 1Q9LA 4LCWE 5ICZB 3GEWB 3ESVF 2PXYB 1VFUA 5KG9A 3CDGB 3W9DB 3EYQC 1QRKA 1I85A 3RI5K 1F6FB 3DBXA 5KSVA 2P5EB 3ULVH 2GJZB 4X6EA 5ERWA 5IVNA 5IB5B 1PG7W 1XIWA 5KS9F 2X5PA 1AXTH 6CGTA 2YA1A 2F74B 5IVZB 3EOYG 4IRSC 5T1MB 3IFLH 3QO0B 4XCYB 1L7TH 4FTVE 4BELD 4OZGF 4C4KT 5JW4R 5F89A 4LNRA 3TBTB 4EKXA 3TZVB 1MFAL 3QIUD 4X98B 3VXMB 1MRFH 4HIEB 4RRPA 2HG5B 5EOCL 2Q87A 1EDQA 2R29L 1C5CH 4KXZH 4Q6IC 4BFBD 2JJSC 4RA0C 2NPLX 3H9HA 3D39B 4X99A 3RIFK 3G6JA 4QRPA 4ALAH 5IQ7H 4F7EB 2DQIL 1OQXA 2EKJA 5DGQA 3SO3B 4YHOL 3MRQA 3QWQB 2CIKB 5IMOA 4JAMA 5L6YH 1A3RL 3D5OF 5D1XC 1AGCB 1ZT4B 2BC4A 9CGTA 3VFTA 3RL2A 1JYVA 5FK9B 2D7PA 5ISZE 3ARYA 4HEME 5ALBL 2AJVH 5AWNH 3SKMA 5DK2A 4KRPC 4JKWA 4KTEH 3QCTH 3ARDD 5F97E 5JHDD 4KAQH 1KLUB 1NGYB 4LHUD 3LKSA 3Q2CA 4I2XB 4EDWL 4NC0B 4U7MA 4LVEA 1IM9D 3EO9H 4LU5H 4XVJL 1IKNA 2FX7H 5IJVA 1OAYL 4EUPH 3WD5L 4BQBA 3V2AR 3H9YA 1T0NA 2YMXL 2ORBH 2FATH 1OAUH 3D85D 2AJSH 3EO9L 4ODXA 3H6JA 1TPXC 3VFUB 2BNQB 4UT9H 1OHQA 2NXZD 5DJ6A 4EDWH 5CSGA 4V2BA 5F3BB 1OT1A 2GSGA 4YNYA 4N0YL 1YNTA 4MXVF 4M93B 4ETQB 3QYCA 3C6LC 4DWHA 1A6TA 4C56A 4J2XA 5F1SA 3DTXB 4LCYA 5IGXH 3NBNA 2I5YL 1AIFA 1QUNA 1Z2KA 3L5XH 5J6HA 5F7MC 4NKMB 4UQ2A 5DD6A 1FFNA 4OI8A 3BQUA 5EWIH 2HRLA 3KYKH 1AJ7H 2FIKA 1CVRA 3VCLA 1QLRB 1TZHA 2ICWJ 1YDPB 4PBWD 3NFNB 4YWGH 1TVBA 1ZWIA 3JV6A 3Q1SL 1SMAA 3S3SA 3MUHL 1MJUL 2COQA 5JW5B 3VXNA 1EFXA 3RWJB 1G0XA 2R2HA 3LKRB 5A43C 3ABZA 4DJMA 4RWHA 3ULUH 1KCUH 3LRSA 1R24B 2CLRA 1KBGL 4CDGC 3LVEA 5I74B 2DQUH 1H3PH 2BVQB 4XVTL 1BFVH 2FB4H 4LLYB 3NA9L 4NNXB 1YEJL 4OBSA 5F1KC 5C0BA 4NKIL 4KI1A 1S3KH 3EHBC 4KVNH 2BSTB 3GMLB 3PDOA 3GJFK 1AXIB 1IAKA 4PJ9D 3A6CL 3L95A 4G42B 4KI5F 4FQXD 2EE3A 1IAIM 3T3PF 2I25N 1K9TA 1LO2H 3Q5YA 4HUNB 1X4YA 3HC0B 3HG1E 4Y2DA 3RFZC 1UH4A 2WK2A 