1MQTC

Swine vesicular disease virus coat protein
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
238
structure length
238
Chain Sequence
GLPTLATPGSNQFLTSDDFQSPSAMPQFDVTPEMDIPGQVNNLMEIAEVDSVVPVNNTEGKEMSIEAYQIPVQSNPTNGSQVFGFPLTPGASSVLNRTLLGEILNYYAHWSGSIKLTFMFCGSAMATGKFLLAYSPPGAGAPTTRKEAMLGTHVIWDVGLQSSCVLCIPWISQTHYRYVVMDEYTAGGYITCWYQTNIVVPADAQSDCKILCFVSACNDFSVRMLKDTPFIKQDNFFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprotein
publication title STRUCTURE OF SWINE VESICULAR DISEASE VIRUS: MAPPING OF CHANGES OCCURRING DURING ADAPTATION OF HUMAN COXSACKIE B5 VIRUS TO INFECT SWINE
pubmed doi rcsb
molecule tags Virus
total genus 39
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 2002-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1mqtC00
1VBA1 4RR3C 1RUJ2 1CD3G 1NA1B 2RMU2 5C4WC 4CDUC 2Y26A 5L7OA 2HWC3 2WFF1 2GH8A 4RR3A 1PO11 1TME1 1AR63 1VB4A 5C4WA 4CDUA 4IV3A 5AC92 5BNOB 5BNPA 1B35B 4IV1C 1HRI1 1RVF2 3VBUB 1AYN1 1CJDA 2HWB2 5C8CC 3TN91 2RS13 3J8F2 4IV1A 3ZXAC 2WS93 4N43A 2WZR1 5C8CA 1VBD3 2RS51 1VBB2 1GFF2 1PGW2 2R042 1RUE2 4WM7C 1QJU3 5A33A 4CEWC 1NCRC 1QJX3 2R071 2X5IA 4GB32 5DDJ3 1BBT1 3JD73 3JB4C 1V9U1 4CEWA 1NA1C 1IHMA 1NCRA 4AEDB 1QJZA 1POV0 5BNNB 1Z7S3 1ZBE3 1K5MC 2RM21 2RS32 1FMD2 1NA1A 1ND3B 1ASJ2 1FOD1 1R093 5BNOC 1HQNA 1HXS1 1RUH1 1EV13 1B35C 2TBVA 3HAGA 4CEYB 1F2NA 2PLV2 4Q4W3 1RUG3 3VBUC 1D4M3 2VQ0A 4PDWA 2WS92 5BNOA 4Q4X1 2XBO1 1TMF1 1RUF2 2DF7A 2BFUS 1RHI3 5FMOL 1OOPB 1AR92 1COV1 5ABJA 1ND2B 1AUYA 1WCDJ 4QPIB 4RS5B 1AYM2 5DDJ2 1H8TB 1PO21 1RMU3 5C9AB 3ZFEB 1R1A2 5BNPB 2FZ1A 1DDLA 1Z7S2 1ZBE2 1RUI2 4AEDC 1EAH2 1RUD3 5BNNC 4Q4Y1 1POV1 1QJY3 2RR13 1ND3C 1PVC1 4AEDA 4Q4V3 5A32A 1D4M2 4CEYC 4FTSA 1W39A 5D8AB 1PIV2 1VBA3 5A33B 4RQPB 4YVWA 4LLFA 1VBC2 2QQPA 1ZBA1 4CEYA 2WFF3 4N53A 2X5IB 2HWF1 1FPN2 1PO13 1TME3 4NWWA 3VBRB 1OOPC 1VRH2 5FMOS 1RUJ1 1HRI3 4RS5C 2RMU1 1AYN3 1OOPA 4IV3C 3TN93 5C9AC 5J98B 3ZFEC 1ND2A 5ACA2 1SMVA 5BNPC 4QPIA 4RS5A 5JZGB 1RUD2 3NAPB 2WZR3 1H8TA 5AC91 2RS53 4PDWB 5C9AA 1AL21 3ZFEA 1VBE2 4BCUA 4RFT0 1RVF1 2HWD1 2HWB1 4FSJA 4N43C 3IDEA 5K0UB 1MEC2 3J8F1 2R073 4JGZB 4QPGA 5ABJB 1BBT3 1QQP2 1AR72 1V9U3 1VBB1 1PGW1 1OHFA 3VBOB 2R041 1RUE1 1R082 2R061 4FTBA 3JBG2 2X5IC 5D8AA 5FOJB 4RQPA 2RM23 1F8VA 4CDWB 3VBRC 4RHV1 2MEV1 1FOD3 2WWSA 4GB31 1VB2A 1HXS3 1RUH3 2BPA2 2HWC2 5CFDB 2ZZQA 3VBRA 5A32B 4Q4X3 1AR62 2XBO3 2HWE1 1TMF3 2RS31 1FMD1 1ASJ1 4GMP0 1PGL2 5GKAC 3NAPC 4CDQB 4YVWB 4PDWC 1AL0G 1C8NA 1COV3 2PLV1 4N53B 3VBFB 5JZGA 1RUC1 2RS12 2ZTNA 3NAPA 1PO23 5K0UC 1E57A 4YVSB 1RUF1 1VBD2 4JGZC 5ABJC 5CFCB 4WM8A 5K0UA 1AR91 1QJU2 3VBOC 4JGZA 4Q4Y3 1AYM1 1POV3 1BMV2 1QJX2 1PVC3 3VBOA 1BEV1 3VBSA 1R1A1 3JD72 1RUI1 5CFDC 4CDWA 1EAH1 3DPRB 5J96B 1ZBA3 3ZFGA 1M06G 4QPGB 2HWF3 5CFDA 1R092 1EV12 4CDQC 4GMP1 4YVWC 3ZFFB 4Q4W2 1RUG2 4N53C 1PIV1 1RUJ3 4CDQA 2RMU3 3S6PA 1HRV1 1VBC1 4JGYB 1OPOA 3VBFA 1RHI2 1C8M1 1FPN1 1AR81 5CFCC 2GSYA 1NY72 1VRH1 5AC93 4YVSA 1AL23 1X33A 1ND2C 1RMU2 4QPIC 1RVF3 2HWD3 5CFCA 2HWB3 3CJIB 1H8TC 3J8F3 5ACA1 4CDXB 4WM7B 1VBB3 1QJY2 1VBE1 2RR12 1MQTB 3DPRC 2R043 1RUE3 2R063 4Q4V2 4QPGC 3JB8A 1MEC1 3DPRA 4WM8B 3ZFFC 4RHV3 1VBA2 2MEV3 4GB33 3VDDB 1QQP1 1AR71 5D8AC 2WFF2 4RQPC 1K5MB 3ZFFA 2WLPA 1R081 4JGYC 3JBG1 1PO12 1TME2 3VBSB 2HWE3 2RS33 1FMD3 1AL22 1ASJ3 4JGYA 1HRI2 2HWD2 4GH4B 1AYN2 1A6CA 3ZFGB 2PLV3 2HWC1 3VBHB 2BBVA 3TN92 4Y4YA 1RUC3 1NOVA 3CJIC 2BFUL 1AR61 1RUF3 2WZR2 2RS52 4CDXC 1PGL1 5JZGC 3CJIA 2R062 1AR93 1MQTC 1HX6A 4CDXA 2RS11 1AYM3 4RHV2 2MEV2 2R072 4WM7A 2WS91 1MQTA 4WM8C 1BBT2 3M8LA 1BEV3 1VBD1 3VDDC 1R1A3 1V9U2 4SBVA 1RUI3 1QJU1 2HWE2 1EAH3 1VAKA 3VDDA 2RM22 3VBSC 1BMV1 1QJX1 1FOD2 5DDJ1 1K5MA 2IZWA 1HXS2 1RUH2 4NWVA 4GMP3 3JD71 4CDWC 2FZ2A 1RUC2 4GH4C 3ZFGC 3VBHC 1PIV3 1B35A 1Z7S1 1NCQB 1ZBE1 4Q4X2 2XBO2 1HRV3 1TMF2 1VBC3 3VBUA 1X36A 4GH4A 3VBHA 1R091 5L7OB 1C8M3 1FPN3 1EV11 2XPJA 1AR83 3LOBA 1COV2 4Q4W1 1RUG1 1VRH3 4RR3B 1D4M1 1NG0A 4Y5Z0 5C4WB 4CDUB 4IV3B 3VBFC 1PO22 1BEV2 2BUKA 1RHI1 4YVSC 5ACA3 4FTEA 1NY71 4IV1B 4Q4Y2 1VBE3 4N43B 1RMU1 5C8CB 1PVC2 5BNNA 1MEC3 2ZAHA 1ND3A 1HRV2 3FBMA 1QQP3 5LK7B 1RUD1 1RB8G 1AR73 1NCQC 4EJRA 1ZBA2 1QJY1 2RR11 4Z92B 1C8M2 2HWF2 1R083 1AR82 3JBG3 4CEWB 4Q4V1 1NCRB 1NCQA 5L7OC
chains in the Genus database with same CATH superfamily
3RZMA 1CZVA 5EWSA 3T2TA 3M4FA 5A7OA 3ROUA 3KCXA 1NA1B 2R0FA 5BNQA 5C4WC 1JUHA 3RMYA 3L9JT 5CB7A 2HLEA 2Q8OA 2HWC3 4LBJA 3LFIA 3GBGA 4QHZA 5KC6A 4RR3A 1GZ9A 3PJQA 4OHXA 1QOTA 1AR63 2V5YA 2VQTA 4YG3A 3THPA 1N3QA 5A7WB 4B4RA 3A7QA 3I59B 4URTA 3NKGA 1OA2A 1EUTA 5AC92 4MGZE 4QQ2A 1K12A 1A8MA 4LE4A 4NRPA 4QU2A 3WCSA 4A3ZA 2J1UA 5BNPA 4RGAA 5IK4A 2BDRA 5DUVA 1UZ0A 5I8SA 4UW6A 2BWCA 4LQRA 3OUJA 3TEXA 2Y6KA 4GQ7A 1RGSA 2RS13 3RG0A 3WDTA 5LW9A 3J8F2 5EZWA 2WS93 2XHNA 1CR7A 5LRSA 4ASLA 3MICA 2CGPA 4NOTA 3I3DA 1GFF2 1S2BA 2DVFA 2TUNA 4HVRA 1H30A 4HZFA 2PMWB 3GALA 4WM7C 3UKTA 5F3EA 1D4VB 1W2NA 2YHJA 5CU1A 5FP8A 5A33A 1GANA 3IIIA 5FXXA 4ES9A 5DN2A 1XSRA 1NCRC 4AHZA 4JHTA 2CNAA 1ZYBA 3IKWA 2X5IA 5JMOA 3B9IA 3H1WA 4FFIA 4S2HA 2R6QA 2XLAA 5FMBA 2YFUA 