1MRAA

Mandelate racemase mutant d270n co-crystallized with (s)-atrolactate
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
357
structure length
357
Chain Sequence
EVLITGLRTRAVNVPLAYPVHTAVGTVGTAPLVLIDLATSAGVVGHSYLFAYTPVALKSLKQLLDDMAAMIVNEPLAPVSLEAMLAKRFCLAGYTGLIRMAAAGIDMAAWDALGKVHETPLVKLLGANARPVQAYDSHSLDGVKLATERAVTAAELGFRAVKTKIGYPALDQDLAVVRSIRQAVGDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTWIEEPTLQHDYEGHQRIQSKLNVPVQMGENWLGPEEMFKALSIGACRLAMPNAMKIGGVTGWIRASALAQQFGIPMSSHLFQEISAHLLAATPTAHWLERLDLAGSVIEPTLTFEGGNAVIPDLPGVGIIWREKEIGKYLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of the reaction catalyzed by mandelate racemase: structure and mechanistic properties of the D270N mutant.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Racemase
molecule keywords MANDELATE RACEMASE
total genus 131
structure length 357
sequence length 357
ec nomenclature ec 5.1.2.2: Mandelate racemase.
pdb deposition date 1996-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1mraA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1mraA01
3RCYA 3ZVHA 4ENLA 4HNCA 3S5SA 2OG9A 2RDXA 3GD6A 3EKGA 1EC9A 3KUMA 2HNEA 4H19A 2PCEA 4KT2A 3V3WA 1XS2A 4HNLA 2PGWA 1FHUA 2PP3A 3DDMA 4E4UA 1FHVA 2OQYA 3CAWA 3TTEA 2XH2A 1SJBA 3B97A 3VC6A 4E5TA 2ONEA 3RR1A 2DW7A 3MSYA 4K2SA 3V5FA 3EEZA 3STPA 1MDLA 3DG3A 3ES8A 3UCDA 2PTZA 3FYYA 4E4FA 2PPGA 4A3RA 2PGEA 3Q45A 3TJIA 4Z17A 2NQLA 3ZLHA 2PSNA 5ENLA 5J04A 3MY9A 4JN8A 4H83A 3H7VA 3P0WA 3ES7A 2QDDA 4ROPA 4YWSA 1JDFA 1TKKA 2AKMA 2OZ8A 4GIRA 3QN3A 1SJAA 4DN1A 4KPLA 4DHGA 4MKSA 2DW6A 4K8GA 4KWSA 3Q4DA 2QVHA 1SJDA 4JHMA 2AL2B 2OZ3A 3VA8A 4HCHA 3ZLFA 4MMWA 3I6EA 2P3ZA 3QPEA 3QTPA 4GGHA 1P43A 3CYJA 3T9PA 3R0UA 2FYMA 3UGVA 3DG6A 5EU9A 4MGGA 2OQHA 3FXGA 4IL0A 2AKZA 2XGZA 4FP1A 5FJTA 5FJOA 2OLAA 4H2HA 1TE6A 2HXTA 2OFJA 2XSXA 4E8GA 3R1ZA 3SSZA 3THUA 3SN4A 3OP2A 2QJNA 1BKHA 2P88A 3OTRA 3SQSA 3SN0A 2PU1A 3FCPA 3N4FA 4E6MA 5FJPA 1KKRA 3MZNA 2OVLA 3UXLA 3FV9A 2OO6A 4GMEA 2OZTA 3MKCA 3N6HA 3TW9A 3P93A 1DTNA 3OZYA 4F4RA 4HYRA 5FJRA 2GGEA 3R10A 2GGJA 2MNRA 3CXOA 3D46A 3MQTA 4G8TA 3I4KA 3S47A 2P8CA 5FJUA 1MUCA 4M0XA 2HZGA 3DEQA 1EBGA 3BOXA 3MWCA 2PTWA 1EC7A 3DG7A 3TOYA 2PTXA 3QLDA 3CB3A 3IJIA 1JCTA 1XPYA 3DESA 3VC5A 3DFHA 1PDYA 2PU0A 1IYXA 1EBHA 4GYPC 3ENLA 3SBFA 3DGBA 2QQ6A 4FI4A 4KEMA 2PA6A 1JPDX 3UJFA 2ZC8A 2AL2A 4J3ZA 1WUFA 3VCNA 6ENLA 3UJRA 3GO2A 1WUEA 2PMQA 1KKOA 3P3BA 2XH0A 4HN8A 3DERA 4IL2A 4IZGA 1R0MA 2QGYA 3V5CA 3JVAA 3H8AA 3H70A 2FKPA 2OPJA 2P0IA 1RVKA 1MDRA 3TCSA 4IP4A 4EWJA 3N4EA 4DX3A 3T8QA 3R11A 1YEYA 3UXKA 3JW7A 3R0KA 3VCCA 3ZVIA 3VFCA 3QKEA 2XH7A 2I5QA 3FJ4A 3IJQA 4G7FA 1ELSA 3ZLGA 4ZA0A 1W6TA 2QDEA 1ONEA 3NZGA 1OEPA 3CT2A 2OKTA 3SJNA 3OW1A 3U9IA 3TWBA 2QJJA 4K1WA 3RRAA 2GGGA 3UJ2A 2PP0A 2GGIA 3NFUA 3PWIA 4HCLA 3CK5A 2GSHA 7ENLA 1F9CA 3VDGA 1SJCA 2O56A 3OZMA 3V4BA 2GDQA 2XH4A 3PWGA 4J1OA 4X2PA 3RITA 4DWDA 5BOFA 3TJ4A 1JPMA 1KCZA 3GY1A 3PFRA 3RGTA 3SN1A 3NXLA 3BJSA 3HPFA 3H12A 4HCDA 2GL5A 4A35A 2PP1A 3R25A 2QJMA 1KD0A 2POZA 3DFYA 1MNSA 3TQPA 3TWAA 2MUCA 3T4WA 4ZCWA 3T6CA 4IHCA 1NELA 3IJLA 2CHRA 2HXUA 1TZZA 3ZVHB 4GISA 2ZADA 2AL1A 3UJSA 1R6WA 3N6JA 2OX4A 4IT1A 4Z1YA 1EC8A 1ECQA 3JZUA 1MRAA 1BQGA 4GFIA 4HPNA 1NU5A 4DYEA 3UJEA 3DIPA 2PS2A 3I6TA 4DXKA 3NO1A 5IDZA 4M6UA 2P8BA 3K1GA 3MUCA 1L8PA 3PK7A 1E9IA 3UCCA 1P48A 4A6GA 2PODA 5BOEA 3FVDA 4H1ZA 3IK4A 3D47A 3U4FA 4IP5A 3OPSA 4GGBA 4GYPA 2GGHA 2PTYA 3RO6A 1PDZA 3GC2A 3BSMA 4JN7A
chains in the Genus database with same CATH superfamily
3B06A 3GXMA 4BURA 5I77A 4H04A 4OBTA 1J0YA 1Q5MA 2AAQA 1TZ7A 2DSUA 3BMXA 1W37A 2VEFA 4Z2HA 5G5GB 1VB9A 3BG9A 3APYA 1EXPA 4H4SA 1DQWA 1JD7A 1BVWA 3LLFA 3SIMA 3W23A 3OA5A 1VQTA 2JBMA 3PZNA 1FCBA 5A6LA 1H7OA 3SADA 1XHGA 2GUYA 3QM3A 3CZLA 4UOZA 3VMOA 4E4UA 1C90A 1O66A 2ZUMA 4I5XA 4Z1BA 3EDJA 3WLKX 5JCKA 2PDMA 3AMDA 4PTWA 4DLMA 1Q4WA 4PZVA 3G6MA 3W7JA 3GFYA 3WH9A 2FZNA 3PF3A 3ZYZA 5JCIA 4M80A 2H8XA 4A3RA 1P0EA 3HMCA 3BARA 1RVGA 4GA8A 5I6SA 1OQFA 3SGZA 1KR0A 1MXGA 1KFCA 4MFEA 3VKCA 2PSNA 4FR6A 3AXKA 3QQ0A 4NVTA 4JN8A 3GE7A 4HK6A 2FZMA 4LC8A 3ES7A 4MB4A 1QDSA 3C86A 4DJEC 4BZYA 2UBPC 2W5FA 3NYZA 3LOTA 3WF1A 1EGVA 3GDRA 3VGHA 3WD2A 4DWSD 3O15A 3BTNA 1TFVA 1NFBA 2CBIA 3GIPA 2C3CA 4UWMA 1NDYA 2E28A 3D3FA 3ARUA 3R8GA 1TUXA 5D09A 3KOWA 4R34A 3UZZA 3EF6A 2IXVA 2PDPA 4QAIA 3MPGA 4FXRA 4MAZA 2WPEA 1XCXA 3QTPA 4RE4A 4JYFA 4TXEA 1QOXA 1C93A 2V5LA 2XJ7A 4LJ3A 3I6RA 1FWWA 3CHCA 1UYQA 1OIFA 1VPYA 3GH7A 3HMJG 2OFJA 5BRPA 1R3YA 3ABSA 4XZLX 4M3PA 3SCNA 2Z2BA 3W6MA 5A1AA 2E6YA 4IG2B 3BLDA 4NXSA 4QSFA 4D8LA 4EKJA 3UPWA 3OG2A 4S3KA 3THQA 4D6GA 4WD0A 1JEZA 1DKWA 2XGBA 3Q67A 5B7YA 3WDJA 5H8PA 1F8IA 1VENA 3OU8A 3MJMA 4N6FA 1PPIA 1C91A 3VOIA 4S2CA 1IWAA 3KS6A 1YNPA 4D6CA 3LD5A 2WKLA 3FLUA 3H4KA 2X16A 4YPJA 