1JZ3A 1RUPH 1NGWB 4X8XA 2DMCA 3U7YL 2NXYC 1WIOA 4RAUA 5T1KA 4QRTA 3L3IB 4HUUA 2GK0B 2GITA 4DEPC 5IR1B 2Q86B 4PRPA 3E2HC 5TF1L 4KJQC 1FC2D 4U1HB 1U6AL 4XBGA 2YOCA 3LV3B 1T66D 5HI3C 3SCMC 1BVKB 1MI5A 5SX5K 3D9AL 1JYWA 3IAPA 1T6VN 2VLKA 3MLYH 2XN9A 4X4MA 3D1MC 2CQVA 2X9XA 2UZIL 5AAMA 4BZYA 2JIXA 2X05A 5E56A 5CEYB 1Q9KB 2OTUA 3IAQA 2DTSA 4CVXB 3O8XA 3QUMB 2F53A 1NCTA 2NY1C 2VOTA 4KH2A 4TSCL 2XPGB 2Z93B 5H94B 4C59B 3EOTH 4W81A 3FT3B 1OSPL 2DJSA 4PJFE 4E41A 1IKNC 2XZQH 3L3DA 1G7JB 1JF1A 1V3MA 5I16B 2BVOA 4G8GE 4XC1L 3LKSB 3ZE1E 1A4JB 1JHTA 1XGTB 2XZQL 5B22A 3LEXB 1F11A 1KENH 3ZTJH 3PL6C 4MLIA 4WY7H 1RUMH 1U36A 5CKAA 1U95A 1I3RA 3A6OA 1JPSH 1FO0A 3EJZC 5ISZB 4XB7A 3BW9A 5HHPB 4CUCA 4I0CC 4WFEE 4BA8A 2MWCA 4NSKA 5I0ZA 32C2A 4HBQA 1U8LB 5LXGH 3PIQA 1GIGL 2JK5A 1F5WA 3P77A 4LEXL 4N9GA 5CEZD 4D9QE 1BVLB 5T5FL 3DRTA 5T3ZH 3BZ4A 3CXDH 3O3UN 4LHUB 4AYFA 4YHYB 5J6HB 1PKQE 25C8L 3JUYA 3W11D 1LDPL 2NY5C 2BY2A 2X4UA 4N8CL 1QVOB 3SKNA 1H5BA 2G75A 2DYPA 3GMNB 3IDGA 1VGEH 3PP4H 2D7TL 2W9DL 1JZ8A 4R96B 3DARA 4WHDA 3D48R 1T89C 4DFIA 4AY0A 1SBSH 5GGVL 3O8XD 4PJDA 3R06B 2O5XL 2V2WB 3F58H 5KSAC 5I0DA 3QIBC 4YBLC 4NUGH 4OLXL 4G7YL 1T0MB 4Z0BH 3RVTC 4LLYA 1RJZA 2AEPL 3MJ9L 4CDHA 4OD3H 2EXYD 1AHWC 3UTSE 4IRJB 2RQ8A 2Q76A 2J8UA 2OR7A 3GK8H 5JPMA 4XC3L 3DVNA 4HS6B 1U92A 1QKZH 2HLFC 4NKIH 3OKDB 5EOTB 5KVGH 1JCKA 3FRPA 5D1QC 2QQKH 1Q0XL 1P2CA 1KXTB 3MLZH 2C3XA 4OFIA 3VWKD 1EO7A 1S7VA 3U7WH 2VN4A 1KT2B 3PWUB 4MD5A 4LCCB 1OTTC 3O41B 4Y5VB 1ZAGA 2KQMA 1ZGLP 2BSED 2OCFD 3KXFD 4WGVB 2NR6C 4LMQE 3WXVH 2P49B 1OGAE 5D7LB 5DUPL 2AJ3A 4F7PB 2ZJSH 5AAWA 4MJIA 2PUQT 1CLYL 3GRWH 2VIRB 1K3ZA 4WI5A 2VLLB 3OHXA 4PGCA 4WVRA 3FFCD 2XNAB 4HKBA 4ELKB 2Q7YB 4PGBB 3LB6D 2ZKHH 3QHTC 3BKCL 4C54A 1KCVL 5GSVB 1XGQA 4U1GC 