1MQTC

Swine vesicular disease virus coat protein
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
238
structure length
238
Chain Sequence
b'GLPTLATPGSNQFLTSDDFQSPSAMPQFDVTPEMDIPGQVNNLMEIAEVDSVVPVNNTEGKEMSIEAYQIPVQSNPTNGSQVFGFPLTPGASSVLNRTLLGEILNYYAHWSGSIKLTFMFCGSAMATGKFLLAYSPPGAGAPTTRKEAMLGTHVIWDVGLQSSCVLCIPWISQTHYRYVVMDEYTAGGYITCWYQTNIVVPADAQSDCKILCFVSACNDFSVRMLKDTPFIKQDNFFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprotein
publication title STRUCTURE OF SWINE VESICULAR DISEASE VIRUS: MAPPING OF CHANGES OCCURRING DURING ADAPTATION OF HUMAN COXSACKIE B5 VIRUS TO INFECT SWINE
pubmed doi rcsb
molecule tags Virus
total genus 39
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 2002-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1mqtC00
4CDQC 2RS12 2R042 3JBG2 5JZGC 1QJY2 1AYN1 3VBHA 1RUJ1 5D8AB 3ZFEC 1COV1 1AL21 1RUE2 2RS33 1AR72 5BNOA 2HWE3 1R083 2HWC3 2FZ1A 2BFUS 2VQ0A 3CJIA 1NA1B 3IDEA 1EV12 1QQP3 1AR83 1BBT2 4JGYC 1FOD3 1V9U1 1H8TC 1VBE2 4GMP3 1RHI3 1M06G 2R071 1RUI3 4YVWC 1AUYA 4QPIC 5AC92 2FZ2A 1NCQC 2HWD1 5JZGB 1PIV3 1F2NA 4CEWC 1AL0G 3VBUA 3ZFEB 1HXS1 2HWC1 1AYN2 3VBUB 2MEV3 1VRH3 1BEV3 1COV2 1VBD1 4QPGA 1FOD1 1HRV1 4Q4V1 4GMP1 1RHI1 1RUI1 4CDUC 3VBSC 4RQPC 1VB2A 4NWWA 1VBC2 4JGYB 3DPRC 4NWVA 1H8TB 4WM8A 4CDXC 1HQNA 4SBVA 1V9U2 2PLV3 3ZFGC 1RUD1 2R072 4QPIB 4YVWB 2WS91 1CJDA 5CFCC 1VBB1 1MQTC 2MEV1 1PGL1 1VRH1 4YVSC 4CDWA 4CEWB 4FTSA 1R091 4IV1A 4N43A 2RS32 1RUC1 4Z92B 1AYM1 1HXS2 2HWC2 2BUKA 1OOPC 1C8M1 1VBA3 1EV13 1VBD2 1BBT3 1FOD2 1HRV2 4Q4V2 4Q4W1 1RHI2 1VBE3 2XBO1 4CDUB 5BNPA 4RQPB 1PVC1 1RUI2 4RR3A 1PGW1 3DPRB 4CDXB 5AC93 4RR3B 1ND2A 5BNNC 1VAKA 1ND2B 2R063 2TBVA 1POV3 2BPA2 2WFF1 2WS92 1MQTB 3VBHC 1OHFA 4YVSB 1NCRA 1AYN3 2MEV2 1PGL2 1VRH2 1VBA1 2HWB1 5C9AA 1RUJ3 5L7OA 1IHMA 5BNOC 1AL23 1R092 2X5IA 5C9AB 1RUC2 5ACA1 1BMV1 3CJIC 1AYM2 1OOPB 1C8M2 2PLV2 4Q4W2 1V9U3 2XBO2 2IZWA 1POV1 4WM7A 4FSJA 2RR11 4Q4Y1 4WM7B 3M8LA 2BBVA 2WFF2 2HWD3 5K0UA 1RUG1 3VBUC 3VBHB 5K0UB 1WCDJ 1QJZA 4N53A 1HXS3 4QPGC 5BNOB 2HWB2 1VBA2 4N53B 1VBD3 1FMD1 3CJIB 4CEYA 1HRV3 4Q4V3 5ACA2 1BMV2 3VBFA 4WM8C 1W39A 2Y26A 3J8F3 1RVF1 1Z7S3 4FTBA 1RUH1 2GH8A 2R062 1RUD3 5A33A 2RR12 4Q4Y2 3ZFFA 2WS93 3JD71 1RMU1 2DF7A 4CDWC 1VBB3 4IV1C 4N43C 1RUJ2 1RUG2 1AL22 1R093 4RS5A 1RUC3 4PDWA 4QPGB 1AYM3 2BFUL 1C8M3 3J8F1 5BNPC 4JGZA 1Z7S1 1RB8G 1FMD2 4RR3C 4Q4W3 4JGZB 4WM8B 2XBO3 1ND2C 1PVC3 2WLPA 1F8VA 1RUF3 5DDJ1 5FOJB 1RVF2 1ZBA1 1RUH2 2RM21 5C8CA 2RMU1 1R1A1 4IV3A 2HWD2 2WFF3 5A32A 4GB31 1PO21 5C4WA 4GH4A 4CDWB 1NCRC 1X33A 3JD72 3NAPA 1RMU2 1OPOA 4IV1B 4N43B 5C9AC 5L7OC 4GMP0 2X5IC 2HWB3 5J96B 1EAH1 4AEDA 1ZBE3 5ACA3 1TMF1 2GSYA 5BNPB 1RUF1 3J8F2 2WZR1 3S6PA 1Z7S2 1NOVA 1MEC3 1QJX1 4WM7C 1TME1 1ND3A 1RUD2 1E57A 5DDJ2 2HWF1 2RR13 5CFDA 4Q4Y3 2ZTNA 1VBB2 5K0UC 2RS51 4Y5Z0 2RMU2 1GFF2 1R1A2 1X36A 1PO22 1NCRB 3VBOA 1RUG3 4N53C 3VBRA 5L7OB 5FMOS 1ZBE1 2X5IB 2R041 4Q4X3 4CEYC 5LK7B 1FMD3 3VBFC 1MEC1 4BCUA 4RHV1 1PVC2 1PGW2 1RUF2 2ZAHA 1RVF3 1RUH3 5ABJA 1PO11 1QJX2 1TME2 1VB4A 3ZFFC 1FPN3 1AR91 1B35A 1SMVA 3JD73 1RMU3 4RS5C 4Q4X1 4PDWC 5FMOL 1A6CA 1QJU3 1ZBE2 4CEYB 4JGZC 1HRI1 1ASJ1 1HX6A 1K5MA 1POV0 3VBFB 5D8AA 1K5MB 3VDDC 1MEC2 4RHV2 4LLFA 3ZXAC 1FPN1 5DDJ3 1NA1A 5A33B 1ZBA3 5C8CC 1VBC1 4IV3C 1PO12 3ZFFB 1AR63 1D4M1 3FBMA 2RM23 5C4WC 1DDLA 2RMU3 1R1A3 4GH4C 4GB33 3NAPC 1PO23 1AR92 1QJU1 4RS5B 4CDQA 4PDWB 4Q4X2 4AEDC 4EJRA 4CDQB 5JZGA 4Y4YA 1EAH3 3JB8A 1TMF3 2RS31 1HRI2 1ASJ2 3VDDA 3ZFEA 5GKAC 2HWE1 3VDDB 1R081 2WZR3 1ND3C 3TN93 1NG0A 1QQP1 1AR61 1AR81 1QJX3 1TME3 5CFDC 3JB4C 1NY71 1FPN2 2HWF3 5C8CB 4JGYA 4IV3B 5A32B 3HAGA 1H8TA 5C4WB 1D4M2 4GH4B 2QQPA 3VBOC 4YVWA 2RS53 3NAPB 4QPIA 3VBRC 3LOBA 1QJU2 1NCQA 1PIV1 2ZZQA 2RS13 1NCQB 2R043 3JBG3 4AEDB 1QJY3 4CEWA 3TN91 5J98B 1BEV1 4RHV3 1RUE3 1AR73 1ND3B 5ABJC 2HWE2 1R082 1ZBA2 5CFDB 1QQP2 1PO13 1AR62 1AR82 4CDUA 3VBSA 2RM22 4RQPA 1NY72 2PLV1 1B35C 3DPRA 4GB32 3VBSB 2WWSA 4CDXA 1AR93 3ZFGA 3VBOB 3ZFGB 2RS11 3VBRB 3JBG1 1QJY1 5CFCA 1EAH2 1MQTA 1K5MC 1PIV2 1TMF2 5CFCB 1RUE1 5D8AC 4YVSA 1HRI3 1ASJ3 1AR71 2WZR2 3TN92 1BEV2 1EV11 1COV3 1NA1C 1BBT1 1OOPA 5ABJB 1CD3G 1VBE1 2HWF2 4FTEA 5AC91 1VBC3 1C8NA 2XPJA 1B35B 1D4M3 2RS52 2R061 5BNNA 2R073 5BNNB 4RFT0
chains in the Genus database with same CATH superfamily
1BKZA 2ZX1A 5CAZA 1VALA 5B4NA 2FDKA 1WBLA 2D7FA 3RJRA 4O61A 4CP1A 4A3ZA 5LA1A 1AYN1 1D2SA 3DL3A 3ZFEC 3ZR6A 1COV1 4Y26A 3GHMA 2OXBA 4XF0A 4E2QA 1QF3A 2ET1A 4XDQA 5BNOA 2HWE3 2OPWA 4G4FA 4UYBA 4P9XA 4QGNA 2PA7A 2EXHA 2W5FA 1NA1B 3MLJA 1OFSA 2PTMA 3OYWB 1QQP3 2YZ4A 4CU6A 2A70A 1OLQA 2X53S 4PJYA 1H8TC 1VE0A 2RDSA 3R4DB 1I6XA 1S4CA 5FZFA 5CG9A 4YW7A 3OGVA 1RUI3 1QXPA 3KZ4C 4ASMB 3WY6A 2ORXA 4QXHA 4LMFA 1EY2A 4MO3M 4B29A 4BISA 1YQ5A 4HPKB 3WEZA 2FZ2A 2WAAA 1KS5A 5FZEA 4HFSA 1TE1B 2VW2A 2DCKA 4BLIA 3MIDA 5FMBA 5FO8B 4LIUA 4JRLA 2Q4SA 3AZZA 1UYPA 1JZ8A 2IVIB 4QQLA 3BIEA 4BQ5A 1AL0G 5FY7A 4XF1A 2VMFA 2WUHA 2HWC1 1IG3A 1CESA 1ULDA 2P6CA 5FZKA 3M3OA 5FY4A 1BEV3 1GZWA 5IFTA 1VBD1 2JDUA 3IPVB 2JX9A 4JHZA 4Q4V1 4JTOA 1RHI1 4BMBA 2Y6HA 2XVKA 1CJPA 