1MQKH

Crystal structure of the unliganded fv-fragment of the anti-cytochrome c oxidase antibody 7e2
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
123
structure length
123
Chain Sequence
EVKLQESGGDLVQPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVASINNGGGRTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCVRHEYYYAMDYWGQGTTVTVSSAWRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.3 A X-ray structure of an antibody Fv fragment used for induced membrane-protein crystallization.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords antibody 7E2 FV fragment, light chain
total genus 32
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2002-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mqkH00
4B50A 3B9EA 4P5MA 2DQEH 4QRQB 1YC8A 3HN3A 4NKOA 3PGDB 5I73C 4MMXC 2ZZUT 1OAZH 3KPSE 5K9JL 3EJYD 2FIKB 3MUGB 3WJLC 4ZUWA 1FO0B 1R5IA 2CK0L 3STLA 3HPJA 4NZUL 4PGEA 2E6PA 1ZA6B 3RIFF 5GISL 3ULVD 3BEWB 4MXQC 1ZLUK 1IILE 5A16B 4A6YH 3ZKQD 4MNQE 3ARDA 3MYZA 2BNRA 3CU7A 1G6RL 5BW7C 3BKJL 4OZIB 4GG6F 3ZTJG 5KG9B 1XF2B 4OD1L 4PJDE 4AENA 3AU1A 1BIIB 1T1WA 4JHBA 3FO9B 1VADA 1KELL 1WC7A 3P0YL 3U4BL 1CD1A 2WM0A 2UWEB 1JE6A 5TDPB 1LO4L 2FX8L 1F02I 4ZSOB 1PW3A 1T6VN 1OT1A 2OTWA 1FO0A 3IDMA 4M1DH 2A1WL 4R7NA 4XWOD 2XWBA 1JZ6A 5L2JA 2P8MA 4ZOCA 4P5TA 5HYFA 4Q9RL 3QIWD 3NAAL 3LS4L 1PAMA 1S9WA 4J3TA 5JHDE 3VXTB 2QR0A 1RHHA 3QWOB 1NCWH 5CBAB 3I02B 4GKZA 4OT1H 5F7EL 3WBDA 4EI5D 4JHAH 5KAQF 4X98B 1C12B 5HHPB 1KPRB 5SWZE 1AQKL 4HIXH 4YIQB 3S35L 3WKNA 1MIEL 2EXWC 1PGRB 1JN6B 5F7HA 2RCSH 3RVXD 2OP4H 4UTBH 2DQJH 2KQNA 2G60L 4GKSA 2ZWLT 3ZDZF 4CJ0A 5EOTB 4NOFA 3QO1B 4HPOH 1R6VA 4TULH 3MGOA 1JNNH 4I0CC 4LF3A 3RTQB 3ZKSD 4X6FB 1INEL 2PW2A 4XMLL 1JZ5A 1I8IB 3MGTA 1AFVL 4MLSA 1W2KT 3DVGA 4LNRA 4IRSD 3MREA 5F3BB 5JMOC 1OTSC 2VXQH 5MHSE 3JUYA 5IW6B 3O2DL 4XXDA 1RFDL 4XWGL 1A0QL 5GS1C 2AJYH 4RZCB 3CC5A 4JFDB 1PZ5A 3OKYA 3L3GB 4ZPVB 4ZD3H 1KIRA 4W4OC 3QEQA 1G0DA 1YMMB 5C0IB 5D7LB 1KTDA 1QFOA 4N68A 4U0QB 4PYGA 2DICA 1C5DA 4BQ9A 5I74B 5DUBA 5INDB 3V8OA 3TPKA 5KOVC 3U7YH 1MI5D 5I71C 5IKCB 4M43H 1EUUA 3MRJA 3MRLA 3U6RB 1AGFB 4XCFH 4X4XB 4QNPE 5GZOC 3BFOA 5I1IH 1PJ9A 1IFHH 5FGCE 4KK5C 1XF3A 5M7QA 1DQLL 5IK3A 4KAQH 5EO0B 1U3ZA 2Y07L 5DJYA 3V4PL 1FV1B 3MLZH 4M7ZC 4OGXL 2DKSA 2X9XA 3BUYA 5E8DL 4LEXH 5DRZB 4XBPA 5E00B 1KNOB 4G6AD 1NMBL 1G9NL 3UJIL 3T2NH 1P84K 5IW1A 2CQVA 4LHJB 3BPOC 3O3AA 1FPTH 3UJTL 3FMGL 3SE9H 4JY5H 4FQ1H 3LSOB 1A02N 3VFRA 2FH8A 5FYKH 4JO1H 1YEEH 3Q3GA 5D1ZD 4OTXH 4LCCC 3RWHA 3GMNA 2QQQA 3N1PC 1CLYH 2XZCL 5JR1L 3MNWA 1EDQA 5CWSB 4MA7L 3VG9C 4MS8D 5E99L 5CP3A 2CKBB 3U6RA 3C2AL 4RGOH 1I9JL 3A6CH 2X40A 5BV7H 1NGYA 1RIHL 1WFNA 1UC6A 1VERA 5JDSA 1ZA3A 1MHPH 4DQOH 3HG1B 2BOBA 1CF8L 4DKEH 5E7FA 5IV2A 1QLRB 4M1GL 3CUPB 4BSVB 4XPGL 4DZBA 5I8OL 4N8PA 4GRLA 1MRCH 2LVEA 1NBYA 3HR6A 3DROB 2LTQC 5KS9A 2GQHA 4NUGH 4X7TA 3BDYH 2I07A 2A0LC 1N5YH 1FAIL 2DMBA 4NQCA 5TJWK 4UT7H 3MLVH 4GLRI 3QG6A 4OCWL 2A9NH 4YO0A 3F5WB 2OZ4H 3TN0B 5L2KA 3JZ7A 1MAML 2R69L 1T2JA 3TC9A 1QTYT 4PV9B 1ZHKB 4PRDA 4UILL 3C08L 3EDKA 5F7EH 1J18A 2XQBH 5DK2A 3QUML 1CDHA 1HOCB 4NSKA 4GRMA 4PUBH 4HK3N 3SGKA 4WW2C 4I5BB 2Q8AL 4DAGH 2P5EA 2Q1EA 5K33A 5BMFH 5TE6L 1ZT4B 1N2RB 3IDMB 5EO1B 1YEHH 2GI7A 1QSFA 1U6AL 4PJXE 4ELKB 1DBJH 1SY6L 2NW3B 4BA8A 3E2HC 3CK0H 3M17A 5DVKA 3VXNB 3HZVB 1JF5A 4P3DA 1WV7T 4RWHA 3NFNB 4BQ6A 4JRYE 3F7VB 2ICWJ 4Y4FD 4K94L 4URTB 4R4NC 4F3FA 2I60L 1FN4B 2V5RA 4KAQL 3D39D 1G6VK 4NOBA 4PR5A 3D0VB 4HUXA 3KVQA 3QHFL 4JFHE 1TVHB 2FHFA 3MRRA 1QA9A 5C2BH 5JORB 1NGQL 3CXDL 5L2KE 1LQSR 1C1EL 4P2QB 1LVEA 3KPMB 1I7TA 5J12C 2XOTA 3KNBA 4NP4L 4P23B 5D2LF 1RURH 4G6FB 3PWVA 3FRUA 4YHZH 2NLJA 2EE6A 1CIDA 1A6TA 2GK2A 1HQRB 4P57A 1XGRB 1I7UA 3ARGD 1TQCC 4GW5B 5EC2B 1A4KB 1KCUH 1RUKL 4WUUE 2R29H 2GSGB 4M62L 5CILH 5BOZG 1EEZA 3EFFB 5KSBE 4X6DE 3UCRA 3BW9B 3MLTA 1BBDL 3VXME 2W9LA 5IK3B 1PYWA 3OKEA 5I8EB 2LU3A 5A2FA 1MHHA 4D9RD 5TQ2H 5FECA 4Z7VE 3D0VA 2ADGA 5EZOL 4X5WA 5AAMA 3VXUD 2WBJA 1TJIL 1MELA 1KGCE 4GSDH 2FGWL 3BHBA 4JQXC 2AW2A 3ULUH 4XNYL 5T1MA 1IT9L 3FT4A 1A7OL 3W0WA 4NN7C 3RI5K 3ARDB 3MV7B 5F9JA 2FX7L 4RFOL 3REVB 1HZHH 1UJTA 3QUXB 4QXUH 2W0LA 3FRPA 1PEWA 2Y4SA 4FQXA 3UX9B 4IRSB 3FB8A 5D6DC 4K3JL 3ULSA 2W38A 3WXWH 2DQGH 5I1GH 1CICB 4NQXB 4E9LA 1WCQA 3OX8B 4LU5H 3OSKA 4LAQH 4L3EE 3S3JA 2J1KA 2EYRA 2XQBL 4ZOAA 3ZE1F 1Q9OB 1MVFA 4YAQB 4MHHG 2BX5A 4JO3L 3TT1L 4YHYB 4RDQG 4HJJL 3QZWG 4DZBB 1QSFD 2NR6C 2WLYA 4OZFH 4CU6A 4FFVD 2V2TA 5GRJL 1D6EA 5DD3L 2D7MA 3MRGA 2WUCL 4FQXD 4KMTH 3ZE2F 4J12A 4DN4L 4ODSL 5E7BA 4R3SB 2QQNL 5GGTH 1IQDA 1ZVYA 2DI7A 2VXSH 4XVSH 2B4CH 4YBLB 3RGVA 4KK9C 2VWEC 1MRDL 4X5XB 5C86A 5F7MC 4H20L 5DK0A 2J8UA 3KAAA 3QQ3A 1NANI 3QUMA 3QIWB 1VFUA 1KTLA 2EEDA 1BLNA 3FOLB 5DEGB 2NY4D 3MFGB 4MJID 2AKRB 5KVDL 4OLVH 4PJIF 2QQLL 2NXYB 4JE4B 4PRHB 5DJCB 4LSSL 3MODH 1KPVA 4K9EH 3UO1H 4WUUA 1H3WM 4IIQC 4L4TE 3TJEL 1QLFB 2Q8BL 43C9A 1UM4H 5IBUB 2DQHH 3GO1H 3RU8H 2GY5A 4HWBH 5CJXC 4PG9A 5J3HD 4HF5H 4NQSB 2O93L 5FDWB 3LN4A 2JIXA 1MREH 1MY7A 1P7QD 4BSJA 4L8SB 3V5DB 5GISH 2NY0B 3BEWA 4S1RL 2DM2A 2HWZH 