3ENRA 4KGQA 2JEMA 3JB4C 4IEXA 4L99A 3PU8A 3WG4A 4TSVA 4D0QA 2ZMKA 1QJZA 3ZX7A 4C0BA 5GLUA 4OHZA 4FPCA 3QLQA 4UF0A 3WSOA 3FMGA 1DHKB 4W65A 2XJUA 3AP9A 2VECA 1J58A 1NA1A 1ULGA 2UWBA 4W6XA 1ASJ2 4AHXA 4H7MA 1FOD1 1UKGA 2ZX2A 5E88A 2IXLA 1R093 2BU9A 4FVVA 4GZ9A 1RUH1 4EE2A 5FWJA 4XOGA 1EY2A 3KF5A 4XUNA 3LEIA 3WP5A 2PLV2 2PQSA 3CZUA 4LXLA 4G9SB 4Q4W3 3VBUC 4LIUA 5A7WA 3FHQA 2YGLA 1OVSA 2ZJCA 1ULFA 2D40A 1QOOA 2DDUA 3HNBM 4PF5A 5H9RA 3ME2A 3MHZA 5F39A 3T1MA 4OYUA 1AX0A 2F17A 2RDSA 2B9VA 4Z07A 3H8XA 1NZIA 1RHI3 3AZWA 2GDFA 1W8FA 3PDQA 4IE4A 1UY0A 2J1TA 1OOPB 3HN1A 1Q8PA 4BQWA 2XJVA 1COV1 2WNOA 3HNYM 5HI0A 2JG8C 2E7AA 1AUYA 4MXWB 4JZRA 1HQLA 1CPNA 2RV9A 3LOIA 2W92A 5C3RA 3O0WA 4D3WA 5DDJ2 4ZS2A 1H8TB 3WEZA 2VG9A 4GIQA 5T3NA 3WUCA 4X8NA 1Y9MA 3CHXA 3AXDA 5D2AA 4QU1A 5T5PA 4S2DA 4Z8BA 1R1A2 3O14A 2BNNA 4HSLA 1SLLA 2DCYA 2ZGLA 2VOKA 2EIDA 4KMQA 1RUI2 4P02B 4AEDC 5FIXA 2FQPA 2Y38A 3IWZA 1RUD3 2K9ZA 1POV1 5FY7A 5FZIA 1QJY3 4XFCA 2RR13 4DUXA 2C24A 3F95A 3K3OA 2R30A 3AKPA 5A32A 1R1ZA 4DS0A 1REDA 1VP6A 3R4UA 5FBZA 5A1FA 3ZSMA 4JC1A 3VHNA 4V2WA 4XAEA 1PIV2 5D8AB 3V0BB 4YGEA 1PZ8A 3UT0A 1AF9A 1ALYA 3BPZA 2VZVA 4LE3A 2FMDA 4IGPA 3N3HA 2EICA 3LB9A 3EMRA 1LCLA 3PUHA 2WSUA 3FHAA 4N53A 4PI0A 4QX5A 5HXVA 3D0JA 4HN1A 5FJKA 1UL9A 3HT1A 1U5IA 1FPN2 1NT0A 5K8SA 4NWWA 1UX6A 4FP3A 4PIYA 1OPMA 4MADA 3POSA 1O8SA 5JR7B 3CJXA 1UMHA 5CNAA 4QM8A 3VV1A 4RS5C 3ZYJB 2RMU1 4CXYA 2JDHA 2VZQA 4ZU5A 5HCFA 1OOPA 3TN93 1W04A 2VZ3A 3URFA 3ZFEC 1SCSA 4MXWA 4AEMA 5KR7A 1OBNA 3MZHA 5CISA 2WZR3 1H8TA 2XKOA 3NV2A 1O3TA 4OFGA 2CY6A 3I2JA 2VMIA 2P6HA 4IESA 3D82A 4XHBA 3MLKA 5A3TA 1WA4A 4TXWA 3N9MA 2OUHA 1YXWA 2VOXA 2HWB1 3K4AA 1Q8QA 4E27A 5EXOA 4META 2V09A 4I09A 4FAGA 5IT6A 4BDVB 2WJSA 5K0UB 1MEC2 2EA7A 4U36A 1O5UA 2R073 4NHMA 4R4ZA 3KS7A 2E6VA 4JGZB 5ABJB 4GWIA 2VMGA 3GM8A 1WW7A 4KU8A 2WQZC 4LA2A 1V9U3 5D1IA 3VD7A 2CU5A 1TNRA 2D3PA 4R9AA 3H3ZA 4XCAA 5HCAA 1J59A 2R041 2QBXA 2YUEA 4N8MA 4MH0E 4V1PA 4FTBA 4XXAA 5D8AA 2ZXQA 5HBAA 1LOGA 4FCAA 5CG8A 2RM23 3SEPA 1F8VA 1KDKA 3VHPA 5A7PA 3WT3A 4OMDA 4IGOA 4XF3A 2B46X 2GH2A 4NVPA 5KHJA 5JDBA 1VB2A 4A7ZA 1JZ3A 3K46A 1DZRA 1GOHA 2Z5WA 4E9KA 4CPBA 2BPA2 4FXGB 1ZM1A 3QOPA 4AGVA 3VKFC 4B7KA 3WF1A 5CFDB 2JE9A 2ZZQA 4KWKA 5FZ3A 3ZXLA 4TTGA 3B93A 3OSDA 1WCQA 4JHZA 3ZSKA 5F3GA 4AGRA 3GNEA 4AVCA 1UAIA 3LKJA 1K3IA 2J42A 2QZ2A 4XBQA 2D6OX 2D93A 4MX3A 4ORFA 5FPVA 3UETA 4YVWB 2JD9A 5FK7A 2RJLA 2VQAA 5IVEA 1AL0G 2ZPXA 4K6BA 2IVIB 2HBTA 4IERA 4Q29A 1RUC1 2K2SA 2VW0A 4NIHA 1IS5A 2C9AA 1PO23 3UJQA 2ZS6B 3ZR6A 1RJ7A 4YVSB 3DECA 1GQPA 4BXFA 1YQ5A 1VBD2 1L3JA 4P5YA 4A6OA 3ATGA 4PLOA 4MYEA 3AVSA 4LNVA 1JN2P 5CFCB 5FYCA 1DQ4A 3IPVB 5JXHA 5K0UA 2YYOA 4IE5A 2A3XA 2GC2A 2VMCA 4JGZA 3LDKA 2WRAA 4Q4Y3 4LT5A 2BGCA 1BK1A 2GN7A 3I3BA 5K4LA 3R0RA 4WVWA 2FHRA 4CYDA 5A3OA 5A6QA 1BK0A 1BEV1 1JYXA 4ISRA 4YW3A 1V6MA 3B01A 3MI8A 4WVZA 2JIJA 2VMFA 2YBSA 5HXMA 4B3NA 3HJRA 3MUZ1 3RDIA 4BZ4A 2OZ6A 3U78A 1LECA 2VZPA 1W2UA 4KNCA 1E5HA 2E33A 5DZEA 5FYUA 1J84A 2GNBA 5CFDA 2WNVC 3WNPA 1ULOA 2W3JA 1O3RA 1EV12 2BNMA 4QX2A 4GMP1 3AZXA 2Y0IA 3Q8BA 4C1WA 4LBKA 4PLNA 1B09A 2WUHA 2G9ZA 1OQDA 1SFPA 1SEFA 3ZMNA 1W8TA 4ATFA 1MR5A 1O91A 4P08A 4QQOA 1QDOA 4I30A 2EVXA 2B39A 4JGYB 2VMDA 2XJSA 2VULA 3IBMA 1OPOA 2W1UA 3ZOIA 1UOFA 2C26A 2ZEZA 1SBEA 1NX9A 3ASIA 3IIAA 4KI5M 4AI3A 1AR81 3ELNA 3J4UH 1UYYA 1I3HA 2VC9A 3LAGA 2LALA 3OCPA 3OUHA 1ZREA 1CIYA 3KB5A 5AC93 2LW8A 3FLPA 4YVSA 4XF1A 3ZDSA 2J1AA 2PAEA 3E5UA 1LJ7A 5EJ1B 4E2QA 2WA3A 4XQWA 1BXHA 1ZRDA 4QPIC 2HWD3 4V2VA 5CFCA 1JZ2A 3IPVA 3SC7X 4FOYA 5JSRA 4XUPA 1YIPA 2QQLA 3ON7A 4GKXA 4Q0SA 4A44A 1GQGA 2VE1A 5FY5A 3J8F3 1XNAA 5ACA1 1PMJX 1GZCA 4I01A 5JIAA 1REEA 2KXLA 1HN0A 4QDSA 1H6YA 1XNTA 4WM7B 1PM7A 2VCAA 3OB8A 4Y22B 3POEA 2A7AA 2CWSA 4NUBA 3PU3A 5CADA 2PFWA 4QPGC 4DZGA 1XXNA 3RZKA 3C7GA 4KG0A 2ZHNA 1N3PA 3WF4A 1BKZA 1ODNA 4RHV3 1VBA2 2E51A 4EN8B 5L9VA 5FKCA 1AR71 2A1XA 4GXLA 4B1MA 2WFF2 2BVBA 2FDFA 1IZ3A 2R16A 5E1RA 3UYJA 3JBG1 5C33A 5JOZA 1PO12 3VBSB 1PHMA 3WP4A 3OG2A 5ERLA 2AREA 2ES3A 1US2A 3ZSLA 5EQUA 5HCBA 1ASJ3 5APAA 2XL9A 5A3MA 1JYCA 4JGYA 2Z79A 4UFKA 1SLAA 3TRSB 1RTVA 2VBPA 3M3OA 4F7ZA 4GH4B 2VJXA 1EUUA 2HBUA 2PLV3 2X29A 2YY1A 3ZYRA 5LA0A 1TZOA 1ZZ6A 3M3EA 1NOVA 2ORZA 3CJIC 4W6YA 2ZGUA 1GZTA 1KFXL 3I3QA 1DGWX 2A6VA 1POQA 2NYYA 3VUOA 2RS52 1H6XA 1XPWA 5KBFA 1W03A 1HV1A 1HX6A 4Y5SA 2P3KA 4ARYA 3LEMA 3PVBB 2JX9A 5L36A 2C5DA 2LTNA 1DCSA 1OVPA 2VTFA 4WM7A 3OBZA 3UK9A 5KXCA 2G9GA 4AOCA 1VR3A 1BBT2 2YDEA 3M8LA 4Q1PA 5AFBA 3U07A 4GWJA 1TE1B 2RE9A 1R1A3 3VDDC 1S2KA 4JKMA 1G9AA 4BWOA 2PHWA 2ZKLA 4Y26A 1RUI3 1QJU1 1QY4A 5JSOA 1D0GA 3N9LA 1HIXA 1VAKA 3POIA 3VD5A 3WDYA 3AMQA 4Z2AA 2AR6A 3MW4A 1QJX1 1SLCA 5FDBA 1ZZCA 3EQEA 2IZWA 1MZ6A 3OY8B 4ZU4A 5ANQA 3JD71 4DRRA 5EJZB 4AVAA 5I0DA 1RUC2 2PHDA 4AK3A 4AVSA 1RL3A 4CP2A 1PIV3 3N7JA 3RJ2X 1NCQB 1ZBE1 2RG4A 2LRPA 2XBO2 2VNOA 4HVQA 5C5TA 1HRV3 1TMF2 2DFBA 1NKGA 1AVBA 3EJKA 3P3NA 3VBUA 2W87A 4YG6A 4GH4A 5FCCA 1OT5A 2MPFA 5F3IA 1NZCA 5K9YA 3RYKA 2WSVA 1FPN3 1LOBA 5FYHA 5L7OB 2XPJA 1XYPA 2CGOA 2W5FA 4LKSA 4FPYA 4HK9A 4NN0A 4AZZA 2XG3A 5EFUA 1NG0A 3VB9A 