4XX6A 3HTWA 2C18A 4BK9A 1XSJA 3FVMA 4LS0A 1OFAA 1V0LA 2P8CA 4FIRA 3MSRA 4WXZA 5H8MA 3VU2A 4ADTA 4AWTA 1E55A 1ZAJA 4UFLA 1BRLB 1MW1A 4BEUA 1SZGA 3VZYA 3H4GA 2F61A 4LPCA 4Q8PA 3CB3A 4RXGA 1S39A 5GQBA 4ZQNA 1W91A 2BWGA 1U22A 4JQ4A 3DBNA 1WXJA 3ABOA 3HGOA 2V3DA 3LXDA 2YDAA 4FNTA 1UROA 3EDKA 3EAOA 4S3GA 1PSCA 3SRDA 1EF2A 5FKYA 2VM8A 2ZZ3A 3PBWA 3VNJA 1FDZA 2XIQA 2CLKA 4H7CA 3UZJA 3H55A 1E4MM 4HN8A 3BW4A 3KRBA 1F76A 3IIOA 4JHZA 4TUFA 3INPA 4AUBA 2J79A 3PZIA 3VD3A 3W1RA 4IX0A 3SQPA 2ISSA 1Q45A 1KLZA 1E1FA 1IZKA 3S1GA 3ONCA 4OKDA 1WZKA 3LHWA 1CENA 3GYEA 5KTLA 4KETA 7ODCA 4O50A 2Z7KA 4AIUA 2OKOA 1DPMA 2YIHA 3W27A 1RCOB 2XH7A 3QKEA 1VGAA 1KCLA 4X0VA 4DYKA 1KC7A 1FTXA 4ZTYA 3WKZA 4EIVA 1PX8A 1XLGA 4JTUA 3BXWA 4C6LA 2A7NA 1R85A 2PB1A 4A3YA 1KA9F 1V3HA 3VKDA 8XIMA 3WDPP 4Q4SA 6TIMA 3QFWA 1GPFA 3WO8A 4W8AA 1GZ1A 4H41A 1XDIA 2EPMX 1BWKA 1H0GA 4XVEA 2GGIA 1N63C 2PDBA 3GD4A 2VRQA 2FQIA 1UKPA 4UTIA 2HDJA 1UMYA 2C1IA 4NHVA 3BPWA 1MUWA 2CLFA 3W7RA 1VAHA 8CGTA 2NXIA 3NQEA 2Y85A 4L4PA 3ERPA 2DU2A 1K3UA 1HKIA 5HWJA 4FLRA 1AG1O 3TAOA 1JRCA 4NY2A 1A47A 4HJWA 4HCDA 4UB9A 3NQVA 1K7XA 4GH3A 2XIOA 2Y7GA 1ZPTA 4WEVX 2MUCA 4WOQA 1W9UA 5D32A 5FEWA 3LPPA 1YQ2A 2RGMA 4H8UA 3RK8A 3QQ1A 2A6LA 4M81A 1XI3A 2TODA 4I7VA 5D05A 3DC8A 3WH6A 4EF8A 1RLCL 3VGBA 2XZ9A 3BLPX 4DJDD 4HPJA 2FB3A 1TCDA 1OFBA 4UQBA 2YGYA 4L64A 4LV9A 3PG9A 4ERAA 4WY0A 1KFBA 3TNOA 3LU2A 4DJEA 1B9BA 2HJPA 2OLSA 1NF7A 2C3ZA 3EWUA 2VWSA 1A5CA 1RA5A 1KFKA 3A4XA 1GTEA 3P62A 3QF0A 4IFKB 4WGXA 2G4JA 1TQXA 2DZSA 3DI0A 3PTDA 2OGYA 1B54A 3W2NA 3AYVA 4G6CA 3TW7A 1GV4A 4JFVA 2DSVA 4XO6A 2UY3A 4MVAA 5J5DA 1WO2A 3P5ZA 3WN6A 1FH9A 5LIWX 3NQGA 2QCLA 1QPKA 4HA0A 5XIAA 4J7RA 1XLIA 4Q8OA 1WX0A 2GQ8A 4P8WA 1V8EA 3WNMA 4H2CA 4FOKA 5EBAA 3NIYA 4HPGA 5E5CA 1XUZA 4B5VA 1OX5A 3PZGA 6XIAA 3BLEA 3EWCA 3GRIA 1RLDA 7XIMA 2G97A 4HIBA 3R58A 1U5JA 1R7AA 4L4LA 4Q8QA 1FHVA 5I7GA 3HG3A 3M4HA 3A7AA 2XH2A 5I3JA 1RD5A 4F40A 2B7QA 5A8PA 2VUNA 2VUYA 3CZKA 5TNVA 4XZ9A 2ONEA 1D7KA 5FEXA 3I3BA 1EUNA 2CKSA 1BYDA 3ARYA 1POKA 1TV8A 3W70A 1KRMA 4AZBA 1W3HA 4FZIA 3STPA 3DG3A 4BQ4A 3UCDA 3FYYA 3O06A 3IK2A 2Z1VA 1Y5WA 1BQCA 3AALA 1FWJC 3DJGX 3GK0A 2X40A 4P7OA 3UESA 4U3CA 4KFPA 3FW6A 1PCKA 4YVXA 1E4IA 3P6LA 2V5BA 3GUGA 1TWZA 5HR7A 2I56A 3C56A 1GOMA 2V2DA 2V30A 3FYOA 4F48A 1HKMA 4JPGA 5DCDA 3ZQ9A 1GRFA 5LA1A 4EXAA 1PWMA 5I3HA 3AHXA 1IEQA 2AKMA 2F84A 4X2RA 1S5WA 4GIRA 5HJXA 1SJAA 1MW2A 1DE5A 2WP6A 1BFNA 3PSVA 2O9RA 4H6QA 1AJ0A 3H2AA 1BXNA 3UVAA 3L5AA 3VA8A 1N60C 3W26A 3KZSA 1S38A 4P8VA 3EOLA 4YJ5A 3M0YA 5D4YA 3UWQA 4FIQA 3DZ1A 2F2KA 4FX6M 3DG6A 3G24A 1V6YA 1TX2A 2QCDB 3AIBA 2PGFA 4HNNA 4AB4A 1O5KA 4OBRA 1MSSA 4NF7A 2GRTA 5E70A 3VX0A 1V0KA 2J7GA 5AY7A 4B90A 1HQTA 4J3TA 3N4FA 1XM3A 4XKYA 4WF7A 5U7SA 2X7VA 1SSDA 1GGOA 1VFHA 1GK8A 2D2HA 2GVYA 4ZGYA 2E1DA 1NDVA 1UIPA 3MKCA 4CUCA 2X0SA 2V69A 1JUEA 3OIXA 2OWCA 1RK5A 3OZYA 4QP0A 3KS5A 3YPIA 4KWUA 5G2IA 3LMYA 5BWAA 3UR7A 2VVSA 3SI9A 4JDRA 1GQJA 2ANUA 1IXOA 2Y5SA 2PTWA 1XX1A 2HK1A 2V82A 7PTDA 3SCRA 3WBXA 4O1BA 4DO4A 3OQ8A 1KRAC 3W1LA 4PB5A 4ALDA 5PTDA 3SB0A 2J9XA 4DM1A 3WCZA 1ISXA 4HOXA 3DESA 1MWOA 3CUIA 3SCWA 3RILA 4XZNX 1U83A 4DLFA 3QW3A 1ZXIC 4W7WA 3ITOA 3WSUA 4GRTA 2FJUB 3S4TA 2X1UA 2J4GA 2YA0A 4U5IA 1ZJHA 3REQB 4C6MA 3LG3A 2Z28A 2PLCA 1F3WA 1FEBA 3M64A 1VCVA 4D71A 3QHMA 3B9AA 2YAUA 4GOAA 4PMUA 3PS7A 3VIGA 4RE2A 1G0CA 2G3IA 2OPJA 2O7SA 3DAQA 2WPGA 4MNJA 5E09A 1EJSC 4L80A 3SCTA 1A5SA 1WAWA 3CL8A 2QCMA 2GR1A 1OD0A 3AUOA 2G3FA 1DJYA 3PULA 3WQEA 3AIQA 2EHHA 3BW2A 3GX9A 3C5QA 1KW1A 3PPGA 3PUDA 4H4XA 4PB3A 1K8XA 3W07A 4LAOA 3TWBA 3ELFA 2QUTA 1WPCA 3UWYA 3L4ZA 1TIMA 3P60A 1DXFA 2YPIA 3VZXA 3MMWA 1XIMA 1UC4A 1JGIA 5CJ5A 2ZRYA 1EJWC 3P8IA 2VX4A 1Q6QA 2B4GA 4MB1A 3IIVA 1F6KA 3KBNA 4FXJA 5ECUA 3EB2A 1KCZA 3BAXA 2RKXA 2I5GA 3H2CA 3L65A 4DWSB 2DT1A 1C92A 1DQUA 2GSJA 2E67A 4CQAA 1GVOA 3PUOA 4J3UA 4ZOCA 4I90A 1HZYA 5DCBA 1SO6A 3HURA 4O0QA 2E68A 2OT1A 1X96A 1B57A 3BWWA 2X0YA 4DZ5A 3MUZ1 3UWZA 4ZCWA 2X30A 4IHCA 1R86A 2WK2A 5C9XA 3TC6A 3CTLA 4JICA 1UA3A 3LA4A 1LQAA 1UCWA 4DBDA 3BAIA 4CN6A 4MLJA 4PBFA 2RDTA 1ZBKA 3NEVA 1KV5A 3MDWA 4GUGA 4GPNA 1IHIA 1VBUA 3L4VA 3IARA 1XHCA 2YKKA 2CNCA 1NU5A 3GUWA 3HA1A 5EY5A 1BSIA 3KLJA 5EB8A 1X1NA 1UD4A 5DEZA 4LYPA 4GUJA 3CIVA 2EPNA 2V5JA 3NURA 3B3DA 2WC7A 5AHNA 4WLCA 2PS2A 3C2RA 4KGJA 5LYRA 3ZS4A 3B0XA 3M5ZA 5TR3A 2CWNA 1JI2A 3L4YA 4D1IA 2O7QA 1RH9A 4C1LA 4DY1A 1UD5A 4MWAD 5BRBA 1E6RA 2QPXA 1PKNA 2INEA 3UG3A 3AU6A 4GVIA 5CCZA 4H1ZA 2ZQ0A 1TTIA 3QMRA 1ZCCA 4IP5A 1A5AA 1LLZA 1UR4A 4JFUA 2YXXA 4G9PA 1D3HA 4JN7A 3W81A 4QG6A 2ZA3A 4X0NA 2BFGA 3W2LA 1AW2A 2EPOA 1EB3A 1QT1A 2DPEA 4A3UA 4CQ9A 1X1OA 3OBAA 3LPOA 1NHSA 4PMZA 1V6UA 3K13A 2Y5EA 5AHEA 4HHHA 1W2PA 4DBWA 2UV8G 3UXDA 5GJNA 4V28A 1W54A 2YZRA 1JNEA 1H5YA 2PGWA 5CGMA 1GVRA 3PVFA 1NQKA 