3BH9B 4UTAL 4DUVA 1ZANH 4JO3L 1HKFA 2AEQL 5IW6A 1CIUA 4FP8L 4H5SA 4HWBA 5GZNC 2CDFB 4KKCD 4ENEC 4GW5B 4G9FA 5IK3A 2F53B 1W0YT 2QKIB 3BYTA 2AXGB 5H94A 1NBYA 3D0LB 3QFJE 5ID0A 5DJ2B 3TIDA 4KZDL 5CSZA 5JOPD 1QFOA 5TQ0H 4HJ0D 3K80A 5TH2B 5DR5L 5JIHA 1UWEL 3MLVL 3QDMB 4I1NB 4WU5A 1W2KT 4ZSOA 1N0XL 1JRHI 4X4XA 4TPRH 4HF5H 1ZHBB 5IHUL 4QHMB 2H32A 1Q38A 3FTGA 2V7HA 3IFPB 4F15C 1IM9A 4OB5L 2PR4H 2IBGA 3QA3B 2C7UA 4PRNA 2OK0L 3QDJA 5DJYB 8CGTA 5FHBH 4CL7A 1W8OA 1MIEL 5JIPA 1OW0A 1QSED 2GUOB 4FMFA 3FQTA 3O9WA 5CGMA 1WCBA 3THMH 5KAQF 5DD1H 1G1YA 1JN6A 4PJEB 4GW1B 2A9MH 1Z9SA 2OP4H 4QWWD 4NUJB 4YHZL 5JW4N 3QHZH 4TVPD 1F8TL 4TRPH 3MYJB 1KN2H 1FQ9C 1QFHA 3FO1A 5CBEB 2B4CH 3VXUE 1VFAA 2DTML 1YEHH 1F4YH 3QJFA 3QIBA 3GNML 1X9QA 5D93B 4ZFGL 1I8KA 3KDMB 2JELH 1CGUA 3F62A 4KI5C 2D7TH 2W9DH 3RGHA 4ZPTB 1A7RH 1UM4L 4DKDC 1UXWB 4OT1L 5HGGS 2ADGA 2WWKT 3HMWL 4PJXA 3RP1A 4NQCB 1CICB 4EI6A 4YC2B 4ZD3H 2UZYB 4OZFA 2UZXB 4I3SH 1D3CA 3QRGH 4LRIA 4OGXH 4NC1C 4OGAC 4C56D 2XXCB 3GNMH 5FK9A 2JTDA 4MA1B 1I3VA 1DBKL 2VE6B 3I6KB 4S0TD 3OAUL 1NAML 3NA4A 1EHXA 3MCLL 4HWZB 1V05A 4L3EA 1KGCE 1C16A 5IW1A 4MS8C 4XPTL 2ZZUT 1ZHNB 4EOWL 5C3TA 2XZAL 2XV6B 1CIDA 1HINH 3MV7D 2WINA 4OSUH 2NY3C 1F4WH 2MKWA 3K46A 4J23A 2VDOH 3S96B 1NUGA 5DJAA 2CUHA 1CBVL 4NWTL 3BIKB 3CC5A 3BEVA 5GS1C 1ZHKB 1QSVA 3MV7E 4QXWA 1RUQH 3VXRE 1RZJH 2YZ1A 4TYUA 5HGAB 4R0LC 1WZKA 4P46C 5EOQL 3W9EA 1RK0B 1NCBL 1HYRC 4ZUTA 2KPNA 4AMKH 4LSUL 1CD1B 4RAHA 5KOVC 5BW7A 3I84A 1D9KC 4PJ9A 3PHQB 4KKBD 5IG7A 4UBDC 3MREA 4Z77A 3CVHA 1UB5B 1HHJA 4G6AC 5GGRA 5IQ9A 1VEPA 2FL5B 2Z92A 2HT3D 5FUZL 1MAMH 2LTQB 3O6KH 4LAQL 4XWOC 1UKSA 1I8IB 5FM5O 2Z4QA 3Q3GB 5CJ8A 4JHBA 3DROB 1KXQE 2IPKA 5IW3A 3QUZB 4P4KB 5H35A 1G7IB 5DEFB 2OI9B 3WNOA 1QEWB 1S7QA 3PWNB 4ZS7L 1UWXH 