1MR3F

Saccharomyces cerevisiae adp-ribosylation factor 2 (scarf2) complexed with gdp-3'p at 1.6a resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
177
structure length
177
Chain Sequence
ASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQSTCATSGEGLYEGLEWLSNNLKNQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of yeast ARF2 and ARL1: distinct roles for the N terminus in the structure and function of ARF family GTPases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords ADP-ribosylation factor 2
total genus 59
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2002-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1mr3F00
3X1YA 1TUEA 4JZKA 1ZM2A 1Z28A 4A6XA 1DAKA 4PPGA 4Q1EA 4R7ZA 1E2JA 1YR8A 4JLVA 3I73A 3QXHA 5C4GB 5E3HA 4EPXA 3V4RA 3ZVNA 4A36A 1SZPA 5JRZA 3IIKA 3U7GA 4CEJA 5FUXA 3SHFA 2H5EA 4FMCB 2QL6A 6Q21A 1SKQA 4YXWD 5L3QB 1G3QA 1T91A 3O8DA 4QGFA 1EFTA 3N5CA 2QU8A 4PAOA 2ZR9A 3WMEA 3KQHA 3PV0A 1FP6A 1AA9A 1Z83A 5JECA 1SKYE 1KNXA 1P75A 2QBYA 3AF4A 3ZGXA 1TPZA 5IK2A 3DHWC 1Z6AA 3CRQA 4OHZA 1AKYA 3GLIB 3R8CA 2A3RA 2QE7A 1I2DA 4OQFA 3UMFA 2YC2C 1IXZA 3R7WB 4TYPA 4LC1A 2ZS8A 3NG1A 1PJRA 5CM8B 1IXSB 5A5GA 3G5UA 3DEFA 1QG2A 4RCYA 4QRHA 5EUQB 4Q4AB 2BCGY 1SKYB 4LV6A 4B3GA 3F0TA 2DBYA 2IYYA 3EG5A 2GILA 3CM0A 1G9XA 2PLFA 3UWKA 4FI3C 4QM7A 3GLGE 2NMVA 4NYIR 1JAHA 1CKEA 1E9CA 3U7EB 4V0OA 4CIDA 1BO6A 1GIAA 2DCUA 2QG6A 3KJIA 1AQUA 1ZCAA 2BV3A 5EXSA 1KI3A 4JMPA 1SXJB 4JVMA 4RFSB 1N2CE 2IXFA 3ADCA 3K9HA 2ZXUA 1E96A 1DELA 4MYTA 1OXXK 4RD4A 4DLRA 2NO7A 1GRQA 1KAGA 1S96A 1FL9A 1NVUQ 1WXQA 1IN8A 3K0EA 2O0KA 3EW9A 1S2MA 3A58B 4KODA 1GKYA 1COWA 2AFIE 4Q18A 1E2QA 1KK3A 2FX3A 3RNLA 2ZM5A 4ZI3A 4QGGA 2JJ1A 2H57A 2EYQA 3TK1A 4ZV4A 4I99A 3V9PA 1X6VA 5L3QA 5FUYA 1AIPA 1NVVR 2WAXA 4QHTA 4JL5A 2QP9X 3SJBA 2YINC 4OYHA 1ZUIA 4GZMA 4POAA 4K46A 1FQKA 2ZYVX 3TLXA 2IYQA 1WP9A 3HU3A 1XCGB 3AVYA 3C15C 3CR8A 3BH0A 3AF3A 1XXHA 3I72A 4Q9JA 4GZLA 3B78A 5G3YA 3LFUA 4KBGA 3TH5A 2HT6A 1QHHA 4URUR 3UG6A 1OHHD 4TTPA 1II8B 5JWOA 3K70D 5F98A 4B35A 5JJLA 2I1VB 3QI2A 3VR6A 1DOAA 1P9RA 1G4UR 4D4MA 3CLVA 1XXHE 2O8FB 4WXPA 3TNFA 3LW8A 3FKSD 2WTUA 1AZSC 1NIJA 5B2ZA 3CR7A 4URWR 4Z8XA 1Z0IA 3RLFA 4FWTA 2BOVA 2Q3HA 5G41A 2C77A 3K0FB 3KXLA 1FX0B 5AJZA 3ZS8A 3DZDA 1Z6XA 4BQSA 5F9HA 1XMSA 4OK3A 1TQ2A 4WIAA 4B32A 3QJYA 4QJ5A 3LLMA 4DSTA 1XDBA 1EFHA 2OCPA 4DWJA 2OHFA 1EESA 1BH2A 3NVAA 3T35A 1OXVA 4CEIA 5EQTA 3CRVA 1LNZA 1VHLA 5FBLB 3B2EA 1Q3HA 4B47A 1TTTA 1US8A 4WXRA 5K8UA 4MGYR 1JJ7A 3K0AB 1JBKA 2ASEA 3ND8A 3OEED 3QPVA 1KDTA 1LF0A 3L82B 5CJPA 1SVSA 4PXAA 3EZ6A 2HUPA 5C18A 1KTVA 3LXRA 5CK5A 2P65A 4M22A 3EZ2A 2XJ4A 2BHRA 3UXMA 3NBYC 3RSLA 3R9WA 3MG9A 5C46F 1NNEA 3QG1A 3IIJA 1A2KC 1XEWX 3GMTA 4DZZA 2F3TA 2A30A 2AX4A 3W90A 1CULC 1FMLA 5E7IA 2VP5A 3D7MA 4JVLA 4MH0R 1HE8B 3TR0A 1IQPA 5SZKB 4XTCS 2XOKD 2A2ZA 4TT3D 1ZCBA 4AURA 1KMHA 2EFDB 2QQEA 4IFEA 2ZR0A 2GETA 1UBCA 2IK8A 4IJMA 1MO3A 3SJAA 2VHJA 2ZS7A 2OILA 1YJ5A 1E3MA 4KU4A 3EIEA 2VSOA 1R2QA 2ZRHA 3HPRA 1NLYA 2BJVA 3CPEA 3QENA 1PUIA 2G1KA 2GJKA 3FTQA 1Q1EA 2GDJA 1DARA 2G83A 3BB3A 5KHOC 3EPKA 1UEJA 1NRJB 1NMYA 3EPJA 1XTKA 2F1JA 3K09C 1G8HA 1ZD1A 3EIQA 3SEAA 5D3QA 5DYGA 4Q4HA 4M9SA 3ZS9A 5JSZB 2V7QD 1N6OA 2RHMA 1G16A 4Q9KA 1K5GA 1Z06A 3THYB 4ZIRB 3QEOA 1G20E 3MLEA 3REFA 1E9SA 3K8YA 2Q3MA 4OQXA 2Z5FA 1U8ZA 4B3XA 4RY2A 1MABB 2W6JD 1SXJC 2O8DA 4KVGA 3PR1A 4G3XA 4XOIA 4EUNA 4GNKA 3EZFA 4DHEA 4GP6A 3X1ZA 2D7CA 4Z1MD 4M1TA 4QBIA 1F48A 1MKYA 4UJ5A 4QBFA 4PC7A 3HP1A 1DAFA 1N25A 1ZINA 2B92A 3ND9A 2R62A 1ANKA 3VHLB 2ERYA 5TVKA 2ZUBA 1R8SA 3PCRB 4HAWA 4WBSA 1N5IA 3QPWA 3ZIAA 1P6XA 4NP6A 4RZUA 1LY1A 2NZ8A 5JZVA 3B13B 3C4JA 3TUZC 4IOLA 1E2IA 1G17A 4TYQA 3VFDA 1GZSA 1WBBA 3G0HA 4CGZA 3QXXA 3WBKA 1E4YA 1OXTA 4TLEA 2O8DB 1R4AA 4BFXA 5HKKA 4I1VA 2Z6VA 2A78A 4RD1A 4JJKA 2WOOA 4RZ2A 4LX0A 4B74A 4DBLC 4M21A 1NKTA 1ZM9A 3WP0A 3TVDA 4DLWA 5H1YA 1XCPA 4OI4A 2A9KA 2OESA 3VHXA 2F55A 1XD8A 2CCGA 4YLGA 4LHWA 4NH0A 4A4DA 5FL7A 4TMTA 2NO1A 4W7SA 4TWZA 4PC6A 1G3IA 1AN0A 2BVNA 4JSYA 2XZLA 2ZJAA 2J59A 3K0CA 5FPYA 5FOSA 4TZ6A 4A6PA 1Q0UA 3EASA 3LNCA 4NL4H 2CJWB 2I3BA 4V0ME 3GPLA 3AH8A 3CH5A 5AJWA 1FP7A 2UKDA 2X77A 2YWEA 1II9A 1H8HA 3T12A 1KI4A 3LD9A 4I81A 1ZU5A 1G3UA 3LBNA 3B1XA 1UKEA 2V4ZA 1GL7A 3ADDA 3AEZA 4KBFA 3OEHD 3TE6A 1ZNXA 2VYFA 4DLSA 2BEJA 1W4CA 5KNBA 2JATA 4IDQA 1NJGA 2WWIA 3Q3JB 5EUMA 4O3MA 3CX8A 2AD1A 5FOUA 1XTIA 3KZ1E 4XD7A 2R44A 3ASYA 3MJHA 3L8YA 3WP1B 2BMJA 2CEAA 5M04A 1SVKA 3LRPA 1D2MA 2KJQA 2OAP1 4A8JB 5FOTA 3WNCA 4AKEA 1G8PA 4ZDKA 2V6IA 4AG5A 2QRZA 3OAAD 2Z43A 2YOHA 3AM1A 5AUNB 2YV5A 1AS2A 1OFUX 2IYWA 3ADKA 4GFDA 3B8HA 3IO5A 2ZR7A 3M6AA 4CT5A 3MGCA 2EFGA 4DLXA 4ASUD 5KDLA 4F4JA 4M9XA 4PAQA 3TW4A 4BGDA 2QSZA 4X8OA 3X1XA 2P67A 1IJEA 5FUVA 1TNDA 3BXZA 4DLZA 3ASZA 4NYJR 5LDDC 2JGNA 421PA 1D9XA 1SVMA 4DCSA 2QAGC 4M1YA 2F43A 4M4SA 4PO9A 1N5JA 3SI7A 4A1FA 3A1SA 1OH8A 4QGAA 1RZ3A 1OYYA 4LHYA 4MITA 3NXSA 4Q1DA 1TL7C 2ZRAA 1GP2A 5FR1A 1NN1A 4OQMA 2FSGA 1US8B 5BN5A 2YVUA 4UNSA 4KLZA 4JL8A 3W3AA 1DAIA 4P4SA 3HPQA 3UMSA 1XX6A 4D25A 1Z08A 4KFTA 4MRNA 4CZ2A 