2WBJD 5F1KC 5GIRA 3VXUA 2DDQH 3JTTB 4U6XB 1MPAH 3VI3E 1JGUH 4QRPA 1A3QA 2O5ZL 3NA9H 1U8IA 2AJ3B 2VDRL 1T0NB 1U8QA 4KRNA 2V9TA 1IGTA 1JGDA 3EO1B 5TFSL 2CDEA 3L9RA 3PV7A 3QJHB 4EOWL 5H94B 4HT1L 3V6FB 3WIHH 4PRIE 5HVGB 3BXNB 4JPWL 5MERA 3OKKA 5DT1L 1ACZA 2E9BA 1EX0A 5FOBB 2DLFH 4HWEL 3CSYB 3TVMD 3I6GB 1GGTA 3F12A 2EO1A 2QQKH 4YFLI 1MCOL 1HHIB 4G6FD 2VRAA 1L7IH 3QI9B 4RGNB 3REWB 4EN3A 4JKKA 2IG2L 4DK6A 4BSWB 2PN5A 4H5SB 4PB0H 1F2XK 5TDOB 2BC4A 3GMOB 3HAEH 4MNQD 5GZOD 3SO3B 1NKOA 4HUVA 3OBAA 4I48A 3R8QA 1TQBC 4YZFF 3M8OL 3VRLE 3WIHL 5HHMD 2EYSB 2VDLL 1M7DA 1AGDA 5F1IA 2Z8RA 4L4TB 1RIVL 4EN3D 3MOBL 1WCBB 1A5FH 3CC5B 3R1GL 4JFDA 4CAGA 1U8KA 4RGMC 3QFJE 3GIZH 4FQJH 3PL6D 5DJ6B 4JM2B 3MRFA 4YXHL 3QIWC 1KB5A 5CBEB 3X13B 1S7QA 3RL2A 3KYNA 4LEOA 1T5XB 2QADB 2N56A 4XVUC 4BH7B 1UQSB 3MXWH 5E8OB 4HF5L 1VGEH 3RY5A 4NGHH 4Y7MA 4OT1L 3VG9B 1CE6A 1R5VA 5IMOB 2UV3A 4IMKA 1CDCA 2EDWA 2XTJD 1R3HA 5GJTL 4XCNA 3F58H 3DARA 4ZFOB 4HIEA 4P4KA 2WMPA 4G42B 4P2OB 1F4XH 3VFMB 1HOCA 4NSKB 2WK2A 3OAZH 4JN2B 1VFOA 2HWZL 4EI6B 2B2XL 3B8YA 4F7CA 5E08L 4FFVC 4U7SA 1BFVL 1T89A 1U8LB 2AJUL 5E6IB 3WLBB 5AUMB 3KYNB 3HMXL 3U0WH 1M7IB 1BIIA 4PGCA 5HGAB 3RDTD 3SPVA 3GSOB 2ZP0T 3IDNA 1S7UB 2C3VB 3C08H 4OSUH 5JOPD 3V6ZA 1TPXC 3MRPB 1IGIH 1JRHL 3RFZC 3A67H 4D8PA 5ILTL 3QO0A 4XAKE 4AG4H 4HWEH 2UWEA 2DD8L 1HHHA 3VRIA 4NKQB 4UQ2A 5ID1A 2DJ4A 3PWVB 1WQVT 4GAYA 3K8LA 4I3SL 4OTXL 4HZAA 1M05B 3FZUD 4M1CC 2UWEE 3MOAH 1K8DB 3BUYB 5D1XD 1J1PL 3RVTD 3FQXB 1I1FB 3MLYL 2BK8A 5IB2B 4KK6D 3N9GL 5TH2B 1OPGH 1JGUL 2DJUA 5B38B 3EYFA 1WK0A 1P2CB 1A2YB 4PD4J 4QRUA 1NCUA 2FZ3B 4L5FL 1P7QB 3O41A 1YUHA 2W0FB 5LXGH 2J4WL 3O3BB 5E2TL 2AK4E 1KN4L 1K8IB 2RBLA 4HKXB 1RZ7H 1A22B 1P69B 4DCQA 5DHVA 3TGXA 3AXLB 3LQAL 5K59E 4DVRL 3FO1B 2R2EB 3H0TA 2X4RB 3SGDI 3QIBD 2Z31D 3TLRA 5JZ7D 3TV3H 1QSFE 3V52H 2ATKB 4YHIA 3SCMD 3WDHA 3T77B 4QGTA 4MB4A 4RAVB 1SHMA 4AEIH 1C5DB 1Q94B 2BMKA 3NACH 5HSFA 2EE9A 4FRWA 3O9WB 5C0IA 4ODUA 4P59L 1SBSL 4WO4B 1ZE3C 1K3IA 1ONQB 1TDQA 4WFGD 4QXUL 4JRYB 2XPGB 4KJWD 3STZB 5ADPL 3AREA 1A6VL 3MYJB 2DTML 1MUJB 2MNUA 4WI8A 4YDKH 1GZQB 3JBG7 4YFDB 4UAOC 1YEGL 3WFHB 4XXCC 3MV7E 5HYSA 4ZD3L 1XR8B 2GFBA 2V7NB 3OQ3B 4Y8AA 5C09D 1CFQA 3UPAA 2CR3A 1AIFB 1CFTB 1HCVA 4P4KB 5KSVA 1MIEH 2BVYA 1CICD 3ARFC 1XCQB 4JO3H 3TT1H 4EDXA 4ZXBA 4RX4D 4M7JL 1I9IH 4G43B 4PJ9A 2XWTA 3O4OB 5IROA 3VGDA 4X80L 2AABH 4ODTH 3MRMB 2CIIA 3LKRA 3DYOA 4ZS7L 4I1NB 4LEOB 1GYAA 5IVXB 4M8VA 2A6KB 4U1KB 2VR9A 5L0QC 1J0HA 3MV8E 5GGTL 1LDPH 3GSUB 4JFFD 2Y5TA 1PYWB 4Y1AE 2W0KA 5FYJH 4S0TD 2I9TB 4IDLA 1J86A 3I50H 3CH8A 1HCFX 3MRIB 1EEZB 3HE6A 3P0VL 2B1AH 2VR4A 2Q3AA 2WLZA 3CLFH 4OM0L 5J8OA 3O6FD 1YEJL 2FDBP 5DD6B 3WIIH 4LIQL 5MEPB 1QSED 3BAEH 3CZJA 1KACB 3KS0H 1CGVA 4OFYD 4WW1A 4EZMA 3ARGC 1URLA 4JFFA 4I0PD 5IMKB 2BVQA 3OG6B 1ZHLA 1MHEB 4DEPC 4KXZH 5HGAA 3GSUA 3QCTL 5BQ7A 3W9DB 4UTAL 32C2A 3O6FB 3HE6D 3HNSL 35C8H 1QPXA 3P9MB 3PDGA 2VITB 4LPVA 4PJAA 3K7UA 2ADGB 2Q87A 4KRPB 3O4LE 5DJ2B 3L1OL 1XEDA 2LAGB 4J23A 4E41B 2MTPA 3CSYA 4G43A 4G3YL 1I7ZA 4K7PY 7FABH 3F8UB 5D1QA 3M17B 2AXJA 3OAUH 1NAKH 1S7XB 3MRIA 2BFVL 3UTTB 1Q0YL 1QRKA 3RWGA 5BZDB 1NBZA 4KQ3H 2XQYK 4WEBH 3L7EA 4LHQB 2R0WH 4E0RA 1DFBH 5TPWH 1FZJA 3HFMH 5AD0A 4OCXH 5IG7B 1XFPA 1F4HA 3MUHL 4QNPF 1U58A 4P3DB 3F7VA 2DQEL 1D5XA 4Y4FB 4OGYL 4Y2DD 4HS8H 4L4VA 5IW3A 5KSUB 2R0ZL 3UEZA 3HZVA 2APWA 4GKOA 4Z77B 2JLLA 2IFFL 1FFNA 1KJ2B 3JV6B 4X6BA 5CUSH 4AEHL 2QJDA 4L3AA 3IDYC 5MEOB 3DGCR 4P4KD 3MX0A 5J89A 2VE6A 2EDHA 4K7FB 1A3RL 2PO6A 5JLZA 2VL5A 4XPBL 5HXMA 3QXTA 4PJ9D 3DX7B 5DJ0B 1K4DA 2JCCF 1IM9D 1CFNB 1RI8A 4ZQKB 2X4SA 3MCG1 4Y4HC 5ESVB 1A1MB 4WO4D 3D39E 3HNVL 1ES0B 4JRYD 3KWWA 4HSQA 1Q0XH 4YXKL 2CKBH 4Y16A 5C7XL 3IB4A 4OD3H 4ZOBA 2HKFH 1CD9B 1PQZB 1U3HC 3VXSA 3P11H 2YK1L 4M6NL 4Z7OF 1AGBA 1JHKH 1QKZH 1ZTXL 4L8CB 1G7JB 1UWXK 1OOAA 1ZXQA 3T0EA 5B39B 1JTOA 4K3GA 1U58B 5D93C 3HLAA 4DW2H 3NIFF 3GI9L 3P4MB 3U2SB 4HGWB 4M62H 5CILL 1BQHA 3E6HA 5HHOB 3PWUA 5F44A 1HINH 4OQTL 2O26U 4JDZA 4TNWF 1BZ9B 5E2UL 1DBJL 3H6JA 2DLFL 3GMOA 2R1XA 3EYVA 4PTUB 5D7IA 2DQUH 5B8CC 3SE3A 4ZUSB 2FEEI 4ALAH 2WV3A 3K8KA 2APFA 4EIGB 4GG8A 5ESAB 3GK8L 1LD9B 5D7JC 3TVMB 1HKLH 1UH4A 1FVCA 1TTUA 1HHKB 4FXKB 5DD5H 3QYCA 2HKHH 5A3ID 4NC0B 5DUBB 4KJYB 1JWUA 1TTFA 5MHSD 2KPNA 1RZIA 1YNKH 4L3EB 5JUEH 4OFDA 3SKMA 2DDQL 5H37H 2WANA 5BO1H 3CU1A 2ICEA 1UJ3A 4IDJH 5C09E 1JI1A 1NFDB 5MENE 1WTLA 1MJJB 1V7NL 3KG5A 4NNPL 3S37X 2IF7A 1CXHA 3EOTH 3QXDA 4K3DL 3VRJA 4M43L 4W68A 4KJQC 4CVXA 2XNAA 5EBLB 3U7YL 2FD6H 3RWFA 3LZFH 2FB4L 1RFDH 4XWGH 5E6IC 1VPOH 4IJ3B 4KUZH 1A3RH 3RRQA 1CQYA 5IHUH 2HLFC 5DT1H 3U83A 4Q2ZA 3UC0L 3QJFB 4PGDB 2EZ0D 1I1AD 1DUZA 2GJ6A 2JCCA 1ADQL 2IPKB 4PRAB 4U49A 3AS2A 1A4KA 3DHMA 5IT2H 1AP2A 4HS6A 4QXTB 2ZUQC 5C3LD 5MENB 4U6YB 4YNYA 2GK0B 1CTNA 5A2KH 1RJZB 4OM1L 1R3IL 3P11L 4RRPG 5LGHH 4C58B 1NCTA 2FHBA 1AHWB 4ENEC 2C4XA 1U3JA 3C09B 5HHQA 3K2UL 2GT9B 3BD4A 4P2OD 1XGTB 3SOBH 4HGKC 5F21B 4POUB 3VFGH 1MWAH 3PP4L 1R3HB 1IJ9A 4OAWB 4FFWC 2VB5A 3QAZB 5EUOE 4HCRH 1JPFA 4DUWA 1JPSL 4LKXA 5CHNB 3UC0H 5D70H 2D7OA 1FZOB 2UUDK 2X4SB 4UT9L 4WV1C 4AIZB 