4GX8A 1KFLA 4L65A 4G7EA 1QI3A 5LXXA 1SJBA 2WOWA 3PG6A 3AQUA 1V51A 3WDIA 4D1JA 2DW7A 1S5TA 3GB6A 3CC1A 2J7EA 3MSYA 4U3AA 3V18A 1VRXA 2ZUWA 4GI4A 3ZWSA 1B3VA 3GNOA 4AZCA 4PFMA 2ZRVA 4JR5A 2YYUA 4TX8A 5EMJA 2Z24A 3THDA 3URAA 3LHUA 2DZUA 4XKMA 2FGBA 2V5KA 2VGIA 4A8IA 3BLIA 3WLSA 2ZWZA 4FPSA 3EA1A 1NWUA 3F5LA 5AC4A 5I0DA 3K2GA 4I8DA 1YBQA 2BSLA 1GKQA 1XSIA 4XD4A 4UCFA 2KZHA 1H7PA 3FOKA 4W4QA 3EKLA 1REQA 3MVIA 2Y24A 2DSWA 2D69A 1OZQA 3CPRA 1T0OA 5SWUA 3TEVA 3GHTA 3L2LA 2A4AA 1I9CB 3E96A 4RZ4A 2XFWA 2VRKA 2JF6A 4H4UA 1BYCA 3PBUA 2WOVA 1A5BA 2Y1HA 3LHTA 1X1ZA 1MO0A 3H2MA 4FS9A 2I5IA 3CYJA 5ABEA 1FP8A 4B5WA 3GU1A 4GLEA 4S3EA 3UGVA 1S2CA 1DHPA 4IL0A 1YKWA 3MCNA 5D02A 4BKNA 3M5XA 4E8GA 3QZEA 2Z6IA 2F6KA 4LVFA 1HL9A 4XBKA 1TJ1A 1LLOA 2WMFA 1TYGA 2FPYA 4OBSA 1YTKA 1G7VA 3ITXA 4DNMA 3CHVA 4GD0A 3HJEA 3W6LA 3S8HA 4M1RA 4R53A 3EDEA 3JR2A 3CU2A 1XR2A 1FWNA 4AXKA 3LTYA 4W7VA 4OT7A 4I7WA 4O0KA 3MV01 2PWEA 1OVDA 2IXUA 5DBUA 2GGEA 4MTVA 1N5WC 1OT2A 4GZJA 1FX6A 1XP3A 1I2PA 2ZDSA 4OUEA 4PMJA 3BJFA 3IVUA 1JCYA 2YBUA 1QPNA 3D0CA 2REQB 4ZOAA 4U4MA 1DWFM 1VIWA 4H9XA 1OD8A 2YA2A 2XFFA 4Z1AA 1HP4A 2ZXAA 4CU6A 2QMJA 3O9NA 1VBRA 3NWRA 5A6BA 3NVWB 3FGCA 2BASA 4GI9A 1R9ZA 3ZMRA 3C0LA 4IPPA 1DIDA 1GVIA 4FI4A 5ABTA 4B15A 4LGXA 5A6MA 4I9TA 5FSEC 3N25A 1R3WA 2Y88A 4N9BA 1M6IA 1VR6A 2Y4SA 4AEFA 2HROA 3ID7A 2QW5A 2QMKA 1VFUA 3U7VA 1TPEA 3G0XA 5KVHA 1Q8JA 5JBFA 4IPJA 1GZGA 1CECA 1VS1A 2ASHA 2DZTA 2CC0A 5E9AA 1ISVA 3D6NA 4O1DA 1NDAA 4H4YA 4X60A 1CXHA 1FDYA 2V3GA 1RVKA 5EMMA 4B4HA 1E0UA 1H60A 4DNHA 4DBUA 1Q7ZA 4Y90A 1T8XA 1ZUAX 2Y0FA 3QPZA 4W5ZA 3AS3A 2JQXA 5L9FA 3VCCA 3ZVIA 3O7UA 2Z6JA 3BVJA 1SPQA 2J77A 3MA8A 3MP4A 1J12A 1OC6A 2WBKA 3O0FA 1UP0A 1ZBCA 4QCFA 1QU4A 4BI7A 3QHOA 3OW1A 1K6AA 3MBDA 4IIEA 2HVNA 2GGGA 3MMTA 3VILA 1QWKA 3VGGA 4K1GA 3PWIA 1WYIA 1JR1A 2VX7A 1KR1A 1U2YA 3C3NA 5FACA 1GCYA 4KCTA 4EE9A 4PC8A 1V08A 1UD2A 1JFHA 3TC3A 4DWSA 3FK4A 4NNCA 3WQ8A 8A3HA 4HJFA 4JTKA 4LALA 3CB8A 4DJFC 1B3OA 1Y0EA 2Z00A 3OGRA 2AOSA 1W5PA 1BD0A 2YYTA 4HK7A 4J35A 5FA5A 1SO5A 4LQ1A 4JIHA 3IGXA 4WKHA 3M0HA 1QHOA 3TQPA 3M0VA 4ZQRA 1XDJA 2WW5A 3B0PA 3TSBA 2QZRA 3T4WA 1VYPX 3UF9A 3S2LA 3FKKA 3F5JA 3MUXA 1MMFA 1XD1A 3GH4A 4KFOA 5AC7A 3ARPA 4AX7A 2QT3A 2X1TA 3MO7A 1P0DA 2QYGA 3WH5A 5LGXA 4MNMA 4LYRA 5I00A 3ARTA 1M3UA 1M04A 4TX6A 3RYSA 2DORA 1WCGA 2FTWA 1KO0A 3CV2A 2J7FA 2FHBA 1F8WA 2X50A 1FHDA 3LCLA 2NUXA 5FF0A 1XQKA 2VX5A 2GVLA 2J9YA 3GVGA 5B7ZA 8RUCA 4C7FA 3ICJA 2BG5A 1EZWA 5GRTA 2UZ9A 1KTBA 3SQLA 4YTQA 2ACQA 3MDUA 1XF0A 2NXHA 1ZJIA 3GW0A 3FAXA 2DVXA 5CZTA 5MKGA 1DWIM 4AW7A 1M41A 4NNAA 1OWQA 4PMNA 3NVZB 1TRDA 5C2CA 1XG4A 2W55A 1TIWA 5DT5A 5BCAA 4F2TA 4GZIA 1E1CB 2YCIX 4IICA 1DJNA 1U1JA 4DM2A 4H9MA 2V6AA 3T7VA 2BGQA 1IQ8A 1EQPA 3QH2A 4PL1A 3Q37A 2QKFA 2WQDA 2ZUUA 1CLXA 3H26A 1E9YB 4XTIA 4QQ3A 3T81A 1X98A 3W1QA 4CD8A 1GOKA 4LYKA 4YWIA 1DWGM 1OG6A 5BWFA 4CGTA 3EEZA 9XIAA 1MDLA 1UH3A 2D24A 3G2GA 2INFA 1PCWA 4O52A 3BOLA 3S46A 3OLGA 2Y63A 1LZOA 4NYYA 2OWWA 5EA9A 2HQMA 2JE8A 3M1ZA 4JQ1A 4HOWA 2F6XA 2XINA 4ADUA 1Z3NA 3ZLHA 3TE9A 1MI3A 5CPLA 4NAEA 4BY3A 2ZX8A 3UBPC 5CZKA 5E6ZA 5KVIA 1KCXA 3TVAA 2EJ1A 4JY9A 1F8MA 1ESWA 1AQMA 1VJSA 1CI1A 2VEKA 1LBMA 1IT7A 2J24A 1BXBA 2V81A 3CWHA 3G8RA 2J6VA 1YIXA 2PDKA 3BMWA 1W1A1 3AHTA 4G56A 3WLQA 3TLQA 1J5SA 2CZEA 2FTPA 1QI0A 2XVNA 4DJFA 1TWSA 4AH7A 3RJYA 5F2GA 2Z1SA 3GKFA 2P3ZA 3UZWA 4HMDA 3KHJA 3OYXA 4XB3A 1JIBA 3VNKA 2XVKA 3BZJA 4IMEA 4G5DA 5HQLA 1MQRA 3AO0A 1XLLA 1MVYA 4YYFA 2WC3A 2A85A 4AD1A 3R1ZA 3HB9A 4ZB2A 4WDTA 2BB0A 2ZDRA 2BZNA 2ZVRA 3BH4A 3DOPA 1BGAA 5HWNA 3DKLA 1US3A 2JIWA 2GQ3A 1I1XA 3QY6A 1XLCA 4JQAA 1ZZMA 3RCMA 2BS9A 4BF7A 3E0FA 3UETA 1O7AA 1NFPA 1FY6A 3EXSA 1BKSA 4UOQA 1I4NA 1LOQA 1ZLPA 5HATA 3PZQA 5MKGB 2ACRA 1HO4A 4LBRA 4LC6A 1NARA 1NY1A 1TPVA 4F4RA 4F66A 3ZO9A 1VZWA 5FJRA 3E0IA 1H50A 3CXOA 3LERA 3QR1A 1TRIA 3QMSA 4WQ6A 1MUCA 3NZPA 2HE8A 3NQCA 3W2KA 2CXGA 2UY2A 4Q8MA 1WAUA 3XISA 5HK4A 2IQ0A 4O10A 5C55A 3ORWA 3NDZA 1CXEA 1KB3A 3PPCA 4HHLA 4UXDA 2TPRA 2PLKA 5CLWA 3GH5A 5AB3A 1J18A 2WBAA 3PTMA 5JVLA 4EPEC 4PTNA 2ZRXA 3MV11 5IM51 3DGBA 3H7RA 4MAVA 1QBBA 2WAGA 2OYLA 1VLIA 1IGSA 4AWUA 1HKKA 3VIPA 3VCNA 1G7UA 3VMNA 1IXNA 1W5NA 1AK5A 2W0UA 3W9ZA 3WBAA 2YCJA 4Y2WA 4LBUA 4R5EA 4H4IA 4O28A 1W3LA 1FKWA 3G1SA 1L9WA 1MYRA 2W0HA 1ZALA 2DT2A 1HJVA 1VBHA 4GBDA 4LS2A 1OY0A 2ZWYA 2AAMA 1PTGA 2GFTA 1M01A 5KITA 1Q1RA 4WY0B 4JZ5A 4PUUA 3GD3A 9RUBA 1H51A 1RCQA 3GAKA 5CLTA 1V0MA 2HK0A 2I5QA 2PEVA 1PKLA 1ZSXA 4P7QA 5AYBA 4ZA0A 3MMDA 3MU7A 1TSIA 3ANUA 2GK1A 3W7PA 2C6QA 3W75A 1HO1A 3G77A 1F7BA 1QW7A 1N8WA 1JROA 3AWNA 3TYCA 1N61C 5EBKA 4O18A 3EB4A 3W02A 3R94A 4GFSA 4N02A 4UTMA 4WK9A 4HNTA 3OZMA 3PJTA 4QLKA 4J1OA 4RR4A 1VCFA 3UZYA 1UUQA 2XG9A 3FX4A 4KRZA 4AD4A 4Y7EA 3C2VA 4QISA 3G1HA 2VMFA 3NXLA 4UTWA 5LNSA 3HW2A 