1G5RA 4PPNA 1VKJA 2HCBA 2RHDA 5JLJA 5E7MA 2IYUA 2F1HA 2JJ2D 2WICA 3IBYA 1W36C 4OKSA 5KDDA 2ZSEA 2VHTA 4P3YA 5DO9A 3L43A 1O3YA 4TSFA 2A5JA 4V02A 5HTKA 5HPYB 5FBRB 3P4YA 2GXAA 4UJ3A 4KHZA 5BW8A 1DAEA 2BKUA 2H8KA 1XB2A 1WRBA 3IILA 4C0LA 5JJKA 2QAJA 4PR0A 1NF3A 4IXNA 4C9BA 3K0SA 1X1SA 1GFIA 1U8AA 5J4YA 3WHLA 4DLTA 2WJIA 2FF7A 3A1UA 3U44A 2D3WA 3DDCA 3M4YA 4G5QA 1NBMA 3BC1A 3CONA 4YDHB 4YMWA 3FGNA 4UNNA 5DHAA 4LV5B 5JFGA 2VHCA 2YZ2A 4Q1BA 1OIWA 2GCOB 4BFSA 3MD0A 4TYWA 1M1YE 2Q0HA 1IN4A 1JR3A 1QDEA 2Q9AA 2WMNB 3LX8A 4ILEA 1QHXA 2FE4A 3UMRA 1DTSA 2OUKA 2V9PA 2C95A 4HAUA 3SHWA 1Z63A 2NOAA 3ZVRA 2NO6A 3ZZTA 4BRWA 1N0UA 1NKSA 2FNAA 1P61B 2NPIA 1JI0A 1KI6A 2OCAA 1E69A 4ON9A 3WNBA 3GJXC 1R0YA 5CYPA 4URYR 2QTHA 2JIZD 2X1VA 4DLUA 4EIWA 3OZXA 1Z8FA 4C0QC 2QORA 5KNCA 4PSAA 3CO5A 4K81B 4LBZA 2C99A 2ZRPA 4DEXA 3I5YA 2NPFA 1QHIA 2BKEA 1W0KA 2JCSA 1R8QA 2WVJA 4JLPA 4EQ6A 3SR0A 4ZCMA 2RGNC 5BN4A 1N5LA 3GLIA 3RS7A 2REOA 3TAHA 3AVVA 3AF2A 4ZKDA 2HJVA 5BXQC 1R6BX 1KDPA 3IPYA 2O8EB 3KKPA 2J7KA 2C9CA 1W7AA 4AYWA 2D7DA 1BMFD 5JRJA 1BS1A 2YWFA 2HYDA 5EJEA 2F1IA 5KDOA 4V03A 5IHPA 4DRZA 1E9FA 2AWOA 4NPHA 2RGCA 5HR5A 4N0EA 1W46A 3A36A 3F5FA 4TMWA 3CX6A 3CKLA 4E03A 2H92A 1ZUNB 4FMDB 2OEPA 1BYUA 1NMXA 4RKFA 1CTQA 2J9RA 1L4UA 4TLBA 3I5XA 3WRXC 3CUEF 4UKDA 1A5TA 3W9YA 2PEYA 1W49A 5KO2A 1CLUA 2IUSA 3CIOA 2ZJBA 4FW9A 4FMDF 3I32A 3VTKA 4II7A 5HZHA 1FW6A 1EK0A 3IQWA 3T1TA 3IPXA 2ZANA 5KPJA 4ACAA 3T1VA 4DUGA 1D5CA 5KSZA 2W2TA 2GBLA 4Y0AA 3NDPA 3KUDA 4AY2A 4B3CA 1D9ZA 2Q6TA 4C30A 2ZJOA 4LGMA 1ZMXA 1X8JA 3ETLA 3TMKA 3NC1C 4HUQA 1C4OA 3BH7A 1I4LD 1VYUA 2IUUA 4DSOA 4CEHA 4ESHA 1O87A 5JBQA 2A5DA 3NBZC 2OT3B 1J8MF 2XOKA 4DT1A 2JLZA 2ZYTX 4WA7A 1T6NA 3PQCA 2MMGA 2VF8A 2KBFA 2D2EA 2F1RA 2AD5A 1U0JA 4YDSA 3GCGA 2QP3A 2G0NA 2W58A 5KOYA 1QHYA 1ZVQA 4PO8A 5DE3A 2YNMA 2OXCA 2JJ8A 221PA 1HE1C 3A1TA 3R7WA 1HYQA 3L0SA 4DSNA 2GCNA 5J40A 1YZLA 5FTKA 3O8RA 5JS7A 3I61A 4FCTA 4XVQA 4WW0A 4IOKA 3KL4A 4MKFA 5CDFA 3NHBA 1Z6YA 1FQJA 1ZRHA 3PG5A 1LW7A 1SGWA 1U90A 2ZETA 4PTLA 3TSZA 2IEYA 3MCAA 4LRWA 4QNRA 3OHMA 3JZAA 3NC0C 3TW8B 1Q3TA 3IHWA 1Z29A 2AHOA 4HZUB 2GXQA 4L16A 1KMHB 1KOFA 4MGZR 4PSVA 2ZAMA 1QVRA 1DPFA 1KHTA 5EE0A 2DYKA 1DADA 2OO7A 4P4UA 2OFWA 4RD6A 2JJ1D 3U3KA 2B6HA 1XBTA 4F93B 5H68A 2QY9A 3BFVA 3Q8XB 2PMDA 4W5WA 3T34A 3CNLA 2WAYA 3RABA 3FMPB 1YHNA 1AGPA 2BMEA 5G53C 4B75A 1MABA 4EPWA 1XJCA 1Z2AA 4IRUB 1C1YA 4DT1B 3UANA 4FCWA 4TMVA 2CHGA 3B9QA 4NDZA 2WKRA 1YR7A 2Q9BA 4HLDA 4YXWA 4OI2A 4G0NA 4HDCA 4V0KA 2ZQ5A 4L9WA 1LS1A 1VYVA 1ESNA 3PXGA 4DSUA 4JLDA 1NY6A 2BWJA 5GVRA 5HCNA 1KSFX 1ZUHA 2JEOA 1R0WA 3SYKA 3VR2A 2R8RA 2OFOA 1XMIA 5IK2D 2ZRKA 5KTYA 4AKGA 3WYGA 2WWXA 4L5BA 4MGIR 4C0BA 2VRWA 4OJQA 2DFLA 2RMKA 2OSBA 4XWAA 5KSOA 1W36B 2GRJA 3AVUA 1M7BA 3PUVA 3CZQA 5JSZA 2RB4A 4EPVA 1TF5A 5CB6A 2PZFA 1BIFA 1P9NA 2C04A 3ZYCA 2YWGA 4U02A 5AUOB 3TKLA 3ZJYA 4JBYA 4EFMA 3VR1A 1HA3A 2DPXA 2IXEA 3GEIA 1JPNA 4Q1AA 3SYLA 5DN6D 2XNDA 1U0HC 2V55B 3PUWA 4RD0A 1WA5A 2RKOA 4Q00A 1P73A 5B30A 2JA1A 2E87A 2JAQA 4UXIA 5ELXA 4TN1A 3R20A 4AYXA 2R65A 2AXNA 4EJSA 4QFMA 3LW7A 2CNWA 1XP8A 5EE1A 2EU8A 1QHHB 3QXJA 4C0AC 3UIEA 4DLYA 3E2IA 4RCZA 3H86A 1EFCA 4H9GA 1F60A 4BE7B 3U44B 1MR3F 1W5TA 1WB9A 4JLKA 2G0TA 1U9IA 3Q7QA 1A4RA 5E95A 4O2RA 1OH7A 3B1WA 5JHGB 3ZZUA 2K5UA 4RZXA 4NYMR 3AQ4A 1Z6GA 2GEUA 3VU9A 1KO4A 1IBRA 1ZD9A 4F92B 1VG1A 3T15A 1ELOA 3KUCA 2PL3A 2IL1A 2IBMA 1T3HA 1VTKA 5BN3A 3C5HA 1IJFA 4Q7KA 2IC5A 1P2SA 4ZDJA 1X8LA 4HB3A 4S35A 2DHRA 2QMEA 4LHZA 4B3DA 4TT3A 2Q21A 2EFCB 1X1RA 3VR5A 4A0GA 1G291 3QKSB 4BEJA 4DKXA 1EX6A 4CEIB 4MQBA 3W6PA 4PQFA 1GOTA 2GESA 2QMUA 2R2AA 2OBNA 4NYIQ 5CM9C 4DCUA 5DIFA 4JL6A 2VEDA 1OHHA 3WYAA 2RH5A 4BRUA 2FFHA 3K0AA 2J0SA 1KSHA 5UKDA 4MUBA 4CRWB 1RFLA 2GF9A 4TLAA 1G6OA 3GFOA 2VSXA 4QJ4A 1U99A 5H70A 5TB5A 1W36D 2V8OA 4KI0A 1RPZA 4GDFA 5SZIA 5JCZA 2VSFA 2NGRA 1IM2A 4LJ4A 1F3OA 3SU8A 2J0VA 4FMCF 4FINA 4B6FA 3LO5A 3GFTA 4DIEA 1WE2A 1VCIA 1E2DA 2WWYA 3PUZA 4AK9A 2V1UA 1R7RA 1KK2A 1GNPA 1SVOA 3CWZA 2OAQ1 4A0RA 4QJ3A 1AQYA 3SJZA 4WAUA 2CCKA 5FL7D 3Q9LA 3B5JA 3HWSA 3Q7PA 4MRPA 2YWHA 2FWRA 5DLQC 3W3ZB 4D4KA 5K8LA 4IDPA 5FTJA 5DHFA 4Z8YA 3OIUA 3FHOA 1E94E 1EFRA 1R5OA 1IY1A 5JHHB 4M0LA 2CXXA 2ZTSA 2GEDA 3JVVA 5EE9A 2FPMA 3GLGA 4MRVA 4LJ6A 4JVNA 1N0VC 4TQ9A 4BLOA 5CDFE 1VG9B 1EWRA 1XD2A 3PVSA 3GJ5A 4JJZA 3U60B 3WY9A 1H8HD 1U8YA 2NTYC 1KK0A 2PX0A 4F4CA 1UBFA 2GK6A 4IW3B 2ORVA 2PBRA 2YC4C 2ZROA 4WVFA 3U7FB 4EDHA 1VYTA 3OEHA 1QF9A 1G5PA 4A15A 4LBVA 3I92A 3CF6R 4GOKA 3JZMA 3CNOA 2ZSFA 1WMSA 3A4MA 1GVNB 1U94A 2J41A 3U3JA 4MKGA 1KSGA 1C9KA 4OHVA 4B33A 5KU1A 1GRRA 1UJ2A 4D0GA 4Q7JB 4C7OB 2VP4A 1P2UA 3A8TA 1E4VA 2B8TA 3LV8A 2EFHB 5H8WA 4TL8A 3KTAA 2EYUA 1P3JA 3RRZA 5KSPA 1E9DA 1NBMD 4ZDIA 4WZ6A 1S1MA 2P0EA 4OK5A 721PA 3GLGB 4MGKR 2GZHA 4TYNA 1TX4B 4HAVA 1JR3D 4ACBA 1YKSA 2XB2A 4DLVA 1IY0A 3GD7A 3WXMA 4TMZA 5JEEA 2IW3A 3EA5A 4EFNA 3PUXA 3QKSA 4IDNA 5FFMA 1TF2A 4D4JA 2O5VA 1VIYA 2FPKA 2QRNA 1IOZA 5TY0A 2QZ4A 2QPOA 1KKMA 5FI1B 5FTMA 2ZJ5A 2ONKA 3MAAC 1VDZA 1ZIOA 2B8WA 3CF2A 3QF4B 4FXPA 1KSJA 3Q72A 4KCGA 3GJ8A 3K70C 1Q21A 2BDTA 