3PGCB 1AP2B 4EI5B 4R96A 2KBGA 3CMGA 3NTCL 1S9XB 3SGEH 2JCCB 3MXVL 4XCNB 4MAYC 2HRLA 4NQTA 5GGVY 1W0WA 4M61A 4RAHA 2C7UB 1IAIM 3SO5A 4RSVA 1KC5H 3N06B 4Y2OA 1NCWL 1Y0LB 3MRHB 5FIEA 1YY8B 1LGVA 1BQUA 4L8DA 4HG4K 1OARH 4TVPD 1A4JB 3MLRL 2AXGA 5FO8A 5HI3C 1MRDH 3HPJB 3ZYIA 3SY0B 4TQEH 2BVTA 5HDLA 1EBAA 2VDPH 2DTMH 4D0DB 4QEGA 1HNFA 2ARJB 2OSLB 4OF7A 2HVJA 3O8XD 1JGLL 5EFIB 2ZKHL 1GC1L 4J3VA 5SWZD 2J6EL 4MB3A 4YDLB 4JJHA 3KPPA 3VWJB 3SDAA 4UB0H 4NQVB 1ED3B 1UACL 4ELMB 3BESR 4ZUWB 4JM4L 2A74A 2VDOH 4HWBL 1QG3A 1MCOH 4Z6AT 3OTTA 5B39G 4AENB 2AJYL 1VPOL 4OBRA 1KLGA 2AQ2A 5F9AC 3RWDA 2D7QA 4G6JH 3FJTA 4LLWB 2HFGH 3O8XA 5K9KA 1N4XH 1BIHA 1MHCA 3KDMA 4LHUA 3MLPA 4PJDA 3SKMB 2BVUA 4M7KL 1FRGH 4JRXD 5HVFB 5I66B 5F88A 1JNLH 2XTJE 1OAYH 3LPGA 3B6SA 5C71A 4K2UH 1LP9F 1UWGL 1NUGA 4OCLC 1FYHB 4I3SH 3H7BA 4WWID 4XMKL 3T2PA 1ACYH 1AXSA 2X4NB 4HG4J 3CX2A 3CLFL 2VYRE 3VWJA 1A6AA 5J6GB 3VI4F 4GW1A 3L7FA 1DBBL 2BHZA 4XBPB 3JV4A 5JUEL 1QRNB 3DO7B 3BH9B 1ONQA 5D71L 1IEBB 4D9QD 3JTSA 1IGCL 3WD5L 3WKMH 3TBWB 1KIQB 5D1XC 3OXRB 3V7AG 1L6XA 4AYFA 4XHJD 2J8UF 4KRLB 4JVWA 3I6LD 5D7SH 3WSQH 5A2IH 3WLBA 1X5IA 3EO0A 5J1TC 3ZSTA 3D87B 2KKQA 4XZUA 5B4MC 5JZ7C 3HE7B 5F93C 4WWKD 1NDMA 2JTDA 2JKXA 3TEUA 4KRPC 1C7SA 4BK5A 3GSWA 1UB5B 5JIPA 5C0BE 2ZNWA 3D85B 2M8XA 1KELH 3NA4A 1U92A 2FX7H 4RFOH 4CVXB 3SJVB 4HLZH 1AJ7H 2F53E 5FV2A 5CSZB 3G08A 5BVPL 1AKJD 1ZHKA 4PRDB 3KYKL 1P9MC 5EUOA 2YWYA 2HFTA 1CWVA 3QUKB 2NTFB 4JJ5B 3QR2A 1DVFA 3MRGB 4F2MB 5EZLA 4D9QE 5KS9B 5F7LB 2ICWB 3I75A 4GAGL 1SBSH 2VLME 3REVA 3EDEA 1CFTA 1EGJA 4PBVC 3EOBA 4BFBD 4I18A 4XZUB 2FR4A 2IMNA 1R3KB 4APQA 3P9WB 1IKNC 5EWIH 1OWRM 1V3LA 4Q9QH 5L9DL 5E0QA 3SJVE 3FT3A 5L88L 1XF1A 5DRZA 5E00A 5HDBE 3ALPA 1U8HA 1P2CA 4PJXA 4TTDC 5H2BA 1MCQA 3GUTA 3EO0B 1QFWI 2OZ4A 5I1LB 3V79C 1BPVA 4G6JL 4Z7VA 2X44D 4L9LB 4DCQB 2AERT 1MAMH 1C16A 3W9DA 4OZGE 5GSVA 5T1KB 2XZZA 3UTQB 5I1KH 4M3KB 4YXKH 4M9OA 3PWUB 1PG7W 2VSCA 5F96L 4UNTA 3MCLL 4L9LC 1YQ2A 2DWDA 5IBTH 4JHWH 3SQOH 1DBBH 3VWKC 3VFRB 3O45A 3OR7B 5E95B 4D9LL 3W0WE 5DJ8A 3ARTA 2BCKB 4JFEE 3O2DH 4YBQD 5IB3A 4G9FE 1JV5B 1JGVH 3DMMA 3LH2H 4PLOB 5AAWA 1ZTXH 4LRNL 5IQ9B 5KVEL 5JTWA 3HB3C 43CAA 2ZG3A 4P5TD 3RWDB 2W9EL 1CZ8H 1XF4A 3NZ8A 4WI9A 4XB8A 4XP1L 1I8LC 2YD3A 3O6KH 1EK3A 1P4IH 3HI6H 2R0ZH 4TRPL 1NMCB 1T1XB 5IM7A 1K85A 3PHOB 3UJJL 4PRPE 4NWUH 5EU5B 3AY4C 4LSTH 5EIVA 1MFBL 1IRAY 1YECL 4KC3B 5EOQH 4NQSA 3BJLA 1NCBH 2YKLL 5D96B 4NRXA 1R3LA 2JJSC 3SE4A 3BKYH 5D7LA 5I8KH 3FONA 4YH6A 5AYUH 2X9YA 2WBKA 4KDVA 2ZOKA 5ICYA 2VLKE 5FYJD 1A6VH 3MACL 4U6HA 4PY7B 3TJHC 4GKNB 1DQJA 4KPHH 2CRYA 4BK4A 1YPZE 2R9HD 3O2WL 4OZFB 4IDJL 3MCKB 1CG9A 3ZHLA 2RJMA 3TT3H 5TQ0H 2PTTB 2YMXL 5IR1A 1X5ZA 1BAFL 1KBGL 3I3BA 3FN0L 1EHXA 3IVKA 3EJJX 4NKMB 1OTUC 2A0LD 2P45B 4D94A 4LSRL 4WFHD 3B5TA 3HR5A 2HTLC 5IB1A 5GGRA 2DQGL 1ADQH 2EIZA 5I1GL 2AK1L 1PKQA 4OD2A 5JDJA 4F15B 1MI5A 4N5EC 1HI6B 1SQ2N 4OLXH 5DJZA 3GIVB 1T5XA 2VISA 4JDTH 3C8KA 4KQ4L 2Q76A 3M45A 5TDOA 4DN3L 5T1KD 5E5MB 2AK1H 1FE8L 4J3UA 1R3IH 3ULUF 4WU7A 1FVEB 3K1KC 4WUUD 4NO0D 3RL1B 4PJBF 1TPXB 4YFEA 2Y7QB 1ZA3B 1MQ8A 5JNYB 5IB1B 4HAGA 4F58L 1CE1H 3DO3A 1EHLH 5C7XH 3RQ3A 1WAAE 1KLFA 1LO4H 1M71B 4X4MA 4PJ7E 4EIZC 1NEUA 3D3VB 2GAZB 3ARVA 5KJRH 5LKNA 2IG2H 4Z77A 2CLZB 3HAEB 4YC2B 4LNVA 5DI8A 2J5LC 3T8XB 1KC5L 3T08A 1G7HB 2F58L 4X80H 1TJGH 5KAQG 1MCPH 4H1LA 4TNVK 5I17A 1AHWC 5IIEB 2BSED 3PABA 4Y8DC 1IE5A 1Z2KA 1B2WH 4MD5B 4CMMA 1XMWA 3SGJA 2V5SA 1C5CL 1UA6L 1UZ8B 1CVRA 4JQIH 1U8MA 4PJHB 5DURB 4U1IA 3VXRE 3BJ91 3QJFA 3CXDH 3KHOA 2F74A 1JGEA 1F11B 2CR6A 1BGXL 1U8NA 4D0CA 3PL6B 2XG5A 3G5XA 5F89B 5A3IC 5C0CD 4OKDA 2IAMC 5ID0B 3U82B 2OMBA 1HXMB 3LS4H 4LSPL 3PIQB 1D5BB 3ARBC 3KYMA 3O11A 4TULL 4U1MA 3PHQB 4V1DA 1ZOXA 1QFUL 4ELMF 2YMXH 2Z93A 1E4KC 5C9JB 5LGHL 3W5NA 3ZKXC 3MBEC 3S4SG 4H1LB 5HDQL 4P23D 2NY7H 2P5WB 4FQHA 1S7WB 3T0BA 5I16A 3KPRD 5C9KA 5FGBC 4HQQH 3HRZB 4K23H 3ZYJA 3QUZA 3MQIA 1HILB 3GSQB 2YD8A 1OAZL 4ESKA 4MD0A 1CFSB 1KCVL 2DLIA 1B0WA 1XGQA 4NJ9H 3CSBA 5FUZH 4PRHA 3RJDA 4ZFZB 1ZLSH 4PLNC 4M03A 3GRWH 1DZBA 4KTDH 4GG8B 4HCRA 2BSSA 3G6JB 3TNMB 2XIDA 2J8UE 4K3DH 1S7TB 1MWAA 4B0MM 2IPTH 5IFHH 4J8RB 2R1XB 4X98A 3Q2CA 4YHPA 4OZ4A 3S34H 4WTXA 3HHRB 3QUMB 1K2DA 1KN4H 4S0SD 4IRJB 5JHDA 1NAML 1YNLL 3TH4T 1QD0A 3GJFH 1GGIL 1CK0H 3ESUF 3QISA 5MP6L 1IGCH 4Z7UA 3ZL4H 4FMKA 5GGRB 2OTWB 5HHXL 2FBJH 2R4SH 5CSZA 5TQ0L 4EUPG 3DRTB 3BGMB 1HI6A 3EOAB 5BS0B 4MA3A 4LVOB 3QXVA 2N7AA 1CD1B 2AJVL 3IDIA 1TJIH 4U6HB 2AKRA 2XZQL 2DMCA 5CGTA 3O8XB 2CRIA 1UGNA 4HK3J 1I3UA 5DMYA 3QHTC 4JO1L 1EFXB 5CGYD 4GKSB 4WTZA 5AZEL 5ELIA 3INUH 1RZFH 4KRMB 4ZDHA 3DYMA 3NN8A 1KEGH 4XPAL 2UWEF 1ED3A 2CDGB 5JOFA 3GNMH 2DF3A 4WUKL 1UENA 3I6GA 5E5UB 4ORGB 4OCRL 3DJ9A 4UT7L 3OKKB 2PO6B 1YC7A 2BNQD 1YZZA 3GKWL 4PJCE 5IB5A 2F53B 5IJKC 3S5LG 2Y6SC 4GBXC 3BP4B 1XIWA 4B7LA 1BJMA 4UAOB 4XWOC 3KYOA 3KLAA 1D5ZB 3L9RB 1MFAH 3HPLB 3QDMA 1E27B 1KCSH 4RGMB 1M6OA 5DRWA 4NFDA 3QXDB 3RBGA 2YEZB 4WTWA 3DV6A 1NFDF 5HI4D 4PB9H 5HPMB 3GKWH 5IJVB 2IALB 3K3QA 3W82A 3SBWA 4G8EB 4MAUH 5IFJA 4IOFC 1A9EA 4Y1AD 3O2VL 1HDMB 4OLYL 4FQXB 1RIHH 