1MAJA 3U6RA 5HYSB 1MWAH 2B2XL 3TCXA 3MRNA 1W72L 2A6KB 4PB0L 4ZTOL 3MROA 2Q20A 4CU7A 1ZLWH 5GHWH 3WSQH 4XNQA 4Z0BL 4Q9RL 1CXHA 4OM1L 5GGTA 3UJTL 1JK8B 4P2OC 4U3XA 4Y1AD 2NY2C 2VR4A 3BP4A 1MVUB 4MGXA 1W72A 1BLNB 1U58B 5LGJA 3QXVA 2NX5E 3W0WB 4NWUH 4LKXB 2Y07H 3MNVA 1R3HB 4HMDA 4HWEH 4PGDA 5DK3A 4ERSL 4RGMB 4MA3A 2IADB 3OKNB 4JZOB 4Y89A 3OJVC 4NN7C 1WBYA 4OGYL 1CWVA 5E8EA 4X4YB 5IR1A 3RTQA 3WJJC 5IIEA 3RWFB 3C2AH 4JPKL 4XCYA 3BVNB 4XTRC 4NN5C 4J8RA 1FFPB 4LCWD 4ZQKA 2BNUB 3GBMH 1ORSB 4LEXH 5CJBA 4NPYB 4FQ2L 3OKOB 5TFSL 4RDQF 2JJUA 2X70A 1FG2B 4DKFH 4YX2H 5I75B 1S7XA 3L3GA 1Q9OA 4Y16D 2PO6C 1KV3A 5DRXB 5D1ZD 5E5RB 4JPKH 5E0QA 1PZ5B 4OGAD 4HBCH 2BVPB 3DV6A 5CIPA 3QAZB 4JAMB 1RJYA 1PAMA 5I8KL 3NACH 3FT4B 3ARBD 4HJJH 2E6PA 2ZOKA 2ZPKL 2B1HL 3S35H 3NAAH 4U1KB 3ULUC 1DBBL 3QUYA 4RISH 3K81A 4RMSA 3MV8E 4S1SL 1WUNT 1YQVH 2NMSA 2OL3B 4X4ME 5IBTL 3ZKNC 5DD3H 1ZA3B 2A9NH 1M71B 4GLRI 3HZKB 5JUEH 2H26A 3QSKB 5LGHL 1JYXA 3O8XC 5D4QA 3IJHA 2KKQA 2R23B 1A1OB 4ZNEA 1WIUA 1P1ZB 1L0XA 5FECB 4G3YL 4OCWL 3TN0D 4Z7OE 4M1CD 1TZIB 3BEWB 4QWWC 1ZGLA 1LEIB 2FWOB 2JF1A 3DUHA 2NY2D 1P69B 4I4WB 2EDNA 5BW7C 1CICD 1FE8H 3DVIA 3P9LA 5HJ3A 3C5JA 3SCMD 1HE7A 5ALBH 4YDKL 5B38A 1U8JA 3TO4C 1A6VH 3MRCB 4YE4L 4FQHB 4NQUA 4PJ5B 4KJQD 3MO1B 5DMIH 2CSPA 3T1FA 1Q8MA 2CLVA 1K6QH 4M7ZB 1MY7A 1R3KB 2MOVA 2WWMC 1TVHA 1J8HB 3B9AA 5E9DA 4YXKL 5IM7A 1WTGT 4LPVA 4HX1B 4LPXA 2Y7QB 2DYPB 3GMNA 3JV4B 3SOBH 1AC6A 3RL1B 2IPKB 1CLYH 2Z91A 3GRWL 4PRHE 3VXQA 4NC1E 5IJKA 3WIIL 4NRYB 2CUMA 1M7IB 2J4WH 3MBEC 1JZ2A 5DQDL 4P99A 3R06A 3AMLA 4NNXA 1NDMB 5CZVH 5F1IB 3LCYA 1FYHB 4MCYB 4OI7A 1QTYT 2H32H 1S3KL 5GZND 1QKZL 1WWBX 5KVMC 3SDCA 1LP9E 4QHKJ 1YEIH 2OJZL 1HINL 2Q76B 1BD2D 2F5AH 3O6FD 5AZEH 3MLZL 5E94A 3GM8A 2VISB 4LF3B 2R56L 