3VU9B 5AJXA 1T0HB 2NO0A 3BD9A 4JBWA 1N6KA 3QBTA 1SVLA 1KI8A 1W2HA 4E22A 1CRQA 4PHHA 1W48A 4AI6A 2AL7A 3QKRB 1CJMA 4Q01A 4G01B 2PMKA 5BWMA 1KJWA 3NEYA 2QM8A 2WSSD 3AKYA 4IOJA 2JLQA 2X8AA 2ODEA 1E32A 1KZGB 2QTFA 1YRAA 1CBUA 3C7KA 4RD2A 4URVR 3B1ZA 3BERA 1OYWA 3IEUA 4X8MA 2NO9A 4D2IA 5B58C 2FSIA 3K70B 821PA 3LDAA 3EZ9A 4CYMA 3RS0A 4BUJA 1ZW6A 1P9WA 2W00A 4PC3A 2WJJA 1UAAA 3V00A 4MYHA 4TMKA 3PFIA 1ZC3A 3C16C 1LF5A 4LHVA 3PENA 4C2UA 2XGJA 4RKEA 2XSZD 5GADl 3AVWA 1QHGA 1RW4A 3F8TA 2DY1A 4JLJA 1G6HA 2CHQA 2FU5C 3RRNA 3NEJA 4TSFD 1GILA 4R2HA 4D80A 4D0NA 3SYNA 3PEUA 2YKGA 5HKKD 1CJTC 1UFQA 2ZAOA 3NH6A 1BOFA 2GJ9A 1EGAA 1OFIA 3NBXX 1XEXB 2GAAA 2QSYA 2KB0A 1QHSA 2QNRA 3QVUA 1G64A 4DUGD 2FFQA 3UK6A 3EARA 3FDIA 3GLFE 3TBKA 5FOWA 4NCIA 4XH9B 3CRRA 1KJZA 1U9IC 2Z0MA 3B82A 1KO8A 1XJQA 3DMDA 4HLCA 3KKOA 3ZVLA 4IHQA 4WZBE 1SHKA 2A5YB 3GJ6A 3GJ4A 2ZRJA 1FFHA 2QP4A 1E2LA 3MMPA 4OJKA 4KSCA 2QT0A 1DBSA 1RJ9B 2ERXA 4GOXA 5FOVA 3RS4A 4NZYA 2IUTA 3PJRA 1QVAA 3EA0A 4DC9A 1DE0A 2BC9A 3J81k 4C0JA 3K09A 3TUJC 4LYFA 4DDWA 1OB5A 4LY6A 1CJVC 1Q1QA 4E09A 1NG1A 2GBLC 1M34E 4I1UA 4PFSA 3OESA 2AKYA 2FN4A 1XEXA 3N2IA 1K6MA 1GKIA 4W9MC 2ZYWX 3A4LA 1P60A 3BGWA 3DM9B 4BLSA 3CB4A 3U61B 4OBEA 4ZO4A 2NQ2C 4H1VA 5GVSA 1RRPA 1E99A 4XD7D 1IN7A 3KB2A 1HY3A 3O8BA 1EG7A 1JQLB 1R0XA 1T5LA 1TQ6A 4HUQB 3AF0A 3CNNA 1DAHA 4U5XA 4BFWA 1BMFA 1JXOA 5EZ5A 2O8BB 3U2QA 5BYKA 2RCNA 2XTMA 3NKVA 4BFUA 3SBEA 4PX9A 1G8FA 2OCYC 2ZI3A 4OHYA 1DEKA 2CVFA 2AN9A 1TF7A 1Q22A 3W5JA 4HYYA 3LWNA 2CHVA 1RYHA 2IWHA 4LJYA 3ONWA 4IDOA 3QPUA 3GLFB 3LQRA 1NI3A 4UNQA 4PHFA 1LS6A 2WHXA 4H1UA 1UBGA 3IDQA 4W5JA 2GXSA 3AGPA 1B0UA 3BORA 1OFTA 2GZAA 4N0DA 2W0SA 1K5DA 1W44A 4LC0A 1CR4A 2IYRA 3C41J 2N42A 4JS0A 1OW3B 4D82A 2WV9A 4RJLA 2VQSA 2QMHA 3ZLJA 1IXRC 1FNMA 4OI0A 3L8ZA 2OM2A 2WPDD 3LVQE 2BM1A 1Y3AA 2OBMA 3HDTA 3ZQ6A 3EC2A 2ZU0C 3QNUA 2IXGA 4C2TA 3U3RA 5IT5A 1W1WA 4ZCIA 4TQAA 2GK7A 1XEWY 1OKKD 2I4IA 2X2FA 4D81A 3LQQA 3FFBA 4BPBA 3P1JA 1TQ4A 4OI1A 4PANA 4N1AA 2YOFA 4P4SB 1JR3E 2WKPA 2XB4A 2O52A 4GPTA 1E98A 1KI1A 4Q5IA 3QSYA 4ARZB 1XTRA 3L2OB 2Q3FA 5JCPA 4QHYA 4UXHA 1CXZA 1Z6TA 5CK4A 1P72A 5E7JA 4R71A 2ZRNA 2HYIC 2VLIA 2ZI7A 4M8NE 1GNRA 2HLDA 4P32A 1M2OB 1Z22A 3GEEA 3HR8A 4HZIA 3L0IB 3KTAB 2FFBA 1ZD8A 1JECA 2EQBA 1G7RA 2FEOA 2RGNA 1FTNA 3BBPA 1DS6A 1IAQA 3TGPA 2ZJ8A 3KDSE 4TTQA 1S3GA 1VCNA 4TTRA 2PEZA 2ZE7A 2AK2A 3KJGA 1RVDA 1WQ1R 1YR9A 1YZQA 2W2VA 3V4FA 4A0HA 4B43A 1JJVA 4B34A 3THWB 1NVVQ 3EAQA 1NJFA 121PA 3GP8A 5JI2E 1VMAA 3U3MA 4M2LA 1E79D 4J0QA 4B3BA 1Z0AA 4KITB 4M1WA 1G19A 3AV0B 1MOZA 1ONBA 2HJGA 3UPUA 1KAOA 1ZNWA 1EX7A 4HDOB 1RKBA 4PSKA 4BECA 1RYFA 4DDTA 2PJZA 2OV2A 2CL0X 2RGXA 1JQJC 2CL7X 2O0JA 2ODNA 4RVCA 1XTQA 2FSHA 1KI2A 3AUYA 3G82C 3EWAA 1Q57A 3KKQA 1JNYA 4HLQB 4EPYA 3I8XA 5FI0B 2GF0A 4IFBA 1P4SA 4S2EA 3SNHA 4ARZA 3PEWA 1M8PA 1GUAA 1NL3A 3REGA 1IHUA 2P6RA 3SFZA 1G18A 5HZKA 3MFYA 1II8A 1EWQA 2BEKA 2FA9A 3BWDD 4YMUA 4Z51A 5FPSA 1D6JA 2REXB 1OF1A 5IDVA 1W0KD 4GMDA 5F9FA 1UF9A 1XZQA 1HT2E 4JLMA 2D06A 3W34A 5FBVB 1VHTA 3U4QB 2BBTA 2CMKA 5DYIA 2ZSAA 5CJ2A 2PT7A 1S8FA 3W5IA 1FOEB 4Q4HB 4HUTA 2GJAA 3LBIA 4GI7A 4LCBA 1ZAKA 2EFEB 4IDHA 4B44A 2X2EA 4UNRA 1OXUA 3T5GA 5CLLA 3FMOB 3I62A 4QM6A 1XF9A 2C78A 5TMPA 1P2VA 2RGDA 1VPLA 4Q9HA 1XPUA 2LCFA 3H84A 2KSQA 4BLTA 4OL0A 3GLHE 4HAZA 1ZNYA 4F4IA 1P62B 5DN6A 1ZYUA 1R5BA 4IXMA 3TJZA 3VKWA 4HATA 5J5CA 1N6PA 3TSOA 2QAGA 2X19A 4YMVA 3FB4A 5GJCA 1YZUA 3EWSA 1YZKA 2CJWA 2CNWD 2ZVQX 1ODFA 1Q20A 2LWIA 1OLOA 2YYZA 3BK7A 1MH1A 3QXSA 2DB3A 4JLNA 1PUJA 2VL7A 3RC8A 2G3YA 1N0WA 4UQOA 3FYHA 4KSBA 1Q12A 1QBKC 4YC7A 2XITA 3R8FA 2P6NA 3MJRA 4Q47A 2RAPA 1A82A 1HURA 3NBFA 2G6BA 2WWGA 5FPTA 2BCJQ 4JLAA 1KY3A 3C14C 2HDNB 3TUIC 3KJEA 3WRYC 2D2FA 4DCTA 2QMOA 1G7CA 1U0LA 2ZREA 3EPLA 1GTVA 5DNYB 3Q5EA 4IOMA 5AJVB 1YE8A 2QQ0A 2JLSA 1E2KA 1YRBA 1YZGA 4MKHA 3EPHA 4JT2A 3K53A 1KDRA 4GOJA 4NONA 5TARA 2O8FA 5KYKA 1NIPA 2GJ8A 5B57C 3TVTA 2WJYA 4Q4JB 3FVQA 1TEXA 3KFXA 1VIAA 4LDJA 2PCLA 1PVOA 2EWWA 3VX4A 1CF4A 2RGAA 1ZM4A 2IYTA 3KB1A 2G9NA 1GG2A 3UKDA 4C0HA 1WF3A 4OHWA 1L7VC 2WWWA 5EP4A 4ZDWA 3SZRA 4BEBA 4Q1CA 1EXMA 2IHYA 3CH4B 4KFRA 3PEYA 1SVWA 2AKAB 1FNNA 4LWZA 2VP2A 1S1CA 3LLUA 2R6GA 2IHBA 2IYXA 2GWHA 3S1AA 2JLUA 4DXAA 2HV8A 2OBLA 1U98A 4KJZA 4NCHA 4QXAA 5FBWB 3TIFA 5JWRA 3KQKA 2YHSA 5JWHA 4PO1A 3K0CC 5AK0A 4ZIRA 3CBQA 1JEDA 1YU9A 2GVZC 3CW2A 1F2UB 4PHGA 1RC8A 1PZNA 4QKQA 3C8UA 4NCKA 2J46A 4PZZA 3ZD7A 1T8TA 2J7PD 1XJ0A 2E1RA 3MWKA 4AYTA 2ZE5A 4M9QA 2N46A 3LY5A 2HCJB 5DGXA 2G88A 2O0HA 1KJYA 5HE9A 2GVDC 4B2PA 1W0JA 3H1TA 2DFTA 2KI5A 4L8GA 1EFRD 2ZI9A 2N1BA 1ZNZA 3QEJA 2UZ3A 2L0XA 3AP1A 3TQFA 4GT1A 1T8UA 2FSFA 2Y8EA 2ZI4A 4DB4A 1N6IA 4C4PA 4URXR 2RGGA 2BJWA 2C03A 2CK3D 1E0AA 4LBYA 4FCVA 4DDUA 3EXAA 2IA5A 4QL3A 1E1RA 1T0JB 4LSGA 2FGJA 1TUIA 2A7QA 4A8JA 1GITA 3B85A 3FMFA 1Z0FA 1G7TA 2IYZA 2ZS9A 4O25A 3MSXA 5EXPA 3TAUA 1GAJA 5E4FA 1E0KA 4QOSA 2C9YA 2IYLD 2PT5A 2JLVA 5F3WB 2ONJA 1PLLA 3AVOA 3BOSA 5GJVC 2WBLC 1E1QD 2VBCA 4R9UC 1NSFA 4MRSA 2ODWA 1TU3A 2F9MA 1KIMA 1AS0A 2XNDD 3B1YA 3P27A 3SDZA 3CRW1 2IS6A 4M1KA 2DWPA 2FV8A 1Q1BA 