2ZZJA 1JUIA 2G1MA 4IEOA 1UU5A 3PMEA 4HMZA 4IEPA 4WVWA 4YW5A 4DXTA 2OUJA 3WDVA 1YQ6A 1QHDA 3LCPA 3DXTA 4AHXA 2WR9A 4AGRA 2CWMA 3A7QA 2DBIA 1CJDA 4A7YA 2FCTA 3HT1A 1T6BX 2DVBA 4LIVA 5CFCC 3VD5A 3THTA 5E8AA 3GXUA 5FYVA 2QQOA 4P9WA 4MHUA 4YVSC 1W2TA 3A22A 3HNBM 4ZU4A 1O7FA 4N43A 5FYZA 1JZ6A 4OUSA 1W8TA 5LK5A 3WNLA 4YG0A 1AYM1 1HW5A 1JZ5A 1G9CA 2XJPA 1OOPC 5FFOC 2E53A 4EROA 5C3OA 3W9AA 2JG8C 3NJYA 2YGLA 2V5DA 4ITCA 4Z2AA 5CG8A 3POJA 3QH6A 4LO6B 5FY8A 5FZ9A 1UOBA 5BNPA 2XBO1 2VGDA 3ES4A 2LRPA 1UZYA 1PVC1 2DURA 4RR3A 3NO8A 2WC2A 3J7NA 3DPRB 3OPZA 4KWKA 1ENSA 2BW8A 2Z69A 1I1EA 3EQEA 2MPFA 3IMMA 3WG2A 5KXEA 2PAKA 3WHUA 5BNNC 2J42A 1CX4A 4JQRA 1HV0A 2UY8A 2R063 3AVRA 1AJOA 5IVFA 1UQXA 5JAXA 4UT5A 2TBVA 1J83A 1POV3 2XL9A 5FKCA 3HQUA 5FBJA 4WVVA 3UK9A 3O1TA 4P9JA 1UYYA 2D44A 2BGPA 3KV5A 3VKFC 1MQTB 3O1PA 2BYVE 3VBHC 4XOGA 3PUQA 1U5YA 1OHFA 3ZYBA 1NCRA 2HH9A 2MEV2 2EIDA 2R7EB 4HN1A 1VBA1 4R9DA 2RVAA 3T2QA 1RUJ3 3TBDA 1PGL2 1ZRFA 2DCJA 4FFFA 1Y4WA 4IGOA 4ES9A 1RUC2 2D3RA 2E33A 3DN7A 4URTA 3SKVA 1W9TA 2D40A 2D6PA 3CJIC 4DUWA 5ACA1 1BQPA 1UW8A 2O0OA 4GIQA 4LBNA 3TOJA 4XQ4A 3RMXA 4COUA 1R1ZA 1UZ0A 1NE4A 2PLV2 5IK7A 1E5SA 1V6NA 4GD4A 5J09A 4I02A 1JHNA 4QKFA 5CYYA 1LOBA 1W6QB 4Z07A 4WM7A 4FSJA 2DTYA 2YUEA 5DXDA 4KU7A 4UFHA 4KG0A 3MF9A 4FP3A 2VJXA 1QWRA 3OY8A 1W04A 2XQXA 2W2IA 3DYOA 5JPMB 1DLCA 1RIRA 2WFF2 2VNRA 1W90A 2IXJA 2QE3A 3N9OA 3BB6A 5FZ0A 5IFPA 4PBPA 5A3OA 1JOPA 1LGCA 3TNQA 1NQJA 5FXZA 4C1XA 4PLMA 1S55A 2VNOA 4ISQA 1UZZA 2GC3A 4QPGC 2VUAA 1GZTA 5BNOB 2HWB2 4NVPA 1LULA 1J1LA 2NP0A 1MVQA 2WZEA 5F5QA 4TSVA 4CEYA 4CCNA 1FATA 1LR5A 1PK6A 3IWZA 2J1RA 4Q5OA 4BM8A 2WWUA 2WT1A 4WM8C 4JX0A 2ES3A 3OGRA 4EWAA 4H55A 4FTBA 2VCMA 1DZRA 3IMNA 2GH8A 1SLTA 2A6WA 2VOVA 4I3PA 2LTNA 1GOFA 1ENQA 3DECA 4TTGA 4YG3A 4GALA 3GBGA 2RR12 4GJZA 5FZDA 2ZABA 1OQ1A 2W47A 2OQ7A 4LHKA 3ZFFA 4CA9A 3UNPA 2FHRA 5HI0A 3AMPA 1NX9A 5F6LB 1G8WA 2DF7A 2X29A 1DQ2A 4AQSA 1VBB3 2AC1A 2WO7A 3CZUA 1BYHA 1RGSA 3IB3A 2JDYA 1OFNA 4IV1C 3CF6E 4ZXKA 1XC6A 5AFEA 4BWOA 1AL22 1EPWA 3WF4A 1XJAA 2WNUA 2P3IA 4TYSA 1RUC3 3CL1A 1GZWB 4D6QA 2ZEXA 3C7FA 5FYTA 2BOJA 2H0BA 2PN5A 3ZKYA 4AVSA 3RFRA 3OD0A 3KVAA 4MGTA 4P9IA 3LSDA 1H1IA 3OUJA 1V6KA 2AENA 2N7GA 1UOJA 4XFFA 4OI0A 1RINA 1RJ8A 2ZMLA 4LKDA 2FD8A 1Z7S1 1FMD2 3V0BA 1NXD1 2GAUA 2WLPA 1F8VA 3CEWA 5IK8A 5FOJB 3E5QA 3MV01 2D6MA 5KXDA 2RHPA 4IE5A 3KQ4B 2JDPA 2PHTA 1OF4A 1OA3A 2QZ3A 3WX5A 5A32A 2WFF3 2B45X 2IXKA 3DKWA 4GB31 1GMMA 4A41A 5IVBA 3D4KA 4U36A 4LA3A 1FV3A 3BPSA 4DEVA 5T50A 5L36A 1X33A 1CZVA 1NLSA 4HK8A 3RI9A 4JKKA 4X8PA 3I3MA 4N43B 3MLLA 3QBQA 3BTXA 5L7OC 1WMEA 4ARXA 4L0PA 3S7EA 2HWB3 2XLGA 4KH9A 2IXLA 1Y9GA 1CZSA 2WNOA 2BEOA 2W87A 2XJRA 4HONA 4QU2A 4EN7B 4HOOA 5BPXA 5LB6A 1ZBE3 4AEDA 1TMF1 4D6SA 4Y33A 5JXIA 2H6BA 3BTAA 3ZM8A 4EWEA 3PURA 5BNPB 1MS8A 2BOIA 4NIIA 5HV4A 2IFRA 3R0RA 4BHPA 4I30A 1S0BA 2LROA 2VH9A 2C24A 2V4VA 3I3EA 4BB3A 3APBA 3ETPA 3PJYA 4P9LA 1ND3A 2UWCA 5HXMA 5C33A 1NT0A 2VW1A 4A2UA 2ZHMA 2RR13 3FFZA 4LOSA 3H0OA 1U5IA 4CCKA 3IM0A 3ZSEA 1GWMA 4E27A 4FT8A 4LBQD 4TLGA 2JG9C 3GCXA 4K3UA 5T3NA 2FMDA 3I4IA 1NCRB 5EHDA 1YLLA 3TAYA 3AP6A 3M1HA 1ZZBA 5FMOS 4BQ3A 3MPPG 1RUOA 1OXCA 5HCBA 1AVBA 2Q1MA 2D6NA 4IE7A 1X9PA 3TRSB 3T4VA 1H6YA 5LEJA 1FMD3 1W99A 1Y3TA 4Y1YA 2EF6A 3ZYPA 4QQOA 4RSUA 3MEPA 4BCUA 5GZDA 2UWAA 4XXPA 4YM2A 3UL2A 1F5FA 4FOWA 1UXZA 3HD8B 1RUF2 4FAGA 3AM2A 3LKJA 2PQSA 4XW3A 3BPZA 1BVVA 4A45A 3J9SA 2EVXA 4QQ2A 4BLJA 3UETA 5ABJA 4LA2A 5C71A 3VD9A 3OY8B 4MXWA 3R4UA 3OG2A 1CR7A 4NAOA 4C0HA 2K2SA 3ILRA 4A3XA 2DUOA 4CCCA 5FQ0A 5A80A 3ZXLA 2A6VA 1SMVA 2WL1A 5J1XA 1WMXA 3LEMA 1UKGA 3HBZA 3ILNA 4Y1UA 3VHNA 2Y0OA 3MZHA 1BJQA 1Z78A 2QQWA 1WZXA 4Q4X1 2RE9A 5FUIA 4YW3A 4AWDA 4J6GA 5T55A 5A7WA 3WXPA 1KDMA 3B9CA 3ENRA 5FYHA 1YC61 4CEYB 5EYXA 4QGMA 3HPNA 3O1UA 4OI4A 2B7YA 2Z42A 5JXGA 4AVCA 4UW5A 3MUY1 1SHWB 3ZXAC 2PFWA 3WF0A 1FPN1 4OHYA 5EXOA 1KXGA 2PHFA 3OBRA 3GDBA 1Q8SA 3ZYIB 4IV3C 1EUUA 4Q0QA 2R32A 3ZFFB 5CA6A 3JZVA 3AKRA 5C4WC 2D5HA 4LE3A 3ZXKA 5G04L 4AAPA 1QEXA 2HLEA 5F3GA 5CISA 4XABA 3RZJA 1X9TA 4NAMA 4FPLA 3A21A 3HT2A 4QKDA 2Y6LA 2DCZA 3POBA 3RRDA 3FBYA 1QJFA 4KG8A 2WNUB 1UOGA 5T5OA 1JXNA 1DYKA 5FY0A 5CKQA 3P1IA 3PTYA 4Z8BA 2ZEYA 1W2AX 4EJRA 3PMSA 3K2OA 3WINE 3M2MA 2R0HA 4W50A 4D3WA 3UJOA 2JJ6A 3J26N 4XE9A 3BU0A 1Z0HA 2DVDA 1ASJ2 4PHZA 2VUCA 5EJ3A 1UXXX 1ZZ8A 3ZFEA 3MIHA 3TYJA 1SLLA 2ARBA 4UBGA 1A34A 4NN0A 4PI2A 4TLFA 3TN93 1ZA7A 5HXVA 5FZ1A 2EIGA 2ZJCA 4NPLA 1MZEA 4OI2A 3ZIWA 1W0PA 3ZKUA 4XFAA 5CFDC 2VVDA 3LAGA 3WP6A 2CAVA 4Q2FA 2YXSA 5A32B 1H9WA 1U0AA 1H8TA 1OD3A 2XKPA 4TXWA 1VJ2A 2X05A 1UX7A 3MO4A 3RI8A 2HEYF 2WQ8A 1D4M2 5IW0A 3W5MA 5JPNB 2QQPA 3KSCA 3LOBA 1S1AA 4FPCA 5KXBA 3LE0A 1OLRA 2VZPA 3TEYA 1YQ8A 2W1QA 2GN3A 2LALA 4ORFA 4XEZA 5I91A 3TEXA 3NW4A 3ASIA 3HQXA 5FREA 4XURA 1TVGA 2ATFA 2E7AA 4AEDB 4JHTA 3Q8CA 1H6XA 2Q8OA 3EMRA 5FPVA 4D7TA 1ZRIA 3AYAA 5JIUA 4RD7A 2B8MA 1WW5A 3MDPA 5FZ3A 1W6OB 1RUE3 3KF5A 2B46X 2R30A 3MW2A 4Y24A 2OT7A 1W8HA 1ND3B 1QMJA 1VP6A 2W95A 3IDBB 1O3QA 3PUIA 3LQCA 4IL7A 4O9EA 3WQBA 2FDFA 1AR62 4LKFA 3WT3A 1AR82 3HR9A 2RDRA 2RM22 4W6YA 2PLV1 1XU2A 