4OQTH 1Y6MR 5D2LA 3VGAC 1SJXA 5C1MB 3P2TA 1KJMA 3FQNA 3T65A 1IEBA 4I2XE 1P1ZA 3QEUA 1G6RA 1MFCL 2J5LB 3HI5H 1F90H 3NCFB 4EI5A 4NQEB 3BIAX 1F6AB 3TVMC 4PG2C 4N0UE 2FATH 25C8H 4R7DB 4CW1A 3LKOA 4Y4KB 3OGOE 5MEND 3R0NA 1II4E 1OY3B 5AG8A 1X6LA 2OJEB 1CIUA 3I9GH 1CLOL 1BVKA 3P0GB 3ROLA 5CBEA 4IRSC 2UZIL 3QFJB 2F19H 1JNNL 2IAMB 1XZ0A 1VFMA 1PKOA 5D2LB 2G75B 3JSSA 5DVMA 5IB5B 5JHDD 3GSRA 4LCYA 4YHOH 5F70A 2ZG1A 4K7PX 2BNQE 4N5UA 4MJ5A 4PJ5A 4O2CB 5CHNA 3H3KA 4QOKD 2X2YA 2EDLA 3HRPA 3LQMA 1FL6B 5SV4A 1XH3B 1I3RB 3NCJH 3QUKA 1Y0LA 3MRHA 4Z8FH 1RUMH 5FB8A 1NFIB 4F9PA 4X9FA 3I6KA 2AQ1A 5DJCA 4MMZC 1T3FA 2WWKT 3BYTA 2EECA 3B8SA 2AABL 2HVJB 5F1OB 2FR4B 2X4OA 3RTQD 2HRPH 2IH1A 2VLKD 1EO8H 4WI6A 5AZEH 3VD4A 1V7MH 1R5VB 4MGXA 4MD4A 5IMOA 5DMKA 4XP9L 5EZLB 4LK4A 5BRZE 1NGYB 5HI5C 3P9LB 1MAJA 4HW6A 5FM5M 3K0WA 5GGUA 3O6ML 5BZWA 2VDML 1Z3GL 1A7NH 4KHTL 2HJLB 2NR6D 2BNQA 4XNZB 2FEEL 3K81A 4X7TB 4BFGA 4P46D 1T4KB 4Y5VC 1RIUL 2EDDA 5EZIH 4WGVB 3ILQC 2DBJA 4G8IA 1NBVH 2CDEB 5EG6C 2WIIA 1QFWL 1YQVL 3HAEG 3OKLB 3TNMA 3BRFA 1IGFL 5JW5B 5KSUA 2VZ3A 4CN6A 4UTAH 1A6AB 1SEQH 3RY4A 1DDHA 1NUDA 4QRRB 3P0YH 4M7LH 2VZUA 4KV5F 1NC4B 4QTIL 4MD4B 4LDEB 5DF0A 2HN7A 3O2DA 2Q8AH 4DAGL 4MA7H 5J0BA 4S2SB 4TOYL 4YDVA 5DGQA 1I9IL 5B21A 2Z4QA 1XIWB 4NM4L 4S1QH 1FE8H 4Q9CA 2F5BH 1UFUA 4LPYA 4HJGB 3WUWA 4LVEA 3L7FB 4GW1B 1G7HA 1MCFA 1I7UB 3BN3B 4GW5A 4NJAL 1LEKA 4ERSH 2NX5E 3ILPB 5I1AA 4OKVB 5C2BL 5I17B 3O3UN 1O5DT 3C6SB 1LDPL 3H0TB 3NN8B 4M7LT 5F9WC 4P23A 5HJ3B 4IRJC 3S7GA 1UXWB 1KIQA 2YPVL 3OKEB 5I8EA 4UI2A 4HWZB 5DHVB 4WVRA 4UDTA 1L9MA 3PL6A 3O4LD 1RZKH 2X4PB 3UTSA 5IKCA 1XF5A 2HKFL 3IU4L 1U8LA 5FXCH 2D4DA 2GKIA 5F7NC 3P4MA 1OCWH 1CGXA 3MJ8A 1LE5B 4I0KA 4JN1L 3A0OA 4FTVA 4JFEB 2CJUL 2HKHL 5IMLA 3HNTL 2OLDA 1QSEE 1I3GL 1TZHB 3BQUD 4QHUB 3JUZA 3QRGH 1N6UA 4LLQB 4PJIB 1TETL 3RP1A 5F1NA 4OZHA 1MNUH 3EYSH 3G04B 1A7PL 1BBJB 4AMKH 2CGRH 3VXUB 1IGJA 1ND0A 2X5PA 3M1BA 4JFOB 3CSGA 4GAYB 3LMJH 4NPYA 5C0RL 2DLHA 4NYLB 1ZGLA 4GXVH 1JHTA 4Y4KD 4JFFE 3UTOA 3RDTA 1N8ZB 1MCWW 1DLHB 4O5LH 4NO2A 2CPCA 3TJHD 1NBYB 4AZ8A 2ESVA 4XRCB 3CFEA 4AQOA 1NL0H 1XCTB 1AIFA 4EVNB 3WL9B 3SDDD 1KG0A 2EDOA 3SCMC 3U1SH 4NRZA 4ALAL 3PWPA 1O7VA 1A14H 3UBXI 1MI5B 1WZMA 1MQKL 4OZGB 1RQ5A 2BSTB 2HJFB 5E8EA 1LK3H 3VXQB 3GMMA 3PWPE 1QNZH 3A6OA 4OCNC 4Y4KC 1ZT1B 1H3PH 3D3VD 43CAB 1DSFL 3WO4C 4XP4H 4PS4H 2HMIC 1I9RL 4ZUVA 4NO2B 5JXEA 5E94A 4XVUD 5DHYA 3KXFE 4XNXL 4FQJL 3UDWC 3ET9F 3WJJA 4BQCA 3N1MC 2GK0A 2R4RL 1DQMH 3ZL4L 4HK0B 3C60D 3W81A 2EYSA 3VE0B 4Y5YC 1TFHA 5DJ2A 3P77B 4F9LA 1S9VA 3L5HA 5JORA 3KYMB 3O11B 5BMFL 4KUCD 5JPMA 2Y36L 3IKKA 1OAUL 3MBXH 3DVNA 4TUJB 3VH8B 1X5XA 1K8IA 4U1IB 2VDKL 2PNDA 3GSXA 3IXAB 2VITA 4PRPD 1QVOA 2O61A 5CINH 4NWUL 2CK0H 4PBXA 4FTVD 4Z7WF 3VFTA 2AI0H 4KKCC 3R06A 3LKSB 4I0PC 2G2RB 3CPLB 5LCVH 4ZFFA 2MCG1 3QDGD 1IQWH 5I73B 1FG9C 3LN4B 1IKFL 3EFFA 3QQ4B 5J6HB 3ZT5A 4J3WA 4LLDB 3ZYOA 3SDYH 1HHKA 1AFVH 4L4TD 4XP5H 1HQRA 1U3HD 1JCKA 2H3NB 2AXGB 3GRWL 4QRPB 4YXHH 2J3SA 1F58L 4LRNH 3G5ZB 5KVEH 4L8SA 1SJEB 3IT8D 3QI9C 5C6PB 1J0JA 1CFNA 1I8MA 3JWDC 1PY9A 4Y5XC 1N3NA 5GIRB 5CZKA 5FUOL 5I76B 1UACH 3K4DA 1S5IH 3O6FC 4X6CE 1YNLH 1K9TA 4HFWA 3F6IA 1FL5B 3RWIB 1QACA 1RUAL 3E8UL 2MWCA 3RX5A 1I9EA 4K94C 3IFPB 5DEZA 2BDNL 4U1LB 3S35H 3U0PA 5EBWB 1T0NA 4ZAKC 1A1NB 3Q6GH 4E41D 5EIIB 3T0EB 1PQZA 1SMAA 3MJ9L 2IH3B 1EFXA 2NY0C 2QSQA 1AGBB 2VL5B 5FEBA 4X99A 3GKZA 4J7RA 1WZ1H 1MWAB 3D3VA 1J8HB 1NUNB 4L3ED 5I1IL 4RBPK 5JQ6H 2IH1B 3IXTA 2W92A 4YNYB 5SWSE 4AEFA 4UV7H 1AXSB 1W0VB 5I76A 3T4AB 3UJTH 4BKLB 5EU5A 1E6JH 5I30H 1TQCB 3GMQB 4ZNCD 1N26A 5F6IC 4NHUB 2VDOL 4Y19D 3RL2B 3TNNB 4MNGE 3ULUC 1IEAB 3FCTB 4PJFE 1WLHA 2F53D 3CVHH 5F71A 2BNQB 1MJUH 2VJXA 1IGYB 3AXLA 3ZMRA 1VFAB 5KSBB 4F15C 1WJ3A 2B1HH 4R7NB 5ANMB 4MZ2A 4XX1E 5FGSA 5KVFL 2HYMA 4CGTA 5J11C 3NABH 3PHQA 4V1DB 2AGJL 4MD0B 1MHHB 1KXVC 3PDDA 1JPGA 1HE7A 2BY1A 4X0KA 3QIUB 5LXGL 1D6VL 4LVOC 1P7KA 4WJ5B 1CD0A 2ADIB 4N0UB 3TCLB 2X4QB 5EPMB 4LSSH 4X4YA 4HEME 4D0BA 4N8VA 1D9KC 1TENA 3QIBA 1AO7B 4GBXD 4JFQA 1CDJA 2XWJB 4JO4H 2OXHA 5T1MB 1UM5H 1N0LA 4QCIA 4XH2A 3RWEB 4OSUL 1HSAB 1BOGA 3ESVF 4K8RC 4O4YH 3V4VH 3MUJA 5C08D 5IVZB 2HVKB 3GSNB 1HNGA 2ILLA 4ETQB 2G75A 3O45B 5IP4A 2B0SL 3SKUD 1J87A 5F6HI 2VXSL 1I1FA 1XZ0B 4Z7QF 4ZFOA 2HFFA 3EOBB 5LBSL 4PJEA 5FA3B 5CJXA 1QQDA 1B0GA 4LLWA 2R0KH 2C3VA 1P4LA 3LS5H 1N64L 5E99H 2I5YH 1FG2A 3WIHA 3BDXA 1KENH 3F6LA 1DR9A 1TMCB 4MSWB 1CGSL 5DQ9A 1EO8L 4JM4H 2HT4C 3QIBB 4Y4FC 4QRTA 3Q6FA 1TTGA 1S9XA 3O2VH 3QFDB 4OLYH 2ITCB 2DD8H 5KOMC 3QIUA 3STBA 2F54B 2I26N 3MZGB 3P73A 4K7PH 4JPIB 1IEHA 1FYTD 5ABDE 5HHXH 2VOTA 4NUGL 5ALBH 4PLJC 3DMMB 1KJ3L 3IRZA 2YRLA 3FOMB 3TO2A 4PREA 4WWKA 1ND0B 3M1BB 3TO4C 1XGTA 3LEXA 1JTTA 3F7YB 1S7SA 2WIMA 2X4RA 1LO3L 2F53A 3S4SA 3SJVA 3DTXA 1FFPA 3DV4B 2GITB 3LKNA 3TWCL 4U1NB 4KKNA 4GG6E 4U1GC 3M8OH 4MQ7B 1LO2L 3QNZB 3SY0A 5DS8B 2YKLH 1YEHL 3UP1A 3WFDL 3U46A 1FN4A 1GCFA 1KFAH 1D5IL 3BSZH 3T09A 1CR9L 4NDMB 1QFWM 2JB6A 4EXKA 1OAXH 1U91B 4XBEL 1RZGB 4NQCE 5DC4B 4JY4A 1V7ML 1ZV5A 5TE4L 3RZCC 3LD8C 1GOFA 2QR0B 3PUCA 1RK1B 5KSVB 4LP4A 