1UB6A 5A2KH 4EEEA 4RZCB 2Z31A 1EAPB 2FEEL 3DUUB 1CLZH 1TNNA 3DX9A 1IKFH 1D6VL 2YRPA 1DANT 4LLMB 5IHBA 1YUHB 2V17H 1MSPA 5T1DL 1ITBB 4ORGB 4NQXB 1CZ8L 2DB8A 3GGWA 1XR8A 2BVEA 1R3HA 1U93B 5D1QA 4UT6H 5MEND 3NN8B 1CE6B 2J8UF 2ICEB 3L3HB 4K94C 4PREB 5SWQA 3QEGH 4AG4L 3GSRB 3SGJA 1S9WA 1C5DB 5J1AB 3QI9D 3GUTA 1YPZA 4YDKH 3MRIB 1ORSA 5HGHA 2WBJC 1J87A 3PGCB 4Y16C 4RX4A 4XNMA 3UTSD 5J12C 4Z0XA 4WIQA 3W0WE 1L0QA 1MFBH 5L2JB 1AY1H 4ODHL 1IGIL 1NBZA 2XN9D 2FD6H 2F58L 5IROA 2P5EE 4XBEH 3W39B 1XF1A 1K8IB 3O3BB 3R8BB 1FVDA 2MTPA 4FXGB 5T3XE 5HTSA 4LFHG 3DVGB 3EAKA 5E6IA 2YSSA 4LPCA 3WD5H 1RUKL 2CDFA 2XG5A 1YMMD 3LMJH 2XZCH 3SDAC 2APWA 5DFVD 3CMOL 2DQHH 4PYGA 4U1KA 1YC7A 3G5XA 5E4EB 1MCKA 4JRXA 3EKCA 2X4OB 1NEUA 4WJ5A 1BFSA 1A4JA 1JHTB 4X5XA 3RWIB 3WXWH 4R0LB 3QR2A 1S9VB 4G9DA 4OTXL 3MLTA 4Z7WE 2VO5A 5L6YL 4XP4L 1ZLUH 4OFKA 3U4EB 1U3HB 4PY7B 3I50L 4L4VE 4ERSH 2H32B 3MV01 4FZEH 2H2PC 2ZUQB 2V5RA 3I9GH 4HZLA 3BEWA 4K3HA 2EC8A 1HHHB 1UYWH 3BGFC 3E6HB 4RAVB 2FJGA 3FZUD 3F6IA 3TO4A 5J3HD 4H20H 4ONFH 4K3DL 3EJYC 4IDJH 1PG7X 1LILA 4GAYB 4X6BB 1NAKH 4N9GB 5DLMH 5EZJB 4Z7UB 4Z6AT 3GSQB 3O2WH 5BVJA 3V5KA 3IS1X 3RWEB 1E27A 2BZDA 1B88A 3LEVH 4NDMA 1AC0A 2Y5TA 1I7UB 1I9IH 5E8DL 1JGDB 2D2OA 3E8UL 4GBXC 5IFJB 4POZC 4CN1A 1I1RA 4M7LL 2A2QT 3VD7A 1IZJA 2I07B 5JUEL 1CK0L 2FBJL 3E3QE 1VFAB 4Z7NE 2FLBT 3I02A 2XACC 1OLLA 1YQVL 4MNGB 1J12A 4HLZG 2NY2B 1FYTB 4XCNB 1D5ZB 3QDGB 4K9EH 4O2EB 5KSBF 5CEZE 3GMMA 1YMHA 2R0ZL 3DUSB 2MSPA 4H25A 5HDBF 3C5ZB 3LQAH 3NIFF 4OKVB 1LO2L 1QA9B 4JANA 2CJUH 5SWSD 4DFHA 5A40E 4LSPL 5IKCA 4WV1B 1BFOB 4X80H 4TSCH 4K23H 1INEH 3GO1H 3QPXL 1UM4H 5B3JF 3WJLC 4GSDL 2YUVA 3IDJA 5EPMA 3MLWH 2VXVH 1R6VA 3DUUA 5EZIH 4BQ8A 1OAZH 1GOGA 5JO5A 2Q3AA 2P45B 5AZEL 3RWCA 2ARJQ 3FN0L 4M48H 