3HPFA 1E9LA 3T0CA 1KD0A 4N7QA 1E40A 4NILA 3NPUA 2WWCA 3QSTA 4LSBA 3QY7A 4QR6A 3W1PA 3IV3A 3CUJA 2QDGA 4E3VA 4O57A 1J5TA 4IJBA 3HGSA 3IGUA 3QOKA 1T6MA 1TTJA 1B1YA 2YXGA 1VRDA 3B03A 4LEQA 6XIMA 2XZ7A 3WBYA 3GTHA 1QXLA 3NVDA 3UT0A 3IAQA 4ERIA 5AHIA 2OX4A 1K6WA 3U2CA 4DJED 3WBWA 1EO7A 2VEPA 2TAAA 5DXYA 3CPUA 1O68A 2RJHA 3JS3A 4QJ5B 1LJYA 3UU0A 1K8ZA 2HBVA 3W88A 5GJMA 2GSEA 5IDIA 4OOUA 1WDRA 2QS8A 3A4WA 3TYUA 2W3SA 1WDPA 4CN4A 2FZ9A 3CGEA 3WX7A 3F2BA 2KAUC 3AXXA 3K1GA 4JFWA 3WEMA 3V5OA 3NG3A 3UCCA 2CWXA 5BOEA 2R1NA 3HU7A 4K38A 1A5NC 1YXYA 3E38A 3WK3A 4Q4PA 4DXVA 3PM6A 4EWND 5CPSA 3OPSA 4LS1A 3DHUA 5LKYA 2P50A 1GKPA 4GABA 4RW5A 4GJIA 1PZ3A 3VXGA 4MG4A 5A6TC 1HF6A 4JHOA 1DXEA 1XSKA 1V3IA 3QY8A 1DQXA 3S5SA 2RDXA 4CU8A 1EP1A 3WD1A 1C7TA 2Q8LA 1W17A 4H19A 1XIDA 2NVAA 4GYFA 4FX9A 1SSGA 5F2IA 5C9RA 2C79A 4JIQA 4HK5A 1VFFA 3HGJA 1EGMA 3DBPA 5BYWA 4J56A 4PMRA 1L2UA 2XGIA 1OIMA 3LX9A 3BV7A 3PWAA 4QE4A 1OJTA 1JPKA 4BFAA 3VOJA 3NZQA 4D6DA 5I78A 1O94A 4DF1A 1Z7AA 3ARRA 4E4FA 5G1MA 1F4AA 2WSYA 2HSAA 3TV8A 3FHAA 2NX3A 4RE3A 1E6XM 3NOYA 4YU1A 3G1RA 1KWKA 2O4QA 2JK2A 3ANYA 4AZIA 2Y70A 2VWTA 3H7VA 3BLFA 4V33A 1JDFA 1JI1A 1DJQA 3AXIA 4F2BA 1BYAA 2FZBA 1VJZA 2XIJA 2R14A 4DN1A 1J0IA 3MP3A 3F4NA 3FAWA 3C61A 4AVFA 5BXPA 5F2MA 4LANA 4LUSB 1O6IA 4XIAA 2V67A 2CBVA 2IKJA 4BCEA 3VDBA 2VFEA 5G1TA 1DIEA 4GGHA 2C14A 2O0TA 2XIMA 3T9PA 4XTDA 1XYAA 2OQHA 2BVTA 4H9ZA 1XDLA 3BGJA 4JX4A 5DMNA 4C6FA 5M1TA 1SW0A 1TE6A 1L6YA 1NVMA 4MDOA 4WKAA 1S3HA 4HPHA 3BLOA 4NYUA 3LDVA 3RG6A 7REQB 2QJNA 1WDWA 2ZZ6A 3CWOX 4Q7BA 4UFIA 1BZLA 3QGAC 3DFQA 3W7MA 4DZHA 1R2RA 4H4PA 4YL2A 4B5NA 2B7OA 2FPTA 5C2GA 3GQYA 3VNYA 3MZNA 4ZODA 3FV9A 3DGZA 3GXTA 4URIA 2E5AA 1GRGA 2PF0A 2GR0A 2X42A 3AIWA 3HV9A 3KP1A 2NVCA 5IXEA 1ZJAA 3GDKA 4NZ4A 1LQ2A 4QJ1A 3A47A 2NQJA 2IKHA 2E9LA 3TH6A 3S47A 3CH0A 4M0XA 3O6CA 5DMLA 3Q58A 1DTUA 3H2EA 4IG2A 4PTDA 3SFKA 1FWTA 1WYGA 4JTQA 3NQ8A 1V97A 2NXGA 4ZQCA 3TTOA 1UWIA 1EHNA 3AFBA 3B9OA 3DXIA 4PMYA 3M9YA 3G1VA 4E4PA 3SUUA 3HBLA 2CXEA 1FDJA 1FCVA 3TSMA 1FP9A 4S3DA 3CS2A 2ZC8A 3UG4A 4B91A 3AYSA 4NUWA 3KLLA 2W91A 3TTYA 5EMUA 1YDOA 1K77A 2Z7GA 1Q66A 3U57A 1VBJA 2XHYA 2Z27A 1YXDA 2D20A 1RALA 1XYFA 1SYTA 1IF2A 4PEEA 3SUWA 4Y8EA 1NDZA 2UY4A 2WZMA 3U2EA 4TV6A 5CC3A 5CG0A 4L6DA 4DWSC 4QXIA 4U33A 2F5ZA 4W88A 2EG6A 5C9ZA 4GNJA 4WKFA 4P7RA 4QS5A 4LB4A 3PFMA 3TQ0A 1NHPA 1PL9A 1VPQA 4PUEA 3MSDA 2F7FA 1RBOB 4BQ2A 3POHA 4NJKA 1FH8A 2DVTA 1ONEA 4ILSA 3TP4A 1KXTA 2BXYA 1GESA 3NQMA 4A05A 4BR1A 3TN5A 4OV4A 3VD5A 4G2DA 3S5NA 3W37A 4AG0A 4EQXA 1T40A 4C6BA 4HCLA 1EDQA 1XG3A 4JDYA 1HJWA 1JJKA 1FVPA 3QSRA 4G1KA 5KEZA 3I3EA 3WNOA 3EKZA 3QFBA 3GW3A 2XVLA 3FEQA 3ZT6A 1N8IA 3GNDA 2AQVA 4GZEA 3A6OA 2WO5A 1CB7B 1BXCA 5HUPA 3BCFA 2DIKA 1NHRA 4UFKA 1LBLA 3HN3A 3NR0A 4KMQA 3ZJ6A 1X6UA 4OWGA 4GCXA 3UWVA 5E0FA 5F7UA 3BJSA 1DOSA 1UR9A 1E15A 2J25A 2J74A 4IX2A 2WM0A 3G8EA 2E6DA 4QSHA 1Z42A 3M7SA 2F9RA 3T2OA 1QWGA 3O2LA 2G3JA 3WUBA 5HPOA 3RNMA 3S83A 1OGGA 1B90A 3UR2A 3EWZA 2WMKA 4HNUA 1ZNNA 1JXKA 3CJPA 3SR6B 4IMGA 1AQFA 1R3VA 3LHZA 4FF7A 3BUVA 3I10A 5HPCA 2W92A 4PMXA 2OYKA 4L1WA 2IKIA 5U25A 3WJYA 3T08A 4HP5A 3ZWTA 2WVVA 2VDHA 2Z1XA 1FHLA 4B5UA 1TMQA 3AJ7A 1KGWA 3ARVA 3IRSA 1LWHA 1H6VA 2R24A 3CLMA 3CUZA 5C7HA 5JCMA 3DHPA 1ODUA 4N0RA 1CTNA 3CAQA 3I7RA 4NG3A 3FG2P 2E9BA 1P48A 3NSMA 4A6GA 1FFVC 4DZAA 1RPKA 3LCIA 2EAWA 3PZMA 4IPIA 4L1GA 4XZIA 1S5NA 1ITXA 3UXIA 3LLDA 3VOHA 2ZA2A 2BC0A 1VHCA 5LIYX 2C15A 3N3TA 3SUSA 2P76A 1Y5VA 4QROA 5DLCA 1CPUA 1BVZA 4FSAA 4LUIA 4RZBA 3CHFA 2WP5A 1NPXA 3T2PA 3HOJA 1GSNA 2R91A 3TCEA 3A24A 1LYXA 5CC7A 1AUSL 1THFD 3UA3A 3IIPA 3N2MA 1AJ2A 2BVDA 1FHUA 1ZQ5A 4S3JA 4AZ6A 2OQYA 3O63A 2H3DA 1WDDA 1POJA 2HMCA 4OU1A 2J7HA 3SIZA 3KCLA 3VC6A 1XV8A 3MUAA 1LQ0A 3E2VA 4ZO9A 1FFUC 1US2A 3U5YA 1JPIA 4RNJA 5D2WA 3SURA 2FGZA 1WXZA 2R1LA 4TTUA 1XLBA 1L6SA 1XWYA 2QUMA 3EA2A 4F8XA 4FXSA 1Q6OA 5HAOA 1MXDA 4H6KA 3N04A 3HG5A 1EOKA 3DYMA 2CYGA 1C7SA 1X2HA 1Q6CA 5DQPA 3KOXA 1RY0A 3MBFA 2F8QA 1FXQA 3PBYA 3ZR5A 4TIMA 1JZ2A 5B80A 4PH6A 2WC4A 1JAKA 5XIMA 1P7TA 3W22A 1WOBA 5CC5A 2YW3A 2R9ZA 1LT7A 4MOZA 2WZEA 4GC4A 3Q65A 3AS1A 1NH6A 1R7OA 3W00A 1GOXA 4NEVA 3T0DA 4P7NA 4AAJA 2AKZA 2OLHA 1E0VA 4QDWA 1UJPA 2I57A 5FJOA 3OB8A 4CCDA 3CTTA 4H2HA 1KLYA 1TA3A 3N19B 2C7FA 4B2DA 3THUA 1H3GA 3R43A 3I7SA 3OP2A 3EB3A 3NPXA 5I06A 3BAJA 1CXFA 2P88A 5FI8A 4AWSA 1JCMP 1JG9A 4XVDA 5K4ZA 3FCPA 3UYIA 3GNNA 1TWIA 5JIWA 4GQRA 3MO4A 1N55A 3W86A 1ZKQA 5M03A 2VGGA 4Z1CA 3ZR6A 4LIIA 3SEPA 2OZTA 5IBXA 1I8JA 3W76A 4LUJA 3E5BA 1P0KA 4O15A 5CZ0A 2ZX6A 4HYRA 2PD9A 3VI2A 1RQHA 3L7RA 4TOQA 4ML4A 3VGDA 1LOLA 4HQVA 4RLIA 2OSYA 3O6DA 1H7RA 3FEMA 3ATYA 3QLDA 3TYEA 1VCGA 4UTJA 4MWAC 3A7UA 1PDYA 2YQUA 4KW2A 2WNZA 3ENLA 3T42A 3NM3A 1KBLA 4AC1X 1GWJA 2PDXA 1JPDX 3E0VA 5LIUX 2ZX5A 2X99A 4Z08A 1WUFA 