4QWWC 3WDIA 4H1LH 1OTTC 3EFDH 1W72A 3GMNB 3MRBA 2MQCA 3NZHL 4A2MA 4HULB 3HMWH 3QUYC 4UU9A 3DUHA 1JK8A 3GJFK 3UMTA 4OZFA 5IV2B 1HIML 5T3XD 3SDDC 4B53A 2P47B 1JYNA 1P6AB 4GMSL 4UINH 4M6AA 2DL9A 3QEHA 3ILPA 5I1AB 3OKNA 5CWSA 2YPVH 3CFCL 1MJJA 4UDTB 1CGTA 4GS7B 4YHPB 3B6SB 4DJMA 4PJHF 3PWJB 5MERB 5GS2D 5JA8B 2FEDD 2H8PA 3V0VB 5C0CB 1RVFL 4MNHA 1RJLA 3KDMB 4YDVB 4BZ2L 1LK3L 1FGVL 3CK0L 3C5SB 4Q58C 1EUTA 1CBVH 2AEWA 2AJZB 2P8LA 2B5IC 1H3PL 1FLTX 4YDJB 4HLJA 2H2PC 3MREB 3WEXA 2ADFL 2CRMA 4IM8A 4QF1A 1WTGT 4YQXH 5D70L 1YJDC 1J12A 1JK8B 2Y5TB 3QO0B 4RFNB 1W72L 2NY1C 3OJDA 1CFBA 3GM8A 2VDNL 1ADQA 1WZLA 1C5BH 1OAKH 5IW6A 3CLEH 1TCRB 4LLVB 5EU6A 2ZPKH 5ID1B 5ACMA 3DECA 2Y7QA 1OGTA 5DWUL 2I25N 4R4ND 4ORGA 1U9KA 2EDBA 2R1YB 4EQ2A 3D1MC 1A7QH 2AJZA 4RCAA 3WIIL 4GAFB 1AD0A 1NBQA 3CCHB 4LKCB 4NN5C 1J1PH 2XG4A 4HXBL 5KW9H 2A73A 4Y4HB 2MCPL 1QSVA 3ZE2E 4JGJA 3WHXA 4NUJA 1CCZA 1NSNH 1T5WA 5CEXA 3CH1A 3GMPB 1MLBB 4XCYB 3DBXB 1Q9LA 3FFCB 1FNAA 1WUNT 3EJZC 4KKAC 4S1RH 4NFBA 1B0RA 1YN7B 5CLWA 1DVFB 2P44B 3GM0A 3NFPB 2KH2B 5E2UH 3FB6B 1CG9B 4PR5B 4LSTL 4AT6A 4PGBB 3WCYA 2R1WA 1YY9C 3IS0X 1LD9A 4HIXL 3KLHD 2QHRL 5TF1L 1R0AL 3X11A 4XBEH 3E0GA 3F7RA 4XAWH 2X42A 1FJ1A 5IG7A 3VFMA 3IFLL 3KXFA 4ONGH 1X5YA 1PLGH 3FN3A 1NJ9A 1EGJH 3X14B 1ZT1A 4YX2L 3D85D 4CU7A 5D1QB 3ZKXB 4C57C 5C0RH 1S9WB 1SEBB 1VFBA 4CVZA 4YLQT 5T5NF 4YHIB 4RISL 3SE8L 3U46B 1DANU 1T66C 5ESVA 3OB0K 4YIQA 3RAJL 2DN7A 3CXHJ 2BFVH 3ZLQC 2EIZB 3NA9L 1MCNA 3HR5B 5MEOA 4OCXL 4FQCL 2FJFB 4PJGF 1IZJA 5I9QC 5IFHL 4NNYA 4WI3A 1CLZH 4KU1A 3VFNA 5FHBH 4KMTL 1A14L 1A1MA 2CH8A 3D39B 5HI5D 1N7ML 3VFTB 1CFVL 4MCYB 2XY2A 2R23B 3GBNL 1DBMH 4PFEA 3ARED 3IDGB 4Q0XL 3GSXB 3IXAA 3KPSD 4AIXA 1U0QA 3G6DL 3VW3L 2B20A 2FX9L 5T1LA 2Z31C 4NZJA 4FZEH 5IM7B 2VNCA 4POZD 5BOPA 1AR1D 1JWMB 3QA3A 5GQBA 3B2UC 4TUOA 1MOEA 3RUGA 1NGXB 3X12B 4O51B 3TFKC 5D6CB 4OV5B 4MJIB 4K3HA 2H2SD 1Q9OA 4HZLA 3FO2A 3BMWA 4NRXB 3CGTA 1RK0B 1KT2A 5J7CC 1ORSB 5CZVH 5F7DA 2BNUB 3HC3L 3SDAD 5FK9A 3E6HB 1R5IB 1YYMH 2WQRA 3FRUB 3DGGB 3H9HA 4WIQA 4BQBA 2IWGA 3KR3H 1T1XA 1K6QL 4HCRL 3EYOA 2CO7B 4ZXBC 1QSFB 4QY8B 3UZEA 2H6PB 4Y19E 2DLGA 3ME0A 5F96H 3VW3H 4R6UA 2D31B 1MHEA 2PKDA 3MNZB 4XPBH 5KG9A 4N0CD 4TUOB 5EU7C 2IPUG 2XA3A 3GB7A 2FSEA 3MODL 4K07A 4TPRL 1UYWH 4TSBH 4XVTL 5T3XL 1JVKA 1CL7L 1NMAH 1U8JB 4V1DD 1Z9MA 2PO6D 4HUKB 3TYFA 1D6VH 3VXRB 3WNOA 5TE6H 4F80A 1BVLB 4X5WB 2NLJB 3INUL 1JNHA 3RWCA 1WIOA 4CDGC 4OF5A 5HGGS 4PRIB 1CXEA 5ESQA 5LCVL 1I7TB 4WV1B 4WO4A 1T21B 3RVTC 1J8HE 3KPRA 3KJ4B 3QNYB 5D5ME 2MHAB 3VFUA 3CFEB 1Q38A 4LVHB 5KVDH 3S8WA 1TQBB 4FG6C 5LJYH 1H5BB 5T33L 3BMVA 3V0AC 1TXKA 2NPLX 2OMNA 5LBSH 3VDBA 2CLVA 4KUCF 1NGZA 4JEGB 5AEAA 2PYEE 3L3KA 2YA2A 4Q9BA 4FNLL 5DJXB 5HYQA 2OR7A 4RMVA 2O5XH 1JWSB 5HHME 2NXZD 4U1JB 1Z0MA 3W2DL 3IU3A 2OBGA 3DX9A 3OJ2C 1OPGL 1RZ8A 3LN9A 2BSSB 4EQ3A 3I6KB 4ZSOE 4LQFL 3Q6GL 1CFVH 1QLRA 4BSVA 1GPOH 3DRTA 2EDXA 3A67L 4ZUTA 1EAPB 3EJZD 4KKAD 3LB6D 3W2DH 3PF2A 2J2ZA 4ONHB 1DUZB 4KZDL 1Y18B 3ARXA 3OGCA 3RVWD 4KKLD 3RIAF 4FNLH 3U30B 4AT6B 3FMGH 3P40A 4UUJA 3GJFA 2UZIH 2N7BA 4Q6YA 5GRVK 4RA0C 1N3NB 2AEQH 1KCKA 3PNWB 4PRID 3TPUA 4ODVL 2VQ1A 3RY6C 3TBYB 3VXMB 4DOHE 3LIZH 2VAAB 3OR6A 3ULVC 4HS6B 1RSFA 1OD9A 1SJEA 5IHZA 5J9PB 4C59B 4KPHL 5EORH 1D5BA 1OAQH 4RFEA 3FAWA 2BHUA 3O4LB 1D6EB 3VWKB 5C0JA 3BVNB 1G9MC 4HH8A 3D18A 4NKDA 4TVSa 3UPRA 1S7WA 2F74B 3PWLB 3QDME 4R8WH 2F8XC 3PWJA 1X5HA 1DE4A 1YEDA 4KHXL 2YBRB 2Y06H 4CMMB 1T6WA 1I1CA 1J0IA 2NY5H 1FQ9C 1K5NB 4O2EB 2DWEA 4ELMA 1KSRA 4E5XA 4KVNL 4U6XA 2D0HA 3MOBH 5EB9A 4YDJA 4X6CB 2VXUH 1M6OB 5DRWB 3DWTA 3E2HB 4LCIH 4P4RB 3SE9L 1I1YB 4BYHA 4C83A 3KPPB 3WHE1 4POZC 3SOBL 1IC5H 3C60C 3ZYZA 3KS0J 3ROOB 3C8HA 1YDPB 5E08H 1MVUA 4BUHA 1T83C 3BW9A 3MLTB 5DYOB 3C60B 4P2RB 4ODXB 1LILA 2FEDC 3MA9L 2HH0H 4IOFD 3HC0A 3KPSB 4MAYD 1HDMA 4UT6L 3THMH 1GOGA 5JW4N 4PJAF 4F7MA 4O2FB 5JQHC 2E27H 1E4WL 3EYUH 5FCUL 5F9DC 3KJ6H 4N8CH 4FA8A 4I77L 4NM8H 3QNZA 2QKIA 4LQFH 5BV7L 4GKZB 3O0RL 3QHZH 4XNQA 15C8H 2GITA 4JANA 1AGEA 3C6LC 3GIVA 3V6ZB 4BH8B 4XXDB 4X7EC 1E6OL 4PGCB 1RZJL 1FC2D 2JB6B 3U79A 1JPGB 4HKJB 1UWEH 2WBJC 5FB8B 1T2QL 1MFDH 1C1EH 4LFHD 2D7PA 5DFWH 4KVCH 4NC2B 2APTA 4MNGA 3TN0A 5ALCH 5F3HB 2UVEA 2J4WH 3AM8C 3P0VH 4LLYB 3BN9D 1B6DA 4HWNA 4NBZB 1E4XL 1F8TH 4JKPL 1FSKC 4F7MB 3SKJH 3DUUA 3VXOB 2E27L 3G04A 3QEQB 1G84A 3QXAA 4ODXA 4WNQB 3V5HB 1IGYA 3UYPA 4ODWB 4YGVA 3WE6B 3WNPA 3HG1E 5J13B 4M48L 3TZVA 2ZUUA 5BCAA 5H37G 4XMKH 4NQUA 5FUZL 3WNKA 2E7LC 1WCBA 2GY7B 1ZA6A 4OIIL 3SKJL 4HGMA 3MOQA 2CIIB 3H8NA 1S7VB 4M7JH 3KPSA 3LD8B 5MEQB 4G7YL 1YEEL 3NIDF 1Z9OA 4I3RH 2W65B 3FFDB 3L1OH 1KIPA 1OTUD 3WUZA 6FABH 2DQHL 2R2EA 1PG7H 3PGFH 5DJAB 2BXZA 5HDQH 1GPOL 3GSQA 4RBPH 2PUQT 4GMTH 2FD6L 4LEXL 1XF3B 4H1LG 3KPNB 3ZKMC 4NZDA 3UTTD 1U93B 1VESA 2IANA 3P4LA 3VXOA 5DVNA 3RWEA 1NL0L 1C7TA 1ROWA 1UQSA 5DGRA 4Q6IC 4LSRH 2IFFH 2V17L 2M26A 2MSPA 4XBGA 5JA9A 4N1HB 1FZKA 4JY6A 5J1AA 4HXAH 1RHFA 2ED8A 1OCWL 1G9EA 4P2OC 2IQAA 4U2ZA 4GXVL 3QWRA 4UOJA 1K4CA 2H32H 3D18B 4NKDB 2Z0BA 4IOIA 1B0GB 1INDH 5ISZE 3NZHH 1WBYB 2WUCH 4KQ4H 4GRLD 3BOVA 2V17H 3N1GC 