1RRCA 2DFNA 4EQ6B 3GJ7A 3RWOA 4ZCLA 5LD2C 2QM7A 5L8VA 1B23P 4OQLA 2ZRLA 4MYUA 1G3MA 3ZH9B 2FEMA 1W4RA 3LBHA 2XJ9A 1QRAA 4EJSC 1BKDR 5A4JA 2VIIA 5D3MB 1VECA 1RRGA 3K0FA 1OE0A 1UBEA 3CF0A 2NZJA 2ZPTX 4JIMA 4D0LB 5L3SA 2D4HA 5EP2A 1E2PA 2ANBA 4HB0A 2WZQA 1G3RA 4DCNA 1AJEA 1XU4A 3UATA 4XVUA 4B2IA 2P5TB 2XTNA 3KKNA 4PHTA 4TL7A 2QTVB 1Z0JA 4A9AA 3CPJB 2AFHE 4KXFB 1TMKA 4N3NA 3T61A 2CE7A 1V5WA 4ZKEA 1IN5A 1NLFA 5FTLA 2GCOA 3W6NA 1SXJE 3QF4A 1XXHB 3K9GA 3P20A 2ZJ2A 2XXAA 1WCV1 4NU0A 4KV9A 1IONA 3DOFA 4B71A 2CLSA 3U5ZB 3AF1A 3FPAA 3B60A 3VQTA 1NG9A 1Z3IX 4IVRA 3A37A 4BFTA 4LI0A 1TAGA 2ATVA 5HE8A 4LYHA 1G5TA 4XSGA 2PX3A 3QVVA 1LVGA 1AKEA 4LYJA 1XRJA 3L0OA 4A2PA 1E2MA 4PZLA 4M1SA 3NWJA 1CU1A 1T3LA 2QAGB 1H8EA 2B7CA 4NTZA 1Y63A 1G8GA 1KI9A 5J4LA 1SXJA 1P5ZB 3SS8A 3BB4A 1PLJA 3PEVA 3QKUA 2VHQA 3BS4A 5KUTA 4TL9A 1KNQA 5SZHB 1OIXA 1XNJA 4HAYA 4DDVA 3KQNA 2I1QA 3D31A 3KXIA 1KK1A 4QBGB 4GP7A 4Q21A 4AG6A 1KKLA 1QHNA 2W6ID 3BRWD 1ESMA 3RRYA 1ZU4A 2HEIA 2WSSA 1GNQA 4CF7A 3HYRA 3FE2A 4ESVA 4DCVA 1JXMA 1N5KA 4WZAE 4DIDA 4TYYA 1N6RA 4NYJQ 1XZPA 4DJTA 2ZE8A 3LAWA 2YJTD 5FPKA 3LX5A 5FBQB 5C2JB 5AR1A 4ZI2A 1HQYE 2CLDX 1TQDA 5AUQA 2B7BA 4Q48A 2VH5R 3BFXA 4HEJA 4BZQA 3AUXA 4B2LA 2ZUCA 1S4QA 1G8YA 1UKYA 3OIVA 4C0KA 4EJSB 4JVSB 4EPRA 4YMSA 5HCIA 3DPUA 1J2JA 4TMXA 1AM4D 1NP6A 2OXRA 1OT3A 1E6CA 4LJ7A 3WMGA 2ZRIA 4GSYA 5C1BA 5LD2B 3RSOA 1CJKC 4Q7MB 3CRMA 1XTJA 4RD3A 2IYSA 3SE0A 5C4MA 1MO5A 1S9DA 4LPKA 1F6BA 1LFDB 4Q19A 5L3RA 3ZZ0A 4MUAA 1H65A 3B9PA 3I1FA 1J7KA 1CR0A 3QKRA 3W8RA 4US2R 2QBYB 1DO2A 4B6EA 5CITA 2FZLA 4LUCA 1NLZA 4QNMA 1X86B 1ZIPA 3ECCA 1BYIA 3BIFA 3N70A 3OIWA 2JDIA 3KQLA 4AC9A 4QBHA 5FPHA 1COWD 3PUYA 3IIMA 2CLCX 2CVHA 5J47A 4QHSA 3T1OA 2F3RA 3P4XA 3VKGA 3FHCB 2BM0A 2V6JA 5LBIA 2V3CC 2KBEA 1D8TA 5IRCD 3AVTA 1E2GA 1MV5A 2HT1A 3D6TB 2PH1A 4PZYA 2FFAA 4ZPXA 4HI0E 4PPQA 5K8IA 3QBVA 4W5HA 2XZOA 2A5FA 3DL0A 5G40A 4KFUA 4URZR 1YZNA 1PLKA 2VTKA 4LJ9A 1GL6A 1FUKA 3VR4A 2G1JA 3P32A 5TDHA 4MDFA 1UDXA 4LOAA 3N2EA 2XTZA 3IHLA 1M7GA 3CZPA 1N6LA 1RIFA 1OB2A 4XIGS 4MKIA 1OKKA 2F43B 4US1R 3T1QA 2J0UA 3WBJA 5IF9A 2IT1A 1LV7A 3F3YA 1KMQA 4U7DA 1U2RA 2DR3A 2P6UA 4XJXA 2GA8A 1F2TA 4ITRC 2WJGA 5G3ZA 2ZRFA 1S0UA 4EAQA 3RHFA 2PCJA 3QUSA 5LPNA 3FMIA 3BJIC 4JLOA 1HV8A 1GL9B 2H16A 2HLDD 3U6BA 2ATXA 1DAGA 3QOFA 1II0A 4Q4AA 4Q9IA 2ORIA 3DOEA 2XSZA 2FZ4A 4IEIA 3FFAA 4I4LA 2W83A 1NN3A 5DSZA 3K9NA 4BLRA 4PAMA 5LB4A 1T3SA 3CWQA 1X8KA 1J70A 2H7VA 3RWMB 5EP1A 5DI3A 3TRFA 1P7CA 1JPJA 5SZJA 3ZD6A 2JLRA 1UEIA 1P2TA 1S9HA 1VCOA 4BFVA 4F7WA 1MRNA 1ZM3A 2OE2A 1OPXA 3OE7A 4Q7LA 1VG8A 2REBA 3H0KA 2KWIA 1YR6A 1XTSA 1E9AA 1AK2A 4HAXA 3LH5A 3RC3A 5CIWA 3AVXA 1YVDA 2A5GA 1G7SA 1E79A 3MRSA 2JLXA 1OH6A 1JR6A 3DM5A 2O8BA 1KO1A 4IVPA 1UADA 1WDTA 5F2EA 3RS3A 2IEZA 2ZE6A 521PA 4FWIB 4FIDA 2BIFA 3VX3A 3MWJA 3THXA 3MWYW 2W2XA 1XD2B 3A4NA 4Q1FA 5CYOA 2J1LA 1E9EA 1NSTA 2IF2A 2QA5A 1F5NA 2WWFA 4LHXA 4LK2A 2ZJYA 4KAXA 4RZ3A 3Q85A 1IY2A 2RGEA 3NTUA 3TR5A 3GLFA 2FDCA 2VA8A 4TLCA 2F7SA 1OV4A 2QENA 3BH6A 1CRPA 4KVAA 1QG4A 1XPRA 4YQFA 2V1XA 4X8HA 3FHTA 3WMFA 4EFLA 1Z47A 4F38A 2WIAA 1W2GA 2IWRA 3ADBA 1J90A 3AGQA 3MUFA 4MDEA 1RJ9A 2PZGA 4BLQA 2HF8A 2LKCA 2R6CA 4BZXA 1FPMA 2ZRDA 2ODBA 1J8YF 4P4TA 2XAUA 2RGBA 2ZRCA 2R9VA 1M7HA 1N6HA 1W5SA 1MO6A 2PLRA 4MA4A 3HU1A 4P0TA 2ZSBA 2O8EA 4E07A 1SVIA 1ZM7A 3AVPA 2W0MA 3R9XA 4FMBB 1TEVA 5ANRB 5JS8A 1XMJA 1XEFA 1NVXQ 3RYTC 4A82A 1I4DD 2V54A 3RDPA 1GSIA 3OFNA 2SHKA 4KFSA 3IKJA 4EPTA 4O0MA 3ZQJA 3A6PC 1G4AE 2ZI6A 4Q66C 3AKCA 5L3VA 1Z2CA 2ZJZA 1MT0A 5EP3A 3E5HA 3SN6A 3OEEA 1ZP6A 5KSYA 4TQUS 1W0JD 5FTNA 4G1UC 1UKZA 2QN6A 3KX2A 1E2HA 1EFUA 2EVWX 2OZEA 1GWNA 1SQ5A 3K9LA 4TLDA 3W8NA 1NY5A 3SBDA 1XCMA 2WPDA 4CEHB 4HDQB 4HLUC 1YQTA 4MRRA 1K8RA 1IN6A 2J3EA 3IO3A 4XSHA 3ICEA 5B64A 4KO8A 2MSCB 3AB3A 1AZTA 2MSEB 3FKSA 4GBMA 1F2UA 4U00A 3DVLA 1T9HA 2OCBA 4D6PA 4JSTA 621PA 1FUUA 3DKPA 1MRSA 3THYA 2QE7D 3CPHA 3WYFA 3T5DA 1KYIA 1LTQA 2PJRA 4BZPA 3AP2A 2WJHA 2CL6X 2VHUA 1W4AA 3GQBA 1NBME 1FX0A 5TXGA 2O8CB 1R10A 2CCJA 4C3ZA 3B6EA 5FL3A 1WBDA 3RRMA 1W47A 2F6RA 5CIQA 4PC1A 3RS2A 3DMNA 5EXXA 4MYCA 2UZIR 3SFVA 3AKEA 3O8CA 4X8LA 3SOPA 4LJAA 1R5NA 4NHOA 4B48A 1ZJ6A 2VP6A 3IQXA 3QKTA 3E70C 4NYMQ 4HSEA 4Z54A 5JJIA 1G21E 5DI3B 4M1OA 2OG2A 4RFVA 2NIPA 4G5GA 4R98A 3T06B 2NG1A 2TMKA 1DG1G 3VNVA 2AXPA 2IS2A 2QPAA 1GKUB 1JB1A 2P5SA 5J4KA 2VF7A 2V7QA 1G41A 3AVQA 4Q03A 2WWHA 1E2NA 5EE3A 1HUQA 1LB1B 1FMJA 4B3FX 2DWOA 4BFYA 4RFSA 3GLIE 1GDDA 2FPLA 4L15A 1PV4A 1OH5A 3OF5A 3L0PA 4LBWA 1NN5A 2P3SA 4NBSA 4WOPA 2WSMA 2C98A 2J7PA 3HYTA 2HXSA 1L2TA 4TZ0A 3D8BA 1UKVY 2GEVA 5LB2A 3KJHA 2BBOA 1A2BA 2VO1A 3HJNA 1E2FA 3CX7A 4Q4LA 2J0UB 3QXCA 1T4GA 4Z1MA 1VG0B 4LJ8A 1CIPA 1E9RA 5AUPB 2IS1A 2IX3A 3FOZA 2P2LA 3GJ0A 5D3MA 1KI7A 2DFKB 1XWIA 2GJSA 2R6FA 5BQ5A 2FMXA 3BE4A 2G77B 5EE5B 1Q1ZA 2GZDA 1ZC4A 2QT1A 4M53A 4XWOA 2GNOA 2WOJA 3VAAA 3EZ7A 3EX7C 3U7HB 4OK6A 2CBZA 3H2YA 2ZRBA 1M6NA 1V43A 3ZVMA 3U3OA 2F9LA 1HQCA 2YOGA 1JAIA 2GKSA 8OHMA 2LKDA 1OJLA 4YONB 4B76A 1UPTA 4XTRA 2XEXA 4UNPA 2JLWA 4A92A 2XXAB 4NCNA 4PC2A 2ZITA 2BBSA 1KO5A 1L8QA 4V0NA 4K8OA 1L4YA 2GHIA 3FWYA 4FN5A 5TV2A 5AWFC 4XWKA 3PITA 2ZSDA 3B7GA 3IUYA 1JEEA 3I4LA 3AKDA 4HB2A 2FOLA 4A8JC 4A2WA 2AK3A 2FH5B 3C5CA 1G1MA 3NH9A 4TL6A 1AS3A 1RE0A 4CDGA 3HR7A 2H18A 4I1SA 1OFHA 4NMMA 1A1VA 5L3SB 1ZBDA 3NDBB 2AWNA 2R6AA 2JLYA 3IBGA 3QY0A 2ANCA 1J99A 4LV8B 1KZ7B 1HH4A 2J5XA 1HTWA 2VPPA 3RS5A 4GRAA 2DWQA 1FTSA 3ZDQA 2CE2X 3X1DA 3DKVA 1Z5ZA 3KKMA 1JALA 3LVRE 4LPSA 4AIIA 4JLBA 1SULA 1W4BA 4US0R 2VP9A 3THWA 4M9ZA 1SHZA 4NE2A 4LZZA 4ABYA 4YMTA 2ZIAA 2HF9A 1OXSC 4L4UA 1U81A 2FG5A 2H17A 3WHKA 2QI9C 1KY2A 1F2TB 3IEVA 1OSNA 1CR1A 3W6OA 3A1WA 1TADA 4M1MA 2BMFA 3TQCA 4BASA 2WM9B 4F91B 2XX3A 1X3SA 2ZI5A 3UG7A 5GJBA 5JEDA 4Q02A 2FJUA 3GJ3A 1E0SA 5FH9A 3P26A 1TU4A 2JDID 1I2MA 2XNSA 4LYAA 5JMTA 2JASA 1N6NA 2OLKA 2UVQA 3EC1A 3M1IA 5EXTA 4BLPA 1E0JA 3THOA 2QGZA 5K8TA 4AKIA 4KYIB 1AGRA 1UDWA 2ECKA 4I1OA 3RAPR 4OHXA 2MMCA 1Z0DA 2QUZA 4BWYA 4HZUA 2QROA 1NMZA 4IVQA 2KE5A 2GTPA 5FR2A 5P21A 4P31A 4Q4JA 1MO4A 3BFKA 4KYUA 3R9IA 5KNDA 3QIAA 3VNUA 3KFVA 2H1LA 1FZQA 3RVBA 1OIVA 1Z07A 1R0ZA 2OFXA 3WNDA 1Q44A 2GCPA 2JIZA 4P33A 3SC3A 2IS4A 2QPTA 2PZEA 4CEJB 4E5UA 3BAFA 1XD9A 1XMVA 4RSGA 5GJWC 2QEQA 2W6JA 2WIBA 2ZYUX 5DISB 5CB8A 2BBWA 3U6KA 2W6IA 4D26A 4B73A 4DB2A 3QF7A 2R6DA 1D2EA 2QGNA 2C8VA 4O2LA 5DH9A 1KGDA 4ERNA 5J4VA 4JYBA 4PPFA 3S1AB 4JKYA 1ETUA 3GLHA 3KXKA 1I4TD 3E1SA 4QG7A 4QC2A 2CK3A 2B21A 1GM5A 2EWVA 2EW1A 3AP3A 1A7JA 2IYVA 4JBXA 1E1RD 3UWOA 2WMOB 4NCJA 4UXJA 3SJCA 5DI9A 3VKHA 4DVGA 3NHAA 4L9SA 2C96A 1QZXA 4HB4A 5A0FA 3ZIAD 4G5SA 2Z4SA 2O8CA 2E9SA 3H4MA 1T5IA 4D4LA 1E9BA 4G5RA 1N3BA 3NIBA 4JKIA 4ASUA 4IEEA 4QGHA 4Y0VA 4IKEA 1KO7A 4HLUA 3BB1A 1H8ED 3GEHA 2GAOA 1HT1E 2J45A 4AD8A 1SXJD 3I8SA 3OIYA 4PQYA 3ICQB 3O47A 5EZ6B 2ZVPX 2MSDB 4XVRA 3OE7D 1E1QA 5KPDA 3VMFA 4G5OA 2GXUA 3GLHB 3Q5DA 1DO0A 1UM8A 1S3SA 1M74A 1NN0A 1XFAA 3D3QA 2C5LA 4PQRA 1CP2A 5AJYA 2CDNA 1NVWQ 5J4HA 3U4QA 3EIHA 2Q9CA 3KQUA 4FD2A 5FUWA 3M0EA 1DG3A 4BFZA 4JT4A 5BYJA 2J87A 4KLNA 2OLJA 3B1VA 2ZUDA 2XZPA 2ZEJA 3MWLA 4A0FA 2J0QA 3DZ8A 3SQWA 1Z0KA 3TSWA 1DAMA 2ORWA 2C9OA 2WKQA 4A2QA 2AR7A 1RRFA 3I3SR 2WJVA 1GRNA 1E2EA 4EKDA 4C0SA 2FGKA 4V0MA 3VR3A 2JJ2A 5CLQA 3RANA 3QQ5A 4JYCA 3PIRA 3QG5A 4NKRA 1YZTA 3HU2A 5FOXA 3X2SA 1CR2A 4OQNA 4DEYA 2D62A 4AWXA 3THXB 1XPOA 1CS4C 1KI6B 1VCMA 4AKHA 1DVRA 3JVUA 2Z83A 4CW7A 2HXYA 1HEIA 3LA6A 1D2NA 2VP0A 4C7OA 3OAAA 2Z4RA 1CEEA 1KDOA 4GL2A 4CT4B 3K1JA 4R2IA 2IF0A 5JI3E 2ZRGA 4LJ5A 4GMXA 4CVNA 4V0LA 3QE0A 3GFPA 3LXXA 2ZU6A 3FKQA 3OFND 3X1WA 2ZRMA 2BMDA 3IGFA 2C2HA 2D74A 3SQXA 1CJUC 3A1VA 4Q9LA 3DO6A
chains in the Genus database with same CATH superfamily
4D9CA 3QU4A 3OQIA 3OMXA 1BX0A 1TUEA 4WFKA 4WCFB 2FPGA 3X1YA 4A6XA 4K5QA 4XQEA 1VIMA 1DDOA 1NW6A 4H1TA 5C4GB 3I73A 5E3HA 1AUOA 1O7JA 3ZVNA 4J8PA 3DBIA 3U7GA 1NDUA 3FRJA 2H5EA 3I37X 1DNPA 3K4HA 4WNYA 2QLTA 4WE3A 2HHLA 1DTEA 4G1VA 1T34A 4IIFA 4JHXA 2UAGA 1MOQA 3QEBZ 3R9XB 3O8DA 1RYEA 2PGIA 2QU8A 2ZR9A 4PAOA 4F8EA 5JFOA 1Z83A 1CUEA 2HTEA 3P52A 5ECGC 2QBYA 1W5AA 4KQEA 1QIEA 1Z4OA 3ILHA 1AMUA 1JLSA 4JP2A 4OHZA 4XCQA 1AKYA 1SIWA 3JW8A 2WB2A 1YA6A 4A8TA 5JH7A 1O94C 1ADCA 4KXXA 1GQOA 2PGDA 1I2DA 3GA5A 3VPHA 1C9YA 1LDBA 2N47A 5BMVB 1CCWA 4TYPA 2ZS8A 4CNQA 1RFGE 1SUSA 2VT7A 1YS9A 1EP9A 2IP1A 3G5UA 4D4HA 2GUWA 5DZSA 2Z6UA 2B30A 1OC2A 2BCGY 4O5AA 4QASA 3H8JA 4RK0A 2I99A 2FPXA 1ABBA 2VWPA 3VYSB 3G88A 3IJRA 3NS7A 2QZJA 3EEIA 1ORIA 4I9UA 3BMXA 3LDHA 3ZWYA 2PLFA 4FI3C 1BHSA 1M1UA 4NYIR 1GPLA 4D46A 5LA6A 1Z4QA 1EA5A 2GI4A 5AOCA 2DCUA 1T9AA 3JQBC 1KVTA 1I1OA 1SXJB 4JVMA 5KC8A 5KS2A 3ADCA 2H31A 3RVQA 1NT4A 2PLWA 3OWHA 4NZMA 1MC8A 1OXXK 4M55A 1MOSA 1GRQA 4N3GA 4RD4A 4DLRA 1NVUQ 1ZK1A 5KAMA 4ZQGA 3P0EA 3ICCA 2IUFA 3VAZA 4EHNA 2ZUFA 1N2OA 2JJQA 3AY6A 3EW9A 1S2MA 2OD2A 4KODA 5DDIP 4Q18A 1KK3A 3FUVA 4Y98A 3A9VA 3IULA 3HHPA 4EYKA 1GPNA 2RGUA 1Z68A 5TSDA 1R88A 1G0NA 1KS9A 3PLNA 1UDBA 3OQPA 4MS1A 4C7KA 3TK1A 4I99A 4PLGA 2Y2VA 4YA6A 3QLEA 1X6VA 2UVPB 1XEAA 3QVGB 4P6VF 3VV3A 2WAXA 3VYRB 4F5DA 5EZSA 3DYIA 3SJBA 1ZUIA 4GZMA 4POAA 5DJ5A 4K46A 1FQKA 1M1YA 4WOKA 2JCVA 4LN1A 1CUAA 1QAMA 3PDIB 3RSHA 3WK5A 5CFLA 4JXXA 3EOAI 5BV0A 5KWSA 1XCGB 1K6XA 3JWGA 3OPNA 3OOEA 1XXHA 2AFIB 1PNVA 4QDTA 2EQ5A 2D1SA 3M3DA 3ZGLA 4BP9A 5AJTA 3B78A 1U2TA 4QQRA 3H1BA 4PS1A 5G3YA 2HT6A 1BCSA 2CB9A 5JWOA 1EMDA 1QHFA 2A3NA 4EL0A 3K70D 2G06A 2I1VB 3QI2A 3PC8A 2NT3A 3F8WA 1SIOA 3NETA 1GTRA 3N39C 4EHAA 4D4MA 4H7DA 1ZN9A 3PUIA 4ZC8A 2Z8YA 1TM1E 4H6XA 1I4EB 4QTTB 4YGYA 3TNFA 5C35A 3LW8A 4NDAA 3WVNA 1NIJA 3R7BA 3I6YA 2ADMA 2P2DA 3P9QA 3CEPB 4PR3A 5IDYA 2XCSB 3ZK9A 1ULAA 2IUYA 3K9QO 1BE8A 3HG7A 3SR4A 1ZN7A 1UK9A 3M4XA 2RARA 5G41A 2B7LA 3GGPA 3ZS8A 5AVXA 2AB0A 3DZDA 3JCZA 4PY2A 1V3TA 4BO9A 4DYHA 2W2KA 2NVOA 2NZVG 1XMSA 1M73E 1CUYA 1U0GA 3A70A 3JZFA 5J5AA 4BVFA 2AJCA 4DSTA 2PUCA 1XDBA 3O9MA 2VZ8A 3T35A 4QECA 5HG0A 4MQLA 3FRIA 3CRVA 5JXWA 1C50A 1VHDA 2ODTX 4RV5A 4OXKA 1LNZA 1VHLA 3WI7A 1Y5NA 1Q3HA 3I9V6 5ADWA 1AGYA 3ZWVA 3MF4A 2Y2UA 3K0AB 1JBKA 3OEED 3ND8A 5CJPA 5TQ2A 1LF0A 3SC4A 4IZ6A 4IINA 3ZWQA 2AZDA 1E92A 4UHEA 4CCWA 1VJ0A 1IMJA 3OJXA 2P65A 4M22A 2XJ4A 2Z3ZA 4ZZIA 2FW7A 3SEFA 3G5TA 