1MR7A

Crystal structure of streptogramin a acetyltransferase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
203
structure length
203
Chain Sequence
MGPNPMKMYPIEGNKSVQFIKPILEKLENVEVGEYSYYDSKNGETFDKQILYHYPILNDKLKIGKFCSIGPGVTIIMNGANHRMDGSTYPFNLFGNGWEKHMPKLDQLPIKGDTIIGNDVWIGKDVVIMPGVKIGDGAIVAANSVVVKDIAPYMLAGGNPANEIKQRFDQDTINQLLDIKWWNWPIDIINENIDKILDNSIIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogramin A Acetyltransferase
publication title Structural Basis of Synercid (Quinupristin-Dalfopristin) Resistance in Gram-positive Bacterial Pathogens
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Transferase
total genus 63
structure length 203
sequence length 203
chains with identical sequence B, C, X, Y, Z
ec nomenclature ec 2.3.1.-:
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 1mr7A00
3R5BA 4HUSA 5DG3A 4DCLA 3FSYA 1MR7A 3I3XA 4N6BA 3FSCA 3VBIA 4AAWA 4KQLA 4N69A 5DEPA 1QRFA 3VBLA 4KNXA 3BRKX 4J09A 3NZ2A 1KK4A 2TDTA 3IXCA 3TIOA 3FOQA 2QIVX 3SPTA 3TDTA 1HM0A 1OCXA 4J18A 4KNRA 3EG4A 1LXAA 3R5CA 4M9CA 2QIAA 2V0KA 4EABA 2XATA 1YP3A 2GGOA 4K6RA 1T3DA 2V0JA 5ADXU 3BSWA 2IC7A 2RIJA 2WLCA 3C8VA 4N6AA 4HZDA 3BSYA 3BXYA 3V4EA 3D98A 3DJ4A 4IHFA 3ECTA 3MC4A 4FCEA 2WLFA 4G3QA 3EH0A 4AA7A 2VHEA 2WLEA 1KRUA 2VD4A 2JF3A 4MYOA 4M2BA 3R8YA 3I3AA 4G3SA 1TDTA 1MR9A 1SSMA 1KHRA 3R2WA 5U2KA 3OTMA 1SSTA 1G97A 2FKOA 3Q1XA 4EA8A 2QKXA 3DHOA 1XATA 2OEGA 2JF2A 3BFPA 3HSQA 4M99A 2AQ9A 1KGTA 1V3WA 5E3RA 4IHGA 5F42A 1KRRA 4E79A 1QRLA 2ICXA 4HURA 1SSQA 4H7OA 4IHHA 3FSBA 3JQYA 1KRVA 4R7PA 3PMOA 4M2AA 2W0VA 1KK6A 5L6VA 3R1WA 4R37A 4EGGA 3BSSA 2OI7A 4HZCA 5E3QA 1XHDA 3KWDA 1KQAA 3KWCA 3IGJA 5L6SA 1S80A 4R36A 3R5AA 1FXJA 3P47A 3VBJA 3F1XA 5ADXV 3EEVA 1HV9A 3CJ8A 3VBKA 1YP2A 3FTTA 5AFUV 5AFUU 2V0HA 3TV0A 3D8VA 2WLGA 3SRTA 3TISA 1QRMA 4E75A 3R3IA 3MQGA 4E6TA 4MFGA 3OW5A 1THJA 1HM8A 3FSXA 3TK8A 2W0WA 3VBPA 3P1BA 3ST8A 2IU8A 5DEMA 1G95A 1FWYA 3FWWA 3VNPA 2NPOA 3R3RA 2ICYA 4EQYA 1MRLA 4AC3A 2WLDA 3MQHA 3R0SA 1Z90A 4N27A 1HM9A 1KGQA 4E1KA 1QREA 2V0LA 3KWEA 2OI6A 4M28A 4MZUA 2Q4JA 3FS8A 2V0IA 4G87A 3GVDA 1V67A 1QRGA 1J2ZA 1KK5A 2OEFA 3HJJA 2OI5A 3R5DA 3TWDA 1YP4A 3VBNA 4EA9A 1QQ0A 4KPZA 3T57A 2GGQA 4G3PA 4HCQA 3DK5A 4EA7A 4M98A 2P2OA 2I5KA 3GOSA 3OUPA 4E6UA 5E3PA 4KPXA 3OTZA 3OU9A 4ISXA 4EAAA 2IUAA 3VBMA 2IU9A 3GUEA