3N15A 1WUEA 2V2CA 3G0UA 4H7ZA 4ZO6A 3EDDA 3ZJ7A 1EYEA 4Q6XA 2P53A 3N11A 2I14A 3UNTA 4C7GA 3VKKA 4A3QA 4NRRA 1ZK7A 4IGNA 3G1AA 1ME7A 2FH8A 3GM8A 3W38A 1G9HA 3VX1A 4DIAA 1R3QA 2NT0A 3W28A 1N82A 3I65A 4W86A 1W1YA 5K9DA 3VNIA 3JW7A 1UH2A 1STZA 1H41A 1P1MA 1KCKA 1B4KA 3IJQA 3OJGA 4LAZA 4TVCA 3TYBA 3SCVA 1XCFA 4RCXA 1VYRA 1I1WA 1W6TA 3NZGA 3RX4A 4PA8A 5K3VA 2ZOXA 1FWFC 3LK6A 4P7LA 2G5WA 1XQLA 4ADWA 4UQDA 3OG3A 1FWCC 3KRUA 4US6A 1UD6A 3RRAA 6REQA 2QV4A 4LUYA 5CSSA 2C0AA 2PP0A 3GIYA 4R7OA 4ES4A 3O8AA 5JH2A 4ZXLA 2VD8A 2Z1BA 4MY8A 1DL3A 2HV5A 1ML1A 2QUUA 1OBAA 3DKJA 4X2PA 1UPMB 4Z42C 1KFWA 4FO4A 3UP8A 1E71M 3OLDA 1A5MC 3VDHA 3PFRA 4FLQA 1MNZA 5F2LA 5RUBA 1V3MA 3ALFA 1E6SM 3ABRA 2DH3A 4IUGA 1W3NA 4J27A 1K70A 1GOIA 4XZBA 4L9ZA 1NELA 4W7UA 5TD4A 1ZP3A 2ZZ5A 4JFSA 1KFEA 3OZPA 4TV5A 4NNBA 4A3HA 2NV1A 5EL1A 3WLIA 3C8NA 5DT7A 4F0HA 4YS1A 1HKVA 1TTPA 2FGLA 3LN3A 2VELA 5A6JA 3VNMA 1WKFA 3ARQA 1FWAC 3N2CA 2VFHA 3RLHA 1OCBA 5HDRA 1Y7VA 3S1UA 3S5YA 1MQQA 4B3KA 2FDSA 1ADSA 2ZTKA 2P10A 4EX4A 4PR4A 3PZOA 3VVGA 3WELA 4O1EA 4GXMA 3T78A 4CCZA 3GVVA 4UCGA 4RDWA 1ZFJA 3WK1A 1N5XA 2P8BA 3FJ6A 4UTUA 4XD5A 3W83A 1IIHA 2J7CA 1G6CA 2J8TA 1Q65A 2DDXA 4WXYA 1WZAA 3NUKA 3S5ZA 4FNPA 3V1PA 3QJAA 4UFMA 2Z29A 2F38A 3T44A 1SQ7A 3KRZA 4OFCA 3ZM8A 5A6SA 2INZA 3UA4A 3RO6A 1FFQA 2TSYA 2EKCA 3PJUA 2E9MA 3S2MA 3TN6A 2HNHA 4HU4A 1OC5A 2CIPA 3EMQA 1KRCC 4AZHA 2PLMA 4CEUC 5A2AA 3TW6A 3EKGA 4C6CA 1EQCA 1XRVA 5D33A 1OSEA 5FF3A 3WZ0E 2HNEA 3MZ2A 1YE6A 3GIQA 4REQB 4W87A 1FRBA 3CQJA 2PDQA 4J3XA 2DFAA 1D3CA 4HHPA 4C5YA 2X1SA 1H7XA 1A5KC 3KVMA 1EP3A 1VQZA 1V6XA 2JALA 3B97A 1GQLA 1OZMA 3UG8A 2GUUA 1FWEC 1CLKA 3W7NA 1KN0A 4JYEA 1E43A 3NGFA 1QK2A 6ALDA 3TONA 3BK0A 4DEFA 3URHA 3HRDC 3CL6A 3VO0A 2PZ0A 3VINA 1PAMA 2XSAA 1VFOA 7TIMA 4IFRA 5CPQA 4C1NB 3VOFA 3SSJA 4PFHA 1IXQA 2VFDA 4X22A 1G4PA 1PZ0A 5GNZA 4JD4A 4IMCA 1UG6A 4GNKB 3P0WA 3S3GA 1WE5A 3LSCA 3WF0A 4ROPA 4YWSA 2JEPA 4B2DD 3STGA 3TQKA 1MEWA 1T7LA 1FH7A 1H1YA 3C4UA 1K9TA 4AU0A 1BF2A 5LHFA 4D8AA 1EX1A 4NZ1A 2QJHA 4NL1A 4RJEA 4M5PA 1V0NA 1BWCA 4IISA 2WJZA 3QGVA 3QV9A 3R0UA 3RJXA 2WPBA 1RHCA 3G3DA 3BQ6A 2B7PA 4FMVA 2TMDA 4LY4A 1D8CA 1LUCB 1TPFA 4H7VA 1XKJA 5I3FA 2ABBA 3UCQA 2HTMA 4LAUA 2ZICA 3CO4A 3MC5A 1I2QA 3L9CA 4IIGA 3DCPA 1EX5A 2BDQA 1JDEA 5EMLA 4WRHA 2BHUA 4CVUA 4E6MA 4OV9A 1WZMA 1KKRA 3PG8A 5D04C 5CPNA 3EUB3 3OVQA 4O53A 3MT1A 4JTCA 2R82A 1DIOA 2WVVB 3HG4A 3MKVA 3FKRA 3GBEA 1RBLA 2CDUA 1J96A 3MTWA 2YL9A 3GXIA 3KTCA 3N2OA 5C0QA 3KBMA 3FY1A 3LTPA 4MHBA 4HGXA 5DRCA 4IM4A 4JTTA 4M7TA 4EANA 1LT8A 3KCOA 3KHDA 1DXIA 4LCRA 4N9EA 3CBWA 4MYXA 1ZB5A 3USZA 3E2SA 4MPKA 4UZSA 2PDWA 4DXXA 4E2DA 1M7PA 3WG6A 5D2VA 4X3ZA 3B05A 4EAYA 3W71A 4PMQA 1PX4A 1VDVA 2O9PA 4NT0A 3W24A 1W9PA 5G1YA 3T8LA 4QDMA 3T4CA 3CHDA 4WDUA 2W3ZA 4W93A 1UBPC 1C29A 1JZ4A 2H9AB 1C8YA 1ZS2A 1LORA 5C5YA 2PMQA 3APGA 4AMAA 4LH8A 2BY0A 1UR1A 4N4PA 1ADOA 2WBGA 2WMHA 1LDCA 3G6LA 4Q8VA 3USBA 3V5CA 3P67A 3TLLA 1HGWA 4C1KA 3R0DA 4RNIA 5E0CA 3E49A 1EPVA 4NIRA 2PWUA 3UXAA 2B81A 3P8JA 4EWJA 3GU2A 3C2YA 4DAIA 1R47A 3EMCA 3ZXWA 3AWOA 2XN0A 4YWOA 2ZC1A 3SJNA 2W54A 1YX1A 3WMCA 5FESA 2CPUA 3H4WA 4XG1A 2BOFX 3J7HA 1OT1A 4P8UA 4KESA 4UMBA 4LVDA 4K8HA 3SJ3A 3GR7A 4KEUA 4XAYA 3BSHA 3IGSA 2HS6A 1WB0A 4FNUA 4Q8UA 1XLAA 3GY1A 4LWWA 2WYSA 2CLEA 5DX7A 1B3XA 3RGTA 4CU7A 3SN1A 4A35A 4GXPA 2FVKA 3E2QA 3EXTA 4LU0A 3S9YA 1CT5A 5D37A 3S6OA 2V3FA 2GJXB 1KBIA 3TFCA 1XYMA 1OFDA 3IJ9A 1DORA 3B8VA 3UZ5A 2OWXA 3LBCA 2X1RA 4QQUA 4GISA 4C6JA 2VR4A 5GVJA 1CWYA 3IIZA 4Z2IA 5T26A 1R6WA 3N6JA 3WEOA 5KZDA 2C1GA 4IT1A 5TF0A 1ITQA 1S2TA 1EC8A 3H2NA 2WMIB 2YB1A 3AHVA 5A6AA 1T99A 2J62A 1U5HA 1F07A 5CXPA 1JZ6A 4UC5A 2W67A 3IUHA 2OZ0A 2CHNA 4JFTA 2XVGA 1XC4A 4KWWA 3FXYA 2QUNA 3H22A 3AROA 4L9XA 4DPPA 1PEZA 2TRSA 3OODA 5EYWA 3CAKA 4WSHA 1AMYA 4UNLA 1KFJA 1XC6A 4AX6A 1ZAIA 4IFKA 5AYYA 5GPRA 3NAVA 1J6PA 3CEPA 4HA3A 3WDHA 2H8ZA 3V16A 7CGTA 1QNRA 2D3NA 2PDLA 4HU3A 3RLVA 1F6YA 3CO8A 5LNWA 4GK8A 3KBVA 4WDXA 1BG9A 2GDUA 2BXZA 2F2HA 4LY8A 1BAGA 1E3ZA 3LY0A 1VF8A 1TVLA 1WOAA 1AH4A 1GJWA 1XL9A 2XWDA 4JYDA 5FF2A 1GQKA 1VEMA 2NSOA 3TAKA 2YCKX 3R89A 1NP0A 4OE7A 1E1EA 5G2HA 3LADA 2PP3A 3MHFA 1SFTA 3LQGA 3PZUA 3KTXA 4AEEA 1RM6B 4LTSA 3QFEA 3GNXA 3DFNA 3FNDA 4W8LA 4PEKA 2XISA 1GYNA 1FUYA 4K2SA 1A49A 3PBVA 2Y2WA 4LCSA 1VFTA 2FZDA 1FWGC 4ZL1A 2FB2A 5JBEA 2R1PA 1WP6A 3H23A 4XBSA 2V9DA 3RNDA 4GUFA 4LBSA 3OLEA 1RUSA 4QE5A 3GNPA 4PMVA 3GWQA 1KM6A 3HPZA 1SZFA 3LM7A 3GTIA 3EWXA 1WKEA 1T96A 1NQ6A 3LYEA 1TKKA 3WDQA 2PFHA 4AC7C 5HULA 5A6KA 3TYDA 1XXXA 4GIEA 1ADDA 1C8XA 3GHRA 2R94A 3WK0A 4JHMA 2V3EA 3W1MA 4AY7A 3VE7A 3PPHA 3CV1A 1KM2A 2GJPA 4IIHA 2VCBA 3GTXA 3B04A 4AIEA 1X38A 5CPMA 2D2GA 3BGGA 1VKFA 1LP6A 3M5YA 1QTWA 4O13A 1RAKA 5BMXA 4RX0A 1AL7A 1GYLA 1GZJA 4ZBCA 3SN4A 2NW0A 2DSZA 3S9ZA 4L56A 4FDCB 1SZRA 