1CZTA 5C6CA 2X09A 5FV3A 3ZKUA 1W8HA 3RI9A 3RZJA 1QNWA 4CDUB 1OFSA 3VBFC 4F8AA 4M3CE 3S0MA 1F4HA 2JG8A 1BEV2 3AMHA 1FX5A 4XW3A 2WLQA 3MF9A 5FKBA 3VZMA 1UU4A 4I0WB 4BQXA 4AW7A 2P1BA 3B02A 2Y6HA 2FMYA 3BTAA 1XRUA 1FV3A 2UYBA 4BQ4A 5GALA 1AXYA 4UBHA 3CQOA 4LBQB 4YGCA 5F5IA 2X10A 4AFCA 3I2DA 3WXPA 1WMXA 5C8CB 4J1XA 3ZR5A 1HW5A 1VRBA 4I0AA 5GLWA 3SNMA 1YCIA 1J3RA 4XDPA 4EROA 4L8QA 3UGGA 1MEC3 3KV9A 3R6SA 2YPJA 3SLIA 1QKQA 2IFRA 4QXKA 1QU0A 4XJUA 5FXVA 1CN1A 2E53A 4MHUA 1W0OA 2YPDA 1DYPA 2WO7A 4EJRA 2OW4A 1W2AX 3DF0A 2DURA 3OY8A 3KQ4B 4LIVA 4XZPA 4PHZA 5FAXA 3GCXA 4Z92B 3UL2A 2HWF2 1FATA 2VQUA 4YZ3A 1H9PA 3WW1A 1AR82 1ULEA 1IPSA 4Q4V1 2HEWF 3MFCA 1G6NA 1WLDA 2D5FA 1NCQA 4BJ0A 5KXBA 4XPVA 1W3VA 4RL7A 1ZA4A 2VZUA 2CGNA 1GNZA 2YC4A 3FBYA 3KV4A 2QNKA 1TVGA 2DU1A 4COZA 3H8OA 4GA9A 2XONA 5L7OA 4HONA 4F83A 2ARAA 2GH8A 3ACGA 4MHRA 5FRAA 3JCIA 3S7IA 3IM0A 1YFYA 2JDPA 3ETPA 4W6WA 4Y1UA 5KHHA 4CU9A 1CQ9A 1TME1 3B7MA 2A6ZA 2G1MA 4QKBA 3HMYA 2RDRA 2BERA 5FK8A 4CDUA 1I1EA 5DUWA 5A70A 5BNOB 3P5BA 3Q8AA 5FZMA 4IV1C 2H0BA 3A0NA 1HRI1 5DMYA 4W8JA 1JYWA 4EQVA 3AP4A 1RVF2 4LHNA 1AYN1 1CJDA 1GNHA 5FZ6A 1VJ2A 4CE8A 5LA1A 1UU6A 2D6LX 1QDCA 3POBA 4Q0VA 1LGBA 2WAAA 5CBLA 4HMZA 2PN5A 2YU2A 4ZS3A 3ZXAC 3PLQA 4LBQA 4RFRB 1H4HA 4LTAA 1XNDA 2J1SA 5C8CA 1VBD3 1E5SA 1H2LA 1VBB2 1NYWA 1LULA 2VZ1A 3FN9A 3LDRA 1PGW2 1W2OA 2Q1MA 2PELA 3AB0A 1JYTA 2MNGA 4LEJA 4YZ1A 4NHYA 2GNTA 3HIFA 2ILMA 1W90A 4CEWC 2FCVA 1H1MA 2W1SA 5IHRA 2DCTA 4HPKB 5GZEA 5LBEA 1WLCA 3JXSA 5CKMA 1IQAA 2VUAA 3GBWA 3IN9A 5KWRA 4XC9A 3BPSA 2XJRA 1WW6A 2RVAA 2XJTA 4L11A 3IAPA 4YZ4A 3M3QA 1Q8VA 4NMIA 3C8XA 5BNNB 3ACIA 1Z7S3 1QNYA 4ET7A 4ONUA 4H14A 1K5MC 1LOCA 3BCWA 5FZEA 2IC1A 2RS32 3CKHA 1G9CA 1ND3B 5J37A 4QGMA 4XF9A 2F6BA 1HXS1 1F31A 1EV13 1B35C 1D7PM 1O6UA 1SZBA 1W8NA 2O0OA 2TBVA 4PBOA 1S0FA 1D4M3 4N9HA 2WABA 2VQ0A 3SKJE 1U5ZA 5IVBA 3TBDA 1LU2A 3MLLA 5BNOA 5CEHA 4P9JA 4Q4X1 2VBDA 3BGAA 2NP0A 3CIHA 1RUF2 2NLRA 3AM2A 2P3YA 2O1QA 2VGDA 2WO1A 5JAXA 3GZEA 2JDZA 2L9LA 3MIBA 4FFHA 3AKSA 3PTRB 4P9IA 2GMMA 4QB1A 3BTYA 1AR92 4IEOA 2WZPP 2E7TA 4TN7A 4QPIB 4A7YA 2QQJA 2CDPA 3CU7A 4L9BA 5JOYA 1DGRN 4E4ZA 4H2AA 2WZEA 3EHKA 2JWPA 3AKRA 5GZGA 5C9AB 5FZOB 5IVYA 3RFRA 5J1XA 3C7OA 1KDMA 1GWLA 5BNPB 5FLJA 4DUVA 4WVMB 1XSQA 1ZBE2 3I2GA 4ZPIA 4HPKA 5A7QA 4AFAA 4M0NA 5FPXA 2IUWA 3O1PA 4GJZA 4YARA 3AYCA 3ZN4A 1OI6A 1XOYA 2QUOA 2V4VA 4BQ3A 3AC0A 2CTVA 1PGSA 1PVC1 4XFGA 4H55A 4DUWA 5I0TA 1GKBA 1N1YA 5H9SA 2P3IA 1H2KA 3MIGA 1RINA 4CEYC 4XF0A 4BQ2A 5J48A 2GC0A 2WNVA 2CAUA 1VBA3 4IEWA 3A22A 5A33B 2XJQA 5IVFA 1S0DA 4IQPA 4Q8LA 2VVDA 4LLFA 3N9NA 1PNGA 1ZBA1 4NPMA 2WFF3 2H0VA 5T55A 2XVLA 2BVVA 2X5IB 2XB6C 2A70A 2Y6LA 2FCTA 3PL0A 5FUIA 3SKVA 5HPOA 1CAWA 2XHKA 1PO13 3WDVA 3C2UA 1SHWB 1YQ8A 4XE9A 3T4HB 3VBRB 4HT1T 3ST7A 4ZKTB 1Q8OA 1X9PA 3MUY1 2B9UA 3K2OA 3ZYHA 1QEXA 3MIDA 4BA6A 2JXAA 1RUJ1 3K48A 3NNLA 4AAPA 3MIHA 5G04L 5HCHA 4JRLA 1SG3A 4IV3C 3HBKA 1DIWA 4QPWA 5H9QA 4QPIA 1UXZA 2EAKA 3T3YA 1UWWA 2EIBA 4QX3A 1UNBA 2FDJA 1Q5OA 5F32A 2WWJA 2RS53 4Y3OA 2A73B 5C9AA 4MSVA 5FZOA 5HV0A 4A3XA 4MXVA 4XDOA 4RFT0 4WVMA 4PT6A 1LAJA 3AP6A 4DY5A 1J3QA 3D8CA 4N43C 3ZXJA 4LHKA 2BBAA 3H7JA 3PIJA 4XIOA 2ADEA 1V6LA 4HXCA 3UNPA 4Y1YA 2ZOEB 2DBNA 5FO9B 2XJPA 2RJKA 4QPGA 1BBT3 4A7KA 3O1MA 2W0XA 1LR5A 2W1WA 1GLHA 4OI2A 1LODA 1GSLA 2W47A 2CSGA 1OHFA 5FP3A 4YM2A 3F2ZA 2OPKA 1RUE1 2R061 2VH9A 5T52A 4CP0A 4E8CA 5GZFA 4BH9A 1OH4A 1S1AA 4BISA 4Q0PA 3VDBA 1JS9A 2AEZA 4KWJA 3ZXDA 3HQRA 4O9GA 3VGIA 4AFMA 1W6QB 4GB31 1DZQA 1A3KA 3POFA 1W9WA 2R1BA 3NMBA 4AI0A 1PX4A 4COVA 1I5PA 1S2EA 3T0DA 2JKXA 5IFTA 4Z82A 4BIFA 2Z4FA 5IJRA 3UJOA 4FAHA 3VBRA 2QQKA 2Y6GA 4IUGA 4R9CA 1TEIA 5EIYB 4C8DA 5A32B 2ZGTA 4N7UA 1NE4A 2XBO3 2HWE1 1OD5A 1HB4A 1TMF3 4CUCA 3BU0A 1FMD1 2D7FA 1C1FA 3KSCA 1Y9GA 2AGSA 3EB7A 1PGL2 5GKAC 3NAPC 1M4WA 4CDQB 4R9BA 2ZCWA 4P5HA 4FFFA 4QAWA 4PDWC 1AXZA 2QQMA 3RZGA 2XMLA 3I54A 4LITA 4N53B 1WD4A 3VBFB 2XR4A 2B45X 1UU5A 1G7YA 3OGGA 4FPHA 3THCA 2J1RA 3HT2A 5FZCA 5T54A 4AVVA 3VD9A 1UO9A 3FJSA 1RUOA 3D4KA 1Y3TA 3HPNA 3SEEA 5B4NA 1BZWA 2QQNA 2CDOA 3K75B 5KXDA 2GC3A 5GJ6A 1NQJA 2N7GA 3VBOC 2PAMA 1UKRA 5IAVA 4P00B 4YW1A 1IQDC 4AWDA 2OZJA 1CAVB 1AYM1 5JWPA 5CG9A 4DB5A 1BMV2 3MGUA 4IEPA 4AG4A 3OBAA 2HYKA 4KWLA 4CCMA 4HL0A 3RQ0A 3U75A 4HSJA 4XILA 3O7OA 4CUGA 2A3YA 2JDMA 3SHRA 5IWFA 3USSA 1W9YA 5FYIA 1EAH1 3E1F1 4AEJA 1W6QA 4JTOA 3AVRA 3CO2A 4IE0A 1M06G 2G19A 2G9FA 4XABA 4NAMA 1NLSA 1OUSA 1WUVA 2HWF3 2OXBA 3IDCB 2LUWA 3U14A 3DGTA 3O12A 4YPJA 5C3PA 1RUG2 5FXZA 2C1FA 5FPZA 1AJOA 4CPBD 5JXJA 4F3JA 2EXKA 1S0BA 5FLIA 1OKOA 4YW5A 4JKKA 4CDQA 3AMPA 3S6PA 3WG1A 1UZZA 1VBC1 1LEMA 5JLVA 2VCMA 2WZ8A 3IDAA 5TSWA 3OGJA 1QF3A 5A3LA 1OFNA 1Z0HA 2JENA 3MW3A 3VBFA 2YB7A 3LSDA 4J6GA 1CIWA 4DOUA 2QJVA 4XUOA 3V0AB 5IVVA 1VRH1 3T1LA 3PMEA 5IVJA 2P34A 5J09A 1AL23 1X33A 5FZFA 4QKFA 2GP3A 4DNYA 2KD7A 2V72A 2WT0A 3CLPA 5LBFA 1ND2C 1RMU2 2VUCA 3RMXA 1C28A 1RVF3 3APBA 4W50A 1UIKA 1L7LA 3QCWA 3OBTA 3VZKA 3WQBA 4FQ4A 3VKNA 1XBFA 4MG2A 1Q43A 5SV5A 2ZX4A 1LESA 3I7DA 4DMIA 1ZZ8A 3JQXA 1CAVA 2VPVA 4XFAA 5FYSA 3WHUA 4QQPA 1GU3A 2JD4A 3KCYA 1SLTA 3PUIA 