3IKWA 1X82A 4D69A 3N36A 3OBZA 5L9RA 1YRZA 1HJFA 2W46A 1LHOA 2Q8CA 1BLZA 4OCTA 4LEJA 4X6QB 3W59A 3JBG1 1ZREA 1JMUB 2JD4A 1LOFC 1QJY1 3K4DA 4BYYA 4CCEA 4UFKA 4BXFA 4LO5B 5LY2A 2W08A 2KXLA 2BNNA 5CFCA 1EAH2 5DMYA 2QZ2A 3ZLIA 1PIV2 3OBAA 4A42A 1KEXA 3LEKA 5D8AC 4YVSA 1ASJ3 2I07B 2PHLA 2VNVA 4CUGA 1FI2A 1GNYA 3LD8A 2ZGTA 2WZR2 4A44A 1LAJA 2WRAA 1UKRA 3LIGA 3SITA 1COV3 5FXWA 2OA2A 1QIQA 5HCHA 1JYTA 1LGNA 1DLLA 1DQ6A 1OOPA 3ZN5A 2LUWA 5ABJB 1XRUA 2FDHA 2W94A 2JG8A 2HWF2 5FTTC 4MXWB 1BVP1 3B7MA 4OHXA 5H9QA 5AC91 3IN9A 1REFA 5FQ0B 5CBLA 1D4M3 1OVSA 3EHKA 2RS52 3M3QA 4ISRA 3EO6A 4CE8A 1YFXA 2WSUA 2EALA 5BNNA 4ZPIA 2AREA 1DHKB 1STMA 4R8HA 5FY5A 3HBKA 2W1UA 4UFIA 4HKWA 3LFIA 4RFT0 2CL2A 4ZU5A 2BQPA 1O5UA 3SKJE 2JDAA 4KBZA 2RS12 2QQNA 3LB9A 3PDQA 5DZFA 2R042 5A7WB 5JZGC 5ERLA 2P6HA 2GALA 4CP9A 3C7GA 2MNGA 3I8TA 5FBZA 3VBHA 4YW6A 1W9YA 2J1SA 2WT2A 1AL21 4IEWA 3KVBA 4DXZA 1OURA 1AR72 1HKDA 5FO7B 5IVEA 1W9FA 2OKXA 4AEJA 4AR2A 1UIJA 1WD4A 2HWC3 4Q1PA 1H2LA 2VQ0A 2W1SA 3CJIA 3OPTA 4AGGA 1GWKA 1EV12 2VZOA 3JQWA 4UAPA 3IT8A 1S2BA 1AR83 3ETQA 4EN8B 2WFPA 1GR3A 1YJKA 3N7LA 1US3A 4JGYC 3D6EA 3T2TA 2CHHA 1M06G 1RHI3 4FCAA 2R071 4PCRA 1AUYA 4HSLA 4L9BA 2BJSA 4CU9A 2CNAA 1GP6A 2Q1FA 1QOTA 4EV0A 3WDTA 3WSOA 3WNPA 4PT6A 2JE8A 3I49A 3WNKA 3ZIXA 2ET7A 4LHLA 5CZKA 2JIJA 5IJRA 1CX1A 2A5ZA 5FYMA 1RTVA 1ULGA 3ZDSA 1PIV3 3MV11 3ECQA 5FYIA 1F2NA 1AX1A 2WNVC 4YYOA 2OPKA 2CGOA 2PHDA 3ZFEB 1HXS1 4A6SA 3ME2A 4LBQA 4QMAA 3RZZA 3VBUB 3E6CC 3IPVA 2W39A 2Y6GA 5FRAA 1N1YA 1O3RA 3O0XA 4QPGA 2VC9A 1FOD1 2VZ3A 1HRV1 3I3DA 2ILMA 4GMP1 3PUSA 4UOJA 1LHNA 1RITA 1XBFA 4HL0A 4CDUC 5EQUA 3Q8FA 5FZIA 2WNEA 4NWWA 1VBC2 5CIRA 3ZOIA 1YWKA 1H8TB 4WM8A 1UD1A 5LRRA 4CDXC 1HQNA 3LWCA 1V9U2 2B9UA 4LUMA 4AQTA 4WV8A 5JMCA 2XJSA 5KWRA 1J59A 2D43A 4DUVA 2AZ5A 4NHKA 1JW6A 1L7QA 2DBNA 1BXHA 2VW0A 1NLQA 4JAAA 1UPIA 2WS91 1XNAA 2XB6C 2KD7A 2Z79A 3RG0A 1IS6A 4YFZA 2YMZA 1D2QA 4N9HA 1XSRA 4E2SA 1PZ9A 2ZGPA 4TWTA 1VRH1 4RGAA 4IV1A 5JMOA 4Z92B 4OVEA 4TN7A 5FZOB 2EIEA 3FMGA 3JUUA 2YFZA 4Y1ZA 1H2KA 4EYUA 1W0OA 1VLNA 2ZGLA 2VZVA 3ABZA 3FFQA 3G7DA 4GAZA 4HKOA 5T5LA 1VBA3 3M3IA 1DQ0A 1EV13 5SV8A 1AX2A 3H50A 1EUTA 4AFMA 3WF1A 4UWDA 2E26A 3AYCA 3PUAA 1RUI2 4W6XA 3HN3A 4KWLA 4QX8A 4XJAA 3Q8AA 5GLTA 4Y5TA 2VZ1A 3ALQA 3D3AA 5EYYA 1VAKA 2F17A 1ND2B 2O14A 1PNFA 1VAMA 2JE9A 4K7JA 4MLOA 5FLJA 1F35A 2XHNA 5H9PA 5JSRA 2PHRA 3LA3A 2D5FA 3ZMOA 2ZS6B 2PHUA 1SLBA 5JR7B 2HBUA 4BZ4A 4YGCA 3HWJA 3NNMA 4YVSB 3PVEA 4FPFA 5FLIA 3LPGA 2VZUA 4MGSA 3CJXA 5L7OA 4ZHNA 1JOJA 5LBBA 1R092 3MGUA 1AJKA 3W5NA 1BMV1 3ACIA 2VZQA 4KQ7A 1OOPB 4IEYA 1C3HA 2NPIA 3AKQA 2JG8B 3IAPA 2AACA 1C8M2 4M01A 3M3CA 2B42B 2J7MA 1JOBA 4CVUA 4Q4W2 1V9U3 5K7PA 3LA7A 4UW4A 4XVHA 3I2FA 4ZS3A 1PMHX 3WW1A 4OMDA 4OZOA 4L2NA 3OD4A 3R6SA 4LBLA 5FY9A 2VQAA 1TEIA 3THPA 1JZ7A 1DU3D 3MFCA 4AI0A 4ZU7A 4AI8A 5A3PA 1Q43A 2C0ZA 2HBTA 4HLTA 2P3JA 1UY0A 5A3TA 4FBFA 2HWD3 2LW8A 4CP9B 1OH4A 4QM9A 2JG9A 4Y3OA 3VBUC 2GMMA 3VBHB 3VL9A 3VDAA 5K0UB 5C70A 5A3WA 4I0WB 4IEXA 2JXAA 4AVTA 1HB4A 1QJZA 4LT5A 3RPQA 4QU1A 5F1RA 2ZGOA 1IS4A 2C26A 3AX4A 3GJAA 4JV4A 4N53B 2YHJA 4WZCA 2CSGA 3EYPA 3S5QA 3VHPA 3AP5A 4NIHA 1CAVA 3CJIB 4JZRA 4P00B 3VDBA 3USUA 5JWPA 4IQPA 2XWBB 3I59B 1MS9A 4XHBA 3SHRA 2JDNA 1LHVA 2A7AA 4DFSA 5LA2A 1W8WA 2JENA 3BKZA 1Z7S3 4XFCA 2R062 1KJRA 1I9RA 2BDRA 3WP3A 3UJQA 5BV6A 1RUD3 1FV2A 3OOXA 3VD3A 5BNQA 5GZCA 5LA9A 1GP4A 4Q4Y2 4UXAA 3DYPA 3RYRA 1DQ4A 3IBMA 3GBWA 4GKYA 3W20A 5JSOA 4CDWC 3AL5A 2DFBA 5CB7A 5KHKA 5FPBA 1RUJ2 4XF3A 3H7YA 1RUG2 4LBQB 1R093 4HT1T 4C91A 5A3NA 1SPPB 1V6MA 2GZWA 4MZUA 1DCSA 1AX0A 1Q8VA 4FOYA 1O3TA 4QPGB 3SCFA 3ZVXA 2Q8EA 3A23A 4O7XA 4GXLA 4XETA 3NJZA 1W6PB 1C8M3 3ZYJB 3J8F1 4PQ9A 1D4VB 2BTVC 4ASKA 1RB8G 1TZOA 1B09A 4Q4W3 4JGZB 4RYDA 2JIGA 4WM8B 1J3PA 5E1RA 1ND2C 3LZZA 5GZGA 5DDJ1 4G3YC 3WDUA 1W8NA 1F4AA 3V56A 3NJXA 2Z5WA 1RVF2 1ZM1A 3UGGA 3KCYA 5I0SA 1RUH2 5FWEA 3UKNA 3HNYM 4D6RA 1Y9QA 1C1LA 1UYXA 4AI1A 2RM21 3T0DA 1R1A1 4IV3A 3KV4A 5FP8A 4LTAA 3KMHA 1YHFA 2XL7A 4QT6A 1YFYA 1RL3A 4QAWA 5C4WA 4L11A 3JD72 1RMU2 2QBXA 5A6XA 5GLVA 1OPOA 4IV1B 4ZS2A 2QQUA 3O1SA 3ZN6A 2VCCA 2XOMA 3ZYGA 2X5IC 4AQ6A 1J1TA 1FAYA 2JICA 5J96B 3T4HB 4XUOA 1W8ZA 4UBHA 1EAH1 3MIEA 3OEBA 5F8PA 3AYDA 4XUNA 2NMNA 2RJ2A 2ENRA 4GQ7A 1T2XA 3V64A 4NRPA 2XVGA 1NZCA 2WZR1 4MUVA 1F5JA 2TNFA 3WP4A 4JTNA 1TME1 1GKBA 5DAWA 4Q0VA 2YC2A 5SV5A 1YFWA 1WCQA 2C6SA 2XDVA 3INAA 3WG3A 2HWF1 1DP0A 5CFDA 2A6XA 4Q4Y3 1BK0A 1LJ7A 2YBSA 1PZ8A 5B2GB 3KHBA 4IE6A 3WNXA 1VBB2 5K0UC 4P14A 2RS51 3UESA 5IHRA 2RMU2 1GFF2 1HB1A 2RV9A 3C7EA 1X36A 3GALA 3U0ZA 4COYA 1PO22 4H14A 1WD3A 3UKVA 1RUG3 4N53C 1JN2P 2A73B 2D98A 5L7OB 3TWIA 4XFGA 3WCRA 3S57A 1POQA 1QXRA 3LEIA 2R041 3PU8A 4A6OA 4ARYA 2WT0A 1WW7A 4Q4X3 4DINB 3WVJA 3H3ZA 3ZX7A 3VBFC 1QY4A 2ZXQA 5A7QA 1MEC1 4YSFA 4QQPA 2Q8DA 5A7NA 4YW2A 5JI7A 2Y34A 1A78A 4WZFA 4Q8LA 4J1XA 3O1MA 2I2SA 1BCXA 4Y4RA 3B69A 3PLQA 1RVF3 4FP2A 4K6BA 1RUH3 3U10A 4CUCA 2GDFA 1PO11 1QJX2 4QKNA 4YRDA 1FPN3 5M0TA 2OUHA 3MLKA 4CXWA 2WKKA 1VMFA 1CAXA 2AEZA 2ZGQA 1AR91 3BODA 3ITQA 2UYBA 2JWPA 1G9AA 2PXJA 1OQDA 2B5HA 3JD73 2JG9B 1RMU3 