1ETZA 5CIPA 4I0PB 1T2XA 3QDJE 2EXYD 1HH6B 3BPNB 3D48R 4QWWD 1WWBX 1DN2A 3BISA 4Z9KB 1NBVL 1Q1JL 1DSFH 2BOBB 4TTDD 3AAZB 1HSBA 2Z8WC 1FORL 2VN7A 2HT2D 4S1SL 5H35B 4HJGA 4OLWH 2H2SC 3UYOD 2E7BA 1T22A 5K9QI 5HD8C 4OLXL 4Q97A 2AJSH 3UTSE 3LV3A 1G9MH 3MNWB 5FAAA 4NCDA 1FVDA 1X5GA 3C6SA 3QJHA 4LQ1A 2BJML 3LKPB 3VWKD 1K4CB 4RWYL 5L88H 2VXTH 3J7HA 4W6XB 1HZHL 4GOSA 2OTUA 4ODBD 1DJSA 4QRSA 4DW2L 2BCKA 1ZVSA 3FT3B 4N8VG 1YNTB 5JW3L 3QDJB 4ZXBB 4LIQH 5E9DE 4MQTB 5JNYA 3SDAC 5JMRA 5SWQA 5GGRY 4J4PD 4KI5E 1YMMA 1PX3A 3NMEA 2A6DB 2P46B 5CEZL 3E6FB 2AK4B 1U8PB 5T1KA 3VXPA 4RZCA 4PJCA 5F9OL 4OF3A 1W72B 4R9HA 12E8H 4U1KA 5IB2A 3O9WC 4P3CL 3ORJA 4YWGL 2BVOA 5D2NC 3MRMA 2X6MA 1HEZA 4F7EA 4NO0A 3DNKA 4MXVF 5E2JA 1NGWB 5CFHA 5KSAB 3HE7A 2DQIL 4OI9A 2XN9D 4QRSB 3ZZ1A 5BV7C 3MPCA 1VDGA 3VGGA 4H0GA 1VFBB 4H26B 4J4PA 1NCCH 2DQJL 5EN2A 4FQ2H 5K9OA 2K3TA 5FGRA 2ESVD 1VGKA 2QSVA 4WI7A 1F3DH 4F7PA 1UH3A 5C0BB 4G6KH 2IH3A 2JB5L 5ITBH 4FG6D 2HT4D 1IKFH 3CDGA 3IF1A 4X99B 1QEWA 4IHOB 4NN7B 3W9EA 2CK2A 2D4FA 3JV0A 4N9OB 2NY0D 1ZGLP 2XICA 2OTPA 5IVXE 2GCYA 1A7OH 3ABZA 3MJ6A 5C0GB 4GAJL 4Y1AA 5TPWL 1U2CA 4YHKH 2XA8L 5HGHB 1RURL 2D31A 1LO5B 1EH9A 3HC3H 4M6OL 2AK4A 1XAUA 2FJGA 1IC4L 3A6BH 4RIRA 2NNAA 1NGXA 5DDHB 2CIKB 3KJ4C 1KLGB 4NO5A 4PJ8D 5EZJB 1BVLA 4YXLH 1F4YH 4OCMC 1PEZA 3LOWA 4MXQD 2E7HA 1NLBH 4JM2C 2EIEA 4LCWE 4Q9RH 2E8YA 3O3DA 2V5YA 4TTGA 4IIQB 2VE6B 2W9DH 1P9MA 4BFEA 4P4KC 1GAFH 3MMEA 4Z8FL 5D6CA 4Y89A 3NCBB 4MA8L 1J9CT 4LSQL 1XR9B 5ENWA 5INCB 4QY8A 3OXSB 4P2QE 4LCWD 3FFDA 2YXMA 4QHNB 2GTWB 1T89C 2KZ1B 3RI5F 3EW3B 5M94B 5FF6A 4QOKA 5MI0C 1T7VA 1QFHA 1J0KA 3OR7A 4FFZH 1A8JH 1F3JA 3HZYB 3L5WB 5C0AB 1MH5A 1UADC 2OR8A 4FABH 2XN9B 1KGCD 12E8L 3S5LA 3VXUE 4PJDF 1ZT4A 5I1HL 4JG0H 4DTGL 5JXAL 3OL2A 3PP3H 2BC4B 2BVQB 2YD4A 1J0ZA 3QRFM 4ETQA 1N5AB 1OW0A 4PJGB 1KCRH 1JF6A 3RJQB 3C2SA 4YEEA 1BQHB 3GI9H 4GUPB 3WN5A 2A77H 1J1OL 2ATPB 4YQXL 5DDHA 1BGXH 3V52L 2C3GA 4LSUL 1ETZB 5HTSA 3WJLA 5DEFA 1DBKL 3NABL 2UY7A 3DYPA 4HFUH 4MCYA 4AH2A 1P7KB 4WJ5A 5HI3D 4QRQA 2VWEE 2ESVE 4ELKA 3ARQA 3EKCA 4X7SL 4HHAB 4UBDD 1KEML 3S3PA 2H1PH 2B7DT 1GZPA 3ARDC 4AEEA 1INQA 2CRZA 3GIZL 4OZGA 3BD3A 2FJFA 5FHAH 1IGIL 1JRHH 4P57B 1MJUL 4JFHD 3RUGB 4KTEL 4Z7NE 5ICXA 3OGCB 5DQDH 4GS7C 3MO1B 1X5KA 5HYQB 5KVGH 5EC1A 3HCVB 4EBQH 5C07E 4EVNA 4AM0A 3U0PB 1HYSD 5F9OH 5DJDA 1W0WB 5LWYH 4QLRA 1X44A 1RZJC 5EU6B 1INEH 2Q7YA 4UQ3B 2HP4A 2NZIA 3MLZL 1DQDH 1UWGH 4GXUN 3T0EE 4RGNC 2EH8L 1KJ2A 3GO1L 3RU8L 4U31A 3O3EB 4LCCB 3C87A 4E5XB 1DEDA 1D5XB 5CEZD 1Z9LA 3JVGA 1NCNA 1B4JL 1DE4B 1SVZA 4J8RA 3VMPA 4MAUL 3QUXA 4BQ8A 3NFPA 2E9JA 4JPWH 5D1ZA 3OF6D 1HILA 1UM6L 1Q9KB 3Q5YA 3N1FC 1NAKL 1NFKA 3VRJB 2X70A 5C6WH 1NGQH 3GBLA 4NO3B 3KPRB 3IFOB 3F12B 4F7TA 1P6FA 1FJ1B 4UQ2B 1WICA 3P4OB 5E6ID 1LEIA 2UY6A 3EYOB 1I3RA 1T0PB 2IGFL 1SVCP 4JZJC 1QVOB 2O61B 2PCPB 1I1AC 3F7PC 4ENED 1WFOA 4ODVH 5SWSA 5DUPH 4FP8H 5IMMA 1IVLA 5C09B 2CLZA 3HAEA 3GFUA 5GS1B 4I8DA 3QCUH 3LEVH 2PYFB 1I8MB 1KEGL 3EFDL 4MDJA 2VDQH 3WNMA 4QHMB 1L7IL 4MD5A 2H3NA 4XI5C 3MJGX 3KPRE 5D5MA 4RQQA 3O3EA 3OKMB 4PJ8C 1FPTL 2PYEB 1KTDB 4PRBB 2P8LB 4CVWA 3IFOA 4U33A 4Y5YB 1JRHI 1FBIH 3EHBD 5E2TH 3BE1H 1T4KA 3WNLA 2F54D 1JBJA 1CQKA 3IJYB 4ZUUA 2BVPB 3IJHA 1BD2A 1IT9H 5DTFB 2PCPA 3PABB 3U0WL 4R4FH 5DJXA 3LEVL 2DYPB 3U4EA 3VXSE 2ZUVA 1GHFH 4XTRC 5IOPB 5TF0A 5DR5H 3BRGC 3SE3C 1ZANL 1NGPL 2D03H 4MDJB 2A1WH 3VXRD 1T7YA 3DSFH 2VQ1B 3BH8B 3HPLA 1U8OB 3HKFA 1BLNB 3FOLA 2R4RH 1CXFA 4TSBL 4XVTH 4MQXD 3D6GA 5TDNA 4Z7UF 3L95A 4R4FL 3BQUA 1CICC 5SWSB 1WT5C 4N0FB 4RGND 2R2BB 1BHGA 4MQXC 4WFED 4OZFG 4HJJH 1RIUH 2WP3O 3C9NA 1HHGB 3FOMA 2FECL 2VXTL 5F8RC 1ZLWK 1KLUA 5C0AD 2F19L 2GUOB 1JN6A 5I2IA 3Q0HA 3FKUS 3IDYB 1EA9C 3UTPD 1TJHH 4JPIA 1PG7L 3PGFL 5E94B 5DRXB 1BJ1H 3NIGE 4HKZB 4Z0XA 3B4NA 1B4RA 2W9EH 3IXTB 4JHZA 3RVXC 2FSEB 3G6JF 3RNKB 4DK3A 2UZXB 2DS4A 2IFGA 5CEZH 1CXIA 4WNQA 3QH3A 2GJ6E 3WV0A 3QFJA 3L95B 3H9ZA 3GMLA 3DV4A 3QDGE 4L5FH 5KVMC 5I0ZA 3VCLA 4K94H 3DX6B 5E6IA 1MCKA 5I9QB 1FL6A 5FM5O 1TZIA 3IAQA 3VD9A 3VDCA 3FQUB 3RZWA 4HAFA 3SN6N 1FH5L 1S7VA 4PJXF 1QBBA 4QCIB 4XH2B 5DYOA 5IF0B 5L8LB 3T0DA 4OCSH 4NJAH 3BWUC 4PRAA 1MRFL 3H3PL 5IUSA 3C9NB 5M95B 4G3YH 5J06A 3MV11 1YEDB 1I1YA 4QHUA 2ADIA 2JJTA 1S5IL 3BQUB 2W60A 4HBCL 3F65A 2WSKA 1OAXL 3QRGL 2UZYB 4KHTH 4PV9A 4Y2DC 1A6WL 1EZVX 1PD6A 5L8JB 2FBOJ 3FO9A 5C92A 2GUOA 2X05A 2FH6A 1J11A 3GZKA 1E28B 4MXVE 1U95A 3IFNL 2XTJB 3D25A 3BGFB 3RHWF 4Z78B 3WSQL 5IESL 3QFDA 4XNQB 2HH0L 5IVZA 1UKQA 2BNRB 1Z5LA 5HGBB 4H8WC 1T22B 2WUBL 4KI5F 2B8OT 5I18L 4L3CA 2LU7A 2NY5C 5GRYA 1FG2B 4QKXB 4NQDD 4JM2D 5JW5A 1P53A 2CKBA 4PLKD 5I1KL 2EDKA 3MRKB 3T0XA 1UXWA 3TPUB 1T7WA 1EEYB 2OL3A 3I3EA 5JHLH 1SY6H 4M02A 3RTQA 3QEQE 1XIWD 4AEHH 5EO9B 2H6PA 2H2PD 1RZIB 4OKVA 3V95A 2CLRA 2GJ6D 2ZSVB 1QLEL 5EC2A 4QTHA 3GUTB 2AJXH 5E2WL 5I1LA 5IWLC 1BF8A 1OGAB 3FQWB 3QDJD 2PXYA 2YK1H 3ILQD 4M6NH 4FQIH 5GGSY 1DDHB 1JPTL 1X4XA 2DI9A 4LOUC 3V8CA 1MUJA 5HVHC 5C0BA 3V6OA 3CLEL 2H45A 1PY4A 1DQQA 4DTGH 3BDYL 3OKDA 1FIGL 3W0WD 5HVWA 3BP7B 1XR8A 2HT3C 1GGYA 4H8WH 2H41A 1RK1A 3WHXB 4R2GD 4UT6H 2SEBB 