4MUVA 5F3CA 3WF3A 3O1RA 2VR4A 4XTMA 1WLWA 1VBB3 4UYBA 4RSUA 1VBE1 3DPRC 1MQTB 5FO8B 1RIRA 4MGIE 4P9XA 5FYBA 1YWKA 1ZRCA 2ZHMA 2SBAA 2J1VA 3N4MA 3Q9OA 4MLOA 2WAOA 1YQ6A 2A5ZA 3JU9A 4IGQA 3ZFFC 1MZ5A 2MEV3 2LROA 3TWIA 4KGGA 3M3CA 3ILRA 2WR9A 1QQP1 2D6MA 2IWGB 3T30A 3PUSA 5FPBA 1AX1A 1EP0A 1ULCA 2ENRA 1J3PA 3E6BA 1WMEA 3OYWB 1K5MB 1V0AA 1STMA 2QTWB 2WLPA 1R081 2X8KA 4NIIA 1RXFA 4URAA 3OD0A 2ZGPA 3AYAA 3NNFA 2RS33 4BM8A 1C57A 4RYDA 4NAOA 5F6KA 1S0IA 4QHBA 3QD6A 2GP5A 1V70A 5CVRA 2WIIB 1RXGA 1VLNA 3MW2A 4QX1A 2HWC1 5FBJA 2DUQA 3VBHB 2BBVA 2J22A 5A3WA 1XC6A 2WYSA 2CL2A 2ZGRA 3ACLA 3V0AA 4YZ2A 1EYBA 2XH6A 2V5DA 3TEWA 1AR61 3MEPA 4LUMA 5FFOC 3WNMA 1RUF3 4MGYE 1YNAA 5FQ0A 5FP7A 4CDXC 4LPLA 4QMAA 2R062 1Y9QA 4M3CB 1JYNA 3LEGA 1AR93 5A7SA 4A41A 2BOIA 4BMEA 2IFWA 2W1QA 1I6XA 2RS11 2I45A 1JH5A 2A6XA 4YNIA 4EZ4A 4YSFA 5LY2A 3T2PA 2WS91 3O5SA 4QHOA 1MQTA 4WM8C 1RJ8A 1OSGA 2YV8A 4YLZA 4DEQA 2PXJA 3K51A 4AQ6A 1HV0A 1UYZA 1O3QA 5F1RA 5LWBA 4K7JA 4QQHA 4NIDA 2YC0A 5JI7A 4Q27A 2HWE2 3NW4A 2E26A 3VL9A 1F4AA 4ZONA 4BLIA 1OLQA 1ULDA 5EJ3A 4AEKA 4QXBA 5LB6A 3KWVA 4AAXA 1FOD2 2JB4A 4DEVA 3OYWA 3CDZB 4CUBA 1K5MA 3OPTA 1RUH2 2FCUA 5A80A 4NHKA 3VZOA 1YC61 3CZJA 4UFIA 2VUJA 3UKNA 4GWNA 4QX8A 5FZ0A 3FUOA 3WNLA 3ZFGC 2QDNA 3WNKA 1B35A 1MPXA 1OQEA 1JUIA 1UOGA 4JQTA 1WBFA 1DFQA 4XF4A 1G9DA 1LOFA 3ECQA 5FMCA 1X36A 5DAVA 3RRDA 4UWDA 4PJYA 3VBHA 2GALA 3HQXA 1R091 1C8M3 1LHVA 3GF6A 3ZO0B 1COV2 1UY1A 3B00A 2WDBA 4MV2A 1W9TA 4Q4W1 4EN0A 4XJ8A 2R1DA 2TNFA 4HETA 1E5IA 4M00A 5C4WB 1GP6A 1JXNA 3KVAA 4IV3B 2GC1A 5JXIA 2GAUA 3WCRA 4COYA 1UZVA 3LA3A 3O1SA 4NO4A 5LEKA 4M3CA 2Z69A 4LOTA 4NRMA 3U10A 4PIZA 5EYYA 1RHI1 4AFDA 3UV9A 1HN1A 2A3WA 2VNRA 1W05A 3AL6A 2DU0A 2VZTA 4IEZA 4YW6A 5FYYA 3EO6A 1NY71 2NQYA 2VD7A 2LS6A 4QX0A 3ZPOA 4XETA 5JXGA 3K77A 4TWTA 3OPWA 3IAQA 4KH9A 1XB9A 4MOAA 4N43B 2R0HA 4D6RA 1FNZA 1LTEA 2NN8A 4ZY9A 4DXSA 1LU1A 2WNUC 3TNPB 1IS3A 1XNKA 5BYNA 4PQ9A 2ZAHA 2HEYF 2EALA 4I3GA 3HVDA 5LK7B 1ZVFA 5F2SA 1RUD1 4AI2A 2HJIA 2RDNA 1A78A 2ID4A 1QXJA 3MF6A 4XBLA 1Z78A 1SBFA 4LBNA 1QJY1 3LD8A 2RR11 3MDPA 4B4QA 3I2OA 2UYAA 3B9CA 4KBBA 4HKWA 1NCRB 5GLTA 1DGLA 4XEZA 4LKFA 3H3UA 1S0CA 4YW2A 2Y0OA 3LQCA 3Q8EA 4LOSA 2VNVA 4RR3C 5F37A 3WLUA 2O8OA 4UFLA 4FOWA 1CD3G 2RMU2 4INDA 3VZNA 1U12A 1PZ7A 1DLCA 2Y26A 3DEMA 3MIFA 3NSTA 5CKQA 1GBGA 3H0OA 4HVOA 1MS3A 5KC5A 1VB4A 5C4WA 5I8TA 4A6SA 4I0BA 4IV3A 2VBBA 4RGGA 2FDIA 1YFWA 1JU4A 3I2IA 4QGNA 2PQQA 2Q1FA 2WN2A 1VMJA 1GOFA 4HANA 4XQDA 1CGPA 3ZN6A 5JCTA 3VKOA 3DKWA 4OI1A 3A23A 2Y33A 3VBUB 3VN4A 2HWB2 4UFMA 5BPXA 3I49A 2Z42A 3TN91 1O4YA 5E8AA 1A8DA 2R7EB 4XMIA 2IXIA 4CUAA 1ONAA 1WWYA 2EIEA 4IETA 4M4RA 3NJVA 2QQWA 2WZR1 4N43A 4N90A 2IVJA 3Q8CA 4JTNA 5EYXA 5GZCA 3TB0A 4N9IA 5FZDA 1XYNA 3C7FA 2JG8B 2Q0AA 2R042 2CAVA 1GMMA 3M2MA 1WGPA 2VOVA 3PHMA 4JQRA 2YFZA 3ZXKA 2R071 1NAEA 4M4PA 5DDJ3 3AFGA 2C9KA 2W52A 3H50A 1V9U1 3WD5A 1NA1C 1NCRA 1WKYA 2J1EA 2JKBA 3ILNA 4AEDB 4AQSA 4BOWA 3E6DA 1OA3A 4A45A 3ZXEA 4FXKB 2PAKA 1OD3A 1X7NA 1WD3A 3OJBA 2RM21 2AUYA 4UFJA 3S5AA 4X8PA 3HQUA 2E9QA 1XNCA 3O1TA 5C70A 1HB2A 3HAGA 4NROA 2XGXA 4JV4A 4AHYA 2BOJA 5FZKA 5IK7A 4BK4A 1RUG3 1ST8A 2D6KA 4ISQA 3I8TA 3QH7A 3AZVA 4PDWA 5JR2A 5A3PA 2WS92 2QE3A 3PMSA 1GWMA 2QQVA 3SH5A 4EZHA 4LO5B 1H1AA 1F35A 4KU7A 3WG3A 4AL9A 4Z1VA 3LZZA 5C5UA 2KA3A 3K4ZA 3R4DB 5B2GB 5I8YA 1K45A 5IK5A 3TEYA 2BFUS 3N9QA 5FMOL 2O8QA 3M7AA 4RGKA 1X9TA 2WT2A 5JI9A 1O5LA 1LHUA 1ND2B 4Y1XA 5C3SA 1WCDJ 4RS5B 1W6OA 4Q1RA 2VZSA 4XUTA 4B8EA 5FUPA 1V00A 1HQWA 1PO21 1RMU3 2ORXA 1BVVA 1J1TA 3WQ1A 3ZFEB 4LBQD 1YLLA 2W9XA 3SCHA 1DDLA 1HJGA 1KXGA 3KV6A 1WW4A 1CX1A 5FY4A 2ZEYA 5FMDA 2EIGA 4Q4Y1 1UXXX 3SITA 3DXTA 4R52A 4YRDA 2GNDA 4AEDA 2XDVA 1PK6C 3ZYFA 2C6SA 4OZXA 4X6QB 4JDOA 1OLME 2DVDA 1DF0A 1NE6A 5JPNB 4FTSA 1IKPA 4GJYA 1JU3A 1OMIA 3UESA 3RZLA 2QQPA 1EPZA 1X82A 4LO4B 1W8UA 2DCJA 4IE7A 3S5QA 2JDNA 3KGLA 2Z2SB 4IEVA 3WOGA 2YROA 4YFZA 3ITQA 1S0EA 2TEPA 1O7FA 2OT7A 1OOPC 4BMBA 1QJFA 4ASMB 1OQ1A 3G7DA 4HG6B 4QM9A 4HK8A 4YG0A 1UCXA 3LA7A 2WBKA 3H8UA 3HEIA 4ASKA 1ZX5A 3R4SA 4O7XA 3ZMOA 3PVOA 5FZ7A 3VHRA 2WQ8A 1LOAA 5FPAA 1C1LA 1V6NA 2VZOA 3USUB 1QXPA 1KGYA 4K9SA 3I97A 3OEAA 4DFSA 3PUQA 4PIXA 1X8EA 5GM0A 3O1OA 2GMEA 2DTYA 1ND2A 1W06A 1SMVA 2BW8A 5ACA2 4RS5A 4N7IA 4NE9A 1APNA 5IFPA 3IT8A 1RUD2 3HD8B 5AC91 2F4PA 3ZFEA 3GZAA 2QQIA 4FBFA 1OA4A 1C5HA 3AXEA 1DYKA 2HWD1 3CNAA 4IW3A 1U0AA 2HKXA 2XQRA 3GYDA 1IGOA 2FDHA 4FSJA 4LBMA 3IDEA 2ZACA 3VL8A 3R05A 3H9AA 3J8F1 3WVJA 2R49A 4OVEA 3KM5A 3L2YA 5LBCA 1RYYA 5KHIA 4CU6A 2LM3A 2AEYA 3AFKA 3NV4A 3KLSA 1AR72 4A42A 3HN3A 3LGRA 3FX3A 4XAAA 5I0RA 3RZHA 1MZFA 2OX0A 4U2AA 3T0BA 1UW8A 4FOVA 2VXRA 4TYSA 4QKNA 1DQ0A 3JBG2 3VDCA 5JUVA 5FOJB 4AR2A 2ARCA 2XL7A 3QACA 5LZ6A 1LGNA 1H4GA 1V6IA 2D6PA 3RI8A 4RHV1 5DUUA 2WWSA 1FOD3 4NHLA 3T09A 1X8MA 3ACFA 4LKDA 1CVNA 1RUH3 3RVHA 3AK0A 2FDGA 5LEJA 2B42B 3OUIA 4WBBA 2WN3A 3CEWA 5LK5A 3U1XA 2W2IA 1MS1A 3NWKA 2UURA 1YFUA 3N7MA 4CZSA 3GCWA 4S2GA 5DG1A 5FREA 3WNXA 3BI3A 1F15A 5A3UA 2BQPA 5IAXA 1ASJ1 2D3SA 2WNVB 3LCPA 3OTFA 4GALA 3USUA 4E4DX 1VAVA 4HN0A 3E5QA 5C3OA 4H3WA 2EF6A 2XVKA 3O0VA 