3LA2A 2ZGSA 1MACA 3ACGA 2QCSB 3RWKX 1DGWX 3O12A 1OKQA 2CY6A 1VPHA 4JDNA 3U78A 1A8DA 1LOFA 1WMFA 5F3EA 3JCIA 1ZBE2 4K1ZA 1CAVB 1Q5OA 2IXHA 4GWJA 4JGZC 5HPOA 3USUB 4E4HA 1POV0 3BUCA 5D8AA 3RJ2X 2HKXA 2CAUA 1K5MB 3FZ3A 4ZZ5A 2PHWA 3GZEA 4P9YA 1X50A 3VDDC 4BQ1A 5JOWA 4RHV2 5I8SA 4CU8A 2YB7A 1KFUL 4LXLA 2C5DA 4XHXA 4MOAA 4AQ2A 1T6GC 2XJTA 5F9TA 5C7GA 5IVVA 5JOYA 4XJWA 5DUWA 3VN4A 3AXEA 1UMIA 1ZBA3 3LDKA 5C8CC 1VBC1 4QM8A 5F5AA 1KDKA 3ON7A 5EJZB 3P3PA 2QUOA 5HV0A 2RMU3 4GH4C 4GZ9A 4XF9A 4AVVA 3GF6A 1PGSA 2PAEA 1PO23 4BQWA 3OBTA 3CBNA 4B7KA 1GNZA 2VAUA 3PVBB 4QB6A 4QXKA 2FCUA 2F6BA 4ET7A 1QJU1 5FZ4A 5KC5A 5C3SA 1CPNA 1LOAA 1V70A 2E32A 2YBKA 3BGAA 2O8OA 2VE1A 2WYSA 4YARA 1LHUA 5JZGA 5CNAA 2CGPA 5FKBA 3OEAA 4Y4YA 2NMOA 1IS3A 4DZGA 4QHZA 5F37A 5L9VA 1UYZA 2Y8KA 1HRI2 1G9DA 3GCWA 1ZZ9A 2YG0A 3QOPA 3OCPA 4MH0E 1NZIA 2HWE1 4YZ4A 4C1WA 1XE7A 5FZ6A 2A6ZA 4HSJA 4AW7A 3HVDA 4LKEA 1RJ7A 4AOCA 1NG0A 1QQP1 1QJX3 4XF4A 1Q56A 1OA2A 2J1AA 3VZKA 1NY71 4AFCA 2XUMA 5T52A 3ELNA 3OGSA 4EN6B 4JGYA 4IV3B 4PIYA 5DAVA 3ZPYA 3WDXA 2VTXJ 5LW9A 5C4WB 2WYFA 2NYYA 5GLZA 2YPDA 4UW3A 2QTWB 3POWA 3DXUA 4QXCA 5APAA 4COVA 3L2HA 4XJUA 5IVJA 3ZN6B 4QQHA 5ANQA 2VXRA 5FK8A 5IATA 1GSLA 1XPWA 5FZAA 1VRBA 3AKPA 2BZDA 3AYEA 5FP7A 2KA3A 2ZZQA 3LFMA 4HXCA 3JBG3 5FYUA 2Y60A 1QJY3 2DCYA 5KC6A 3JXSA 2WNVA 1W6OA 5C3QA 3V0AA 5J98B 1R64A 1BEV1 4RHV3 2ZHKA 2HYXA 1VMHA 3NV2A 3VDCA 4Z2WA 1LENA 2VY0A 3I2IA 5FUNA 1I5PA 1RXGA 3P5BA 1R082 1PNGA 2WN3A 4FFGA 3WG1A 5C3RA 5CFDB 3NL1A 4AYUA 3BTYA 4NHYA 5GZFA 2JB8A 2JB4A 4CDUA 2VMCA 2X10A 2HEVF 4NJ4A 1B35C 2GMEA 4UW6A 4HN0A 2WWSA 4CDXA 1NLRA 3EBRA 3M70A 5DG2A 1G7YA 1UY4A 1N47A 4FQ4A 1UY3A 4LE4A 3T2PA 1L7RA 1HQLA 3WNOA 1XNCA 3LF7A 2ZKNA 4CRQA 1XYOA 2ZX0A 3SH5A 3RNSA 4ATEA 4JQTA 3V65A 5LWBA 2EXJA 4UFMA 3N9PA 1K5MC 1WW4A 1JODA 1JU3A 1HRI3 1WUVA 2IUWA 4OULA 3B3QE 1W9SA 4UI9L 4ZONA 2D6OX 3MW3A 3PVNA 4YW1A 2A3XA 3TN92 5L19A 3WNNA 2A75A 1HB2A 1OBNA 1W8UA 3BOWA 5K4LA 1H2MA 1ZRCA 5LATA 2VZRA 2XUEA 1ZZCA 2D3SA 1CAXB 1C8NA 3C2UA 2XPJA 4HBNA 2R061 1HQWA 2GC0A 5L73A 2R073 3NVCA 5BXXA 4MHRA 1Q3EA 3NJVA 1CAUA 1GLHA 3AFKA 4FPHA 4ONUA 4BQ2A 2ZAAA 1CONA 1D0HA 1UY2A 3NWKA 4W65A 4CXYA 3H42B 1JYXA 4COWA 5JUVA 4IEVA 1X8MA 1ZX5A 1JUHA 3Q8BA 1RUJ1 5D8AB 1A8MA 1PM7A 2CU5A 4AVAA 1RUE2 3USSA 2VMIA 2RS33 4YM1A 3M3EA 4Q27A 3QACA 4Y22A 1R083 1G9FA 3K3OA 2FZ1A 1NQDA 1P8JA 1JHJA 2VM9A 4KWJA 3IDEA 2EAAA 3E97A 3KV9A 3NMBA 5D1IA 2QJVA 2VOKA 1BBT2 3ZXGA 2QQJA 1FOD3 4AE2A 1SACA 1VBE2 4GMP3 1ACCA 2V4AA 4QHBA 1SBFA 3BALA 1H1AA 1SEFA 2GMPA 1C5HA 4NR1A 4MX3A 4YW4A 1ZZ6A 4YVWC 4QPIC 1MS0A 4KI5M 4MV2A 5DAPA 2WSVA 1DGWA 1ZZ7A 2EAKA 1US2A 1DGRN 3KM5A 1J3QA 4KGQA 3VB9A 1OVPA 1ODMA 2HYKA 4XMAA 3VZNA 1JYCA 5L9BA 1S0GA 5FPXA 3ZXDA 2G19A 4NE9A 4UFJA 5J3UA 3N9QA 1ULFA 4V2VA 5I8TA 5JZGB 2GNDA 2RG4A 5GZEA 2E7QA 5I0DA 4DS0A 4CEWC 4IW3A 2DUQA 3VBUA 1SDWA 1OT5A 1AYN2 1GNHA 1VRH3 1F15A 2K0GA 1COV2 3N7KA 4QWNA 4XAAA 1DQ1A 1AHSA 4META 4YZ1A 1ODNA 1D7PM 1FYUA 3NRUA 2V72A 3KGLA 1K45A 1H4HA 2B9VA 2A3YA 5A3LA 1BZWA 4Q0PA 1QXJA 4RQPC 5JR2A 1NYWA 4JGYB 4DIQA 4PF5A 4XCAA 4SBVA 5FXXA 4E8CA 2I74A 1OF3A 4AK3A 1N1SA 1DBNA 1MS3A 3E6BA 1WGPA 2IXIA 4BMEA 1PX4A 3GJBA 2G9GA 3VLBB 4M3CF 5FMDA 2CGNA 4GULA 1KFXL 3BN6A 3K75B 1VBB1 1TNFA 4YM3A 4I3GA 1UMZA 1OUSA 4CCLA 2MEV1 1PGL1 2VPVA 3ZYHA 1FNZA 3G6JB 4CDWA 4DRRA 2ZGMA 2YV8A 5FZOA 4FTSA 2WNVB 3V0AB 1ENXA 2JEMA 4EZ4A 1C4RA 1RUC1 3LDBA 3FLTA 5FP3A 4GKXA 1DZTA 2JKBA 1I5ZA 3C7HA 5LBEA 4Q8KA 2HWC2 4XBLA 4AI2A 3GGLA 2UWBA 1FNYA 2V5YA 1DQ5A 3HOBA 5I8YA 2JE7A 1VBD2 2DDUA 3T09A 1BBT3 4Q4V2 2G9ZA 4Y1VA 2XLAA 4LOTA 3D5OA 1RHI2 1VBE3 3LDRA 3W21A 4BIFA 2GP3A 3IDCB 4CDUB 1HDKA 4E9KA 4YGBA 3HNMA 2W9XA 4XAEA 4CDXB 1ND2A 4PQQA 2JD9A 1ULCA 1GANA 3O1RA 2P3KA 4DY3A 5E16A 3NNLA 4S2FA 2Q0AA 4BK4A 1MZ5A 2WFF1 3FN9A 1WA6X 2Z2SB 2QQVA 3I2DA 4H7MA 4Q26A 3RZGA 2OS2A 2WINB 3WW4A 2C1FA 1A3KA 2OIIA 3WUCA 3WLUA 3T08A 3I7DA 1AYN3 1UZVA 2HWB1 3QLQA 4IERA 3ZYRA 2X5IA 5EPAA 3JU9A 5C9AB 2R0FA 1UU6A 4UFLA 1MS1A 1AYM2 1W0NA 4YPJA 4FPYA 5FZBA 3D8CA 5CEHA 3FHQA 1PK6C 4DO0A 2BWCA 2D3PA 4AI9A 3VZLA 2BERA 1S2EA 1HLCA 2XBO2 1UY1A 4B4QA 4FAHA 5FY1A 3OSDA 1CQ9A 2RR11 2YYOA 3J7LA 4OZXA 3M4FA 3FLRA 3M8LA 1CAUB 4IE4A 4LNVA 3VGIA 4Q1RA 3RSJA 2BBVA 1Q8QA 3O14A 5DUXA 4D7SA 3POGA 3H8XA 1SDDB 1SCSA 4NPMA 3P6BA 5K0UA 3B01A 2WZPP 1OLMA 2AEYA 3T1LA 3AP9A 4N53A 4O65A 4X6RB 2EXIA 3N3HA 1JZ3A 4H2AA 4MYEA 3I2GA 3URFA 4CSWA 1VBA2 5ISLA 4Y22B 2ZGKA 4L92A 4NHXA 1VBD3 2JKXA 1SFNA 2IVJA 1FMD1 3P3NA 3WCSA 4Q4V3 3I59A 3LSEA 5ACA2 3C3VA 2YROA 3U75A 3VBFA 5FDBA 3VKMA 1WLWA 2ZGRA 2Y26A 4PBOA 1OUXA 3J8F3 1ENRA 4HANA 1SLIA 3KF3A 4QX7A 4K20A 2WJSA 4KGGA 4QB2A 1SFPA 5DUVA 2FDIA 4PLNA 1NAEA 4AEMA 4FXGB 5A33A 1YEWA 3VHRA 3POIA 4URAA 5I0RA 3AXDA 2FQPA 4GA9A 4LHNA 4CYDA 4FPGA 3TNPB 2XXZA 1O59A 1REDA 3AJZA 3CMGA 4RGGA 1WMDA 3GHNA 2A6YA 2VOXA 4Y1XA 1SPPA 3FHIB 1BK1A 3IZOA 3WV6A 2YY1A 1ALYA 4S2GA 4OFGA 2WWJA 1RUNA 3H9AA 1AYM3 1W6PA 2ADEA 2BFUL 4B1MA 5FYBA 1PZ7A 1RC6A 1XXNA 2XG3A 2XKOA 3FLPA 3MBWA 3OF1A 2OW4A 4JGZA 4CPBD 1QGLA 3I54A 1L7LA 3A0KA 3T0BA 3BCWA 3UKTA 2XBO3 2Y33A 5BY5A 1PVC3 4Q0UA 3B94A 