chains in the Genus database with same CATH superfamily
3R5BA 4HUSA 5DG3A 4DCLA 3FSYA 1MR7A 3I3XA 4N6BA 3FSCA 3VBIA 3OH4A 4KQLA 4AAWA 4N69A 5DEPA 1QRFA 3VBLA 4KNXA 3BRKX 4J09A 3NZ2A 1KK4A 2TDTA 3IXCA 3TIOA 3FOQA 2QIVX 3SPTA 3TDTA 1HM0A 1OCXA 4J18A 4KNRA 1Z2FA 3EG4A 1LXAA 3R5CA 4M9CA 2QIAA 2V0KA 4EABA 2XATA 1YP3A 2GGOA 4K6RA 1T3DA 2V0JA 5ADXU 3BSWA 3GQAA 2IC7A 3V4EA 2RIJA 2WLCA 3C8VA 3OGZA 4HZDA 3BSYA 3BXYA 4N6AA 3D98A 3DJ4A 4IHFA 3ECTA 3MC4A 4FCEA 2WLFA 4G3QA 3OH0A 3EH0A 4AA7A 2VHEA 2WLEA 1KRUA 2VD4A 2JF3A 3OH1A 4MYOA 4M2BA 3R8YA 3I3AA 4G3SA 1TDTA 1MR9A 1SSMA 1KHRA 3R2WA 5U2KA 3OTMA 1SSTA 1G97A 2FKOA 3Q1XA 4EA8A 2QKXA 3DHOA 1XATA 2OEGA 2JF2A 3BFPA 3HSQA 4M99A 2AQ9A 1KGTA 1V3WA 5E3RA 4IHGA 5F42A 1KRRA 3GQ7A 4E79A 1QRLA 2ICXA 4HURA 1SSQA 3OH3A 4H7OA 4IHHA 3FSBA 3JQYA 1KRVA 4R7PA 3PMOA 3GQ9A 4M2AA 2W0VA 1KK6A 5L6VA 3R1WA 4R37A 4EGGA 3BSSA 2OI7A 4HZCA 5E3QA 1XHDA 3KWDA 1KQAA 3KWCA 3IGJA 5L6SA 1S80A 4R36A 3R5AA 1FXJA 3P47A 3VBJA 3F1XA 5ADXV 3EEVA 1HV9A 3CJ8A 3VBKA 1YP2A 3FTTA 5AFUV 5AFUU 2V0HA 3TV0A 1N4IA 3D8VA 2WLGA 3SRTA 3TISA 1QRMA 1EWWA 4E75A 1L0SA 3R3IA 3MQGA 4E6TA 4MFGA 3OW5A 1THJA 1HM8A 3FSXA 3TK8A 2W0WA 3VBPA 3P1BA 3ST8A 2IU8A 5DEMA 1G95A 1FWYA 3FWWA 3VNPA 2NPOA 3R3RA 2ICYA 4EQYA 1MRLA 4AC3A 2WLDA 3MQHA 3R0SA 1Z90A 3OH2A 4N27A 1HM9A 1KGQA 4E1KA 1QREA 3GQ8A 2V0LA 3KWEA 2OI6A 4M28A 4MZUA 2Q4JA 3FS8A 2V0IA 4G87A 3GVDA 1M8NA 1V67A 1QRGA 1J2ZA 1KK5A 2OEFA 3HJJA 2OI5A 3R5DA 3TWDA 1YP4A 3VBNA 4EA9A 1QQ0A 4KPZA 3T57A 2GGQA 4G3PA 4HCQA 3SUCA 3DK5A 4EA7A 4M98A 2P2OA 2I5KA 3GOSA 3OUPA 4E6UA 5E3PA 4KPXA 3OTZA 3OU9A 4ISXA 4EAAA 2IUAA 3VBMA 2IU9A 3GUEA
chains in the Genus database with same CATH topology