3DN7A 1ZRFA 2C0ZA 1C8NA 1COV3 5A1LA 2OUJA 2PLV1 3PURA 4DXRA 1W6PB 2ZGSA 4LO6B 1FYUA 3J7MA 2ZTNA 1CAWB 1QMJA 1G8WA 1YHFA 2ZX3A 3W9AA 5K0UC 3I3EA 5FR3A 3WINE 3WF0A 5I0SA 4OZOA 2JECA 4JGZC 5ABJC 4SLIA 1XE8A 4QWNA 1QH7A 2J7MA 4Y4RA 3V64A 4WM8A 1PMIA 1QJU2 1QOSA 5FYMA 3RNSA 4CVUA 2HYXA 1W99A 1PMHX 4K1ZA 1JMUB 1POV3 1GP5A 1QJX2 2VVFA 1ZZBA 1LKNA 1IOAA 2ZEWA 4NJ4A 3SMHA 4BQ5A 2K0GA 1OXCA 1DGRA 1LHWA 1R1A1 3JD72 1OC1A 5C8WA 1RUI1 5CFDC 4CCKA 2ATFA 2I07B 2MHFA 4G4FA 2Q30A 4Q2FA 3LF7A 1UY2A 3ZFGA 4EWDA 3ZXGA 4CCNA 4QPGB 1RITA 1JYVA 3E6CC 3EYPA 2UWAA 2ZMLA 2QDRA 3I2FA 4QKDA 4COUA 2OQ7A 4YVWC 2AENA 3SH4A 1GNYA 2ARXA 4HLTA 5IUQA 4KQ7A 3W58A 2O14A 1I5ZA 1VALA 1DBNA 1PIV1 2JDYA 5JPMB 2E7QA 2RMU3 3AMNA 5F8PA 1HRV1 1W9FA 4K8FA 3KGZA 4Q8KA 1W6PA 4IL7A 3VZLA 1FPN1 3IZOA 3PJYA 4FP2A 5FY9A 5CFCC 2DVGA 2RHPA 2CHHA 3QH6A 4CA9A 2A75A 5FYZA 3WNOA 1CX4A 2Q4SA 1XE0A 4D69A 4D8MA 3KT1A 3QBQA 4BXSV 5DAPA 2VCCA 1T6GC 1KJLA 2HWB3 3CJIB 5FPUA 3MV11 2B4KA 1GUIA 4QB2A 4YFWA 3NV3A 2WKKA 4AF9A 2CWMA 3M3IA 3I4IA 2WNUA 4NIGA 1MS9A 3FC0A 1W28A 4DY3A 2B5HA 4XJWA 3WUDA 4Z2WA 3GZTB 2KR2A 1GR3A 1CAUB 3GBFA 3IDBB 1VMHA 2R043 4UT5A 4ZXEA 3WP3A 2OQ6A 3WDXA 1JZ4A 1UN1A 3POYA 2W46A 4Q4V2 2GMPA 3RWNA 1MEC1 4JX0A 1HDKA 4QXCA 2DCZA 1JZ6A 2VM9A 3B3QE 2AZ5A 1HLCA 3OD4A 3RZZA 3VDDB 1G9FA 3NNGA 1CPMA 2OS2A 2WO2A 3NKTA 4UFHA 3KZ4C 4RQPC 5IW0A 4YW7A 1CESA 4PQQA 5DABA 4JGYC 3J7LA 3AYDA 1OKQA 1OLRA 2JIGA 1FV2A 1K5JA 1TME2 2WQ4A 3FZ3A 3S30A 3U11A 3FFZA 1V6OA 3AX4A 5JVVA 3C7HA 2PHRA 2YBPA 1HRI2 2HWD2 2YMZA 2SLIA 2Y34A 2ZX0A 4GKYA 1AYN2 1A6CA 4IXLA 3VD4A 2WWUA 5FYVA 5C71A 5GLZA 1RUC3 1S55A 4OHWA 1G86A 2AH2A 5DXDA 1W8WA 4K40A 4YYOA 3WP6A 4I3PA 4Y20B 4DRVA 2ETEA 3GHMA 4LR4A 1KRIA 2EXHA 1D0HA 4UW4A 3N9PA 3T0AA 3CJIA 2YG0A 5JZGC 1J1LA 3T08A 3NNMA 1UZWA 4D7SA 3BTZA 3OGSA 2OVUA 3HR9A 4R4XA 2AYHA 3IB3A 4UI9L 4RHV2 4HFSA 3FUQA 2JDKA 4FPJA 2QQOA 1YJKA 1Y4WA 3NVCA 4KG8A 4MGKE 1CAUA 1BEV3 4UBGA 1VBD1 3V56A 3EXUA 3LE0A 5KXEA 5A6XA 5FY1A 1W6MA 1U5YA 4LK6A 1SLIA 2V4AA 1BQPA 2DFCA 2Q8DA 4TZDA 2QFEA 1UY3A 4B1LA 3BN6A 3VDDA 1PK6B 3VBSC 4FQZA 4Y33A 3FHIB 2X53S 2IXKA 1QH6A 3W5NA 3ETQA 1OURA 4C0HA 5EV7A 5C3QA 2Q8CA 1HXS2 4AYUA 2UY8A 2P6CA 4GMP3 4OUSA 2BEOA 3TYJA 4CDWC 4IEYA 4EN9B 4HOOA 1L7QA 1YQ2A 2OA2A 3I59A 3MPBA 4GH4C 4GWMA 5FZ4A 3I3MA 4P14A 2UWCA 4CCEA 4QDRA 5F5QA 1Z7S1 2Y8KA 4QB6A 3AYEA 4Q4X2 3DL3A 2XLFA 3BB6A 2DUOA 2D97A 2PHFA 3OGVA 3ZIWA 1CAXB 1I9RA 1H2NA 1W3XA 5FJHA 1G9BA 2G4IA 3ES4A 2VOTA 1LOEA 4AI8A 4XYXA 1W9SA 1EV11 4JKLA 4P9GA 1AR83 4W4ZA 4LJHA 2YU1A 1FNYA 1UYXA 2ADDA 3PVEA 2DBIA 2BJSA 1D4M1 4Y20A 4XDQA 4Y5Z0 5CKNA 3DYOA 2VCBA 1UX7A 3J26N 5JOWA 1DQ2A 4RD7A 2ZGKA 3OEBA 2VOWA 1JZ5A 3ACHA 1Q3EA 3GJAA 3NO8A 1SLBA 5SV8A 2BUKA 4JDMA 3SXWA 3WQ7A 3LPGA 1F9KA 2ZAAA 5FZBA 2Y60A 3ZIXA 1DQ5A 1P8JA 5ACA3 4IDZA 3BIEA 1V6JA 4MZUA 4FTEA 2YXSA 1DGWA 4YM1A 2ZMNA 1PVXA 4E2GA 1UY4A 4IV1B 4QPYA 2PHXA 5FYTA 3KHBA 1KD7A 2BYVE 4D6SA 2QCSB 4YGDA 1L7RA 1QIQA 2P37A 5C7GA 3TEZA 1XE7A 1PVC2 3ALQA 3T2OA 5FQ0B 3LIGA 5H9PA 4XXPA 3A21A 5LASA 1D2SA 3P1IA 3KHCA 2I74A 2Q5TA 3RS6A 1PK6A 5I0UA 1AHSA 3RYRA 1WMDA 5F5AA 3TAYA 4YM0A 1HRV2 3FBMA 3ZKYA 4YGBA 4CCDA 2I2SA 1AR73 1NCQC 5HV4A 1ZBA2 3G6JB 3KF3A 1W0PA 3M1HA 4LUKA 4BQ1A 3JBG3 4CEWB 1MS5A 4UW5A 1YIFA 2DCKA 3FL7A 3N7KA 2ZGNA 5JSPA 5L7OC 1BVP1 3GDBA 3VKMA 5LCWL 1VBA1 2QQUA 2A6WA 1CAXA 1RUJ2 4MGTA 1LENA 2NMOA 3KQRA 1YEWA 1T6BX 5FLHA 4YW4A 2WA4A 4CDUC 3ABZA 4XZUG 2WFF1 3TOJA 1W2TA 1GV9A 3NL1A 3FLTA 1PO11 1UOBA 1J83A 4XFIA 2OPWA 5J7MA 2VMEA 5GZDA 3O1VA 1XYOA 5LA9A 2P2KA 2VO5A 1B35B 3KCCA 1AX2A 3P6BA 3JUUA 1WCKA 4DINB 3U4XA 2YBKA 4DIQA 3J9SA 3CBNA 4OUEA 5C8CC 1TNFA 1ZNPA 5FZHA 1C3HA 4IV1A 5LY1A 4LORA 4K20A 3BTXA 4XACA 3WDWA 2DWRA 4MGQA 3WW4A 3UGFA 3E97A 2RS51 4MO3M 1QGLA 3B5LB 1MS0A 1ZRIA 3RWKX 3LEKA 1RUE2 1R64A 1QJU3 3V0BA 1OH3A 5GLVA 2ERFA 2WO3A 1ZZ7A 5DPNA 5BY5A 1N3OA 1O4TA 1AXKA 1QJX3 2PHLA 4QT6A 2ET7A 5AVPA 2BP6A 2Q8EA 4ZZ8A 2D3RA 4GB32 3MYXA 1BBT1 2BGPA 3WHTA 1UYPA 3JD73 2QZ3A 3GGLA 4CEWA 5I91A 3OPZA 4EN6B 2Q1ZB 1IHMA 4Q26A 4I2OA 4YZ5A 2JG9C 1ENXA 4IEQA 3LWCA 3M70A 4J25A 1FI2A 1POV0 3MLJA 1C4RA 4LULA 5FZ9A 2D5HA 1ZBE3 4ZXKA 1LGCA 1DLLA 2E63A 1FMD2 1IPJA 2H6BA 3DUIA 3OBRA 3NQHA 4OHYA 2HH9A 1HQNA 2DVBA 1WLTA 2BV4A 2ZBJA 3OF1A 5AVAA 4CEYB 5BNOC 4CCLA 1F2NA 4EN7B 5CIRA 4EYUA 3AZYA 1YO8A 1REFA 2GU9A 3VHOA 5A1AA 4P9WA 2XBO1 3RGBA 1IG0A 2XWJB 3NV1A 4FI9A 1TMF1 2JJ6A 2DF7A 3NJZA 4DQAA 4L97A 2ZHKA 5LBBA 2UU8A 3GJBA 1YFXA 2BNOA 2E32A 2PTMA 1JHJA 1ODMA 2GZWA 2PYTA 1VMFA 1NQDA 4ARXA 2VL4A 5ABJA 1MVEA 4O65A 3X29B 4BQYA 2ZABA 1AYM2 4YM3A 1GICA 1GYKA 3ILFA 1TQ5A 3N9OA 5KHKA 4CCOA 3AZZA 3LSEA 1NUKA 2FZ1A 2X05A 4NPRA 3RPQA 3ZN6B 3AKTA 4UF0B 5L9RA 2XVGA 1Z7S2 1N47A 1UPIA 2PHUA 3E5XA 1JW6A 4E4HA 2XKPA 2YZ4A 3WW2A 1WCSA 1EAH2 1ZA7A 3AP7A 4BU2A 5BNNC 3ZSEA 4QDQA 2A71A 1S4CA 3ZDVA 3LDBA 4QX7A 1ND3C 2K46A 3ZVXA 3TNQA 4CCJA 4FPOB 1RUNA 1HB1A 4Q5OA 1JHNA 1W8OA 1YUDA 4Q4V3 4Y1VA 4C90A 3MBWA 1D4M2 3IMNA 1AJKA 3HBZA 4X6RB 1UMIA 4B4PA 1LRHA 1OLMA 3V65A 1W39A 2XOMA 1UPSA 4RQPB 4XFHA 4YVWA 4OI4A 4QD2A 3O0XA 2WT1A 4A2UA 1VBC2 5I93A 5IATA 3BODA 4L2NA 