4HVRA 3ZSKA 4I09A 4JC1A 1SBDA 3F95A 2C9AA 3HMYA 3PNAA 3POEA 3KQRA 1YI9A 3MI8A 3MICA 1WLTA 2KR2A 1LEMA 3H1WA 3MF6A 2BGOA 5J36A 5FZ8A 5C8CA 1GV9A 2J1TA 2HWD2 4LBOA 4RL7A 4V1PA 2R6QA 4XPVA 4CCJA 5C5UA 2XGXA 4GH4A 4CDWB 3SEPA 2VQTA 4OQ9A 5C9AC 4LK6A 2GC2A 5F5IA 1S0CA 5AVAA 3RGBA 1LESA 5A7OA 3T1MA 1C1FA 3RMYA 1EPZA 3AZVA 4FFHA 4IEZA 5ACA3 2GSYA 2YGMA 2QQIA 3WF2A 3T3YA 1RUF1 4L97A 4AL9A 1N3QA 2HEWF 2C4XA 1Z7S2 2NM1A 2Y6FA 5CVRA 2VBDA 2WO1A 1MEC3 4DQAA 3SXWA 1RUD2 2BP6A 1E57A 4R4ZA 1OC1A 4U2AA 1XNKA 2YBPA 1VIWB 4YGDA 1CGPA 4E4DX 4J25A 1WA4A 5FYCA 5IK5A 2P2KA 2WN2A 1VAVA 4M3CA 3ZMNA 5K8SA 4N7IA 5A1AA 4Y5Z0 3U14A 3ZDVA 2PQQA 1X7NA 5ANNA 1KRIA 3DF0A 3I2HA 3SISA 3VV1A 3RDIA 5LY1A 2CV6A 4OI1A 4NHLA 1QDCA 1AF9A 4IEUA 4NRQA 3K3NA 2CWSA 5IAXA 1UX6A 2X5IB 5LASA 4CCDA 2O8QA 3SH4A 2P5BA 4E2GA 5IAVA 2BWAA 3L2YA 2GNTA 5B4XA 5LK7B 3O1OA 1ZNPA 4LBJA 2ERFA 5A6QA 3I97A 2R16A 3HN1A 1U12A 3UT0A 1WLDA 1H2NA 1PGW2 3U1XA 4XUTA 3T0AA 1IPKA 3RYPA 4OHVA 3WG4A 5D21A 1O91A 4BXSV 3KHCA 4M00A 5FPLA 1PM4A 5H9SA 1MPXA 3FE5A 1VB4A 2VBBA 3BTZA 2BBAA 2VVFA 5F7UA 5FIXA 4ASLA 1CPMA 2SLIA 2Y64A 3NV4A 1F4HA 1QJEA 4QDRA 1K3IA 4S2HA 5FP9A 1B35A 5JOXA 2XJVA 1OKOA 5JOZA 5FPUA 2PELA 4UF0A 2VL4A 4AF9A 1W2UA 5J48A 4RS5C 1EP0A 1OQEA 2YFUA 4P02B 4PDWC 2VOTA 1KJLA 2EXKA 1YQCA 2FMYA 3PVOA 3R05A 4IDZA 5FMOL 5LCWL 1QJU3 5KHHA 3O1VA 3AZXA 1LNSA 5F32A 2VUJA 5C6CA 5KHJA 1ASJ1 1K5MA 1SCRA 2FCVA 3VBFB 5DN2A 3D0SA 4XXAA 4A7ZA 4FOVA 5C3PA 3RZLA 1QH7A 1XE0A 4LKSA 4F3JA 4LLFA 5FAXA 4M0HA 5EFUA 1ULOA 1W3XA 5FZMA 3VD7A 5IT6A 2VMDA 2LM3A 4PLOA 3K77A 3NNJA 4W4ZA 5FK7A 5A33B 2RDNA 1WCSA 1Q8PA 4BE3A 1D4M1 1UO9A 3FBMA 4I0BA 2BGCA 5TSWA 2NLRA 5A3MA 4NUBA 2P34A 4B3NA 4GB33 4BK5A 3NAPC 2WO2A 2QQKA 5DAQA 3WW3A 5FP4A 4AHWA 4HZFA 3KV6A 3FC0A 5DZEA 4DOUA 4XMIA 4Q4X2 4NROA 4WVMA 4CUBA 1LB2A 1MZFA 4CZSA 1J84A 4FQZA 4CDQB 5J37A 1QH6A 4XZPA 4KMQA 4EN0A 1TMF3 4V2WA 1YI7A 3RZKA 5A6YA 4EZHA 2JDHA 5LA0A 5JSPA 4QKBA 5GKAC 2E6VA 5I0UA 3VZJA 3VDDB 1GWLA 1KS4A 3FJSA 1SFYA 2WAOA 3FL7A 1AR61 1NXMA 4HG6B 1AR81 2VNGA 2QDNA 1H9PA 4LK7A 2KM2A 3PIGA 5EV7A 1J3RA 4AHYA 1FPN2 2ID4A 4S2DA 5FCCA 1V6IA 2J1EA 3NKTA 2ZCWA 4HKLA 3HAGA 4I0AA 4BJ0A 5C8CB 3AL6A 4CU7A 1ULEA 5DAXA 1UNBA 2P3YA 2WA3A 3CQOA 3D82A 1HJGA 2CDOA 2DVGA 1VR3A 4GH4B 3BIWE 4YVWA 4QPIA 5GALA 3VBOC 2NZ9A 1UWWA 1C57A 2D97A 3OB8A 3VBRC 1JI6A 3GZUC 4KWUA 2DU1A 2PMWB 2ZBJA 4DMIA 3AJYA 5DUUA 1PIV1 1GU3A 2BV4A 3VKOA 1E5IA 1NCQB 3KCXA 4D7YA 5BYNA 1JTZX 2H0VA 4FI9A 1V6JA 3C8XA 4ZY9A 4CEWA 2DU0A 1KQRA 2FBEA 3OUHA 2EA7A 5FO9B 3VKLA 1OA4A 1QOOA 3E6DA 5BUVA 3FUOA 1HN1A 1W6MB 3KGZA 4XBQA 3FHAA 1DG6A 1UU4A 1WLCA 3CLPA 4JDMA 2OZJA 2VD7A 1YUDA 3UV9A 1ZBA2 2ZPXA 1XNBA 2WQ4A 4R9CA 4M4PA 3MYXA 4ZKTB 4R52A 1FXZA 4RQPA 1PVXA 5FJHA 4PIXA 4M3CB 4D0QA 3ZR5A 2X8KA 3B02A 5F2SA 3VBSB 3EXUA 2XJUA 3N7MA 3B93A 3WP5A 1CIWA 1L3JA 1N1TA 4IGQA 3ZFGB 5E6HA 2BNOA 2RS11 3GNEA 3RZHA 1S0JA 1X8EA 4YZ5A 2AR6A 4XBNA 1AXKA 5T5JA 1QKQA 2CDPA 3ZSLA 4LO4B 5F2WA 2YPJA 5FYSA 4W6WA 1AR71 3O0VA 4XIKA 2IC1A 4NIAA 3U37A 2XWJB 4QPYA 5JI9A 1V6LA 2D93A 2DVFA 3IIIA 2ZA9A 3O7OA 4NRMA 4XTPA 5J7MA 4XQWA 1W3VA 1EV11 3J7HA 3WUDA 1PX3A 1NA1C 1CD3G 3EJKA 2E7TA 3IDAA 4JVAA 3VD4A 1D0GA 1XE8A 1XNDA 4N8MA 5I0TA 4FTEA 4IE0A 1B35B 1DYOA 2I45A 2A71A 4QX2A 5T5PA 2C9KA 4CPBA 4L8QA 4UF0B 1OPMA 1SQ4A 4AHZA 4JKMA 4GJYA 4CDQC 3RQ0A 3KLSA 2F4LA 3K51A 1W03A 4YFWA 1V00A 3JBG2 5IVYA 4LHSA 1HIXA 4OYUA 4C0BA 1QJY2 4BPZA 5AFBA 1E5RA 3ZN4A 4FPKA 3IAQA 1JZ2A 1AXZA 3E5UA 3QH7A 1O8PA 5DQ0A 3RYKA 1SLCA 1PMJX 4R9AA 1YNAA 2G4IA 4B4PA 3CZJA 4CUAA 4JCKA 1K42A 3NSTA 3BI3A 1GBGA 1OLME 1S2KA 2ZEZA 3GZAA 4KBBA 4QDQA 4HK9A 3SCHA 3ZXFA 2BFUS 1H30A 2UYAA 4Y20A 1SLAA 4QGLA 4WVZA 4YLZA 3ATGA 4D8MA 1V9U1 3K48A 3KCCA 5IVCA 1GP5A 2E63A 2K46A 1QOSA 4SLIA 3VKNA 4K21A 1W8FA 3I3BA 2ZHLA 3AMQA 3RVHA 3QCWA 5AC92 1N3OA 2VUDA 3I2KA 4G9SB 3CIHA 2R49A 3AKTA 4LO8A 2F4PA 4NO4A 3HEIA 3SC7X 2W92A 2SBAA 1RXFA 3H8RA 4YZ3A 1NCQC 2ARAA 2VECA 1W2NA 2HWD1 2YU2A 1LU2A 3QD6A 4PF1A 1QU0A 1KD7A 4WVMB 5F39A 1DGRA 3I3QA 3R4SA 1LU1A 3B00A 5E88A 1GZ9A 2BNMA 4CTEA 1C5IA 1CIYA 3N7JA 2XMLA 3H8OA 4GWMA 3UGHA 2GNBA 2MEV3 1APNA 1WCKA 4XACA 5AVPA 1GZCA 2WIIB 3M7AA 1LKNA 4EN9B 1IZ3A 4F7ZA 3NKGA 1IG0A 1RUI1 1MVEA 1XQNA 1CN1A 3VBSC 1VB2A 2VCBA 5FLHA 2ZX4A 3SLIA 3DPRC 4NWVA 2P37A 1IGOA 2UY9A 3OUIA 5KBFA 3N4MA 3PIJA 2PLV3 3ZFGC 4YG6A 2AUYA 4ES8A 4TZDA 1YYNA 2FDGA 5FOBB 1RUD1 2R072 4QPIB 3O5SA 4YVWB 4BA6A 4QX0A 2Q30A 4MG2A 1DGLA 2RJLA 1O8SA 2A3WA 4XYXA 2WQZC 1HN0A 1W9WA 1UIKA 2K9ZA 2OZ6A 3L9JT 3U07A 5I93A 1MQTC 4P9GA 2D6LX 2J1UA 3POFA 4QX3A 3DUIA 3TB0A 1XU1A 2BU9A 4OMCA 4CEWB 5KHGA 1R091 1YJLA 2RS32 5DG1A 2DWRA 2PAMA 3PHMA 2AYHA 1S0DA 1J58A 1DYPA 4R4XA 3WQ0A 5LBCA 3RZMA 1W2OA 2YC4A 5DZGA 1HXS2 2VBPA 2BUKA 4K40A 3RS6A 1C8M1 4C8DA 2W91A 1FOD2 1HRV2 1GOGA 4Q4W1 5E89A 2JECA 2TUNA 4RQPB 2IFWA 5FZGA 5EWSA 1PGW1 3FX3A 5A70A 4XJ9A 4RR3B 5AC93 2WLQA 2DCTA 4CCOA 3N35A 1PHMA 4GWNA 4BQYA 2ZGUA 1C28A 5JIAA 1NUKA 4IESA 3U4XA 2UURA 3THDA 2BPA2 4XDPA 2WS92 2VTXA 3WD5A 4DXSA 3POYA 1CAWA 3WZ1A 1JYWA 4JRAA 5EIYB 2CTVA 2VVEA 4AZZA 4M3CE 3BYWA 1VRH2 2R1DA 1ST8A 2ZHNA 