2M8XA 4BFIB 1OTUC 4U1JA 3P4MB 2BVTA 4LLWA 4NZRL 1XR8B 5GISL 3QEQA 4P3DA 1CGSH 3BUYA 2WBJA 3C87A 2OP4L 2AEPH 3QHFH 3D25B 2OSLA 4XPHL 3BIKA 2DOCA 2P8LB 2G5BB 4NM8H 3EDDA 4WHCA 1NGXA 2J5LC 4QRPE 3DHMA 5J1AA 3VGHA 3H7BB 5CBAB 3FO0H 3HG1B 1V5JA 2YPKB 1I1FB 4MD0A 4NKOA 1BVKA 2R0KL 4HXBH 4P23B 2IMMA 2WUBL 5CJOH 1PKQA 4UZGA 3MRLA 3SDDA 1U2HA 3QZWB 1LEKB 5SX4H 2F5BH 4D8PA 1X4ZA 3U1SH 1CDCA 1YEDA 2YZ8A 2VITB 5F88A 3VXSE 2RFXB 3UYOD 1NKOA 2KQNA 3VFSA 2AS5M 1QSFD 5IMLA 2AJSL 3D0LA 5ABDE 35C8L 3E0GA 5GS0D 4OCNC 3P30H 1M7DB 4ZUSA 4GXVH 3O2WL 3EYFA 4TUJA 1NC2B 4KZDH 3DSNA 2NYYC 5J56B 1S7RA 4X5WA 2AXHA 4QRRE 1F02I 4Z9KB 4ODVL 4PBXA 4N0RA 4PD4K 1WZMA 5FYJD 3ARXA 5IWLA 5FGBC 1OVZA 1GGCH 1FLRL 3IJSA 3LEXA 1DBJH 4CJ1A 2ZNWA 4KKNA 2I24N 3HMWH 1AD0A 3QDAA 3FQXA 1KCLA 3HPJB 5FYJE 3ZT7A 3AM8A 3QDJD 4KRNA 5DJDB 2KBGA 2JJWA 1QSEE 5HHPA 5J06A 4JFZL 1NCWL 3U83A 3LOWA 4JFDA 3PQYA 1H8OA 3U48A 5I8KH 4TNVK 5ECJE 4RFOL 4ZS6D 1IL1B 3TBYB 4P4RA 1J0YA 5FO7A 3WXVL 2DL2A 1UWEH 4Y0GA 3K8KA 4XPTH 5IIEB 3CFDB 3ECBB 3GRWA 3GI9L 1J18A 4DTGL 4G5ZL 4E9LA 3G6JF 3VXOB 1AXSA 3QUML 8FABA 4IDLA 5FM5M 2L0DA 4OLEA 2XZCL 1MVFA 3SDXF 4LOUC 5I1IH 4IHOA 4FXLA 3S97C 1SM3H 1BQHG 3TV3H 2Y1VA 4URTB 1CDBA 4FQJH 5HPOA 2QSTA 1MWAB 4OZGA 2EDBA 2FX9L 4ZO9A 2FD6L 1PZ5A 2V2WA 5D1XD 4H26A 3BSZL 3MUJA 1RJLB 2X44D 1L7IL 3D2UB 2BNRA 4U7SA 1OP9A 1N3NB 2AI0L 4K3EL 3HUJF 1U8HB 3VXSD 4CGTA 4IS6B 1FL6A 2X09A 4NYLA 5DJXA 1A3QA 4LSVH 1TQCC 3AB0C 4OZ4A 4JJHA 4APQB 4HS6A 2P8PB 4XNYH 3D87B 2V2TA 5FGCB 1NDGB 4PYHA 1C16B 1G1CA 3JVGC 1HSAB 4Z5RB 1D6VH 4MNHA 4YC2C 4OD2A 3CPLA 1X5HA 4WI4A 1S7TA 5HD8D 4MD5B 5FYKH 4WUUB 3V5DB 4J4PD 4D0CA 1QLFB 4LSSL 2B2XH 4KKLC 2XRAH 4IEFB 4XP9L 3WFBH 3OZ9L 4LMQI 1G7LA 3FRUB 3QWRA 4J1UA 4NQDA 4YHPB 5BZWA 5L2KE 1XIWB 4G6AD 