4CEYA 4BK5A 3MIEA 5E6HA 3LFMA 2ZA9A 2HWF1 3MPPG 5LATA 2B7YA 1HJFA 3NJYA 5DG2A 1H8VA 1TME3 1D2QA 4JCKA 4PLMA 3HOBA 3BOWA 5A6YA 3WW3A 3KT4A 3SCGA 5JOXA 4B7EA 4FPKA 1VRH2 2D43A 5FMOS 4XFFA 3WDUA 4AHWA 4ES8A 4D6QA 5DUXA 1HRI3 1BCXA 1YJLA 1AYN3 2VUDA 4PBPA 1JTZX 1Y43B 5DAXA 1ENQA 4WVVA 5C9AC 4BHPA 5J98B 3PNAA 4XUQA 1FXZA 5BNPC 4UXAA 1UIJA 5JZGB 1CZSA 5LRRA 2VNGA 1XQNA 3AMMA 3NAPB 4FPFA 4LK7A 5D21A 4CP1A 1WBLA 4IE6A 3POWA 4PDWB 4PI2A 2BRTA 4FPEA 1AL21 3RYPA 1VBE2 2JICA 2XUMA 2P17A 4BCUA 4YWAA 1NXD1 3BALA 3BU7A 1BLZA 3H7YA 1RVF1 3NNJA 3POJA 4KBZA 4XURA 5F6LB 3ZN5A 1JZ8A 2GN3A 1E5RA 2JDAA 4HBNA 1WCUA 4CU7A 1JODA 1AZDA 3AJZA 5BUVA 2FDKA 1XNBA 2EAAA 3L2HA 3MFAA 1JYIA 1QQP2 2OKXA 1W6OB 1VBB1 4O9EA 1W0NA 1JI6A 4E4SA 1PGW1 3WQ0A 2P4EA 1JOJA 1QWRA 3VBOB 3WR0A 2PA7A 1YRZA 5G05L 1R082 5JMCA 2X5IC 5E89A 4C1XA 4ZHNA 1SDWA 4RQPA 1H2MA 4K3UA 4LHSA 4AVTA 4FOQA 5FUNA 3OOXA 3VBRC 2BGOA 3BIWE 2MEV1 4LA3A 4Y5TA 1OF3A 2Y6FA 2JB8A 4NIAA 5A6ZA 1CWPA 1HXS3 3SCFA 4CU8A 4PCRA 1KS4A 2WL1A 4PF1A 5ISLA 1IKQA 1HB3A 4BE3A 1SBDA 2HWC2 2NPIA 2R32A 1LHOA 1UZYA 2W91A 4OQ8A 4M3CF 3W20A 1TG7A 2WC2A 5DAQA 2ZGMA 1XU2A 2DTWA 4Q4X3 3CMGA 3SQOA 1AR62 1JZ7A 1GWKA 3J7HA 2VVEA 2RS31 5IVCA 5F5CA 4GMP0 4M0HA 3DCQA 4OMCA 4EWEA 2VZRA 1DQ1A 4WZFA 2AC1A 4R8HA 4LO8A 3NJXA 1UF2C 3SH3A 2ZX1A 2AACA 1SPPB 1N1TA 3IMMA 2VTXA 3CL1A 5JZGA 1PX3A 1VIWB 3FE5A 2RS12 3NAPA 3DV8A 4L0PA 2VMHA 4QGLA 4WZCA 3FFQA 5AFEA 5T5JA 1H0BA 4Y22A 3I2HA 1E57A 1K42A 1RUF1 2CV6A 3N36A 4LHLA 4XFBA 4OLLA 2IXHA 3VKLA 4AE2A 4OCTA 3JZVA 4NHXA 5EHDA 4OHVA 3WZ1A 5L73A 5K7PA 4UOJA 1GQHA 4NRQA 3W59A 1AR91 3AJYA 1LHNA 3DYMA 4XBNA 4CSWA 1KS5A 5L9BA 5KHGA 2JDUA 3W21A 1YI7A 3THTA 4OULA 2XQXA 3KV5A 4QXHA 3ZYBA 1UQXA 3BOPA 1U5XA 1PVC3 2VY0A 5JIUA 4GULA 3VBOA 4GAZA 1H1IA 1ZZ9A 3FWEA 3VBSA 2EXIA 2YGMA 2HEVF 3INAA 1YI9A 3K4DA 1QJEA 1SFNA 1SCRA 3PUAA 4C91A 3ZM8A 3S57A 4QQLA 1EPWA 5IK8A 3AL5A 4RA0A 3KT7A 4JRAA 2ARBA 4CRQA 4BPZA 4CDWA 3H8RA 2CYFA 4XVHA 1T2XA 5BV6A 4RN5A 3DPRB 5FO7B 3PTYA 2W95A 4FFGA 1URXA 1KFUL 4L92A 1ZBA3 5FZAA 1WA6X 3ZYGA 5CA6A 5J96B 3U0ZA 1N1VA 4BYYA 1R092 4XCBA 4E2SA 1MVQA 2JE7A 4E8DA 4CDQC 3WF2A 3BKZA 5T5OA 4O61A 1ENSA 3WV6A 3ZFFB 4OI0A 4Q4W2 3JQWA 2DUPA 4UW3A 4N53C 4S2FA 3GXUA 2XUEA 2ZZJA 3OGRA 3RJRA 1KJRA 1RUJ3 2VXJA 5FPLA 4Q0QA 1KITA 2YC2A 3ZYPA 5CZKA 4FO9A 4K8RB 1SPPA 1JBCA 3VDAA 5FZ1A 4COWA 4JDNA 1RHI2 4MGSA 3W5MA 1C8M1 3WG2A 3K3NA 3ZPYA 4NPLA 4MVTA 3AP5A 2ZHLA 4AI9A 2RDQA 1JOBA 2GSYA 1ACCA 1NY72 4CCCA 1YYNA 4XJZA 3ZYIB 2IXCA 3D3AA 3I2KA 3KD4A 4A4AA 1BHGA 3DXUA 4AQ2A 5FZ8A 3T2QA 4LKEA 1KEXA 3GHNA 1DU3D 4DPNA 1H8TC 1GP4A 3VLBB 2EXJA 2ZKNA 3HNMA 4CXWA 3EBRA 2GNMA 2QVSB 2P3JA 2F4LA 4BIOA 4CDXB 1JOPA 3ES1A 3O1UA 3PIGA 4FPLA 4AQTA 1XJAA 1Y7BA 1QJY2 2RR12 2NZ9A 1RUE3 2R063 3LA2A 4XTPA 4BB3A 4I02A 3H1MA 3JB8A 1OF4A 1WZXA 4K1YA 1BYHA 5FZGA 1LNSA 5LA2A 4CDWB 3DPRA 1RC6A 2NM1A 4TLGA 2VU9A 4WM8B 4ZZ5A 1OUXA 4GB33 5FXWA 1O4ZA 3C3VA 2Y64A 2JG9B 5D8AC 5FOBB 1SQ4A 2NMNA 2WYFA 5FY0A 2E31A 2BWAA 2BZDA 3ZFFA 2OIIA 5EPAA 4H7LA 3LPFA 2WINB 2HWE3 5EP9A 3N7LA 1F5JA 1FMD3 4DXTA 1A34A 1AL22 2XWBB 1ENRA 4HKLA 3AKQA 4KL1A 4CTEA 3THDA 4HKOA 5ANNA 1QXRA 3ZFGB 1PZ9A 1NXMA 1N1SA 2IXJA 1GZWB 4Y4YA 5FWEA 3H3LA 3TN92 2C4XA 2UY9A 2BFUL 3WY6A 2ZGQA 4UAPA 3MO4A 4AFBA 3P3PA 2WZR2 4KWUA 1WMFA 5F2WA 1LB2A 3LIHA 1PGL1 2FBEA 4XJ9A 4XJAA 3KVBA 2ET1A 1PM4A 4LBOA 4P9YA 5A7NA 1MQTC 4J1WA 1US3A 1MS8A 4EV0A 5L19A 1H9WA 4CDXA 1BJQA 1AYM3 1IPKA 2MEV2 3NRUA 2R072 4XHXA 4DXZA 1SDDB 3VD3A 5FTTC 1W6NB 1YQCA 2XLGA 3D0SA 4IEUA 5F9TA 2DVAA 2QKDA 1NLQA 4LMFA 1V9U2 5T5LA 3BUCA 4P9LA 4D94A 1UD1A 1UOJA 4AGGA 1DQ6A 2V73A 3CF6E 1HKDA 1GOGA 1VE0A 4SBVA 1MACA 2D98A 1WW5A 2W08A 1EAH3 5FP9A 2RM22 1VPHA 2JG9A 1BMV1 3D6EA 4OQ9A 2FD8A 3N35A 5BXXA 4D7TA 3H42B 5DZFA 2WNUB 4DO0A 5J3UA 5DDJ1 2D6NA 4NWVA 3U37A 1F5FA 4CP9B 1IG3A 1QHDA 2D44A 4JAAA 1V6KA 4XIKA 1LOFC 2FZ2A 5CAZA 1ZRRA 1ULPA 3WX5A 3SISA 3T4VA 3VBHC 1W8ZA 2A6YA 2XXZA 4AI1A 3C7EA 5CYYA 1VBC3 2H6CA 1S0GA 3FLRA 3U4SA 1MZEA 1O59A 1PNFA 4AVBA 2WNEA 4WV8A 1IS4A 2OYZA 4LO7A 4CXXA 1GZWA 3ZSJA 4OUMA 1CONA 3LOBA 2DYCA 1FT9A 3UKVA 1DYOA 4AXOA 1RUG1 1VRH3 4ITCA 1FAYA 4RR3B 3WNNA 3Q8FA 5DQ0A 3PVNA 4LLOA 1NLRA 3B94A 1DP0A 3BVCA 1X50A 1PO22 1S0JA 1O8PA 3MV01 4Y1ZA 2BTVC 5IYYA 1LEDA 3DYPA 1IS6A 4LBLA 4EWAA 1SACA 2B8MA 4YVSC 1Q8SA 5E16A 5F7UA 5B4XA 5FP4A 3DKQA 4R9DA 2Y6JA 3ORJA 4GD4A 5J36A 1KQRA 1XU1A 2W94A 4D7YA 4Q4Y2 1W6NA 4FPGA 3S7EA 3GZUC 1VBE3 4M01A 1DZTA 3POGA 2VW1A 3H1YA 5FY8A 1RMU1 3RSJA 3HWJA 2JE8A 5T50A 3VZJA 5BNNA 3ZXFA 3ZLIA 2KM2A 2VAUA 5M0TA 2RJ2A 2W68A 2VTXJ 3A4UA 1SFYA 1ND3A 3B69A 4Y24A 5DAWA 3UGHA 4XMAA 4FT8A 4ZU7A 2ZGOA 1VAMA 1QQP3 1C5IA 1CJPA 1DG6A 5DZGA 1RB8G 4JVAA 3KMHA 4CP9A 3J7NA 1Q56A 4BLJA 2P5BA 1C8M2 3A0KA 1R083 1MS4A 1UMZA 4XQ4A 4G3YC 4ATEA 3D5OA 2ZEXA 4K21A 5A3NA 4NR1A 2WFPA 1O3SA 2PHTA 1W6MB 5FZLA 3BYWA 4B29A 2W39A 2VW2A 4Q0UA 4TLFA 2DV9A
chains in the Genus database with same CATH topology