3R5BA 4HUSA 5DG3A 4DCLA 3FSYA 1MR7A 3I3XA 4N6BA 3FSCA 3VBIA 4AAWA 4KQLA 4N69A 5DEPA 1QRFA 3VBLA 4KNXA 3BRKX 4J09A 3NZ2A 1KK4A 2TDTA 3IXCA 3TIOA 3FOQA 2QIVX 3SPTA 3TDTA 1HM0A 1OCXA 4J18A 4KNRA 3EG4A 1LXAA 3R5CA 4M9CA 2QIAA 2V0KA 4EABA 2XATA 1YP3A 2GGOA 4K6RA 1T3DA 2V0JA 5ADXU 3BSWA 2IC7A 2RIJA 2WLCA 3C8VA 4N6AA 4HZDA 3BSYA 3BXYA 3V4EA 3D98A 3DJ4A 4IHFA 3ECTA 3MC4A 4FCEA 2WLFA 4G3QA 3EH0A 4AA7A 2VHEA 2WLEA 1KRUA 2VD4A 2JF3A 4MYOA 4M2BA 3R8YA 3I3AA 4G3SA 1TDTA 1MR9A 1SSMA 1KHRA 3R2WA 5U2KA 3OTMA 1SSTA 1G97A 2FKOA 3Q1XA 4EA8A 2QKXA 3DHOA 1XATA 2OEGA 2JF2A 3BFPA 3HSQA 4M99A 2AQ9A 1KGTA 1V3WA 5E3RA 4IHGA 5F42A 1KRRA 4E79A 1QRLA 2ICXA 4HURA 1SSQA 4H7OA 4IHHA 3FSBA 3JQYA 1KRVA 4R7PA 3PMOA 4M2AA 2W0VA 1KK6A 5L6VA 3R1WA 4R37A 4EGGA 3BSSA 2OI7A 4HZCA 5E3QA 1XHDA 3KWDA 1KQAA 3KWCA 3IGJA 5L6SA 1S80A 4R36A 3R5AA 1FXJA 3P47A 3VBJA 3F1XA 5ADXV 3EEVA 1HV9A 3CJ8A 3VBKA 1YP2A 3FTTA 5AFUV 5AFUU 2V0HA 3TV0A 3D8VA 2WLGA 3SRTA 3TISA 1QRMA 4E75A 3R3IA 3MQGA 4E6TA 4MFGA 3OW5A 1THJA 1HM8A 3FSXA 3TK8A 2W0WA 3VBPA 3P1BA 3ST8A 2IU8A 5DEMA 1G95A 1FWYA 3FWWA 3VNPA 2NPOA 3R3RA 2ICYA 4EQYA 1MRLA 4AC3A 2WLDA 3MQHA 3R0SA 1Z90A 4N27A 1HM9A 1KGQA 4E1KA 1QREA 2V0LA 3KWEA 2OI6A 4M28A 4MZUA 2Q4JA 3FS8A 2V0IA 4G87A 3GVDA 1V67A 1QRGA 1J2ZA 1KK5A 2OEFA 3HJJA 2OI5A 3R5DA 3TWDA 1YP4A 3VBNA 4EA9A 1QQ0A 4KPZA 3T57A 2GGQA 4G3PA 4HCQA 3DK5A 4EA7A 4M98A 2P2OA 2I5KA 3GOSA 3OUPA 4E6UA 5E3PA 4KPXA 3OTZA 3OU9A 4ISXA 4EAAA 2IUAA 3VBMA 2IU9A 3GUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R5B A;  4HUS A;  5DG3 A;  4DCL A;  3FSY A;  1MR7 A;  3I3X A;  4N6B A;  3FSC A;  3VBI A;  4AAW A;  4KQL A;  4N69 A;  5DEP A;  1QRF A;  3VBL A;  4KNX A;  3BRK X;  4J09 A;  3NZ2 A;  1KK4 A;  2TDT A;  3IXC A;  3TIO A;  3FOQ A;  2QIV X;  3SPT A;  3TDT A;  1HM0 A;  1OCX A;  4J18 A;  4KNR A;  3EG4 A;  1LXA A;  3R5C A;  4M9C A;  2QIA A;  2V0K A;  4EAB A;  2XAT A;  1YP3 A;  2GGO A;  4K6R A;  1T3D A;  2V0J A;  5ADX U;  3BSW A;  2IC7 A;  2RIJ A;  2WLC A;  3C8V A;  4N6A A;  4HZD A;  3BSY A;  3BXY A;  3V4E A;  3D98 A;  3DJ4 A;  4IHF A;  3ECT A;  3MC4 A;  4FCE A;  2WLF A;  4G3Q A;  3EH0 A;  4AA7 A;  2VHE A;  2WLE A;  1KRU A;  2VD4 A;  2JF3 A;  4MYO A;  4M2B A;  3R8Y A;  3I3A A;  4G3S