4FFOA 2BGMA 1IY8A 3R9WA 3MG9A 4L0MA 2XMRA 1FU8A 3DQQA 3GUCA 3ILXA 3KEFA 4X3OA 3QTTA 3A9CA 1RWMA 2D54A 3IIJA 2AN5A 2HMWA 2PPVA 3E3OA 1F9EA 3GMTA 5ALKA 1FYXA 3HXKA 3AM3A 3FTDA 2VP5A 3D6HA 1L8AA 3COPA 4ZQHA 1IQPA 1ZK4A 4MVJP 4GWLA 3V1UA 1QUEA 1WCWA 5L95A 4XTCS 1FTGA 1WPQA 3G9QA 1KYTA 1EFVA 4Q3BA 3JQAB 4WNCA 1NF8A 1NC3A 3L6UA 4IFEA 2I80A 4CLDA 1HZZA 2VHJA 1TKAA 3PD1A 5THQA 1HE4A 1YJ5A 3K16A 3RFTA 1J2UA 3UUGA 2HXGA 1QRDA 1W35A 4FHDA 4PGHA 3OFVA 4X24A 5AM3A 2FSVC 4RC9A 5U1PA 4EYSA 4ZOBA 2XVXA 4C0XA 1CP3A 3ZDEA 2PRKA 1CQJA 3CPEA 3QENA 3ROEA 4MZDA 2J4DA 4OFZA 1NW4A 4OQYA 4CM4A 2WUEA 3G8AA 4PX5A 3TQSA 4IHJA 4GRIA 3TLGA 3U1VA 3W79A 5GINE 1DARA 3KTOA 2YR0A 3EPKA 2YJZA 3FYDA 2PBFA 4NE9A 1XDZA 3ULKA 3E1KA 3BA6A 3KKLA 3RPEA 5KOIA 4DA0A 4X1KB 5KNDD 2J5QA 1WU7A 1QIDA 4MP6A 1PT6A 4PWZA 1CUUA 5ALUA 2DPGA 1N6OA 3ZE1B 3V8MA 1ZEMA 4D4IA 1ZD2P 5IVKA 4RM3A 1K5GA 3HRIA 4KUGA 1Z06A 2R60A 3QEOA 3MLEA 3REFA 1E9SA 3EIUA 4G0UA 4B3XA 4J1SA 5KTRA 1JKXA 3F90A 1B6SA 5BW6B 1SXJC 4LXXA 2O8DA 4PHCA 4RE6A 1RR6A 3R23A 3PR1A 1BKSB 3EFHA 4FKBA 1QB7A 1OREA 1C30A 1R9NA 3C6KA 1AC5A 1OGJA 5CT4A 3OQ6A 1G9TA 2O2GA 2XRFA 4GP6A 5LBUA 3SXUA 1PBNA 2D7CA 3GCDA 5TQVA 4MPRA 3X0DA 3NWEA 2O2YA 4RSRA 2RHJA 2BRUC 2EHJA 1N7HA 4PC7A 3O73A 2W2LA 4JXJA 1N25A 1PWZA 2GEFA 1QF6A 3LPDA 2DBRA 2R62A 3C8DA 2A67A 4PYMA 2ERYA 3ZLVA 2ZUBA 3IBFA 2BYTA 4JB8A 4BNMA 4O29A 3RYCA 4UVDA 1HNNA 4WBSA 4OLBA 3ZWOA 1I3NA 3UWMA 3RU9A 4NP6A 1DCFA 3KQTA 3B13B 4ZMBA 1E2IA 5FAKA 1JX6A 4OH1A 4WTOA 3DLTA 2Z2YA 3VFDA 4Q4CA 3QA9A 4TWJA 4Q39A 4I3HA 7REQA 4CGZA 3R5XA 3LT1A 4TLEA 1DBRA 4BQRA 4DIUA 5HKKA 3DLCA 1WW8A 2P91A 2QLMA 3O94A 4IP0A 4RD1A 5JYBA 3I1IA 1SHJA 2WIJA 3NRBA 2P1DA 4IIEA 1LXCA 4DBLC 4BQEA 1NKTA 3KOOA 2H2HA 3D02A 5E4JA 3FDZA 3TQQA 4JGIA 4XOUA 1GSAA 4JHLA 2R1VA 4MW1A 5TMDA 4C3VA 4N0PA 1XTPA 2O14A 3K8QA 4QGSA 2HCFA 3ZH2A 1W1UA 3U5TA 5ALYA 3VDXA 4W5TA 4NH0A 4A4DA 1KMCA 3VJMA 1JLRA 2JGLA 1P4RA 1UBLS 3U60B 3F6YA 1E7SA 4G86A 4CGYA 3LQFA 2BVNA 1AN0A 5GGXA 3S2IA 3PNLA 1H9CA 2BSXA 5ED0A 5C31A 5IBRA 2NUPA 1O2DA 4YIHA 2CJWB 1ORDA 2V7TA 3ZWXA 5J2TA 3V7YA 3N7AA 4YP0A 1GKLA 3WYCA 3WGGA 4PYJA 3GJRA 2PYIA 1BGXT 3GBSA 2BW0A 5I8ZA 4ZJUA 5IX8A 1W4ZA 2PFGA 4RVDA 4GQAA 4FKZA 5LU8A 2HWYA 4FFLA 4GGOA 4H08A 4AJ2A 2V4ZA 2BL4A 3RVLA 3ADDA 3CN7A 2H59A 1K7SN 1EGHA 1ZNXA 1ZH2A 3EGOA 4WZBA 2QYHA 2LIVA 2MSLA 4N0QA 3U0BA 1ISPA 3U9SA 2JATA 2PKQO 4IDQA 2WWIA 1UFRA 5KNBA 3L7AA 4F2HA 2G8NA 1H2RS 4H4EA 4CKXA 3HP7A 4B6OA 1XTIA 3GFGA 4XD7A 1ATIA 1SU6A 3ASYA 1YVPA 1IJKA 5AQ1A 4G1EB 3D64A 3HRHA 5C8YA 2PLNA 1J2TA 4JAVC 3HBNA 1D2MA 2L69A 4A8JB 4TVOA 1SA0A 5BQ3A 1DIHA 3E22B 2C2KA 1TYEB 1MC5A 3OPMA 1A88A 3AHCA 3PX3A 3ZDFA 5FWYA 5LLTA 2ON6A 3K94A 1LDMA 5I7OA 3EH2A 4DAEA 2HJRA 2YOHA 3FUXA 1VIDA 3IS3A 1AS2A 2IYWA 1T2EA 3F74A 4IXDA 4MVJD 1QRSA 3DHYA 1AB5A 2IBTA 2YN0A 2VJPA 3ESQA 1PR9A 1IHDA 1KP2A 2ZR7A 4CT5A 2IY8A 4M87A 4CIWA 3DW1X 4NEHB 2XXJA 3W9SA 3PX2A 4EATA 3IEKA 4DLXA 4YT4A 3ASVA 2D8MA 4R0VA 5EERA 4IRMA 5DM0A 5A05A 1XF1A 4P08A 2FETA 4M9XA 5CNKA 3SGLA 5BUQA 3PTAA 3ICVA 3TW4A 3DMPA 2ZQYA 2UU9B 2Y05A 4QUDA 5CLFA 3BBLA 3X1XA 1ORVA 5EZYF 2HOQA 2P67A 3DW3X 3UAXA 1SUDA 4IBOA 1JDVA 4YJ3B 5FUVA 4EG4A 1B0PA 1EE9A 2XUZA 2Q29A 4MVJE 1C7RA 4NYJR 1N2CB 2JGNA 4DA8A 1L5OA 1XRQA 3NBUA 4DV4B 2H4FA 4I4NA 2A1UB 1Q7EA 2QAGC 3ETHA 4M4SA 2HRBA 4DC0A 5I6DA 3A1SA 4O4LB 4K9LA 4N76A 1OYYA 3IMFA 2Y6UA 1NVMB 4MUYA 3SKYA 5C8VA 1A4UA 3Q87B 2XA9A 3R3JA 3SQMA 1GP2A 1USKA 1NXTA 3FBGA 4OQMA 2BN4A 1ZO8A 5IWCA 1US8B 5BN5A 5I7HA 1CVRA 2W4MA 3GUHA 3UYLA 4UNSA 1PF7E 1D3AA 4JL8A 4YV0A 1Y9JA 3HPQA 1XX6A 3EXEA 3V8RA 4KFTA 1TYDE 1NR1A 3EUFA 2VDQB 4P58A 4TRJA 2RH8A 1ICIA 2V96A 3BWCA 4FFMA 3L0ZA 3RF7A 2HCBA 1O9GA 2Z6QA 4AVYA 1FP1D 1PT5A 4WX2B 5E7MA 4YP6A 2BFNA 4RHYA 1DV1A 4OAPA 4IGFA 4XUDA 2JJ2D 3IBYA 5A9SB 3WDKA 1W36C 4KR9A 4OKSA 4DJ5X 4EUFA 3LHKA 2ZSEA 3ICPA 4KQFA 3L43A 4I6GA 1NNUA 2LTAA 1HG1A 1VC2A 2R96A 4UCXA 1HL7A 5HTKA 3GGCA 1P4HA 3FVVA 3GRAA 4RMJA 2GXAA 4KHZA 5BW8A 3ROQA 1RRMA 1XB2A 3Q12A 3IILA 3CUSA 3EFOB 3K35A 2Y1WA 5REQB 5TMBA 5WRFA 1KC1A 1SY7A 4IXNA 3GI1A 5B3JA 3ONNA 1OTXA 4OCZA 5FP0A 2E4WA 3P0IA 4LGCA 3VVMA 3A1UA 3HO1A 1UKCA 4YCBA 3PQ4A 3RK1A 3BTOA 5BOVA 3RUFA 4YMWA 1GNLA 5JFGA 2QTLA 3FGNA 1GGNA 2VAWA 1EUDA 2YZ2A 3FN4A 2GCOB 4Q1BA 3RIXA 5BSRA 4BFSA 4XDHA 2JAOA 4RYDA 3PD7A 4F3KA 4W7HA 4Z4IA 2Q9AA 3Q7IA 3JATA 1E2BA 5C51B 2BAGA 4D9MA 3MERA 4E2WA 3UMRA 2OUKA 4IILA 2C95A 2VDWB 5I3CA 3FOFC 2F8TA 3PNYA 5EG5A 2ZB8A 1PK7A 4CKEB 4EB6B 3QU2A 1KEUA 4ZU3A 1QLWA 4ROTA 2PGOA 3IYLW 1KI6A 4ISCA 4MEBA 2OCAA 3RKUA 4L57A 2I55A 2CLHB 3ESRA 2C3MA 3AY0A 5F73A 1BX3A 5CYPA 1ADJA 4URYR 2X1VA 4ZVTA 1CPYA 1BXRB 2X0JA 2Z8XA 4M0PA 3KSRA 2VH1A 1ZBQA 3P9IA 4R2XA 3USES 1RHKA 4EOGA 7AT1A 1Y1QA 3V4ZA 2Q5EA 4EAAA 3CO5A 5H3CA 4K81B 2WUDA 3PXAA 3GYGA 4ZCMA 4RL4A 2GA9A 1C4KA 4X3PA 3P94A 2XYRA 4P22A 1OQAA 5AVRA 3CSUA 3GDHA 4ZC1A 3AVVA 1JWBB 4ZKDA 3ORQA 1MP0A 1KDPA 4UAVA 2D6FA 3IPYA 4FOSA 3BHNA 3E2MA 3EHEA 3OOYA 1W7AA 1HL3A 4AYWA 2D7DA 2AN4A 3HBFA 5DHRA 5AOAA 5K0SA 2H7YA 5BT8A 2MINA 2VJOA 4UASA 2E82A 3CBGA 5IT4A 4RTJA 2NP6A 2PZJA 3PA8A 