5TE7H 2MHAA 3VFUB 4KY1L 3SGEI 1T20B 3UROR 4M93C 2YPLE 1GC1H 3UTTE 3GSNL 1GC1C 5EZJA 2KDGA 4NQCB 5DUML 1IM9B 1JZ8A 3LRGA 4YHKL 2VTFA 4JO4L 1XH3A 2JELL 5EOQL 2A6JA 4OF0A 4PRPB 2AAVA 3WUWG 3QG7L 2VLKB 5I1DA 1TVBA 4WU7B 1QBAA 5CMAA 3QBTB 5F97E 1ZHNA 3VD5A 2QSTA 2YWZA 5I1EH 3MLXH 2DQIH 4NN6C 4UQ3A 2JK5A 1JHTB 1NC2A 3WFEH 3BPLC 3DO7A 3HS0A 5JIIA 3D9AH 3CXHK 4RFNC 4JFOA 4OLVL 3O3BA 5IQ7H 1FFQA 3NIDE 4NBYB 3HG1D 4PP2A 1NCDH 2IBZX 5IEHA 4M9PA 1BREA 4ZAKB 5KTEH 5IGXL 3VJ6B 2X4TB 1GRWA 1EPFA 2DBLL 4HJ0C 4N9GB 3AS0A 1YPZA 4TQEL 4WRLA 1FLRL 1TVDA 2VLKA 2OS7A 5DA4A 3OKDB 4JPKH 4HPYH 4OF8A 3BGFC 1PVHA 5L7XH 2IEPA 5C2UB 5F7FA 3T3PF 3B2VH 3NIGF 4JG0L 1T20A 4OCSL 3VE0A 4YFLF 2CUIA 2OTUB 5EBWA 4NCC1 1Q0YH 3UBXB 4R4BB 4XP6L 5AWNL 4NWTH 3IDGA 4MVBC 3GHBL 2HLAA 2ZOKB 5ICYB 5T5FL 1ORSA 1HHJA 1OHQA 3HZKA 1FP5A 2YSSB 1T5WB 1V5JA 4XHQA 3FB5B 1BEYH 1QBMH 1RHHB 2BOCB 4LVHC 3IETB 2EE2A 4LMQI 3U30C 2CKNA 2DIAA 3GSOA 3S98A 5HDBF 3QDJA 2X4TA 3UYRL 1IC4H 2Q6WB 4WCYL 3LIZL 3EYQC 5FF6B 1DN0A 3VFGL 4E41A 3VWJD 4GQ9L 3U9UA 2AJVH 4NQDE 1MH5B 4APQC 1ZT7B 5HD8D 5ADPH 4Z0BH 1Z9SA 3VH8A 4ORZC 4C56B 3MSPA 1MCEA 5GRXG 3ZDXE 2E8ZA 1H3GA 2FBJL 2R4SL 2GJZA 3UJIH 2O5XL 2BNUA 3KPNA 2WQ8A 3OKOA 2V2WA 3WFBH 1KTRL 1NDGB 3SKNB 1S7SB 3X14A 4XI5D 2EDFA 3MLSH 4OCYH 3WD5H 1U2HA 2NQCA 4WY7H 3WKML 3WS3A 1A9BA 4G9DB 2G2RA 3CPLA 4GRLC 4G80B 4IS6B 1MCLA 2RGSA 1X5LA 5HI4C 1FO0L 2W91A 1U36A 2GCYB 4ZPTA 3EZJB 2NW3A 1EXUB 2FO4B 3X11B 2AXFA 2EXYC 1SEBA 1YEFH 2ZCHH 3BP6A 1W72H 3NCCB 3O8XC 1G9ML 4MLIA 5GGVL 5CP7A 5KN5B 1LO5A 1XGPB 4Z5RB 2X1WL 1N2RA 3ARZA 2JIXD 2B0SH 3MXWL 2NY1B 2H9GA 4NPYB 1X5FA 1UYWL 2QQNH 1RUPH 1S5HA 5DFVC 4FTVB 2R2CA 2NY2D 3I50L 7CGTA 1N5YL 3VMOA 1I4FA 5DC0A 1MCIA 1N64H 2DQFA 4M6MH 5BJTA 5IROC 4I77H 3P30H 4O00A 4JPKL 2WNGA 2R8SL 4I48B 1QZ1A 4XMLH 4KK9D 1DLHA 4JM2F 2C1PA 1VKXB 4NNPH 1CDYA 4RAVA 1X4YA 3MRDB 2I27N 4U2YA 2AXFB 1CZ8L 3PQYE 4XP6H 3MBED 4UV4H 2R1YA 4X8XA 2R8SH 5EIIA 1G7IB 2DLEA 4G80A 4IS6A 5I75C 4QHLA 5D9SB 2UYLB 4KXZI 1TJHL 5JPNB 1CDBA 4U1LA 5DJ6A 3VGEA 1WZ1L 5C0AE 4ZNEA 4GW4A 1LO0L 2CO6B 5SX5K 4XCYA 1MF2L 2LAAA 2VH5L 3Q6FB 5F9JB 4EEEA 1AXIB 1ITCA 5KN5A 4M5YL 1BP3B 3W11C 4L29A 3FN9A 1UXSB 4ZODA 1LP9B 1F4WL 4KGJA 5HHNB 4MNGB 4RMRA 3T04D 4H26A 4OIIH 4MQSB 4M4RA 4NP4H 4MCZB 5DVOA 1DVFC 2ZSWB 1NFDA 4H0HB 2AJ3A 4QT5A 3CAFA 4I4WB 1RULH 2XKNB 1MLCA 1CDIA 5D8JH 3TYFB 4Z7NF 1CT8B 3L3HB 4JZNA 2G5BB 2FLRT 2XQYG 4N8CL 4YDIH 1J8HD 1DQLH 4YBLC 2ICEB 1HHJB 5H94A 4MJ2A 3G9VA 3OAYH 4M1CD 2X10A 5GS1A 1H15A 1F5WA 4R90H 2G9HB 4OUUB 3VI4E 4U0RC 4V2CB 5D5MF 3AUVA 3ARGB 5IVXF 3LRHA 4WUKH 5I19H 5C8JA 2VKWA 3L5XH 2W65A 4DOHB 1LP9E 4OM1H 5HYJE 1G7PB 3MXVH 5D6DA 4Z76A 3I9GL 2ZUSA 3FQTB 1NANH 4N5ED 5DQJA 2FJGB 1KIRB 5ITFB 4I3RL 1LP9A 3T0WA 1I85C 4CNIB 1JGEB 4Y5YA 5D7LD 5FYLE 4GW4B 4KVNH 1OF2A 1T03H 5MI0B 5DK0B 2DQDH 4OFIA 4XNUL 4PPTA 3PE9A 1KV3A 2HFEB 4HS3A 5HGDA 4KK8C 5CAYB 1C08A 3GRWA 5I18H 3R1GH 5EBMA 3RPIB 1E4JA 5HYSG 2X70B 1RIVH 5ACZA 1IGML 3SGKC 4HMEA 5LWYL 1F2QA 1FL5A 3QQ3B 5D1ZB 3WS6C 4P2RD 2BNRE 4OF6A 1CT8A 3L3HA 3ZO0A 1RZ8B 2ID5A 4JVPA 2X09A 4MX7B 4JFXB 3RNKA 3DETC 1U3HA 2RQ8A 1FYTE 3LH2L 4OCWH 4F33A 4A6YB 3QUYD 4JQVA 1CBVL 4MSWA 15C8L 5D1QC 5CEZE 3GBML 3IJSA 1KB5B 4L8DB 2ENYA 3AC0A 4F7EB 2QV2A 1JUFB 3SEPA 4HUUA 5DD0L 4PJEE 1MF2H 2E7CA 5HDOA 4R7DA 4CW1B 1MFDL 2P8MB 25C8L 1CDUA 4HX1A 4PJ7B 4PUBL 1RZJH 2C1PB 5GHWL 4WWKB 1Y18A 3FT2A 2C1OA 1X4ZA 1KULA 2NTSP 3DUUB 4H88L 1YEKL 1RUML 1EEUA 4NDMA 3TO2B 4EKXA 3MRQB 4GG6B 4KJQD 1QFUH 2DI8A 4X9GA 5F88B 4K7FA 4QHMA 4FFYH 4NQEA 2ENSA 4WEBL 1BFOB 2IJ0C 2Y72A 1J8HA 4R97C 1K5NA 4O2EA 2XZAL 4DFHA 1EMTL 1FNGB 3SDCA 2OL3B 1Q8MA 3IJYA 4PJHE 1Q9LB 1IM3B 4HIJB 3JV4B 3ARUA 5CEYB 4BSWA 2K7PA 2MKWA 2CSPA 3BH9A 5FM8A 2VUYA 2BSRB 5C0JB 1IAIH 4L3CB 4X9BA 1EJOH 4ZTPH 3RVUD 5FO9A 1F00I 2YD7A 5CUSL 3H7BB 3JV5A 3DLQR 4RMQA 5T3ZL 3F62A 1A6ZB 2D0GA 3ARSA 3HC0B 2K1MA 2WP3T 1N59A 1EEYA 2LE9A 3HNSH 4X0KB 2FL5A 2RB8A 4O5LL 2IQAB 4V2BA 2Y23A 1VACA 2WINA 1QFPA 3REWA 1IAKA 3UXFA 1MQKH 4LL9A 2CDGA 1RJYA 3B2UD 4RA3A 3WEXB 3TF7C 4QXGL 2BSRA 5EBGA 4Z7OE 1FNHA 4QRRE 3KLAB 3U9PH 4QHNA 5H8DA 4BZ1H 1FYTB 4LHUG 3ULUE 1ZWIB 4JR9L 4OLZH 1DVFD 3TFKD 1GJIA 3DI2B 4P2RA 1PDKA 3BEVB 4JO2H 4LVNB 4HIEB 3D69A 2DQCH 3ZTJH 4P2QD 1A6ZA 1FNEA 1QP1A 3CFDA 2XXMB 4E42B 2R2HA 1CDGA 3TV3L 4KJYA 3TH3T 4NYLA 4APQD 2HJLA 5CKGA 5EOCL 4G6KL 2JCCE 1CE1L 5E8OA 1EHLL 3WXWL 4GJTB 2ZJSL 3I84A 4UDUB 3SGJC 5IJVA 2CGRL 3DX6A 2EC9T 3FQRA 4PP2B 2B1HL 4P46C 5FO8B 1H5BC 2QHLA 2DYPD 2W60B 3QQ9C 1EAPA 1T66D 2C7UA 3MLRH 4LAQL 5I1EL 5ISZA 3RKDC 4FZEL 2EH7L 4S1SH 4EUPA 4P46B 4ZG1A 4HS8L 4I18B 3SBWC 4O51A 4FQPA 1RUKH 1R24B 1FGNH 2A9NL 2EXWD 2ICWA 3K4AA 3WFHA 4DGVL 1OT2A 2A73B 3KGRA 4P9ML 4U7KA 1H8NA 5E1AA 5J1SC 3CX5J 1E4KA 4PRNB 3FQUA 1X5AA 5GRJH 2PTVA 2X89A 4OD2B 4JJ5A 4F33B 2BRRL 4OZHE 5FYKU 1FCCA 1BQHG 5DVLA 4H20H 1PBYA 4Q2ZB 1FLRH 2NW2A 5KSAA 3OR6B 5ICXB 2XPGA 3STZA 4GRLB 3T2QA 4CU8A 2FIRT 4PIRF 1YPZB 4N1EA 1SM3L 1YEIL 4TSAH 4YBHA 1GXEA 4HPOL 5DWUH 3LKNB 1VGKB 3C6LB 1YY9D 2JF1A 4LSQH 5I8CA 2X89D 3LAFA 5E70A 3OX8A 4TUKL 4ZS7H 4JFZH 4OLEA 