A;  1TDT A;  1MR9 A;  1SSM A;  1KHR A;  3R2W A;  5U2K A;  3OTM A;  1SST A;  1G97 A;  2FKO A;  3Q1X A;  4EA8 A;  2QKX A;  3DHO A;  1XAT A;  2OEG A;  2JF2 A;  3BFP A;  3HSQ A;  4M99 A;  2AQ9 A;  1KGT A;  1V3W A;  5E3R A;  4IHG A;  5F42 A;  1KRR A;  4E79 A;  1QRL A;  2ICX A;  4HUR A;  1SSQ A;  4H7O A;  4IHH A;  3FSB A;  3JQY A;  1KRV A;  4R7P A;  3PMO A;  4M2A A;  2W0V A;  1KK6 A;  5L6V A;  3R1W A;  4R37 A;  4EGG A;  3BSS A;  2OI7 A;  4HZC A;  5E3Q A;  1XHD A;  3KWD A;  1KQA A;  3KWC A;  3IGJ A;  5L6S A;  1S80 A;  4R36 A;  3R5A A;  1FXJ A;  3P47 A;  3VBJ A;  3F1X A;  5ADX V;  3EEV A;  1HV9 A;  3CJ8 A;  3VBK A;  1YP2 A;  3FTT A;  5AFU V;  5AFU U;  2V0H A;  3TV0 A;  3D8V A;  2WLG A;  3SRT A;  3TIS A;  1QRM A;  4E75 A;  3R3I A;  3MQG A;  4E6T A;  4MFG A;  3OW5 A;  1THJ A;  1HM8 A;  3FSX A;  3TK8 A;  2W0W A;  3VBP A;  3P1B A;  3ST8 A;  2IU8 A;  5DEM A;  1G95 A;  1FWY A;  3FWW A;  3VNP A;  2NPO A;  3R3R A;  2ICY A;  4EQY A;  1MRL A;  4AC3 A;  2WLD A;  3MQH A;  3R0S A;  1Z90 A;  4N27 A;  1HM9 A;  1KGQ A;  4E1K A;  1QRE A;  2V0L A;  3KWE A;  2OI6 A;  4M28 A;  4MZU A;  2Q4J A;  3FS8 A;  2V0I A;  4G87 A;  3GVD A;  1V67 A;  1QRG A;  1J2Z A;  1KK5 A;  2OEF A;  3HJJ A;  2OI5 A;  3R5D A;  3TWD A;  1YP4 A;  3VBN A;  4EA9 A;  1QQ0 A;  4KPZ A;  3T57 A;  2GGQ A;  4G3P A;  4HCQ A;  3DK5 A;  4EA7 A;  4M98 A;  2P2O A;  2I5K A;  3GOS A;  3OUP A;  4E6U A;  5E3P A;  4KPX A;  3OTZ A;  3OU9 A;  4ISX A;  4EAA A;  2IUA A;  3VBM A;  2IU9 A;  3GUE A; 
#chains in the Genus database with same CATH topology
 3R5B A;  4HUS A;  5DG3 A;  4DCL A;  3FSY A;  1MR7 A;  3I3X A;  4N6B A;  3FSC A;  3VBI A;  3OH4 A;  4KQL A;  4AAW A;  4N69 A;  5DEP A;  1QRF A;  3VBL A;  4KNX A;  3BRK X;  4J09 A;  3NZ2 A;  1KK4 A;  2TDT A;  3IXC A;  3TIO A;  3FOQ A;  2QIV X;  3SPT A;  3TDT A;  1HM0 A;  1OCX A;  4J18 A;  4KNR A;  1Z2F A;  3EG4 A;  1LXA A;  3R5C A;  4M9C A;  2QIA A;  2V0K A;  4EAB A;  2XAT A;  1YP3 A;  2GGO A;  4K6R A;  1T3D A;  2V0J A;  5ADX U;  3BSW A;  3GQA A;  2IC7 A;  3V4E A;  2RIJ A;  2WLC A;  3C8V A;  3OGZ A;  4HZD A;  3BSY A;  3BXY A;  4N6A A;  3D98 A;  3DJ4 A;  4IHF A;  3ECT A;  3MC4 A;  4FCE A;  2WLF A;  4G3Q A;  3OH0 A;  3EH0 A;  4AA7 A;  2VHE A;  2WLE A;  1KRU A;  2VD4 A;  2JF3 A;  3OH1 A;  4MYO A;  4M2B A;  3R8Y A;  3I3A A;  4G3S A;  1TDT A;  1MR9 A;  1SSM A;  1KHR A;  3R2W A;  5U2K A;  3OTM A;  1SST A;  1G97 A;  2FKO A;  3Q1X A;  4EA8 A;  2QKX A;  3DHO A;  1XAT A;  2OEG A;  2JF2 A;  3BFP A;  3HSQ A;  4M99 A;  2AQ9 A;  1KGT A;  1V3W A;  5E3R A;  4IHG A;  5F42 A;  1KRR A;  3GQ7 A;  4E79 A;  1QRL A;  2ICX A;  4HUR A;  1SSQ A;  3OH3 A;  4H7O A;  4IHH A;  3FSB A;  3JQY A;  1KRV A;  4R7P A;  3PMO A;  3GQ9 A;  4M2A A;  2W0V A;  1KK6 A;  5L6V A;  3R1W A;  4R37 A;  4EGG A;  3BSS A;  2OI7 A;  4HZC A;  5E3Q A;  1XHD A;  3KWD A;  1KQA A;  3KWC A;  3IGJ A;  5L6S A;  1S80 A;  4R36 A;  3R5A A;  1FXJ A;  3P47 A;  3VBJ A;  3F1X A;  5ADX V;  3EEV A;  1HV9 A;  3CJ8 A;  3VBK A;  1YP2 A;  3FTT A;  5AFU V;  5AFU U;  2V0H A;  3TV0 A;  1N4I A;  3D8V A;  2WLG A;  3SRT A;  3TIS A;  1QRM A;  1EWW A;  4E75 A;  1L0S A;  3R3I A;  3MQG A;  4E6T A;  4MFG A;  3OW5 A;  1THJ A;  1HM8 A;  3FSX A;  3TK8 A;  2W0W A;  3VBP A;  3P1B A;  3ST8 A;  2IU8 A;  5DEM A;  1G95 A;  1FWY A;  3FWW A;  3VNP A;  2NPO A;  3R3R A;  2ICY A;  4EQY A;  1MRL A;  4AC3 A;  2WLD A;  3MQH A;  3R0S A;  1Z90 A;  3OH2 A;  4N27 A;  1HM9 A;  1KGQ A;  4E1K A;  1QRE A;  3GQ8 A;  2V0L A;  3KWE A;  2OI6 A;  4M28 A;  4MZU A;  2Q4J A;  3FS8 A;  2V0I A;  4G87 A;  3GVD A;  1M8N A;  1V67 A;  1QRG A;  1J2Z A;  1KK5 A;  2OEF A;  3HJJ A;  2OI5 A;  3R5D A;  3TWD A;  1YP4 A;  3VBN A;  4EA9 A;  1QQ0 A;  4KPZ A;  3T57 A;  2GGQ A;  4G3P A;  4HCQ A;  3SUC A;  3DK5 A;  4EA7 A;  4M98 A;  2P2O A;  2I5K A;  3GOS A;  3OUP A;  4E6U A;  5E3P A;  4KPX A;  3OTZ A;  3OU9 A;  4ISX A;  4EAA A;  2IUA A;  3VBM A;  2IU9 A;  3GUE A; 
#chains in the Genus database with same CATH homology