3RUBL 1E51A 4QS6A 2Z2AA 3M6DA 4FK9A 2Z0IA 3RFAA 1K9FA 5D8WA 3AAMA 4C6DA 4FF5A 4ZXOA 4CNSA 3AHYA 2WNQA 3N6HA 4MJZA 5HANA 4R9XA 4ECLA 4HSOA 2EKGA 2VZTA 3TJXA 1JZ7A 2GGJA 4PL2A 2V68A 1VD6A 4G8TA 4IPNB 1KXHA 4HTYA 4O12A 1UD3A 4C60A 1EC7A 1XICA 5EPDA 4AZ5A 2Y7DA 4DUXA 3VDAA 2VOTA 2F6UA 4HNVA 3K46A 1EFZA 3B8DA 2ZUSA 4KS0A 3UQNA 1UKOA 2QPUA 1TVPA 2E1WA 2EGZA 1IYXA 4XSLA 1RV8A 2WMIA 3NQDA 4D9PA 1H5VA 4IQDA 4KEMA 1K9EA 1W32A 4ICCX 5DN1A 4IUOA 1V6VA 2WCAA 3GFZA 5EKYA 3P5YA 4LX4A 3ITGA 1W1ZA 4XBJA 3UPBA 2ZKMX 5D2YA 3AMLA 3DERA 4NZCA 2OT0A 5T8GA 5DY3A 3PBMA 4X9SA 5CBIA 2W6RA 3WMSA 2BXVA 3FA5A 4CNPA 3M0KA 5FEPA 4KIEA 4O4WA 3MI3A 3U2OA 2ZUVA 1XLDA 4C6KA 4NASA 3E12A 1O60A 4NJHA 2CKRA 4RL3A 1XINA 2NSXA 1HW6A 1E3XA 4RDVA 4ZO7A 3W7CA 3A5VA 3VM5A 2A3LA 3G1DA 3WNNA 1QBAA 4PSRA 1HGYA 1JVNA 3L12A 2VEIA 4MYAA 1E5JA 5LA2A 4WY0F 2X1IA 1KQZA 3A4AA 1XRTA 3WQ6A 1ITCA 5IBXC 2DIEA 1CIUA 3KP0A 2VI0A 3S6TA 3SAZA 3QXBA 2EBNA 3NFUA 4UTHA 2C71A 2E6AA 3LPFA 4J2MA 2XFRA 4BWLA 2GSHA 1F9CA 3V75A 4I6VA 3ONBA 4M56A 1UOZA 4QBXA 1EJXC 3BC9A 2RABA 2E5BA 5AN7A 1M53A 4B9YA 2ADAA 4UTTA 3M16A 1A4MA 4NSBA 3GYCA 3PZTA 5AFDA 3GG1A 2CCRA 4J2PA 4YMZA 4RV8A 2FZ8A 4YXGA 3OHIA 1EA9C 5HWMA 3IGHX 3SUVA 3URQA 4ZOHB 3L2IA 2X7WA 2FFCA 3E1F1 1K8CA 1YNQA 4GIYA 3PJWA 5KETA 3L0KA 3UWEA 2PRLA 1X97A 2IQTA 3U5UA 1REQB 2GJRA 5D2XA 1E5NA 4Q4QA 4ZMGA 3R5EA 2BCPA 3C0SA 4UQ9A 4H6EA 1A50A 1LLWA 3REQA 4ADSA 4IH3A 4ROQA 1TG7A 4EQWA 2CLPA 4ZENA 1GERA 5U1OA 1R30A 1M5WA 2FIQA 4HMNA 1TV4A 1B2YA 3UJEA 1DYSA 2A8XA 4JQ9A 3R13A 4DUVA 2V2HA 2DUAA 1NWTA 1WKYA 1XLJA 4NZJA 1R5YA 1EJUC 3KXQA 2W63A 3GZ3A 4JTIA 3UD6A 4GKLA 4UIOA 1L8PA 1CGYA 4Q22A 5F4SA 1XH2A 1W56A 3CQIA 1DHKA 4N2YA 5HBFA 4A22A 1HIZA 3FVDA 2X8CA 4LF1A 1RSCA 3WLNA 4JN6A 2PDGA 3MYOA 2CEQA 2RJGA 2GGHA 4HPXA 3NL6A 4W5UA 5AHMA 4O14A 1LRQA 4M1BA 3T55A 1E0WA 4DB7A 2ZVIA 3H7UA 4QNEA 1SFJA 4HYWA 1XGZA 2UWFA 4PGLA 1V6TA 3V3WA 1XS2A 4HNLA 3CPGA 3TFXA 5FIPA 5CSUA 1QR7A 2QCCA 3PR2A 2E09A 2RDUA 1PS9A 3WBEA 2EPLX 1K4GA 3TOPA 4ZE5A 3R6IA 5CJMA 4GY7A 3W01A 3TA9A 5HINA 1KXQA 4MY9A 2IKGA 4FA3A 1PZ1A 1M7XA 2V5DA 4N4QA 4C6OA 4EXQA 2W9MA 3KW3A 1X2GA 1OYCA 1S2WA 2OODA 4KGLA 3ZT7A 3LCGA 5AC5A 4WGHA 1OG0A 3LCHA 3O6YX 4H4QA 2NQLA 5T9CE 3UW6A 3I7QA 1EJ7L 3MY9A 1M68A 3CQKA 4PCTA 3VGFA 2SFPA 2QDDA 2YB4A 4XIMA 3KRSA 4QG8A 2QXWA 5JRBA 5BU6A 1PV8A 2DH2A 1HFBA 4JY8A 1W1VA 3LGEA 1VFSA 2X41A 1Z69A 4HBKA 5G5IA 1UWSA 4M82A 2DW6A 1I2RA 1AL8A 1HTIA 3TC7A 2C91A 1E72M 2YOCA 1OFPA 3F7JA 4MWAE 2RDWA 3AZRA 1TUFA 2I16A 2VP8A 1DWHM 1PHQA 2FYMA 3QV8A 4DF2A 3T05A 2ZA1A 5A8GA 5AYZA 5H91A 4DO7A 1R9XA 4JDBA 1XPGA 1SMAA 3ZJ8A 3VIMA 2G50A 1K7EA 1A0EA 5C8BB 3CM4A 1TPH1 3C3UA 3WQOA 3OGSA 2DJLA 1P1XA 3AJXA 3FYPA 2BX7A 3L4WA 2A1YA 1PKYA 5CPOA 2Y7FA 3UYCA 2VQUA 3AZSA 3A13A 4S3FA 2WM1A 4LVBA 2GR2A 1A4LA 3RIKA 2J66A 3BDKA 4DI8A 1GOQA 3G3MA 5EMYA 4DELA 4FALA 4I3GA 3FFSA 3FSTA 2JIEA 3I4KA 2ZUTA 1UWRA 3A3WA 3IUIA 1R38A 2QAEA 1BPLB 2HZGA 3UGRA 2QAFA 5L6UA 1ZRQA 3NDOA 2PI6A 2AQOA 5K2ZA 2XDFA 1F3PA 3MI2A 3VM7A 3WFLA 2ZRWA 1P0NA 3BLKA 1RP8A 1JCTA 4Y96A 2QDHA 1W5QA 4CD6A 4MF4A 5HNTA 1ODZA 4YLWA 5KZ6A 1LCOA 3GTFA 5D2TA 5D03A 3VYLA 4AMCA 1IE7C 3EDFA 2WHMA 3MKKA 2PGRA 2D23A 3CH9A 3NRZB 4JTEA 2DP3A 2WKJA 3ZR4A 3TZNA 3RR4A 1S5MA 2XIIA 4KQNA 4O1FA 2OXNA 3M07A 1Q2SA 1Z48A 4IZGA 5LZLA 4JQ2A 3CZJA 3SRHA 1G5AA 2QGYA 3RXZA 3GRTA 3DYOA 1QPRA 4F0SA 3WF3A 2E5DA 1E6PA 3GDBA 3NL5A 3L23A 3UG5A 3F2CA 2A7RA 3HPAA 1Z41A 4AF0B 2FKPA 1ALDA 2AMGA 4Y6GA 2QHAA 3VABA 2QCFA 4GQBA 4IP4A 4N42A 4P61A 3OBEA 3SCUA 2X2YA 4IPLA 4H4VA 3UXKA 1YADA 3R0KA 2VXNA 2PE4A 2BC1A 1PVNA 1BTMA 1WBHA 2YSWA 1PTAA 3FDGA 4BQ5A 1VBGA 2OKTA 3KFTA 4O54A 1XIJA 1AZ2A 1AJZA 2NVDA 3ME3A 3G1YA 2E77A 1ISZA 3DH7A 1L0PA 4RUBA 1Z89A 2QF8A 3ABQA 3NJ3A 2Y8UA 3BL3A 1PIFA 1OABA 3ABZA 3CGBA 2HQAA 3VOCA 2WB5A 4MUPA 3STEA 1RXOB 4DWDA 5BOFA 2ZBTA 5KINA 3TJ4A 4EVZA 3AZTA 5ABHA 2RFGA 4MUZA 2C0HA 3UWUA 4L61A 3HIJA 4C65A 2DT3A 2GPTA 3B4UA 3SGGA 2POZA 4DNAA 3MHGA 5FF4A 4YHEA 3THCA 1E70M 3AS0A 5HNUA 3S2JA 2AMXA 1TV2A 3W25A 1HNYA 4PMDA 4RKAA 4H01A 4APNA 2VZVA 3PNUA 3BW3A 3U3HA 1S2UA 3RU6A 2HEJA 1AW1A 2OCZA 1UWTA 1GVFA 1F4HA 1OB0A 2HPIA 4YTUA 4Y9AA 3WMBA 4M51A 4IFOA 4KEVA 1TTQA 4GCAA 2IPFA 4Z1YA 3K4AA 4UUIA 1DV7A 1MRAA 3I4EA 1BQGA 3STCA 2CLIA 1FWBC 2JGQA 4JAWA 1QHPA 5TIMA 3O3RA 5CGTA 4Q32A 3PTKA 4CCCA 3RM4A 1WNOA 3PB0A 4OGZA 8XIAA 5BNKA 4O16A 4MM1A 5AYIA 4MFDA 5BZAA 1TELA 4Z0SA 4KFNA 1W0MA 5IDZA 4MSSA 4IIBA 1UWUA 2A0NA 3MB9A 3MUCA 1S46A 3NDYA 5ER0A 4WSJA 1RR2A 3LXCA 1GJPA 3U4FA 4C6EA 1IR1A 4NZFA 1C3FA 1YTEA 1S2AA 2QPSA 5EBUA 1PDZA 2HRWA 1PE1A 1W9XA 3GC2A 3IRDA 2VKZG 3VIFA 2Y62A 4JNZA 4HA1A 3WY1A 3T40A 2D0HA 2OJPA 3CAVA 2EG8A 3O0HA 2NX1A 3NL3A 3LNMA 4HMEA 3N2TA 1SR9A 2J47A 3H24A 1RD6A 4PCNA 4INFA 3WDRA 1SB3B 3LLXA 4F0LA 1IEVA 3WQ5A 1ZDLA 