1OARL 2NZ9C 3TA3C 2CLRB 2ZSVA 2V7HB 4GXUM 2VLJA 4OZHB 4X4ZA 3WO4B 3HI1A 2F8OA 1MFNA 3PWNA 4ZO8A 1LWRA 1KCLA 1FSKB 1A7RH 2GAZA 3JTSB 3WXVL 1G0YR 4P5KB 2ADJA 1QO3A 3BKMH 1VEOA 3JWOC 1FNLA 4HUNB 3QDMD 3BO8A 4Z0BL 4QRUB 1RY7B 3Q5OA 3MRLB 1NAMB 4B5EA 5E9DD 1OL0A 2SEBA 2XZAH 3OKLA 4MCZA 4ZFGL 4UOW1 3TBWA 3QQ4A 2DKMA 4D0CB 5EO9A 1U8PA 5GRUL 3VFNB 5IGXH 2VN4A 1WSST 3QEGL 4HC1A 5ID0A 2OYPA 3MV9D 5CD3A 5SWQB 4UZGA 5E4IA 1EJOL 2V7HA 3VFVB 3IDXH 5E9DB 5JQ6L 1OQXA 3DGGA 3H9HB 1VSCA 3QZWA 3U36A 1IZKA 5B8CA 4JDTL 2VSDA 2EC9U 4I13B 5GJTH 5DQDL 3BGAA 1RK0A 3LKPA 4RRPA 3EYVB 4UIMA 4PJBB 5HHVH 4X6EB 1QA9B 2QQKL 2KL6A 4MNHB 1XIWC 1NLDL 1L4IA 4CUCA 1BEYL 1QBML 4S2SA 4HUXB 4AY0A 1S3KL 2VXQL 4UUJB 4MVBD 1OD7A 4NNYB 3GMMB 4FS0A 5DSCA 2PW1B 3ETBF 1PSKH 1VKXA 3HC4H 5CKAA 3IRPX 3BKCH 1PFCA 2A2QT 3Q5TA 2X1PA 2WWMD 4DVRH 1JZ2A 4PREB 3O4OC 5H2BB 5K9OB 5E8EB 1KB9J 3TYGH 3QDAA 3WUWB 4JQXA 4HIHB 1G7LA 4XBGB 1W0YT 3CDCA 1AE6H 5T1LB 2P48B 3TIEA 5GS2H 4OZHF 5I6XC 5EU4A 4ZUVB 2RFXA 4MQ7A 3RL1A 1QEWB 4IHOA 5E5MA 1CF8H 4AEIL 1QR4A 1B0RB 1WF5A 4EI5C 3IDNB 4XNMA 4LLQA 3GBNH 1U8OA 4XAKD 5EU6D 4FQIL 5IMLB 5EC1B 1B2WL 5HVHB 3HC4L 4RMSA 3EUUA 3E1F1 5CP3H 1S5HB 1RZFL 4IRSA 5CIPH 4ZQKA 1VGEL 2R2HB 4UT9H 5FA4B 4EUPH 4H0IA 4KK8D 1HQ4A 3CJJA 2ORBL 2DQUL 4F37F 5FCUH 2OZ4L 3P4NA 1YEFL 1K3ZA 1IGMH 5DMJB 4PJIA 2EE3A 3TZVD 1A1OA 3CIQA 4LPCA 3BPOB 2FHCA 3HMXA 1YJDL 3CD4A 1SY6A 1JNHB 1HXYB 3RWCB 1KB9K 1AGDB 1B3JA 3RUGE 1JJUA 3TESA 3RGVC 1GOHA 1GIGL 1KCSL 1OLLA 5J56B 1F3DJ 2CDFB 4M8QA 1DN0B 2ED7A 1A7QL 2ERJC 2AJUH 3ZHDA 4YPGA 1UZ6E 3QSKB 5IMKA 4X6DB 4XC1H 3PIQA 4DVBB 3IETA 3MV9A 1FZJB 1MPAL 5DFTA 2AVGA 2FLBT 1IC5L 4E41E 3EIFA 2YZ8A 4HIIA 4G8GD 5E4EB 5C70A 2VKXA 1NBZB 5DA0B 4ONFL 3IDUA 4MAYA 5GJSH 4WCYH 1BOGB 1FIEA 5LVEA 1S8DB 2GSIB 2YOCA 3OB0H 4C56D 4GUPA 3LHPL 1FCGA 3S35X 5BS0E 1FVCB 2ATKA 4Y0GA 2G9HA 4OUUA 3OG4B 5D7JD 3PNWA 2HRPL 5LGJA 1GIGH 4RAUA 3X12A 1G9NH 1NMBH 2J12B 5ETUB 1Z6JT 1FHGA 3EDDA 4HUMB 3ZT7A 2HA1A 5E8NA 1ZVHA 3VH8G 2Y07H 3GJEA 3ARBD 3HE7D 1IAOA 4ZNEE 1QLFA 1GGUA 1ODAA 1QO3B 2JJWA 1VFAA 1TZGL 5ALCL 4OZ4B 3ZDYF 3PWLA 2AEQL 3GJFB 2CJUH 1ORQA 5CZVL 1IEAA 1CFQB 2EKJA 3DVNB 3FCTA 4TUJA 2Y06L 3VWKA 1J10A 2HG5B 5JPNA 4UIKH 1MFBH 2OQJA 3OAUL 1S9VB 4EDWL 4LSVH 1LO2H 1VHPA 3B43A 4ZFZA 2HMID 3LEXB 4PRHD 4WW2F 3ZKMD 4XXCA 3EDFA 5ANMA 5HHVL 1P5UA 2WBWB 2Z91B 4YDLC 4NKIL 1A6WH 4OGAD 1S8DA 2GSIA 3CZFB 1OM3L 4DKFL 1INQB 2W07A 3H42L 5HHNA 1F4YL 3FB7B 4YHMH 4GRWB 4EDWH 1AR1C 3MROB 4Y1AB 5SWZA 4UTBL 4PJ9C 1R24A 2OL3L 4NQEE 3SDXB 4W4OA 4IRZH 3TBVB 2GTZA 3LKQA 1VA9A 2C3XA 3D2UA 4QOKE 4WHTA 1IQDB 4PRNA 3VFSB 5GZND 5D7KE 1KLUB 5BVPH 2DTSA 4AJ0A 2VDMH 3QQ9D 4PY7A 2J8UB 4I3GA 3MRBB 3KPOA 3FO0H 3O9WD 1GGCH 1U8NB 3NOIA 2GEEA 3IU3B 5CZXC 1J88A 2IBBA 4G8GA 3DX8A 1HH9B 2VQTA 4FZ8H 2HFFB 4ZTPL 2O5YH 1KJMB 2PTTA 4WEMB 4ISVB 4BKLA 1QLEH 1A9EB 5L6YH 1TLKA 5MEQA 2DM4A 4Q9QL 3CFKA 4FXGB 3ARGA 2GTWA 2Y5EA 1T1YB 1LO3H 2YPKA 5CJQH 1UM4L 2D9CA 5EH1A 3QHFH 1P4LB 2AEPH 1HN1A 5F72S 3FTGA 3VFOB 5JW4R 1N6QL 2J6EH 4O9HL 4PP1D 4KV5E 1P1ZB 1WWCA 4Z7UE 3G5YA 1JZ4A 3FT4B 4H88H 2IAMA 2Q20A 2OJEA 3F7YA 1UJ3C 5SV3A 4G7YH 1RJYB 4I18C 1IC1A 5L2KD 3B9AA 4M5ZH 5DHYB 1UKSA 3DXAB 4U3HA 2J8OA 2IADA 3CFDB 5GRWA 4D8PB 1HYRC 2BERA 4XAWL 3IKCB 4G8FB 2ZOLB 3D69B 5T3XE 3BUTA 1N59B 35C8L 1YN6B 4X8JB 3TCLA 1YNKL 4GFTB 4PJDB 3UPRB 1AY1L 1RZKC 4PRIA 1OM3H 4DKFH 2IGFH 3TBTB 5ECJE 1BVKB 3PHSA 5J57B 2J8HA 4AIZA 1RZ7L 3HUJA 1MCBA 3HE6C 3ULUD 3LEYH 5KW9L 4M5ZL 2YPLA 4NWTL 5DLML 4DUVA 2CUMA 3LRSB 5JHDB 3DMMC 3WFZA 4IEFB 2BP3A 1Q9KA 2EDTA 4PJEB 4R96B 2NX5B 4FQCH 1YECH 3TA3B 3VFOA 4WW2A 1JIBA 1I9JH 2VLLA 1MJ7L 2ZCLL 4R26H 4BUGA 1A4JA 4WFFD 3V6OE 3NACL 1RMFH 3UBXA 3WFEL 1KF9B 4X7CC 1HSAA 4OLZL 4LRIC 4UOW0 4HWBA 4KJPC 2UUDH 3ARRA 4TVPL 4WFFE 3GMLB 2VDLH 1NQBA 4LCCA 2L0DA 4YHNA 5GGSB 4S11A 2AGJH 1JF1A 3QDGB 5ERWB 1P5VA 4P5TB 3GSWB 5F9WB 5E2WH 4F3FB 3QB7C 4U1GB 5ACLA 3DVFA 3GMRB 4TVPH 3PV6A 2IAND 3RKDD 5CS7A 3VG0H 2OK0H 9CGTA 3MJ7B 1MJ7H 2ZCLH 1A3LL 5D93B 1NAMH 2HT3D 5D72H 3QUYB 3ZE0E 4N0YH 4GAGH 3QAZC 3WE6A 1NDGA 4F57L 1ZEAL 1MCDA 3QXAB 3FFCE 4ZUUB 3DETD 1D9KB 1R3JB 2NY2C 4QHKI 1OAUH 4U1SB 1FNFA 1GGBL 3V5KA 4HXBH 2VQUA 3BWAB 4FHBD 1AO7E 5FUOH 2ATPA 1BFVH 5EU7E 2P7TA 3GSVB 2DWDB 2FX9H 5FFLA 2VLRE 1FFOA 4KDTA 3MJ9A 4M6ML 3KPLB 3QUXD 1IC7L 3AM8A 1OAKL 4NGHL 1J1XL 2MFNA 5FGCB 1G1CA 3OF6A 1L9NA 3RWFB 2NY6C 1MREL 3ZE1E 5EN2B 5FCSH 2YD9A 4JFEA 1BD2D 2ORBH 3VA2C 1V3KA 2CXKA 1HINL 3MRKA 3BD5A 4CBPA 2E6JA 1K8DA 3E8UH 4JHAL 2P42B 4X6EA 4S1DC 3W39A 3U36B 4P2RE 3RA7L 3CFIC 3BWAA 3QPXH 1LNUB 5AZ2L 5B38A 4JB9H 4O9HH 1FVEA 2VDRH 4U3CA 1UCBH 1WZKA 5GRZA 5J6HA 5B38G 4JQIL 4IOIB 2P5ED 4OLUL 1Q9WA 3DURB 4PYHA 3TWCH 4HT1H 2I9LB 1M71A 2VIRB 1NLBL 3MV8B 5EUOB 3ZDXF 1BWMA 5D7KD 4Z7VF 5E8NB 2V2XA 1QNZL 3AAZA 2GHWB 2CMRH 3BKYL 4R0LB 3SKOA 1D5ZA 1I1AB 2BY2A 4WFGE 4KH2A 2WIIB 4CMHB 1B4JH 4L1DA 4X6DF 5D7IB 4JFPA 5C0CA 5D71H 4DGVH 3S37H 3BPCB 1IBGH 1NDMB 5I1CL 5K9JH 3IDXL 4HC1H 3WDJA 5BZWB 3V0WH 4P9HC 1HSBB 3PWNB 1A6UH 2PF6A 1ZGLM 5FUCE 4DKAA 5I15L 4U6VH 4X9IA 1EO7A 3D2UD 4KZEL 4XGZA 1EVUA 5T5NG 4LARH