 3R5B A;  4HUS A;  5DG3 A;  4DCL A;  3FSY A;  1MR7 A;  3I3X A;  4N6B A;  3FSC A;  3VBI A;  4AAW A;  4KQL A;  4N69 A;  5DEP A;  1QRF A;  3VBL A;  4KNX A;  3BRK X;  4J09 A;  3NZ2 A;  1KK4 A;  2TDT A;  3IXC A;  3TIO A;  3FOQ A;  2QIV X;  3SPT A;  3TDT A;  1HM0 A;  1OCX A;  4J18 A;  4KNR A;  3EG4 A;  1LXA A;  3R5C A;  4M9C A;  2QIA A;  2V0K A;  4EAB A;  2XAT A;  1YP3 A;  2GGO A;  4K6R A;  1T3D A;  2V0J A;  5ADX U;  3BSW A;  2IC7 A;  2RIJ A;  2WLC A;  3C8V A;  4N6A A;  4HZD A;  3BSY A;  3BXY A;  3V4E A;  3D98 A;  3DJ4 A;  4IHF A;  3ECT A;  3MC4 A;  4FCE A;  2WLF A;  4G3Q A;  3EH0 A;  4AA7 A;  2VHE A;  2WLE A;  1KRU A;  2VD4 A;  2JF3 A;  4MYO A;  4M2B A;  3R8Y A;  3I3A A;  4G3S A;  1TDT A;  1MR9 A;  1SSM A;  1KHR A;  3R2W A;  5U2K A;  3OTM A;  1SST A;  1G97 A;  2FKO A;  3Q1X A;  4EA8 A;  2QKX A;  3DHO A;  1XAT A;  2OEG A;  2JF2 A;  3BFP A;  3HSQ A;  4M99 A;  2AQ9 A;  1KGT A;  1V3W A;  5E3R A;  4IHG A;  5F42 A;  1KRR A;  4E79 A;  1QRL A;  2ICX A;  4HUR A;  1SSQ A;  4H7O A;  4IHH A;  3FSB A;  3JQY A;  1KRV A;  4R7P A;  3PMO A;  4M2A A;  2W0V A;  1KK6 A;  5L6V A;  3R1W A;  4R37 A;  4EGG A;  3BSS A;  2OI7 A;  4HZC A;  5E3Q A;  1XHD A;  3KWD A;  1KQA A;  3KWC A;  3IGJ A;  5L6S A;  1S80 A;  4R36 A;  3R5A A;  1FXJ A;  3P47 A;  3VBJ A;  3F1X A;  5ADX V;  3EEV A;  1HV9 A;  3CJ8 A;  3VBK A;  1YP2 A;  3FTT A;  5AFU V;  5AFU U;  2V0H A;  3TV0 A;  3D8V A;  2WLG A;  3SRT A;  3TIS A;  1QRM A;  4E75 A;  3R3I A;  3MQG A;  4E6T A;  4MFG A;  3OW5 A;  1THJ A;  1HM8 A;  3FSX A;  3TK8 A;  2W0W A;  3VBP A;  3P1B A;  3ST8 A;  2IU8 A;  5DEM A;  1G95 A;  1FWY A;  3FWW A;  3VNP A;  2NPO A;  3R3R A;  2ICY A;  4EQY A;  1MRL A;  4AC3 A;  2WLD A;  3MQH A;  3R0S A;  1Z90 A;  4N27 A;  1HM9 A;  1KGQ A;  4E1K A;  1QRE A;  2V0L A;  3KWE A;  2OI6 A;  4M28 A;  4MZU A;  2Q4J A;  3FS8 A;  2V0I A;  4G87 A;  3GVD A;  1V67 A;  1QRG A;  1J2Z A;  1KK5 A;  2OEF A;  3HJJ A;  2OI5 A;  3R5D A;  3TWD A;  1YP4 A;  3VBN A;  4EA9 A;  1QQ0 A;  4KPZ A;  3T57 A;  2GGQ A;  4G3P A;  4HCQ A;  3DK5 A;  4EA7 A;  4M98 A;  2P2O A;  2I5K A;  3GOS A;  3OUP A;  4E6U A;  5E3P A;  4KPX A;  3OTZ A;  3OU9 A;  4ISX A;  4EAA A;  2IUA A;  3VBM A;  2IU9 A;  3GUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...