2F1IA 5IHPA 4M46A 2WF9A 3BFPA 4NPHA 5BN1A 1IATA 5HR5A 3AY3A 4N0EA 3FCYA 3A36A 3CX6A 4MIKA 5DV9A 3AB8A 3DOCA 4ZVMA 5ENVA 1RHRA 2J9RA 3K1YA 4IIHA 1S2OA 3CUEF 5H81A 3E3AA 4ZGGA 2BFFB 1CF2O 4BN0A 4IS2A 4KNWA 4D45A 4TXHA 2Q3EA 3CEMA 4K88A 1JG7A 1SB8A 3F1KA 4ND6A 4NH4A 3RHZA 2MR6A 5KO2A 1SOMA 3H13A 1CLUA 2IUSA 3UAWA 3VUEA 1HKUA 3PNVA 1O6FA 2BSQA 1QR6A 1TJPB 4QOJA 5HZHA 4KXWA 4CM9D 2HD4A 5DTEA 4CLRB 3IPXA 3C70A 1OAKA 1ZSVA 4RWEA 3H9EO 2GBLA 4KN6A 3NDPA 1SCIA 3OCWA 4B3CA 4PVCA 3ZDBA 2ZJOA 2NSYA 2TMYA 2XIJA 3IAEA 4YRPA 5B7PA 3AXSA 2O19A 3LKBA 1X8JA 1HYEA 4LOJA 2QQ5A 3NC1C 4BL5A 1C4OA 4AP9A 1M3SA 1TI7A 1DRJA 1H5QA 3HYLA 1YI0A 2XMZA 3RT9A 1O97C 5DNAA 1O87A 3L1IA 4B31A 2X40A 4NBNA 1KH2A 3ZIDA 4C08A 2BGLA 5JBQA 3AFMA 4IXTA 5B58T 2MMGA 1TVCA 4Y2XA 3SSAA 5JIBA 1H66A 2D2EA 4F6RB 1VE6A 1BWQA 4HNRA 1BDJA 5EJ5A 3GCGA 3I2KA 3ELBA 3CV3A 3EG9B 5KOYA 4E2FA 5DE3A 3RKRA 2YNMA 3FPBA 2OXCA 4NCBA 1T5OA 2PYDA 1HE1C 3A1TA 3GR6A 4EGJA 4P35A 5BWCA 2NZ2A 1JIUA 3GOQA 4ZAGA 3R7WA 2VAMA 3QEMA 4IKPA 3R0QA 5C80A 2R11A 2HPAA 4FCTA 2G5TA 1OXMA 2POCA 2W7TA 3M82A 2CLFB 1B14A 1XJ5A 1P31A 4IOKA 3ZWNA 1CDZA 3NHBA 4N82A 2FLKA 5TQ0B 2H4ZA 3I5UA 2ACKA 3AI1A 1E1NA 1BC5A 1SGWA 3C5EA 2ZETA 4X71A 2IEYA 2C5AA 1XDSA 2ZK7A 3TW8B 3JZAA 5E6UA 1ZJ4A 3DC7A 3ZV6A 4AT1A 3QYFA 2QTCA 5EI5A 2O2DA 2GXQA 4L16A 4JJIA 1SKAA 4A7PA 4CODB 1YGYA 1HSZA 2CNBA 2HIMA 3LCVB 2IYOA 3Q98A 2ZAMA 4MW9A 4PINA 4S12A 3M83A 4X6YA 4Y1FA 1JH9A 1OU4A 1DADA 4P4UA 4RD6A 4F3CA 2G4LA 4A0SA 5A4MS 4GMHA 1U0OC 1VSVA 3L0DA 2YS6A 4TZTA 2PMDA 3T34A 2P9YA 4QXPA 4K6MA 4A10A 4G4SO 3UJNA 2ETXA 4WGFA 4G0PA 3G6WA 3DD1A 5G53C 3DFIA 4XX1A 2GBGA 3AHDA 1XVTA 1MABA 4PRZA 1H6CA 4FFWA 2IZ7A 1Z2AA 2CZGA 5BSEA 5LP6F 3WLFA 4DT1B 3AL2A 3ILSA 4R6WA 3L7LA 3UM9A 1EH5A 4ER3A 1TZMA 2HBZA 3B9QA 2C57A 4L9AA 4KTTE 4L3VA 1EFKA 3L9XA 4OI2A 3CF4G 5B6IA 3ZCXA 3ENNA 3N8NA 3BMQA 4QGBA 3PXGA 5HW0A 2QZSA 2CXQA 2F3QA 2FEXA 4F97A 1G1AA 4MR9A 5ADVA 4JQSA 2NZUG 3RIYA 2AEJA 3PRKE 4RH0A 4KQ2A 3AETB 4YO7A 3VR2A 2ILTA 1XMIA 2NTNA 3OT5A 2Q27A 3KJFA 1X1DA 3WYGA 2WWXA 2W93A 4L5BA 4MGIR 3DEYX 3KR1A 3N8KA 1W59A 4K03A 1DEAA 1NVKA 2X13A 4JQZA 5CB0A 4UDYX 2X9VA 1YL6A 4BBZA 5BSWA 3A3PA 1SBZA 2EQAA 2RB4A 3RIHA 3TBHA 3ZDDA 4NXNB 5CB6A 2PZFA 2C04A 1M2VB 4HNAA 4RTNA 1LI5A 2QTTA 1OD6A 2VZEA 4U02A 3ZJYA 1LBEA 2D1QA 4JBYA 1M6WA 2GBIA 5DOVA 4EFMA 4HYEA 3DAPA 3QFSA 2GLXA 2DPXA 1IHPA 1Z4NA 2IXEA 3GEIA 4Q1AA 3UJAA 5CYGA 1ZUNA 5DN6D 3V48A 1AF4A 3CH7A 1XYGA 4JNKA 4QSMA 1GADO 2RKOA 5T8KA 2JAUA 5B5SA 2X1LA 2WDZA 2JIPA 2XYPA 4GKVA 5I7VA 4RTMA 4N40A 1FFEA 4HYTA 4P53A 4RWZA 1XNQB 1XP8A 5EE1A 2EU8A 2Q99A 1BD4A 4DLYA 3E2IA 4RCZA 4X61A 1EFCA 2XYVA 2CXHA 2ZTUA 2FLWA 1F60A 3RB8A 2PH3A 3U44B 2IDZA 5IC4A 1W5TA 2I2AA 4JLKA 4V3BA 1U9IA 3QW2A 2WABA 3D4PA 3URMA 2A9PA 2DX7A 3B1WA 4NF2A 4O63O 2K5UA 4CMAA 3ESAA 4GM0A 1C8KA 1Z6GA 3VNSA 1KO4A 4XJVA 4J76A 2PX4A 4V38A 3WMXA 1L4LA 3R3ZA 1VG1A 1L7PA 4G26A 1AQLA 3G2MA 4NS4A 4UOQA 1VTKA 2W42A 3IB6A 1YJCA 1GZUA 3OHSX 3PYLA 2WIKA 4Q7KA 3ITEA 5KU7A 4NENB 3U49A 4BP1A 1QOPB 4A0GA 3PE4A 1LPMA 2I3AA 1V96A 1EX6A 4EY8A 8MHTA 3CS3A 1J42A 1RLTA 4MQBA 5AK5A 4CE6A 1AV6A 1C0KA 2CZCA 2JGDB 2ZUTA 3W6PA 5JQGA 1BXGB 2QN8A 2FG7C 3PPIA 4L73A 2C94A 5CM9C 5DIFA 5ALRA 4JI3B 1FRNA 4F2GA 3VR6D 4MUBA 1D07A 4EHHA 4CWAA 1N2EA 1WQ4A 2XF2A 3UQYS 1G5HA 1QDUA 1IBSA 2Q62A 4LHSA 2P62A 3DE2X 3HM2A 5GV8A 4AMBA 5H70A 1KFCB 1W36D 5AW0A 5F4ZA 1RPZA 5IH3A 4N8SA 4EL5A 1CF9A 4UOEA 5JCZA 1T9GS 2H4XA 1IM2A 1XAJA 2AEEA 5KNCH 2B1IA 3L6OO 3LO5A 4DMUB 1C7ZA 5EWMB 4O4HB 1WE2A 4Q9NA 4GYYA 1ESDA 3V7WA 2Q8NA 3AI3A 1MNQA 4AK9A 5FUQA 2V1UA 1HYGA 3GUZA 5CUQA 1GNPA 1XJWA 1L5NA 5FWNA 4DR3B 3U1BA 4QJ3A 4I9NA 1D1QA 1GPUA 1C3OA 3AEKA 5DM60 2CCKA 2QVCA 1N0IA 2FX2A 2RHOA 1MQ8B 5A6SB 4F96A 5LFAA 1DEHA 3KR2A 3T6KA 2QF7A 5DLQC 4RAQA 3VDNB 5ICEA 4K05A 3OIUA 5JPIA 1NASA 1ZXLA 3ITNA 1ZK2A 2VJLA 4RJIA 1EFRA 1W34A 5IJAA 4E4TA 5K0JA 2CXXA 2GEDA 1C7IA 3HXMA 1NW9B 3T7EA 2JFFA 1EBUA 4C6SA 1U7UA 3QHPA 1MRZA 4LJ6A 3PQ3A 1PRYA 2BHSA 4PG5A 4YBZA 2YJ6A 4BLOA 3LS2A 2XBLA 3GJ5A 2H08A 1FJXA 3WY9A 1PGPA 2AUTA 1H8HD 4S0XA 1JHQA 2PX0A 4F4CA 2GK6A 4C88A 1GT91 4IW3B 4W1RA 1NDQA 2HUNA 3NGMA 5BQOA 3TX6A 4IDFA 3PNPA 2QJRA 1SC6A 3MINB 4W8HA 2WE8A 2XYQA 2IH5A 1ZQ9A 3CF6R 2XUQA 1M1NA 3OURA 4U2BA 2AOTA 3A4MA 3LPAA 1H2XA 1U94A 4I46A 2J41A 4LXUA 4MKGA 3IJ5A 1C9KA 4B0OA 2EW8A 4B33A 3U31A 2IPMA 1UMCA 5KU1A 1GRRA 4ZXPA 1NJ6A 3AERA 2ECQA 4BNLA 4C5AA 1E4VA 4CFYA 4EG7A 3KVNA 4IO0A 1YQDA 4H3HB 1KTIA 4RLQA 1P3JA 1GCAA 4QQFA 2VWQA 4QYMA 5TJHA 1F1JA 1OU0A 1V6CA 5KSPA 1RXYA 2VYVD 3FOBA 4ZDIA 2P0EA 3DP9A 2R5NA 3D8TA 4MGKR 1U3DA 2A9VA 1EEXB 1UOEA 1TX4B 4HAVA 1GN9A 3O8OA 1JR3D 4MUNA 1YKSA 4YUVA 1IY0A 3GD7A 2W6PA 4LFAB 1ZW1A 3DB1A 4BKMA 4P93A 2IW3A 2VWGA 4UM7A 4W6QA 1N8NA 3EHDA 4A91A 5C1DA 4YV1A 4NFLA 1VIYA 2FPKA 2YXEA 1W4LA 3ZG6A 1IOZA 4MMXB 1VZ2A 1YMQA 1K4KA 1ZD3A 3AR8A 2XIQA 1KKMA 5FI1B 2I6SA 4KB5A 4RJJA 1X3LA 4OH7A 3NYRA 2ODPA 4B4KA 3CF2A 3L1UA 3Q72A 3K70C 3GJ8A 4X3CA 1T0HB 1AKWA 1QK4A 2NO0A 1DQPA 4HFNA 1N6KA 4OXNA 4A3SA 8LDHA 4MRAA 2UYHA 1I7DA 4GC5A 3VNBA 4KQHA 1C3LA 2WP0A 4ESEA 2DH5A 