3DKQA 5C9AA 1JYVA 1IHMA 4Y5SA 1LODA 1AL23 1XYNA 1W06A 3KT7A 4B7EA 5BNOC 4ZXEA 3EB7A 2DYCA 1S0EA 3DV8A 3OPWA 3SEEA 3PTRB 1W28A 4O9GA 3MFAA 2GNMA 2V73A 2W0XA 2VQUA 5IK4A 2GU9A 3GYDA 5FPZA 3TEWA 2ARCA 1TNRA 5KHIA 1F9KA 4AG4A 4A7KA 1O6UA 2IZWA 4MGYE 1POV1 5GM0A 3SMHA 4DRVA 1UF2C 2VU9A 2DV9A 4BDVB 4OUEA 4Q4Y1 1Q8OA 2Z4FA 3AP4A 4NPRA 5GJ6A 4WM7B 2VZTA 3S5AA 3ZO0B 2RJKA 4IGPA 2QDRA 4PI0A 2XVLA 3MHZA 1IQDC 1JBCA 4J1WA 4MGQA 3LOIA 3D0JA 3I2JA 1IOAA 4XFHA 1RUG1 4XJ8A 2W1WA 3F2ZA 2YC0A 4AFBA 1UMHA 4HVQA 1XNTA 3MW4A 4AVBA 1UZWA 3NV3A 2VXJA 1WCDJ 5A6ZA 4HVOA 3KT1A 1HXS3 4XZUG 1QNYA 2RDQA 3MUZ1 3T2OA 3ZPOA 1S0FA 4GWIA 4Y20B 1HRV3 1ONAA 2Y6KA 2R1BA 1BMV2 2D6KA 1DZQA 3H3LA 1PK6B 2EICA 5HBAA 2XHKA 5FZCA 5IUQA 1W39A 4CCMA 3GM8A 1W05A 4AAXA 1RVF1 3J7MA 1RUH1 2MHFA 1E5HA 1UAIA 4XUQA 1HB3A 2B4KA 2IXCA 2BRTA 3S0MA 4LQRA 3JQXA 1LGBA 2O1QA 4RA0A 4DY5A 1YIPA 1XB9A 3AZYA 4IUGA 2WS93 3KT4A 2X09A 2OQ6A 3ZSMA 4E8DA 1LRHA 1SBEA 2GC1A 3JD71 1RMU1 4KL1A 2VMHA 3DGTA 5CU1A 4Q29A 1UCXA 4DXRA 4N43C 2XR4A 3GZTB 1AXYA 4DUXA 4X8NA 4RS5A 5FXVA 4Q0SA 2CYFA 2WDBA 4NOTA 1I3HA 4PDWA 1GQHA 1CWPA 5FWJA 4FO9A 4R9BA 4CP0A 3AMMA 5K9YA 4FPOB 1JH5A 2WBKA 2GH2A 4XJZA 4K8FA 5BNPC 4NIGA 3S7IA 3OGGA 3PL0A 2QQLA 3SQOA 3KD4A 4RR3C 3DEMA 4BU2A 1ULPA 3CNAA 3V0BB 2J1VA 1H8VA 1W6NA 2Y38A 1RUF3 3Q9OA 4CP2A 1ZBA1 2ZX3A 2DUPA 1KITA 5A3UA 1FX5A 2ZGNA 4LO7A 3H3UA 2VTFA 1CZTA 4LORA 5FJKA 3LIHA 3LEGA 2RMU1 3KB5A 4YWAA 3ZXEA 4XC9A 3VZMA 5CADA 1PO21 4QX1A 3WDYA 4AEKA 4YGEA 3NNFA 2LS6A 1V0AA 4FFIA 3AVSA 1NCRC 5GLWA 1MZ6A 3NAPA 4DNYA 3AKSA 5D2AA 3X29B 4FVVA 4FPEA 1H1MA 2AGSA 1NE6A 4GMP0 4XFIA 5JXHA 2OVUA 3BVCA 4N7UA 2XJQA 1UOFA 1WBFA 3UGFA 5CKNA 1JYIA 3BOPA 4OUMA 3H1MA 1UN1A 1IKPA 1K5JA 1VMJA 1NKGA 4P5HA 2E31A 3DYMA 3J8F2 4AXOA 3CKHA 3S6PA 3B9IA 5FV3A 1NOVA 3AP7A 2XONA 4A4AA 1QJX1 4WM7C 2JDZA 4NHMA 4QB1A 1O4YA 4RGKA 4XQDA 4NIDA 5DDJ2 4M0NA 4BOWA 5DPNA 4MGZE 3WR0A 2VZSA 3POSA 4OHWA 1SZBA 4JDOA 3W58A 1LOGA 1IKQA 4DPNA 1ZYBA 3ORJA 5JXJA 1YO8A 1PMIA 2ZTNA 5GLUA 1GQPA 3UYJA 3A4UA 1LTEA 5FZHA 5KXCA 1CAWB 1R1A2 4LLOA 1G6NA 2QKDA 2NN8A 2YU1A 4XUPA 3VBOA 1Y7BA 4XIOA 4M4RA 4BH9A 4FXKB 1OSGA 3LGRA 4XILA 3VBRA 2DVAA 4K1YA 3AMHA 1GQGA 1ZBE1 3HQRA 2ZOEB 3RWNA 5C8WA 2J22A 2TEPA 2XQRA 1JYNA 3Q8EA 3AK0A 4CEYC 3OGJA 1YIFA 5JVVA 2ZEWA 5A1LA 4B1LA 2VG9A 2Y0IA 3PU3A 2QQMA 4RHV1 4XDOA 1IPSA 5LRSA 2VO5A 1PVC2 4IXLA 4E4SA 4XFBA 3N9NA 4L99A 1O5LA 1H0BA 1K12A 1QDOA 1SG3A 1Y9MA 2E9QA 1S0IA 2ZAHA 1TG7A 2XLFA 4AFAA 2A1XA 5HCAA 4COZA 3J4UH 4AFDA 4ZZ8A 1TME2 1WWYA 3ZFFC 2JDKA 2VOWA 3ROUA 5LEKA 5EP9A 4B4RA 2BVBA 1LECA 3CO2A 3KS7A 3IIAA 4FOQA 2QFEA 2BVVA 4IETA 4K9SA 3WQ7A 5C5TA 1OD5A 2WNUC 4H7LA 3WHTA 1O3SA 1EYBA 1U5XA 3NV1A 3FUQA 4LR4A 2FDJA 1O4ZA 2W3JA 4D94A 1A6CA 1IPJA 2EIBA 4QDSA 5JLVA 5JCTA 1O4TA 1AZDA 2ARXA 1WW6A 1MS5A 2ORZA 1HRI1 1CVNA 1HX6A 3T30A 3NQHA 3VZOA 1QNWA 3H8UA 3A0NA 4DB5A 5KR7A 3WQ1A 1REEA 4MGIE 5IYYA 1MEC2 4EE2A 4QHOA 1LHWA 1OI6A 3K4AA 3KWVA 2NQYA 1IS5A 4C90A 4LJHA 1G9BA 1G86A 2ZMNA 4OLLA 1H4GA 5DDJ3 5FZ7A 5F3IA 1NA1A 2G9FA 3OYWA 4LPLA 5FPAA 2DTWA 2E51A 1PO12 4EWDA 1AR63 3N9MA 3AMNA 2RM23 3VUOA 1DDLA 1R1A3 1DIWA 1WKYA 4I2OA 1ZRRA 2IWGB 1GUIA 1W8OA 1YCIA 3BU7A 5F6KA 1JZ4A 1LEDA 1AR92 2HJIA 5G05L 3MPBA 4E4ZA 5FUPA 2QVSB 1N1VA 1GYKA 4HPKA 1V6OA 4RS5B 4MXVA 2GN7A 1Y43B 3FWEA 1OMIA 4CDQA 4PDWB 2ZKLA 4LUKA 4HETA 4AEDC 3ZXJA 5A7PA 3ZSJA 2W52A 1EAH3 3JB8A 3PUHA 1RYYA 3E5XA 3K4ZA 3B5LB 1N3PA 2RS31 2H6CA 3MIFA 4QX5A 5IWFA 2L9LA 4LULA 3VDDA 3AC0A 5LBFA 4OQ8A 4F8AA 4B8EA 1R081 1W6NB 2WZR3 1ND3C 5FZLA 1UPSA 2WA4A 5JDBA 2W68A 2YDEA 4MSVA 4LBKA 1MR5A 4N90A 1FT9A 1TME3 3U11A 3JB4C 1OH3A 3WF3A 4Z1VA 1LCLA 2HWF3 1HV1A 3SH3A 4WBBA 1XYPA 2B39A 1KGYA 3NNGA 4IEQA 3VHOA 3WOGA 4YZ2A 3CDZB 2XH6A 1TQ5A 2QNKA 4MGKE 2WO3A 2RS53 3NAPB 2ZMKA 3OTFA 4BQ4A 2OX0A 3O0WA 4QD2A 1LOEA 5A1FA 3WNMA 4FPJA 1QJU2 3CU7A 1NCQA 3K46A 4XTMA 4AI3A 3E1F1 2RS13 2R043 2VCAA 1YFUA 5T54A 4RFRB 2ADDA 3I2OA 2P1BA 3TN91 2WABA 2DFCA 4MADA 4BQXA 1W6MA 2VMEA 1LOCA 4F83A 1AR73 1YXWA 4I01A 3AZWA 4BIOA 5ABJC 2HWE2 4YNIA 4N9IA 5EJ1B 1GOHA 2PHXA 5CKMA 2ETEA 1GICA 5F5CA 1QQP2 1PO13 3GBFA 1JS9A 3AFGA 5F3CA 4EQVA 3VBSA 2JDMA 1NY72 3CHXA 4JKLA 1URXA 2GP5A 3ILFA 3DPRA 2VULA 3LPFA 4GB32 3ACHA 2VMGA 3THCA 2WZ8A 3S30A 3SNMA 2P4EA 1AR93 3ES1A 3WDWA 3MIBA 3ZFGA 2P17A 4NMIA 4QPWA 3N9LA 3VBOB 4PIZA 3HJRA 3PJQA 3VBRB 2Y6JA 3H1YA 3DCQA 2Q1ZB 1XOYA 2ZACA 4QXBA 3ZYFA 5A7SA 1UL9A 2V09A 1ZVFA 1F31A 1U5ZA 3H7JA 4H3WA 5FYYA 3HIFA 4KU8A 5EZWA 5FR3A 4LBMA 1MQTA 2VR4A 3WW2A 4RN5A 4W8JA 1TMF2 2PYTA 5HCFA 1M4WA 5CFCB 1RUE1 4P08A 3VL8A 3ACFA 4P5YA 4Z82A 4DEQA 5H9RA 2AH2A 3U4SA 1BHGA 1WCUA 1DF0A 5DABA 2Q5TA 4MVTA 3MIGA 4LITA 1BEV2 4XCBA 4AGVA 1BBT1 4KNCA 4K8RB 4CXXA 1VBE1 4YM0A 1ZA4A 1MS4A 1DFQA 1JU4A 3OJBA 2ZX2A 3ST7A 1YQ2A 3SCGA 1VBC3 2OYZA 2UU8A 3AB0A 4ATFA 5FMCA 1W6QA 1IQAA 3TEZA 5LZ6A 3C7OA 1XSQA 3ACLA 4OHZA 4INDA 5BNNB 1ZRDA
chains in the Genus database with same CATH topology