5EWSA 3T2TA 3M4FA 3ROUA 3KCXA 1NA1B 2R0FA 5BNQA 5C4WC 1JUHA 3RMYA 3L9JT 5CB7A 2Q8OA 2HWC3 4LBJA 5KC6A 3GBGA 4RR3A 1GZ9A 3PJQA 4OHXA 1QOTA 1AR63 2V5YA 4YG3A 3THPA 1N3QA 4B4RA 3I59B 4URTA 3NKGA 1OA2A 5AC92 4MGZE 4QQ2A 1A8MA 4LE4A 3WCSA 4QU2A 5BNPA 4RGAA 5IK4A 5DUVA 5I8SA 4UW6A 2BWCA 4GQ7A 1RGSA 2RS13 3RG0A 3WDTA 3J8F2 5EZWA 2WS93 5LRSA 1CR7A 4ASLA 3MICA 2CGPA 4NOTA 1GFF2 1S2BA 2DVFA 2TUNA 4HVRA 1H30A 4HZFA 3GALA 4WM7C 3UKTA 5A33A 1D4VB 2YHJA 5CU1A 1GANA 4ES9A 1NCRC 4AHZA 2CNAA 1ZYBA 3IKWA 2X5IA 3B9IA 3H1WA 4S2HA 2R6QA 2XLAA 3ENRA 4KGQA 2JEMA 3JB4C 4IEXA 4L99A 3WG4A 4TSVA 2ZMKA 1QJZA 3ZX7A 4C0BA 5GLUA 4OHZA 4FPCA 3QLQA 3FMGA 1DHKB 4W65A 2XJUA 3AP9A 2VECA 1J58A 1NA1A 1ULGA 2UWBA 4W6XA 1ASJ2 4AHXA 4H7MA 1FOD1 1UKGA 2ZX2A 5E88A 2IXLA 1R093 4FVVA 1RUH1 4XOGA 1EY2A 3WP5A 2PLV2 4Q4W3 4G9SB 3VBUC 2YGLA 2ZJCA 1ULFA 2D40A 1QOOA 4PF5A 5H9RA 3ME2A 3T1MA 1AX0A 4Z07A 1RHI3 3AZWA 2GDFA 3HN1A 1OOPB 1Q8PA 2XJVA 1COV1 5HI0A 2JG8C 2E7AA 1AUYA 4MXWB 1HQLA 1CPNA 3LOIA 3O0WA 4D3WA 5DDJ2 1H8TB 2VG9A 4GIQA 5T3NA 3WUCA 4X8NA 3AXDA 5T5PA 4S2DA 4Z8BA 1R1A2 3O14A 2BNNA 4HSLA 1SLLA 2DCYA 2ZGLA 2VOKA 1RUI2 4AEDC 2FQPA 2Y38A 3IWZA 1RUD3 2K9ZA 1POV1 1QJY3 4XFCA 2RR13 2R30A 3AKPA 5A32A 1R1ZA 4DS0A 1REDA 1VP6A 3R4UA 5FBZA 3ZSMA 4JC1A 3VHNA 5D8AB 1PIV2 3V0BB 4YGEA 1PZ8A 1AF9A 1ALYA 3BPZA 4LE3A 2FMDA 3N3HA 3LB9A 4N53A 4QX5A 1LCLA 2WSUA 5HXVA 3D0JA 4HN1A 1UL9A 3HT1A 1U5IA 1FPN2 5K8SA 4NWWA 1UX6A 4FP3A 4PIYA 1OPMA 3POSA 5JR7B 3CJXA 5CNAA 4QM8A 3VV1A 4RS5C 3ZYJB 2RMU1 4ZU5A 5HCFA 1OOPA 3TN93 3URFA 3ZFEC 1SCSA 4MXWA 4AEMA 3MZHA 2WZR3 1H8TA 2XKOA 3NV2A 1O3TA 4OFGA 2CY6A 2VMIA 4IESA 3D82A 4XHBA 3MLKA 1WA4A 2OUHA 1YXWA 2VOXA 2HWB1 1Q8QA 4E27A 5EXOA 4META 2V09A 4I09A 4FAGA 5IT6A 5K0UB 2WJSA 1MEC2 2EA7A 4U36A 1O5UA 2R073 4NHMA 4R4ZA 3KS7A 2E6VA 4JGZB 5ABJB 2VMGA 1WW7A 4KU8A 2WQZC 4LA2A 1V9U3 5D1IA 1TNRA 2D3PA 4R9AA 3H3ZA 5HCAA 1J59A 2R041 2YUEA 4MH0E 4V1PA 4FTBA 4XXAA 5D8AA 5HBAA 1LOGA 4FCAA 5CG8A 2RM23 1F8VA 1KDKA 3VHPA 3WT3A 4XF3A 2B46X 2GH2A 4NVPA 5KHJA 5JDBA 1VB2A 4A7ZA 1DZRA 2Z5WA 4E9KA 2BPA2 4FXGB 1ZM1A 3QOPA 4AGVA 3VKFC 4B7KA 5CFDB 2JE9A 2ZZQA 4KWKA 3ZXLA 3B93A 3ZSKA 4AGRA 3GNEA 4AVCA 1UAIA 3LKJA 4XBQA 2QZ2A 2D6OX 2D93A 4MX3A 4ORFA 4YVWB 2RJLA 2VQAA 1AL0G 2ZPXA 4K6BA 4IERA 4Q29A 1RUC1 2K2SA 2VW0A 1IS5A 2C9AA 1PO23 3UJQA 2ZS6B 1RJ7A 4YVSB 1VBD2 1L3JA 3ATGA 4PLOA 4MYEA 4LNVA 1JN2P 5CFCB 1DQ4A 3IPVB 5K0UA 2YYOA 2A3XA 2GC2A 4JGZA 4Q4Y3 4LT5A 2BGCA 1BK1A 2GN7A 3R0RA 4WVWA 2FHRA 4CYDA 1BEV1 4ISRA 4YW3A 1V6MA 3B01A 3MI8A 4WVZA 4B3NA 4BZ4A 3RDIA 2OZ6A 1LECA 1W2UA 4KNCA 5DZEA 5CFDA 2GNBA 1O3RA 2WNVC 1EV12 2BNMA 4GMP1 3AZXA 2Y0IA 4C1WA 4LBKA 4PLNA 1B09A 1OQDA 1SEFA 3ZMNA 4ATFA 1MR5A 1O91A 4QQOA 1QDOA 4I30A 2EVXA 2B39A 4JGYB 2XJSA 2VULA 3IBMA 1OPOA 4AI3A 1SBEA 3IIAA 3ASIA 1AR81 3ELNA 3J4UH 1I3HA 3LAGA 2LALA 3OCPA 1ZREA 3KB5A 5AC93 3FLPA 4YVSA 4XF1A 3ZDSA 2PAEA 3E5UA 1LJ7A 4E2QA 2WA3A 4XQWA 1BXHA 1ZRDA 4QPIC 2HWD3 5CFCA 3IPVA 4FOYA 5JSRA 1YIPA 4GKXA 4Q0SA 1GQGA 3J8F3 5ACA1 1GZCA 4I01A 5JIAA 1REEA 2KXLA 4WM7B 1PM7A 4Y22B 2A7AA 2CWSA 5CADA 2PFWA 4QPGC 4DZGA 1XXNA 4KG0A 2ZHNA 1N3PA 1BKZA 4RHV3 1VBA2 2E51A 4EN8B 1AR71 4GXLA 2WFF2 2BVBA 1IZ3A 2R16A 5E1RA 3JBG1 5C33A 5JOZA 1PO12 3VBSB 1PHMA 3WP4A 2AREA 2ES3A 3ZSLA 5HCBA 1ASJ3 2XL9A 5A3MA 1JYCA 4JGYA 2Z79A 1SLAA 3TRSB 1RTVA 3M3OA 4F7ZA 4GH4B 2PLV3 2X29A 2YY1A 3ZYRA 3M3EA 1ZZ6A 1NOVA 3CJIC 4W6YA 2ZGUA 1KFXL 1DGWX 2A6VA 2NYYA 3VUOA 2RS52 5KBFA 1HV1A 1HX6A 2P3KA 3PVBB 2JX9A 5L36A 2C5DA 2LTNA 4WM7A 3UK9A 5KXCA 2G9GA 1VR3A 1BBT2 2YDEA 3M8LA 4Q1PA 5AFBA 3U07A 1TE1B 2RE9A 1R1A3 3VDDC 1S2KA 1G9AA 4BWOA 2PHWA 2ZKLA 4Y26A 1RUI3 1QJU1 1QY4A 5JSOA 1D0GA 1HIXA 1VAKA 3WDYA 3AMQA 2AR6A 3MW4A 1QJX1 1SLCA 5FDBA 1ZZCA 3EQEA 2IZWA 1MZ6A 3OY8B 4ZU4A 3JD71 4DRRA 4AVAA 1RUC2 2PHDA 4AK3A 4AVSA 1RL3A 4CP2A 1PIV3 3N7JA 3RJ2X 1NCQB 1ZBE1 2XBO2 2VNOA 4HVQA 1HRV3 1TMF2 2DFBA 1AVBA 3EJKA 3P3NA 3VBUA 4YG6A 4GH4A 5FCCA 2MPFA 1NZCA 5K9YA 3RYKA 2WSVA 1FPN3 1LOBA 5L7OB 2XPJA 1XYPA 2CGOA 4FPYA 4HK9A 4NN0A 2XG3A 5EFUA 1NG0A 5C6CA 3RI9A 1QNWA 4CDUB 1OFSA 3VBFC 4F8AA 4M3CE 3S0MA 2JG8A 1BEV2 3AMHA 1FX5A 4XW3A 2WLQA 3MF9A 3VZMA 1UU4A 4I0WB 4AW7A 3B02A 2FMYA 3BTAA 1XRUA 1FV3A 2UYBA 5GALA 1AXYA 4UBHA 4LBQB 4YGCA 4AFCA 3I2DA 3WXPA 5C8CB 4J1XA 1HW5A 4I0AA 5GLWA 3SNMA 1YCIA 1J3RA 4EROA 3U4XA 4L8QA 1MEC3 3R6SA 2YPJA 3SLIA 1QKQA 2IFRA 4QXKA 1QU0A 4XJUA 1CN1A 2E53A 1W0OA 1DYPA 4EJRA 2OW4A 3DF0A 2DURA 3OY8A 4XZPA 5FAXA 4Z92B 3UL2A 2HWF2 1FATA 4YZ3A 3WW1A 1H9PA 1AR82 1ULEA 4Q4V1 2HEWF 3MFCA 1G6NA 1WLDA 2D5FA 1NCQA 5KXBA 4XPVA 4RL7A 1ZA4A 2CGNA 1GNZA 3FBYA 2QNKA 2DU1A 4COZA 4GA9A 5L7OA 4F83A 2GH8A 5FRAA 3JCIA 3S7IA 3IM0A 1YFYA 4Y1UA 4W6WA 5KHHA 1CQ9A 1TME1 3B7MA 2A6ZA 3HMYA 4CDUA 1I1EA 5DUWA 5BNOB 4IV1C 2H0BA 3A0NA 1HRI1 3AP4A 1RVF2 4LHNA 1AYN1 1CJDA 1GNHA 1VJ2A 1UU6A 2D6LX 1QDCA 4Q0VA 1LGBA 5CBLA 4HMZA 2PN5A 3ZXAC 3PLQA 4LBQA 1H4HA 4LTAA 1XNDA 5C8CA 1VBD3 1H2LA 1VBB2 1NYWA 1LULA 1PGW2 2Q1MA 3AB0A 2PELA 2MNGA 4LEJA 4YZ1A 2GNTA 3HIFA 2ILMA 4CEWC 1H1MA 2DCTA 4HPKB 5GZEA 1WLCA 1IQAA 2VUAA 3GBWA 3IN9A 5KWRA 2XJRA 1WW6A 2XJTA 4L11A 4YZ4A 3M3QA 1Q8VA 5BNNB 1Z7S3 1QNYA 4ONUA 4H14A 1K5MC 1LOCA 3BCWA 2IC1A 2RS32 1G9CA 1ND3B 5J37A 4QGMA 4XF9A 2F6BA 1HXS1 1F31A 1EV13 1B35C 2TBVA 2O0OA 4PBOA 