1CX9B 4O1HA 1C80A 1J6UA 1TW3A 3NM4A 4Q01A 3FUTA 3IAHA 2DWCA 5EFZA 3E9DA 5BWMA 1KJWA 3NEYA 4IOJA 2IYNA 2ZWVA 4PNHA 1DO8A 5TJ9A 1UMBA 4ALNA 3OJOA 5D01A 1ZZGA 3OZWA 1E32A 2QTFA 1PT8A 1YRAA 1CBUA 2QD3A 1M67A 5DBIA 1U5BB 4TRNA 4XYEA 1SUBA 2C0QA 4A2CA 1OYWA 2AQHA 3QEMB 3K70B 821PA 1AKUA 1C2YA 1M83A 2AZMA 5AKIA 2DC1A 1Z2PX 4DBZA 3VNQA 2ZJ4A 2QN7A 4E4YA 3PENA 2XGJA 3QBEA 4RKEA 2FPUA 3C3PA 3IVCA 4E1VA 3KNZA 3QUAA 1ORRA 3RRNA 1G6HA 1E1MA 5CFMA 4TSFD 5TEWA 2VJDA 3MIIA 1BJRE 3I1YA 4Q9DA 4J7CA 3IURA 3ED5A 3PQ8A 1VE3A 1IRIA 1CJTC 1LLCA 1UFQA 1Y7LA 4F1WA 5HKKD 2JGMA 1YJBA 2EDAA 2ZIWB 3RK0A 2C5EA 2AJBA 1K7FB 4UAGA 3NBXX 3WOHA 4RY9A 2KB0A 1E4EB 1ZMBA 4LEIA 3O31A 4Y6LA 1AZWA 5ICFA 4FZVA 1BROA 1U2GA 3WB9A 2G0AA 1JZQA 3PTLA 5MN5A 1M8GA 5FOWA 4GX1A 4XH9B 4YECA 5ERGB 3H87A 3B82A 2ZSUA 5E6RA 4FK8A 2QRMA 3KKOA 3PQDA 1A9QA 1INLA 4AX8A 2W9XA 1B2LA 2FQXA 1C3VA 2VKQA 3GJ6A 1SOWA 2QP4A 4YYZA 2ENWA 3UW3A 1EM8B 3DMYA 1RJ9B 2XMSA 4P0PB 5HP4A 1CRZA 4FYMA 4G8JA 2IUTA 4NZYA 4OUKX 2BFFA 3EA0A 4KH1A 5JD4A 1LKZA 2BC9A 1X2EA 4JB2A 1NTRA 1A5AB 4YJHB 4QDZA 3K09A 2JGJA 2FUG6 1O1YA 2EZ4A 3BGOS 4HDMA 3L7JA 3KJQA 4L5JA 4NBKA 2C58A 3NR2A 4MAAA 5TPWA 5DNCA 1F7VA 3HGQA 3EVNA 2M6RA 1E3JA 2GBLC 2Y67A 3QYAA 3R5HA 3ZPXA 3K5IA 2AKYA 3KQOA 4R2JA 1PCXA 5CM2Z 3WQSB 3N2IA 4DGQA 3RVSA 4W9MC 4BLSA 3BGWA 3IMEA 4J4HA 4AWAA 2VRCD 1ZL0A 3MSCA 3SOZA 3TX2A 2JIBA 1X42A 4XWTA 1HDYA 4AZ3A 1DIAA 2BDEA 3NHFA 3RAJA 5JCJD 4MYDA 4XD7D 1JQLB 3VI4B 1HDOA 4QFDA 3DZHA 2VDKB 3IBTA 3AF0A 4TV8F 2DAPA 3F1LA 4QPDA 2YQ4A 1MB2A 3NKVA 4M98A 4N0MA 4GKKB 3DB2A 4KR3A 4F9GA 3NWOA 1FNSA 2AQ8A 4RQBA 3ECAA 1FW8A 3SX4A 3TXAA 1NQAO 3QU9A 4DIOA 1B15A 2H7XA 4UMEA 3H9BA 3TZQA 3L7IA 3CT4A 1TF7A 4XVHA 3EG9A 3MZ0A 4HYYA 3LWNA 2YQZA 3ZTYA 3GLFB 3IQFA 3RV4A 4PHFA 3R76A 1DBPA 4IIJF 1UBGA 1QH1A 1ZXBA 2HSDA 3DDHA 1Y5LA 1KYVA 2I7VA 3Q0EA 4ZU6X 1B0UA 2GZAA 2ZWIA 5JNRA 4N0DA 1P44A 1U8FO 1U31A 1BRTA 2OGWA 2Y1GA 3D6FA 4RGBA 4M1EA 4IUDS 3PC4A 2HA7A 4XEUA 4K8RB 3TLBA 1OW3B 4P7KA 4D82A 3J7AC 3V7FA 2BZSA 1MX9A 4H17A 3VYWA 4L50A 4F2PA 5KYYA 3NWBA 2M32A 3EVBA 2Z6AA 4C2TA 3COSA 2B0CA 4MVJH 3T3OA 4G8BA 4E1AA 4QOEA 1N9GA 3PP8A 4G63A 2B34A 1N1DA 2J8ZA 4X93A 4J03A 4PYOA 3FFBA 3PNQA 4G5FA 2QW8A 5L7YA 3AINA 4RA9B 3EIOA 1T6BY 5E6SB 5A3VA 3BFJA 4B8ZA 2JI7A 3GJYA 3F3SA 1SD1A 4Q5IA 1VQ1A 1XTRA 2Q3FA 2PXCA 3TGLA 4UXHA 4WN3A 4ZZ2A 1MCZA 4U39A 3MOIA 3E7WA 4R71A 2ZRNA 3Q2OA 4M8NE 1GNRA 2CXNA 4CNBA 2Z98A 3S2ZA 1J0AA 2AXQA 1E8DA 3TD9A 4HZIA 3D6UA 2XGOA 2A88A 2CKDA 2X9GA 3KTAB 4X6XA 3ZUPA 3X43A 4NU5A 1OLUB 1X80A 1SBQA 3R0ZA 1NJ8A 2HBRA 2PGJA 1IAQA 3BBPA 3TGPA 1QB8A 2VXCA 2MINB 3EDQA 2JD2A 4TTQA 1PWYE 4CQLA 3IVMA 3VU3A 5CDFE 2PEZA 1C8LA 1JAXA 4LVUA 3NM5A 2GBCA 1YR9A 2X41A 2QXTA 2Z9DA 2VS1A 1AKVA 2PQ0A 5BQFA 4B43A 1EVEA 1TJYA 4KW7A 3BXPA 2Z58A 4B34A 3THWB 1MIOA 4LNUB 5LJLA 3GP8A 3STHA 3A2KA 4A5OA 3OJCA 2JCYA 3P8ZA 2OM6A 2EG5A 3KUXA 4ZI7A 3C87A 2GS9A 2R79A 4R69A 1E79D 2EL9A 4H7PA 3K5HA 3QVLA 1Y5MA 1JBQA 4J0QA 4B3BA 4KITB 3F9IA 2R8BA 1MX3A 5EEHA 1MOZA 4ND1A 1ONBA 1SK9A 3O2NA 2O2EA 3GEMA 4L8YA 5I01A 4L07A 2A33A 3L41A 4HDOB 5REQA 2P11A 3T5PA 1RYFA 1AHHA 4XQ0A 3WOVA 4B81A 2A1IA 2CL0X 2RGXA 3HDQA 3IQEA 1K0FA 3MRVA 4H59A 3AUFA 4NQZA 2WZBA 2P9QA 3RAEC 1XTQA 2CT8A 3AUYA 4IEFB 3G82C 5CAEA 4HLQB 5CVVA 3UMVA 2GFIA 2R8YA 4QNNA 2DPLA 2MSKA 3NAQA 4U7JA 3QLVC 3E8XA 3OZAA 5AP9A 3REGA 4F6CA 2GYYA 1S2DA 5CVDA 5E6SA 3SFZA 3LFHA 4I5IA 5HZKA 2OCLA 1QRRA 3GD5A 1II8A 3BXGA 3H9GA 3BWDD 3INRA 4YMUA 5I9MA 1OPRA 3JQDA 3NOXA 2QLLA 4GMDA 3UO8B 5L4LA 4MOWA 2XTAA 5AM4A 3D8UA 4YCAA 4YY3B 4J0CA 1AQNA 2FW1A 1ZJYA 1DSSG 3DGEC 2CMKA 1M0TA 1FA9A 5CVCA 1A7AA 3N8HA 1S2NA 1L1RA 4C05A 2PT7A 4DOMA 2QI9F 2GJAA 3SS9X 1PVOA 3TG8A 3VTAA 2Y0PA 1V7PC 1TFUA 4TX1A 2X2EA 4UHCA 4OO3A 1IXYA 2A4KA 4PLCA 4UEWA 3T5GA 3FMOB 4DY4A 4FEEA 2R00A 2IYAA 4Q9HA 3QWAA 1PR5A 9MHTA 4CM4B 1AHPA 4FZ5A 1PUXA 4HQOA 3TBFA 1CUHA 1XOIA 1O0CA 1C7FA 4HAZA 1R4MB 3F97A 1ZYUA 1R5BA 4IXMA 3TJZA 3VKWA 4BY9E 4BO6A 4MW7A 3TSOA 2O3QA 2P0YA 2QAGA 3SF8A 2IYEA 1GGJA 1OTHA 4KQ9A 4Q37A 4MP8A 4N9QA 1DQZA 2VUTA 3CEJA 3PHBE 4F2DA 4KN9S 5F1OA 2D00A 2CJWA 3FXAA 3TD6A 1UC4B 1FRZA 1ODFA 2LWIA 1OLOA 3A6ZA 3JQ7B 1MH1A 1U0TA 2Q3LA 3QXSA 4I9GA 3KOYA 4JLNA 3GW8A 1QYCA 2X9LA 2R84A 3ZWCA 4YJ2B 3ZGVA 4BJ5A 1VA5A 2V9ZA 4RGQA 1XTUA 4GW3A 5TMEA 2H7CA 3FYHA 4KSBA 3PFCA 1U3WA 1UIMA 3PICA 3KYIB 3CRZA 2ZB3A 1U0BB 3R8FA 3EPPA 3MA0A 5JAZA 2QVLA 2ZSIA 3FSJX 2R8ZA 4Z9XA 4ZICA 1A9XA 3NBFA 1SBCA 2WWGA 4X65B 2BCJQ 2IRWA 1U4OA 1XYYA 3PGMA 4I2VA 3K9CA 3B1JA 1Z7EA 4JLAA 1CNEA 3C14C 2SKDA 4MHSA 2HDNB 5FHQA 3DR3A 3KJEA 4D0RA 5KQPA 4CCYA 4AW9A 4DCTA 1QC5A 3F6CA 4FYIA 4KE6A 5EJ6A 2ZREA 5IZ4A 3EPLA 3VC3A 2EJBA 1DUSA 1YE8A 4P0QB 1RXVA 1AO3A 2JLSA 4MUJA 2X6TA 3I01A 4N65A 4RHCA 4Z4EA 1YB4A 3K53A 1YS1X 4GOJA 1T6XA 1Y89A 4KXYA 4UHFA 3SCZA 2OOKA 2G09A 4G5YA 4H3KB 2GJ8A 2CB0A 4E6EA 3TZBA 5EMKA 2R1TA 5EWLB 5B57C 4Q4JB 1WMFA 1EAMA 4S1PA 2NTJA 2XKJE 4MUXA 2EWWA 4QEDA 1TCBA 1CUBA 4K6KA 4L3WA 1IFXA 3ANLA 2G9NA 3UKDA 4MCHA 4WBNF 5H9WA 1L7VC 1VBFA 4LJSA 4R0MA 3A6JA 4YRNA 4ZDWA 3QTBA 4B8WA 1EXMA 5FIUA 3AUKA 3DLHA 4KFRA