3TJLA 5DFAA 2BP1A 3TIMA 4XUYA 3XIMA 5A2CA 2YVJA 1W3KA 4G1NA 1W5OA 1OC7A 4UNKA 5FD0A 1K8YA 3W1XA 1JZ3A 1NOWA 4MB5A 3WF4A 4O19A 3GG0A 3URNA 2C19A 4EP8C 2ATMA 4QJ4B 4ZVJA 3QKZA 2GK1B 5T9BG 7REQA 2X09A 3WENA 3V5FA 1I75A 3W6YA 1UR0A 1P6WA 3WIJA 3UEQA 4B3LA 4H8HA 3VIKA 1ZY8A 2PGEA 2WSPA 3OEXA 1I0DA 4GBUA 4NX0A 1W1PA 3EX4A 2PDYA 4QCEA 4Q6JA 3RU8X 4H9TA 3PZ9A 4V15A 5LIKX 1YQZA 3NA8A 1XYBA 4D8ZA 4PB4A 3G22A 4RV3A 1YPXA 4OQVA 2YCLA 3CZ8A 2C8NA 3N2BA 2CZFA 2ZZCA 2YL8A 4O8AA 3DGHA 4GYJA 4AYGA 1A3WA 5I07A 1KM0A 2WSQA 1SJDA 2DT0A 3S42A 3U2ZA 4MWAA 2OZ3A 2FHCA 4U2YA 1Z8AA 4HCHA 1TJRA 2ACSA 3FSUA 3NM1A 3AXHA 3II4A 2W3RA 3AUJA 4O17A 2PCQA 4E38A 3NVYB 1NJJA 3NYDA 4IIFA 4ZEPA 2PDHA 3SUTA 5F1UA 2OLAA 4NAEB 2YBVA 2HXTA 2OO0A 5LHEA 1OF6A 2IUZA 4AVNA 1KXVA 3K8KA 3P61A 1ZHAA 5HA7A 3CUGA 2H9AA 4H8NA 3ZFHA 4NZ3A 5FJPA 1ISYA 1HXJA 2BVYA 2QF7A 1XIGA 1RA0A 4LNCA 4GMEA 4M6QA 5I23A 2DZWA 4AY1A 2YDQA 4D72A 1R2SA 3EWDA 4HD5A 3P93A 3NL2A 3M0LA 4AHPA 2MNRA 3WFZA 4ACZB 3UWWA 3EA3A 5T91A 3EYPA 1GRAA 1VHNA 4ZQMA 3E3HA 1US0A 2XU2A 4GI6A 2B31A 2BGSA 4MJ4A 4YVVA 1BHGA 4QX4A 2JEQA 1Z6KA 3V0TA 3IJIA 1XPYA 3LNPA 4C6QA 1JRBA 4FOJA 3RRXA 3A4JA 4GYPC 2Y89A 3P74A 4U31A 3B8WA 3PP7A 3QHNA 3OVRA 3TZFA 4JIRA 2VRJA 3LPGA 1JCNA 1W9DM 3UJRA 4O0ZA 2BTMA 2V8ZA 2FTYA 3GO2A 4GYKA 4J4KA 2FVMA 1KKOA 1M9HA 3WQ4A 5BROA 2XYLA 2XM1A 3W3OA 2XH0A 4I8YA 5CZSA 1SW3A 1HJSA 4PRWA 2WNNA 4MLRA 4CVWA 1AH0A 4MZYA 1TO3A 1S1RA 5M2FX 1GKRA 4PBGA 1MEHA 2IPWA 1XRFA 2D22A 3M44A 1KM1A 2G96A 3C2FA 2CERA 1Z9AA 1UH4A 1YEYA 3V1HA 1YMYA 1XIFA 3VFCA 1QCWA 1J8VA 4US5D 2OOGA 4YVPA 1GVQA 1O1ZA 3ZLGA 4PCSA 1L6WA 1TREA 3N3MA 3EAUA 3CT2A 4E8DA 3C0JA 3M0ZA 4JTRA 4NQ1A 1U5VA 4Q8WA 4O1CA 4KCUA 8TIMA 3O0KA 1TQJA 4IIDA 1W2VA 5IHSA 1FWHC 1CX9A 3P14A 2DQWA 4L9YA 3MUY1 4BF5A 3UNDA 1K4HA 1HJXA 2ZXQA 3D9XA 3OOQA 2GDVA 1CZ1A 1Q6LA 4N9CA 1XBYA 3ITTA 3L0GA 2GLKA 3MJYA 5I5RA 4IMDA 1YDNA 4KIRA 1M7OA 2D1ZA 4I9JA 3AYTA 4Y9NA 5EFFA 3PAOA 2PWFA 3KL0A 1NM9A 3GXDA 2A3EA 4K8EA 1J4EA 3IACA 4JTAA 4TMCA 2PLJA 1O12A 4L4OA 1TZZA 2H90A 1SZNA 4Q4MA 1EHAA 2AL1A 2YLLA 2KX9A 1T41A 1PYFA 2OGJA 1A53A 2V6OA 4H6RA 1PYMA 2NQHA 3NQFA 5K4XA 4K8DA 1JCLA 3VAVA 4EPKA 2R9RA 3EWWA 1RBAA 2I9UA 1FXPA 2XFYA 1T3QC 3KBWA 2QCNA 3H54A 1KV8A 1BTCA 5KMYA 4IQJA 2I9EA 1GEUA 4M6UA 1VIZA 3QV6A 1QW9A 2BOGX 2Z2UA 4LUTB 3WUFA 4WDWA 3AC0A 3UFYA 4FXFA 2DZBA 1NAL1 4H00A 1PZ2A 4GQQA 2D0FA 1VFLA 3DHDA 5LNRA 3IVTA 3IS4A 1G94A 1V3LA 3TU9A 3SECA 3GVQA 1CGVA 2QULA 2XSBA 4FB7A 3LQLA 2YCEA 2I17A 4NXKA 4HNCA 3WQFA 3MHUA 2P0OA 5A95A 3RLGA 3W1AA 3EEGA 5GNYA 1XLEA 3EX2A 1AW5A 4H4WA 5CZJA 1G4SA 3VCRA 1EPXA 3IUDA 2XIBA 3OGVA 1XD0A 4B5XA 2V5CA 2XUCA 2VCAA 2Y8VA 5FAGA 5HMEA 1QNVA 4JIEA 3GXNA 1B5TA 3CQ0A 3DGRA 2J88A 4Z1DA 4NX5A 2BOEX 4IMFA 4PTXA 1K1DA 2NVKX 4HTBA 2DZAA 3BAYA 3COTA 1EDTA 4OECA 4AD5A 3DC0A 1J0JA 2J27A 3A23A 5H8UA 4DJFD 3ES8A 5BXTA 1XCWA 5I3DA 1GQIA 4TQTA 4KERA 2OEMA 5D38A 1TYTA 3L5MA 3KWSA 3B9DA 1EZ2A 3NSNA 2NQ9A 2WCSA 4UR8A 5J04A 2YW4A 2RGLA 3B8UA 4H83A 4RK8A 4HKPA 1NFGA 2LLEA 3TUUA 3GG8A 1GRHA 3TDFA 3GU9A 4OHQA 2ZXDA 4J3WA 3HQOA 3TN4A 2A3CA 1XFCA 3CWNA 4HHMA 2WHKA 4KPLA 2GYIA 4AXNA 3WQVA 4CCEA 1EA0A 4S3BA 3VE9A 2QVHA 3L2MA 4TVWA 3KCJA 2AL2B 5C9UA 3C2EA 1GEQA 3HZ3A 3TTQA 2OSXA 2ZZ1A 4MMWA 1OX4B 3FJLA 4BS0A 3GDLA 3GXPA 2GWNA 1B30A 1NOFA 1JGMA 4I7UA 2E4TA 1LTDA 3URBA 5HNNA 2VZUA 5IFPA 3BGAA 4IQEA 1DVJA 1XBZA 1WZLA 5FJTA 1YBQB 2V63A 2VD9A 1D9EA 3MSGA 4BI6A 3N34A 3VNDA 3GLCA 4TR9A 3JZEA 4QE1A 4WJXA 2CZVA 1ZP4A 1JOAA 2QCGA 1BKHA 3SQSA 3QR3A 1EP2A 4GXWA 4A2RA 5D9PA 3GAYA 1IT8A 1YLVA 1JZ8A 4C6NA 2OVLA 2QV5A 3B8TA 3UXLA 1XDMA 3K1DA 3Q2DA 3RMEA 5FCZA 3NQBA 2J75A 2GQAA 3CNYA 1OFQA 2GJNA 1OM0A 2EQDA 4YIWA 3PHAA 1BGGA 3CT7A 1WDSA 4XISA 5AHLA 4W8BA 3IVSA 3PNZA 2ZXBA 5J5RA 3MI6A 3OIHA 3GC5A 5FAJA 4ZB5A 3KBJA 3TOYA 1KQYA 3EX3A 4XK2A 1LL6A 1N7KA 1UWQA 3WLRA 2J78A 3VKJA 1K9DA 2QCHA 4JIIX 2DZVA 1GG1A 3VC5A 1L6FA 3DFHA 4ERGA 4DO5A 5F4WA 4UFJA 3KOFA 3EOEA 1TJPA 2PA6A 1V77A 2VC6A 3SCSA 4UQCA 1BYBA 1OX4A 1V3JA 1TWWA 3ANVA 1GW1A 4AWEA 4R27A 2AL2A 5JU6A 1DJIA 5I3IA 2Z1WA 1DNCA 4KRTA 2PURA 1V02E 3EX1A 3P84A 4LAKA 4EPBC 2VCCA 2IW0A 4WX2A 1Q2RA 2FLIA 3A3HA 1JULA 1MFVA 6A3HA 1KBKA 1Q13A 2R8WA 3JVAA 3ARWA 1E6QM 3QQWA 2WVUA 1S2VA 1M6JA 4LVAA 4S3CA 2GJXA 3CEUA 3R2GA 2W27A 2Y5JA 1ONFA 3AYRA 3TCSA 3ITYA 5A69A 1IEIA 2PC8A 4EQSA 4CEXC 2QGHA 1V7YA 1LL4A 3QC3A 1GJUA 4LA1A 2BGNE 4GX9A 3EBVA 3MP5A 3P2VA 3AMCA 3T1GA 1XW8A 3QW4B 5CPTA 1P7TB 4GUHA 2DUZA 4M6VA 1R3SA 1J79A 2A6NA 1TPDA 2FDMA 4AD0A 3HQPA 1JAEA 4MY1A 3LZ5A 4QGCA 3BLLA 1F3TA 1IIGA 4NAFB 1MQPA 3LRLA 1F2JA 4CNNA 3A64A 3IJ7A 3VDGA 3V4BA 1W1IE 4AY8A 4JTHA 4GE8A 1U1UA 4WJEA 1FIQB 1OCQA 2ISVA 2ISWA 3WJXA 6CGTA 2BY3A 2EPHA 1Q85A 4R88A 1TJ0A 3RAOA 3GVWA 2ICSA 1IEXA 1E0XA 1ZAHA 1I60A 2DV0A 3KOZA 3G1XA 4GUIA 3DFYA 