1BKZA 2ZX1A 5CAZA 1VALA 1WBLA 2D7FA 3RJRA 4CP1A 1AYN1 1D2SA 3DL3A 3ZFEC 1COV1 4Y26A 3GHMA 4XF0A 4E2QA 1QF3A 2ET1A 4XDQA 5BNOA 2HWE3 4G4FA 4P9XA 4QGNA 2PA7A 2EXHA 3MLJA 1NA1B 1OFSA 2PTMA 3OYWB 1QQP3 2YZ4A 2A70A 1OLQA 2X53S 4PJYA 1H8TC 3R4DB 1I6XA 5CG9A 1RUI3 1QXPA 3KZ4C 4ASMB 3WY6A 1EY2A 4B29A 4HPKB 2FZ2A 1KS5A 4HFSA 1TE1B 2VW2A 2DCKA 4BLIA 3MIDA 5FO8B 4JRLA 2Q4SA 3AZZA 4QQLA 1AL0G 4XF1A 2HWC1 1CESA 1ULDA 3M3OA 1BEV3 1GZWA 1VBD1 3IPVB 2JX9A 4Q4V1 4JTOA 1RHI1 4BMBA 2XVKA 1CJPA 2ZZJA 1JUIA 4IEOA 4WVWA 1UU5A 3PMEA 4HMZA 4IEPA 4YW5A 4AQSA 2OUJA 3WDVA 1QHDA 3LCPA 4AHXA 4AGRA 2CWMA 1CJDA 4A7YA 3HT1A 2DVBA 5CFCC 3THTA 5E8AA 4P9WA 4YVSC 4ZU4A 1O7FA 4N43A 4OUSA 5LK5A 4YG0A 1AYM1 1HW5A 1G9CA 2XJPA 1OOPC 5FFOC 2E53A 4EROA 3W9AA 2JG8C 4ITCA 2YGLA 5CG8A 3QH6A 4LO6B 5BNPA 2XBO1 2VGDA 3ES4A 1UZYA 1PVC1 2DURA 4RR3A 3NO8A 2WC2A 3OPZA 3DPRB 4KWKA 1ENSA 2BW8A 2Z69A 1I1EA 3EQEA 2MPFA 3WG2A 5KXEA 2PAKA 3WHUA 5BNNC 1CX4A 4JQRA 1HV0A 2UY8A 2R063 1AJOA 5JAXA 2TBVA 1POV3 2XL9A 4WVVA 3UK9A 4P9JA 2D44A 3VKFC 1MQTB 2BYVE 3VBHC 4XOGA 1U5YA 1OHFA 1NCRA 4HN1A 2MEV2 1PGL2 4R9DA 1VBA1 1RUJ3 3TBDA 1ZRFA 2DCJA 4ES9A 1RUC2 2D3RA 3DN7A 4URTA 5ACA1 2D40A 2D6PA 3CJIC 1BQPA 1UW8A 2O0OA 4GIQA 4LBNA 3TOJA 4XQ4A 3RMXA 4COUA 1R1ZA 1NE4A 2PLV2 5IK7A 1V6NA 5J09A 4I02A 1JHNA 1LOBA 1W6QB 4Z07A 4WM7A 4FSJA 2DTYA 2YUEA 5DXDA 4KU7A 4KG0A 3MF9A 4FP3A 3OY8A 1QWRA 5JPMB 1RIRA 2WFF2 2VNRA 2IXJA 2QE3A 3BB6A 4PBPA 1LGCA 3TNQA 1NQJA 4C1XA 4PLMA 1S55A 2VNOA 4ISQA 1UZZA 2GC3A 4QPGC 2VUAA 5BNOB 2HWB2 4NVPA 1LULA 1J1LA 2NP0A 1MVQA 5F5QA 4TSVA 4CEYA 1FATA 1LR5A 1PK6A 3IWZA 4BM8A 2WT1A 4WM8C 2ES3A 4EWAA 4H55A 4FTBA 1DZRA 3IMNA 2GH8A 1SLTA 2A6WA 2VOVA 4I3PA 2LTNA 1ENQA 4YG3A 4GALA 3GBGA 2RR12 2ZABA 1OQ1A 4LHKA 3ZFFA 2FHRA 5HI0A 3AMPA 5F6LB 1G8WA 2DF7A 2X29A 1DQ2A 1VBB3 1BYHA 1RGSA 4IV1C 1OFNA 4ZXKA 3CF6E 5AFEA 4BWOA 1AL22 1EPWA 2WNUA 2P3IA 4TYSA 1RUC3 3CL1A 1GZWB 4AVSA 2H0BA 2PN5A 3OD0A 4P9IA 3LSDA 1H1IA 1V6KA 2AENA 2N7GA 4XFFA 4OI0A 1RINA 1RJ8A 2ZMLA 1Z7S1 1FMD2 3V0BA 1NXD1 2GAUA 2WLPA 1F8VA 3CEWA 5IK8A 5FOJB 3E5QA 2D6MA 2RHPA 2PHTA 1OA3A 2QZ3A 3WX5A 5A32A 2WFF3 2B45X 2IXKA 3DKWA 4GB31 3D4KA 4U36A 4LA3A 1FV3A 5T50A 5L36A 1X33A 1NLSA 4HK8A 3RI9A 4X8PA 4N43B 3MLLA 3QBQA 5L7OC 1WMEA 3S7EA 2HWB3 2XLGA 4KH9A 2IXLA 2BEOA 2XJRA 4EN7B 4QU2A 5BPXA 4AEDA 1ZBE3 1TMF1 2H6BA 3BTAA 4EWEA 5BNPB 1MS8A 2IFRA 3R0RA 4BHPA 4I30A 1S0BA 2VH9A 3APBA 3PJYA 4P9LA 1ND3A 2UWCA 5C33A 2VW1A 4A2UA 2ZHMA 2RR13 3FFZA 3H0OA 1U5IA 3IM0A 3ZSEA 4E27A 4FT8A 4LBQD 2JG9C 4K3UA 5T3NA 2FMDA 3I4IA 1NCRB 1YLLA 3TAYA 3AP6A 3M1HA 1ZZBA 5FMOS 3MPPG 1RUOA 5HCBA 1AVBA 2Q1MA 2D6NA 3TRSB 5LEJA 1FMD3 1Y3TA 4Y1YA 2EF6A 3ZYPA 4QQOA 4RSUA 3MEPA 4BCUA 5GZDA 2UWAA 4XXPA 4YM2A 3UL2A 1F5FA 4FOWA 3HD8B 1RUF2 4FAGA 3AM2A 3LKJA 4XW3A 3BPZA 1BVVA 3J9SA 2EVXA 4QQ2A 4BLJA 5ABJA 4LA2A 3OY8B 4MXWA 3R4UA 1CR7A 4C0HA 2K2SA 3ILRA 4A3XA 2DUOA 5FQ0A 3ZXLA 2A6VA 1SMVA 2WL1A 1UKGA 3HBZA 3ILNA 4Y1UA 3VHNA 2Y0OA 3MZHA 1BJQA 1Z78A 4Q4X1 2RE9A 4YW3A 4AWDA 4J6GA 5T55A 3WXPA 1KDMA 3B9CA 3ENRA 4CEYB 5EYXA 4QGMA 4OI4A 2B7YA 2Z42A 4AVCA 4UW5A 3ZXAC 2PFWA 4OHYA 1FPN1 5EXOA 1KXGA 2PHFA 3OBRA 1Q8SA 3ZYIB 4IV3C 4Q0QA 3ZFFB 2R32A 5CA6A 3JZVA 3AKRA 5C4WC 2D5HA 4LE3A 3ZXKA 4FPLA 3HT2A 2DCZA 3RRDA 3FBYA 4KG8A 2WNUB 5T5OA 1JXNA 1DYKA 3PTYA 4Z8BA 4EJRA 3PMSA 3WINE 3M2MA 2R0HA 4D3WA 3UJOA 2JJ6A 3J26N 4XE9A 1Z0HA 2DVDA 1ASJ2 3ZFEA 5EJ3A 1ZZ8A 3MIHA 3TYJA 1SLLA 2ARBA 4UBGA 4NN0A 4TLFA 3TN93 5HXVA 2EIGA 2ZJCA 4OI2A 1MZEA 3ZIWA 1W0PA 4XFAA 5CFDC 2VVDA 3LAGA 3WP6A 2CAVA 4Q2FA 2YXSA 5A32B 1H9WA 1U0AA 1H8TA 2XKPA 1VJ2A 3RI8A 2HEYF 1D4M2 5JPNB 2QQPA 3KSCA 3LOBA 1S1AA 4FPCA 5KXBA 1OLRA 2GN3A 2LALA 4ORFA 4XEZA 5I91A 3NW4A 3ASIA 3HQXA 5FREA 2ATFA 2E7AA 4AEDB 2Q8OA 4D7TA 5JIUA 3AYAA 4RD7A 2B8MA 1WW5A 3MDPA 1W6OB 1RUE3 2B46X 2R30A 3MW2A 4Y24A 1ND3B 1QMJA 1VP6A 3IDBB 1O3QA 4IL7A 4O9EA 1AR62 3WT3A 1AR82 3HR9A 2RM22 4W6YA 2PLV1 1XU2A 3IKWA 1X82A 4D69A 3N36A 1YRZA 1LHOA 4LEJA 4X6QB 3W59A 3JBG1 1ZREA 2JD4A 1LOFC 1QJY1 4BYYA 4LO5B 2W08A 2KXLA 2BNNA 5CFCA 1EAH2 2QZ2A 1PIV2 5D8AC 4YVSA 1ASJ3 2I07B 2PHLA 1FI2A 2ZGTA 2WZR2 1UKRA 3SITA 1COV3 2OA2A 1LGNA 1DLLA 1DQ6A 1OOPA 3ZN5A 2LUWA 5ABJB 1XRUA 5FTTC 2JG8A 2HWF2 4MXWB 1BVP1 3B7MA 4OHXA 5H9QA 5AC91 3IN9A 1REFA 5FQ0B 5CBLA 1D4M3 3EHKA 2RS52 3M3QA 4ISRA 3EO6A 1YFXA 2WSUA 2EALA 5BNNA 2AREA 1DHKB 4R8HA 4HKWA 4RFT0 2CL2A 4ZU5A 2BQPA 1O5UA 2RS12 3LB9A 5DZFA 2R042 5JZGC 2GALA 2MNGA 3I8TA 5FBZA 3VBHA 2WT2A 4IEWA 1AL21 4DXZA 1AR72 1HKDA 5FO7B 4AEJA 1UIJA 1WD4A 2HWC3 4Q1PA 1H2LA 2VQ0A 3CJIA 4AGGA 1EV12 3JQWA 4EN8B 3IT8A 1S2BA 1AR83 3ETQA 2WFPA 1GR3A 1YJKA 3N7LA 4JGYC 3T2TA 3D6EA 1M06G 1RHI3 4FCAA 2R071 4PCRA 1AUYA 4HSLA 4L9BA 2CNAA 1QOTA 4EV0A 3WDTA 3ZIXA 2ET7A 4LHLA 2A5ZA 1RTVA 1ULGA 3ZDSA 1PIV3 3ECQA 1F2NA 1AX1A 2WNVC 4YYOA 2OPKA 2CGOA 2PHDA 3ZFEB 1HXS1 3E6CC 3ME2A 4LBQA 4QMAA 3RZZA 3VBUB 1O3RA 3IPVA 2W39A 5FRAA 1N1YA 3O0XA 4QPGA 1FOD1 1HRV1 2ILMA 4GMP1 1LHNA 1RITA 4HL0A 4CDUC 2WNEA 4NWWA 1VBC2 5CIRA 1YWKA 1H8TB 4WM8A 1UD1A 5LRRA 4CDXC 1HQNA 3LWCA 1V9U2 2B9UA 4LUMA 4AQTA 4WV8A 5JMCA 2XJSA 5KWRA 1J59A 2D43A 2AZ5A 4NHKA 1JW6A 1BXHA 2VW0A 4JAAA 1UPIA 2WS91 2XB6C 2Z79A 3RG0A 1IS6A 4YFZA 2YMZA 1D2QA 4N9HA 4E2SA 1PZ9A 2ZGPA 4TWTA 1VRH1 4RGAA 4IV1A 4Z92B 4OVEA 3FMGA 