1S0FA 1D4M3 4N9HA 2VQ0A 1U5ZA 3TBDA 1LU2A 3MLLA 5BNOA 4P9JA 4Q4X1 2NP0A 1RUF2 2NLRA 3AM2A 2O1QA 2VGDA 5JAXA 2JDZA 3MIBA 3AKSA 4P9IA 2GMMA 1AR92 4IEOA 2WZPP 2E7TA 4QPIB 4A7YA 3CU7A 4L9BA 5JOYA 1DGRN 4E4ZA 3EHKA 3AKRA 5GZGA 5C9AB 1KDMA 5BNPB 5FLJA 4WVMB 1ZBE2 4HPKA 4AFAA 4M0NA 5FPXA 4YARA 3AYCA 3ZN4A 1OI6A 2QUOA 2CTVA 1PGSA 1PVC1 4XFGA 4H55A 5I0TA 1GKBA 1N1YA 5H9SA 2P3IA 1H2KA 3MIGA 1RINA 4CEYC 4XF0A 5J48A 2GC0A 2WNVA 2CAUA 1VBA3 4IEWA 5A33B 2XJQA 1S0DA 4IQPA 4Q8LA 2VVDA 4LLFA 1PNGA 1ZBA1 2WFF3 2H0VA 5T55A 2XVLA 2BVVA 2X5IB 2XB6C 2A70A 1CAWA 2XHKA 1PO13 3WDVA 3C2UA 4XE9A 3VBRB 4ZKTB 4HT1T 3ST7A 1Q8OA 2B9UA 3MIDA 4BA6A 2JXAA 1RUJ1 3K48A 3MIHA 4JRLA 4IV3C 1DIWA 5H9QA 4QPIA 2EAKA 1Q5OA 2RS53 2A73B 5C9AA 4MSVA 4A3XA 4MXVA 4RFT0 4WVMA 3AP6A 4DY5A 1J3QA 3D8CA 4N43C 3ZXJA 4LHKA 3H7JA 4XIOA 1V6LA 4Y1YA 2ZOEB 5FO9B 2XJPA 2RJKA 4QPGA 1BBT3 4A7KA 2W0XA 1LR5A 1GLHA 4OI2A 1LODA 1GSLA 1OHFA 4YM2A 2OPKA 1RUE1 2R061 2VH9A 5T52A 4CP0A 5GZFA 4BH9A 1S1AA 4Q0PA 4KWJA 3ZXDA 4O9GA 3VGIA 4AFMA 1W6QB 4GB31 1DZQA 1A3KA 2R1BA 4AI0A 4COVA 4Z82A 4BIFA 3UJOA 4FAHA 3VBRA 4R9CA 1TEIA 5A32B 2ZGTA 4N7UA 1NE4A 2XBO3 2HWE1 1OD5A 1TMF3 1FMD1 2D7FA 1C1FA 3KSCA 2AGSA 1PGL2 5GKAC 3NAPC 1M4WA 4CDQB 4R9BA 2ZCWA 4P5HA 4PDWC 1AXZA 3I54A 4N53B 1WD4A 3VBFB 2B45X 1UU5A 1G7YA 3OGGA 4FPHA 3HT2A 5T54A 4AVVA 3FJSA 1RUOA 3D4KA 1Y3TA 1BZWA 5KXDA 2GC3A 5GJ6A 1NQJA 2N7GA 3VBOC 2PAMA 1UKRA 4YW1A 4AWDA 2OZJA 1CAVB 1AYM1 5JWPA 5CG9A 4DB5A 1BMV2 3MGUA 4IEPA 4AG4A 4KWLA 2HYKA 4HL0A 3RQ0A 4HSJA 4XILA 3O7OA 2A3YA 3SHRA 3USSA 1EAH1 4AEJA 1W6QA 4JTOA 3CO2A 1M06G 2G9FA 1NLSA 1WUVA 2HWF3 3IDCB 2LUWA 3DGTA 3O12A 1RUG2 2C1FA 5FPZA 1AJOA 4F3JA 2EXKA 1S0BA 5FLIA 4YW5A 4CDQA 3AMPA 3S6PA 3WG1A 1UZZA 1VBC1 1LEMA 5JLVA 5TSWA 3OGJA 1QF3A 5A3LA 1OFNA 1Z0HA 2JENA 3MW3A 3VBFA 3LSDA 4J6GA 1CIWA 4DOUA 2QJVA 3V0AB 1VRH1 3T1LA 3PMEA 2P34A 5J09A 1AL23 1X33A 4DNYA 2WT0A 3CLPA 1ND2C 1RMU2 3RMXA 1C28A 1RVF3 3APBA 3VZKA 1UIKA 3QCWA 3OBTA 4FQ4A 3VKNA 1Q43A 5SV5A 2ZX4A 1LESA 3I7DA 4DMIA 1ZZ8A 3JQXA 1CAVA 2VPVA 4XFAA 3WHUA 4QQPA 2JD4A 3KCYA 1SLTA 4MUVA 4XTMA 1WLWA 1VBB3 4RSUA 1VBE1 3DPRC 1MQTB 5FO8B 1RIRA 4MGIE 4P9XA 1YWKA 1ZRCA 2ZHMA 2SBAA 3N4MA 3Q9OA 4MLOA 2A5ZA 3JU9A 3ZFFC 1MZ5A 2MEV3 3TWIA 4KGGA 3M3CA 3ILRA 1QQP1 2D6MA 2IWGB 1AX1A 1EP0A 1ULCA 2ENRA 1J3PA 3E6BA 1WMEA 3OYWB 1K5MB 2WLPA 2X8KA 1R081 3OD0A 2ZGPA 3AYAA 4BM8A 2RS33 1C57A 5F6KA 1S0IA 4QHBA 3QD6A 1V70A 5CVRA 2WIIB 1VLNA 3MW2A 3VBHB 2HWC1 2DUQA 2BBVA 2CL2A 2ZGRA 3ACLA 3V0AA 4YZ2A 1EYBA 2XH6A 1AR61 3MEPA 4LUMA 5FFOC 1RUF3 4MGYE 1YNAA 5FQ0A 4CDXC 4QMAA 2R062 1Y9QA 4M3CB 1AR93 4BMEA 2IFWA 1I6XA 2RS11 2I45A 1JH5A 2A6XA 4YNIA 4YSFA 2WS91 3O5SA 1MQTA 4WM8C 1RJ8A 2YV8A 1OSGA 4YLZA 3K51A 4AQ6A 1HV0A 1O3QA 5F1RA 4K7JA 4QQHA 2YC0A 5JI7A 4Q27A 2HWE2 3NW4A 3VL9A 4BLIA 1OLQA 1ULDA 5EJ3A 4AEKA 1FOD2 3OYWA 1K5MA 1RUH2 4NHKA 3VZOA 2VUJA 3UKNA 4GWNA 3FUOA 3ZFGC 2QDNA 1B35A 1OQEA 1JUIA 1WBFA 1DFQA 4XF4A 1G9DA 1LOFA 3ECQA 1X36A 3RRDA 4PJYA 3VBHA 2GALA 3HQXA 1R091 1C8M3 1LHVA 3GF6A 3ZO0B 1COV2 3B00A 4MV2A 4EN0A 4Q4W1 4XJ8A 2R1DA 2TNFA 4HETA 4M00A 5C4WB 1JXNA 4IV3B 2GC1A 2GAUA 3WCRA 4COYA 3LA3A 4NO4A 5LEKA 4M3CA 2Z69A 3U10A 4PIZA 5EYYA 1RHI1 4AFDA 3UV9A 2A3WA 2VNRA 2DU0A 4IEZA 3EO6A 1NY71 2NQYA 4XETA 4TWTA 4KH9A 4N43B 2R0HA 1FNZA 1LTEA 2NN8A 1LU1A 2WNUC 3TNPB 1IS3A 1XNKA 5BYNA 4PQ9A 2ZAHA 2HEYF 2EALA 4I3GA 5LK7B 1ZVFA 1RUD1 4AI2A 2HJIA 3MF6A 1A78A 4XBLA 1QXJA 1Z78A 1SBFA 4LBNA 1QJY1 3MDPA 2RR11 4B4QA 2UYAA 3B9CA 4KBBA 4HKWA 1NCRB 5GLTA 1DGLA 4XEZA 3H3UA 1S0CA 4YW2A 2Y0OA 4RR3C 3WLUA 2O8OA 4FOWA 1CD3G 2RMU2 4INDA 3VZNA 1U12A 1PZ7A 2Y26A 3MIFA 3NSTA 1GBGA 3H0OA 4HVOA 1MS3A 5KC5A 1VB4A 5C4WA 5I8TA 4I0BA 4IV3A 4RGGA 1YFWA 4QGNA 4XQDA 2PQQA 4HANA 1CGPA 3ZN6A 5JCTA 3VKOA 3DKWA 4OI1A 3VBUB 3VN4A 2HWB2 5BPXA 2Z42A 3TN91 1O4YA 5E8AA 1A8DA 4XMIA 2IXIA 1ONAA 4IETA 4N43A 2WZR1 4N90A 4JTNA 5EYXA 5GZCA 3TB0A 4N9IA 1XYNA 2JG8B 2Q0AA 2R042 2CAVA 3M2MA 1WGPA 2VOVA 3PHMA 4JQRA 3ZXKA 2R071 5DDJ3 3AFGA 2W52A 3H50A 1V9U1 3WD5A 1NA1C 1NCRA 3ILNA 2JKBA 4AEDB 4AQSA 4BOWA 3E6DA 1OA3A 3ZXEA 4FXKB 2PAKA 1X7NA 1WD3A 3OJBA 2RM21 2AUYA 4X8PA 2E9QA 1XNCA 3HAGA 2XGXA 4JV4A 4AHYA 5IK7A 1RUG3 2D6KA 4ISQA 3I8TA 3QH7A 3AZVA 4PDWA 2WS92 2QE3A 3PMSA 3SH5A 4LO5B 1H1AA 4KU7A 4Z1VA 3WG3A 3LZZA 2KA3A 5I8YA 3R4DB 5B2GB 5IK5A 2BFUS 5FMOL 2O8QA 3M7AA 2WT2A 5JI9A 1O5LA 1LHUA 1ND2B 4Y1XA 1WCDJ 4RS5B 1W6OA 4Q1RA 4B8EA 1V00A 1HQWA 1PO21 1RMU3 1BVVA 1J1TA 3WQ1A 3ZFEB 4LBQD 1YLLA 3SCHA 1DDLA 1KXGA 1WW4A 2EIGA 4Q4Y1 3SITA 4R52A 4YRDA 2GNDA 4AEDA 1PK6C 4OZXA 4X6QB 4JDOA 2DVDA 1DF0A 1NE6A 5JPNB 4FTSA 1IKPA 1OMIA 2QQPA 1EPZA 1X82A 4LO4B 2DCJA 3KGLA 2Z2SB 4IEVA 3WOGA 2YROA 4YFZA 1S0EA 2TEPA 1O7FA 1OOPC 4BMBA 4ASMB 1OQ1A 3G7DA 4QM9A 4HK8A 4YG0A 1UCXA 3LA7A 3H8UA 1ZX5A 3R4SA 3ZMOA 3PVOA 3VHRA 1LOAA 5JOXA 1C1LA 1V6NA 3USUB 1QXPA 4K9SA 4DFSA 4PIXA 1X8EA 5GM0A 2GMEA 2DTYA 1ND2A 2BW8A 1SMVA 5ACA2 4RS5A 4N7IA 1APNA 3IT8A 1RUD2 3HD8B 5AC91 2F4PA 3ZFEA 3GZAA 4FBFA 1OA4A 1C5HA 3AXEA 1DYKA 2HWD1 3CNAA 1U0AA 2HKXA 3GYDA 1IGOA 4FSJA 4LBMA 3IDEA 2ZACA 3VL8A 3R05A 3H9AA 3J8F1 3WVJA