1AQDA 1IEBA 4RMWA 3AS2A 4ZUTB 3H7BA 1VKXA 5LXGL 5SV3A 5DDHB 3Q1SH 3SDCD 1P7QB 3FO2B 2ZSWA 5J9PB 1A6AB 2X7LB 2DIAA 2Y06L 5HGBB 4GJTB 3C8DA 3VG9C 4XWGL 5J6GA 1CF8L 1ACYL 3SDXB 4P2QA 1TZGL 3C08L 3EGSA 1D9KB 4QRPB 3RL1A 4JFZH 2GSIA 4WUUE 5DEFA 1ADQH 3BKYH 1YMMA 2CK0L 5C0CB 1J11A 2FGWL 1Z5LB 3BGFB 4JY6B 5TF0A 1FNAA 1A7NH 3TNMB 4Q9BA 3FL7A 3T0ED 1L7IH 2IH3A 4JGUA 4FP8H 1ZT1A 4Q2ZA 1NMBH 2XKUA 4HLZH 1SJVA 4WDIA 1V7ML 4HGWB 1G7MB 5F9DC 4OIBA 1I9RH 5K9QI 2ORBL 1FL3B 3VXUD 5DJCB 1QLEH 1IFHH 4ELMA 4I0PA 4X8JA 4Y4HB 5HGDB 1WGOA 4BQCA 5CUSH 1W72B 3CH1A 4GBXB 4GH7B 4K7PY 3QXAA 1DBKH 5EG6C 3PWPA 2ATPB 3H9SD 3HE6C 1WITA 2YWZA 1V7MH 2QV2A 5DA0B 1WSST 4J3VA 1GCFA 2Y5EA 1KULA 4WCYH 1I4FA 3TBYA 2W1NA 2DD8H 3MOBL 3K74B 3QEQE 3NVQA 4MAYD 3DTXA 4LCYB 2EXWD 2YRLA 2Z9TA 2EH7L 4O2FA 4RGNB 4YGVB 1W8NA 3L3HA 3S8WA 4NPYA 4PRAB 4RSVA 1FO0L 3HLAA 5EC2A 2XFXA 2V17L 2VZSA 1OSPH 5C6WH 1T1ZB 1GIGH 2UV3A 1QLRA 1YY9D 5E8NA 2DM3A 1R5WA 1S9YA 4TUKH 2CXGA 3U0TB 3MLSL 3IXTB 3CFCH 4PR5A 4QLRA 1FAKT 1MQKL 3LZFL 1L7TL 4NN5B 3KYNA 2KZWA 1I1YB 3TP4A 3VFVB 5D1ZA 1XGUB 5TE7H 2V9TA 2PYEA 4N8VA 4ISVA 3IJYA 3DX6A 4PJCE 3PGFH 3CFCL 4Y2DC 3L5WB 3Q6FA 5ETUA 4GG6B 5IROC 5IB4B 3ZMRA 3TGXA 2JCCF 3HI5H 2JJVA 1FNGA 4U6VH 1KBGH 3ZSTA 3GDBA 3B8YA 1CT8B 4ZAKC 1E4XI 5JW3L 1QBMH 4Q9CA 1KLGB 1RFDH 3FQUA 4BZ1H 3QWOA 1A1NB 4GG8A 3A67L 2YD4A 2YBRA 1NANH 5DC9B 2R2EA 1SYVB 5D6DC 3IDMA 1KOAA 1B0GA 5EIQA 5HHME 3MRBB 1JWMB 5E8PA 4OFYA 3VFWA 2ZNXA 3BD5A 4ZFGH 4CN6A 3F6LA 1RULH 2OTWA 2OMNA 1RUPL 3AFLA 5D1XB 3DGCR 5DJ6B 3VH8G 3JBG7 4PTTB 3HB3C 1ZK9A 4X6CE 4WNQB 1W72H 2ATKB 2QBWA 5CJXA 3BEVB 4LCUB 1MJJA 3PL6A 4UV7H 1A2YB 3Q48A 1ED3A 4YHZH 2APFA 1U8JB 1T5WA 1CGSL 3FZUC 3WFDL 5FUCC 1HHKA 5GS0H 5ADPH 3RDTA 3THML 1MWAL 3AREA 4MAUL 5DQJA 5IM7B<