3JUUA 4Y1ZA 1H2KA 1W0OA 1VLNA 2ZGLA 3FFQA 3G7DA 4HKOA 5T5LA 1VBA3 3M3IA 1DQ0A 1EV13 5SV8A 1AX2A 3H50A 4AFMA 3AYCA 1RUI2 4W6XA 4XJAA 4KWLA 5GLTA 3ALQA 5EYYA 1VAKA 1ND2B 1PNFA 1VAMA 2JE9A 4K7JA 4MLOA 5FLJA 5H9PA 5JSRA 2PHRA 3LA3A 2D5FA 3ZMOA 2ZS6B 2PHUA 1SLBA 5JR7B 4BZ4A 4YGCA 3HWJA 4YVSB 3PVEA 4FPFA 5FLIA 3CJXA 5L7OA 1JOJA 1R092 3MGUA 1AJKA 1BMV1 4KQ7A 1OOPB 4IEYA 1C3HA 2NPIA 3AKQA 2JG8B 1C8M2 4M01A 3M3CA 2B42B 4Q4W2 1V9U3 5K7PA 3LA7A 4UW4A 3WW1A 4L2NA 3OD4A 3R6SA 4LBLA 2VQAA 1TEIA 3THPA 1DU3D 3MFCA 4AI0A 4ZU7A 4AI8A 1Q43A 2C0ZA 4HLTA 2P3JA 4FBFA 2HWD3 4QM9A 2JG9A 3VBUC 2GMMA 3VBHB 3VL9A 5K0UB 4I0WB 4IEXA 2JXAA 4AVTA 1QJZA 4LT5A 3RPQA 5F1RA 2ZGOA 1IS4A 3AX4A 4JV4A 4N53B 3VHPA 4WZCA 2YHJA 3AP5A 1CAVA 3CJIB 3USUA 5JWPA 4IQPA 2XWBB 3I59B 1MS9A 4XHBA 3SHRA 1LHVA 2A7AA 4DFSA 2JENA 1Z7S3 4XFCA 2R062 1KJRA 1I9RA 3WP3A 3UJQA 5BV6A 1RUD3 1FV2A 5BNQA 5GZCA 4Q4Y2 4UXAA 5JSOA 3RYRA 1DQ4A 3IBMA 3GBWA 4GKYA 4CDWC 5CB7A 2DFBA 5KHKA 1RUJ2 4XF3A 3H7YA 1RUG2 4LBQB 1R093 4HT1T 4C91A 2GZWA 1V6MA 4MZUA 1O3TA 1AX0A 1Q8VA 4FOYA 4QPGB 3SCFA 3ZVXA 4GXLA 4XETA 3NJZA 1W6PB 1C8M3 3ZYJB 3J8F1 4PQ9A 1D4VB 2BTVC 1RB8G 1B09A 4Q4W3 4JGZB 4WM8B 1J3PA 5E1RA 1ND2C 3LZZA 5GZGA 5DDJ1 4G3YC 3WDUA 3V56A 5I0SA 2Z5WA 1RVF2 1ZM1A 3KCYA 1RUH2 3UKNA 1Y9QA 1C1LA 4AI1A 2RM21 1R1A1 4IV3A 4LTAA 3KMHA 1YHFA 2XL7A 4QT6A 1YFYA 1RL3A 5C4WA 4L11A 3JD72 1RMU2 5GLVA 1OPOA 4IV1B 3ZN6A 3ZYGA 2X5IC 4AQ6A 1J1TA 1FAYA 2JICA 5J96B 4UBHA 1EAH1 3MIEA 3AYDA 2NMNA 2ENRA 4GQ7A 3V64A 2XVGA 1NZCA 2WZR1 4MUVA 1F5JA 2TNFA 3WP4A 4JTNA 1TME1 1GKBA 4Q0VA 5SV5A 1YFWA 3WG3A 3INAA 2HWF1 5CFDA 2A6XA 4Q4Y3 1LJ7A 1PZ8A 5B2GB 3WNXA 1VBB2 5K0UC 4P14A 2RS51 2RMU2 1GFF2 3U0ZA 1X36A 3GALA 4COYA 1PO22 4H14A 1WD3A 3UKVA 1RUG3 4N53C 1JN2P 2A73B 2D98A 5L7OB 3TWIA 4XFGA 3WCRA 1QXRA 2R041 2WT0A 1WW7A 4Q4X3 4DINB 3WVJA 3H3ZA 3ZX7A 3VBFC 1QY4A 1MEC1 4YSFA 4QQPA 4YW2A 5JI7A 4WZFA 1A78A 4Q8LA 4J1XA 2I2SA 1BCXA 3B69A 3PLQA 1RVF3 4FP2A 4K6BA 1RUH3 3U10A 2GDFA 1PO11 1QJX2 4YRDA 1FPN3 2OUHA 3MLKA 2WKKA 1CAXA 2ZGQA 1AR91 3BODA 1G9AA 2UYBA 1OQDA 2B5HA 3JD73 2JG9B 1RMU3 3LA2A 2ZGSA 1MACA 2QCSB 1DGWX 3O12A 1OKQA 2CY6A 4JDNA 1A8DA 1LOFA 1WMFA 3JCIA 1ZBE2 4K1ZA 1CAVB 1Q5OA 2IXHA 4JGZC 3USUB 1POV0 5D8AA 3RJ2X 2HKXA 2CAUA 1K5MB 3FZ3A 2PHWA 4P9YA 1X50A 3VDDC 4BQ1A 5JOWA 4RHV2 5I8SA 1KFUL 2C5DA 4XHXA 4AQ2A 1T6GC 2XJTA 5F9TA 5JOYA 4XJWA 5DUWA 3VN4A 3AXEA 1ZBA3 5C8CC 1VBC1 4QM8A 1KDKA 3P3PA 2QUOA 2RMU3 4GH4C 4XF9A 4AVVA 3GF6A 1PGSA 2PAEA 1PO23 3OBTA 4B7KA 1GNZA 3PVBB 4QXKA 5KC5A 2F6BA 1QJU1 1CPNA 1LOAA 1V70A 2O8OA 4YARA 1LHUA 5JZGA 5CNAA 2CGPA 4Y4YA 2NMOA 1IS3A 4DZGA 1HRI2 1G9DA 1ZZ9A 4MH0E 3QOPA 3OCPA 2HWE1 4YZ4A 4C1WA 1XE7A 2A6ZA 4HSJA 4AW7A 1RJ7A 1NG0A 1QQP1 1QJX3 4XF4A 1Q56A 1OA2A 3VZKA 1NY71 4AFCA 2XUMA 5T52A 3ELNA 4EN6B 4JGYA 4IV3B 4PIYA 3ZPYA 3WDXA 5C4WB 2NYYA 5GLZA 4UW3A 3POWA 4COVA 3L2HA 4XJUA 3ZN6B 4QQHA 2VXRA 1GSLA 3AKPA 3AYEA 2KA3A 2ZZQA 3JBG3 1QJY3 2DCYA 5KC6A 2WNVA 1W6OA 3V0AA 5J98B 1BEV1 4RHV3 2ZHKA 3NV2A 4Z2WA 1LENA 2VY0A 1R082 1PNGA 3WG1A 5CFDB 3NL1A 4AYUA 5GZFA 4CDUA 2HEVF 1B35C 2GMEA 4UW6A 4HN0A 2WWSA 4CDXA 1NLRA 3EBRA 3M70A 5DG2A 1G7YA 4FQ4A 1N47A 4LE4A 1HQLA 4CRQA 1XNCA 2ZKNA 1XYOA 2ZX0A 3SH5A 3RNSA 4ATEA 3V65A 2EXJA 1K5MC 1WW4A 1HRI3 1WUVA 4OULA 3B3QE 4YW1A 2D6OX 3MW3A 3PVNA 2A3XA 3TN92 5L19A 2A75A 3BOWA 1H2MA 1ZRCA 1ZZCA 2D3SA 1CAXB 1C8NA 3C2UA 2XPJA 4HBNA 2R061 1HQWA 2GC0A 5L73A 2R073 3NVCA 5BXXA 1Q3EA 1CAUA 1GLHA 3AFKA 4FPHA 4ONUA 2ZAAA 1CONA 1D0HA 3NWKA 4W65A 4COWA 4IEVA 1X8MA 1ZX5A 1JUHA 1RUJ1 5D8AB 1A8MA 1PM7A 4AVAA 1RUE2 3USSA 2VMIA 2RS33 4YM1A 3M3EA 4Q27A 3QACA 4Y22A 1R083 1G9FA 2FZ1A 1NQDA 4KWJA 3IDEA 2EAAA 3E97A 5D1IA 2QJVA 2VOKA 1BBT2 3ZXGA 4AE2A 1FOD3 1SACA 1VBE2 4GMP3 4QHBA 1SBFA 3BALA 1H1AA 1SEFA 2GMPA 1C5HA 4NR1A 4MX3A 4YW4A 1ZZ6A 4YVWC 4QPIC 1MS0A 4MV2A 2WSVA 1DGWA 1ZZ7A 2EAKA 1DGRN 3KM5A 1J3QA 4KGQA 2HYKA 4XMAA 3VZNA 1JYCA 1S0GA 5FPXA 3ZXDA 5J3UA 1ULFA 5JZGB 5I8TA 2GNDA 5GZEA 2E7QA 4DS0A 4CEWC 2DUQA 3VBUA 1SDWA 1AYN2 1GNHA 1VRH3 2K0GA 1COV2 3N7KA 1DQ1A 1AHSA 4META 4YZ1A 1FYUA 3KGLA 1H4HA 5A3LA 2A3YA 1BZWA 4Q0PA 1QXJA 4RQPC 1NYWA 4JGYB 4PF5A 4SBVA 2I74A 4AK3A 1N1SA 1DBNA 1MS3A 3E6BA 1WGPA 2IXIA 4BMEA 2G9GA 3VLBB 4M3CF 2CGNA 4GULA 1KFXL 1VBB1 1TNFA 4YM3A 4I3GA 1UMZA 2MEV1 1PGL1 2VPVA 4CDWA 1FNZA 3G6JB 4DRRA 2ZGMA 2YV8A 4FTSA 2WNVB 3V0AB 1ENXA 2JEMA 1C4RA 1RUC1 3FLTA 4GKXA 1DZTA 2JKBA 1I5ZA 4Q8KA 2HWC2 4XBLA 4AI2A 2UWBA 1FNYA 2V5YA 1DQ5A 5I8YA 2JE7A 1VBD2 1BBT3 4Q4V2 4Y1VA 2XLAA 3D5OA 1RHI2 1VBE3 4CDUB 4E9KA 4BIFA 3IDCB 1HDKA 4YGBA 4CDXB 1ND2A 1ULCA 1GANA 2P3KA 4DY3A 5E16A 4S2FA 2Q0AA 1MZ5A 2WFF1 2Z2SB 3I2DA 4H7MA 4Q26A 2WINB 3WW4A 2C1FA 1A3KA 2OIIA 3WUCA 3WLUA 3I7DA 1AYN3 2HWB1 3QLQA 4IERA 3ZYRA 2X5IA 3JU9A 5C9AB 2R0FA 1UU6A 1MS1A 1AYM2 4FPYA 3D8CA 1PK6C 2BWCA 2D3PA 3VZLA 1HLCA 2XBO2 4B4QA 4FAHA 1CQ9A 2RR11 2YYOA 4OZXA 3M4FA 3FLRA 3M8LA 1CAUB 4LNVA 2BBVA 3VGIA 4Q1RA 3RSJA 1Q8QA 3O14A 5DUXA 4D7SA 1SCSA 5K0UA 3B01A 2WZPP 3T1LA 3AP9A 4N53A 4X6RB 2EXIA 3N3HA 4MYEA 3URFA 1VBA2 4Y22B 2ZGKA 4L92A 1VBD3 3P3NA 1SFNA 1FMD1 3WCSA 4Q4V3 3I59A 3LSEA