1UR3M 4REQA 3DECA 3TX9A 1MNSA 1WXYA 1CBGA 1Q63A 2QIIA 3G0SA 3SCOA 4EQRA 4ZFCA 1ZGDA 3W0KA 4L6HA 2WVTA 4R85A 2R1MA 2VDIA 2CHRA 1SFLA 2XWEA 2O92A 4I5UA 3ZVHB 5CH9A 5FMHA 3OLIA 2WJEA 4Y9OA 2J8GA 4EMIA 4UTTC 3B9JB 3LI1A 3LB8A 5HMFA 2V0TA 3NO5A 6REQB 5A8OA 4N9DA 5K7JA 4TMBA 3NVVB 1H1ZA 3ZZ1A 4O4VA 2V38A 1ECQA 3BOFA 4AEOA 1UP3A 3B0YA 3DUGA 3M0JA 2JF7A 1UZ1A 3RPMA 1UIOA 1VEPA 4JEQA 4R7JA 1EO5A 1QMLA 4H50A 1RQEA 3I6TA 2J7DA 1GYMA 5C2XA 1W9BM 2Q6ZA 2YL5A 2GVEA 2Y7EA 4I5RA 1H61A 3AM9A 4MJMA 1V93A 3ZT5A 1OK6A 4RPPA 3OVGA 4JTGA 1OF8A 4JKMA 1A3XA 4D2JA 3CMJA 4ORIA 1PUDA 1H63A 4MKVA 3LBOA 3NQ2A 1E0TA 4CNOA 1OJXA 3BSMA 4H3DA 4LOCA 5I2UA 4Q3MA 1HN1A 3QRHA 3WFAA 2DVUA 2W79A 3UY7A 4I9MA 4ENLA 1HKWA 1FEAA 5LNVA 1P5BA 2Z4GA 1DWJM 1QNQA 5I09A 3KUMA 4PSPA 3G5EA 1UB3A 1OFRA 1R3RA 2Y6ZA 2J13A 2ZZ4A 3GXFA 4DPQA 4YYCA 1V3KA 4GQGA 1CGUA 1FWIC 1RQBA 3DH9A 5ABFB 5HOSA 1B3ZA 1TR1A 1C8QA 3UPMA 4X63A 2EJAA 5U4NA 1IEWA 5DELA 2G41A 4AYSA 2Z1KA 5FSDC 4H4TA 4OUIA 2ZFAA 3BAKA 2OQLA 3GRSA 5D9OA 1ENUA 5HQMA 2BBFA 5EFDA 2A3HA 4JNMA 3P82A 1UBSA 4MJ2A 1A0CA 3ECQA 1HKJA 2WSKA 3B9NA 3VUSA 1TE1A 1HL8A 1UZ4A 2A7PA 1YE4A 1V02A 4FHAA 5HJYA 4C7DA 4FEZA 2OR2A 4HN4A 4FNQA 1YPIA 3APTA 3E9AA 2CBUA 4UQEA 3DU0A 2VX6A 4OJYA 3PBGA 3ALGA 1ICPA 1YNYA 4U5KA 1TA3B 4AISA 1N2VA 1F5ZA 2I7GA 1XIHA 3AIVA 4V27A 4GHRA 1Y65A 4K37A 3G18A 2VZSA 1O95A 3EPMA 4UTKA 3V36A 1JCJA 4AD2A 1J10A 2D73A 5EU9A 2P3EA 4AVOA 3FXGA 4PCFA 4MZ1A 2XGZA 4LB3A 1DE6A 3TN3A 3LUTA 4PN2A 3WL0A 4RNFA 1AZ1A 5AZ1A 2EF9A 2QJIA 4WZHA 5FJJA 4YCOA 3G1FA 4A8NA 2CLOA 1AD1A 2GQ9A 1E1CA 4OIFA 3NGJA 3CV7A 2CESA 1P4CA 3N12A 2OOFA 2G37A 3W2MA 1YYAA 3ZOAA 2CLLA 2W62A 3ISIX 3HF3A 3MS8A 5C54A 1YTDA 4HZ8A 4ZTXA 1UR2A 3TW9A 6TAAA 4C6IA 5CAHA 4RZ5A 2C3DA 1GEHA 3DHFA 4CQBA 3PC0A 2CZDA 4DYJA 3LCFA 3KEHA 2PD5A 1KM4A 2WQPA 4Y9PA 1GXFA 4LRTA 2A3BA 1L6GA 3JRKA 3DENA 1A0DA 4GO9A 3F1QA 1QPQA 3PB2A 2J6XA 5K9XA 1SO4A 2ODOA 1TPUA 4WJ8A 1O5QA 2ZIDA 1PO9A 1QI2A 2NQZA 2XPKA 3LHVA 2NX9A 4WUIA 3EX6A 3NPWA 4GQ0A 1RPXA 3SBFA 3B0VC 1V03A 1X8CA 1NWRA 1YPFA 1ONWA 3UJFA 3TR9A 1G4TA 3M0IA 3GS6A 5IFTA 1JRPA 6ENLA 5I24A 4ZB0A 5I02A 3P3BA 1P0BA 4JIPA 3L21A 3TMQA 5D9MA 1OHLA 1XLFA 4ZFMA 2WMGA 2NV9A 1Z32X 4F0RA 4LRSA 3W2UA 3B9EA 4UQAA 2Q3OA 2RAGA 3QC0A 3RX2A 4CKQA 4LXFA 5CC6A 5FS9A 2VC7A 2O9OA 2X2GA 3FA3A 5G4WA 3ITLA 1OGSA 2PC4A 3S6DA 3SFWA 1UQYA 4V1YA 3FHQA 1RY8A 2VOMA 2G8ZA 4FX7A 3WD3A 4MZ8A 4TO8A 4K36A 2A21A 3PN8A 3GDMA 2WWDA 5CBBA 1ELSA 4LUSA 1H62A 3H6OA 1QRQA 3I68A 5AYXA 2QDEA 3N13A 3L0NA 2RHGA 4NAFA 2BMBA 4M24A 4JL1A 4LFYA 2Q3RA 3CZGA 2WOIA 3WLOA 2D2JA 1BEUA 3HJZA 4NKCA 2G4FA 4XD6A 2WANA 4WR3A 4GKTA 4XZMX 1ITUA 3GBDA 1B31A 2GDQA 1H2JA 1LPFA 2E25A 3L67A 1W3TA 2DGAA 2ZE3A 3W53A 2VZOA 4M19A 4QHRA 3TXZA 1F3XA 4FLSA 3W7OA 1EDGA 2GR3A 3U7BA 4A8RA 2Y61A 3A12A 3HPXA 4Z2LA 1R9YA 1CCWB 3ITCA 5MHBA 2XM2A 1C8VA 1EYWA 2G3NA 3SW6A 4IXHA 3AISA 3IJLA 1YW1A 3IWPA 1VYSX 4TVDA 5FEZA 3WEZA 2QAPA 3IJ8A 5DANA 2ZADA 1XIIA 4WSKA 3CUFA 2VC9A 1FBAA 2D0GA 3UJSA 1TMHA 2NV2A 5C71A 4BV6A 5AHFA 5H2ZA 1W1B1 4RZ6A 5A2BA 2H6RA 4GFIA 4GJJA 3K5XA 4ATLA 1D7FA 3VK5A 1IZJA 5DBTA 1HUVA 1H7NA 4PRRA 4LEFA 2J3NA 3C2OA 3F2DA 1ECEA 3NO1A 4TTGA 4US5A 3UR8A 4YCPA 3PTQA 4UNIA 3PK7A 1EXBA 3K4WA 2XN1A 2E5CA 2PRMA 4FNSA 4F3HA 4ZZ9A 1AFSA 3LI0A 3AU2A 2PTYA 4W89A 1UA7A 4ZOBA 3N29A 3KWXA 4R9OA 5JUVA 3L4UA 3E0WA 1XKYA 4O11A 4JX6A 2OG9A 1HVQA 1EKOA 3NQ6A 3VIHA 5M5DA 4H9YA 1CYGA 1XYLA 1LVLA 3ATZA 1KTCA 4HOZA 4JXCA 4X61A 2GZXA 1ZMCA 3F5KA 3DK4A 4XD3A 3EOOA 3TTSA 4QJ3B 1A5UA 2ZX9A 5GJPA 4K7YA 1VLWA 5A3HA 1FA2A 3CGCA 4JTFA 4NJGA 4MPQA 2OX1A 4E5TA 1QATA 5BW6A 2IQDA 1N62C 1GPWA 2TYSA 9XIMA 3S2NA 3OA3A 3SO7A 2PPGA 4PCPA 1KGUA 3LTSA 1J0KA 2VT0A 3LXAA 2WHLA 1WV2A 5H1WA 4AIOA 4A2SA 4CQDA 2D2OA 2OSWA 4HSHA 2E6FA 3Q45A 1XLMA 1LM1A 3TJIA 4Q4RA 4E0CA 5A6BD 3CV6A 6PTDA 4M7SA 4C90A 3BE7A 5C7VA 5ENLA 3W85A 4UTLA 4TVYA 2PTDA 3CUHA 1MW0A 2X05A 1KBJA 3C0QA 1ZU8A 3OC4A 2OZ8A 1XUUA 3NQ7A 1CXIA 3LMZA 3GDTA 3V35A 3HQ1A 2VGFA 2WZIA 1MO9A 1TYPA 3BANA 1XANA 1G4EA 2BODX 5G5HB 1K02A 3ZLFA 4UBPC 3BJTA 3E74A 2OB3A 4GWEA 3AIRA 3WJZA 1EH9A 4B3ZA 3VKBA 4G7EB 2CZ5A 3LV5A 3LCXA 3VUPA 1XH1A 1PX3A 3ARXA 3WYZA 5CBJA 4FP1A 5FL1A 4FLOA 2JFEX 5BXRA 2NPXA 5A8NA 1TB3A 3A21A 5C70A 5DMMA 1IGWA 1ZCOA 1CLVA 3T0TA 4ATDA 1UZHA 1GVSA 1XYZA 1PIIA 4GACA 4JS3A 4GVFA 1MEIA 2PDIA 1PJ9A 1FFRA 3H2OA 3K8MA 2PWVA 2WNWA 3B4YA 4HYVA 5CEWA 3OYZA 1X8FA 1OCNA 3TA6A 3B8IA 4J9JA 2ZRUA 1TV3A 2J8FA 4DO6A 4UTFA 3TYZA 5D8ZA 3FS2A 2E3TA 1HL2A 3D5HA 2R1KA 4NP7A 3QEZA 4V2XA 1BG4A 3ZSTA 4QM1A 1G69A 2VYOA 4UR9A 4M52A 1T5AA 4YNGA 5FJUA 3SY8A 1JF6A 4WCJA 5AOUA 3TK7A 1B3WA 3VNLA 3DG7A 4QDPA 2JK6A 4HMCA 3KVKA 1OCJA 3C8FA 3PUGA 3WK2A 1JUKA 2PTXA 4NJIA 3T07A 1A3HA 4F9JA 4RNHA 3N2XA 2PU0A 5AECA 1W3JA 4CNTA 1SW7A 5REQB 1ZL1A 5JMUA 2WKGA 1SO3A 4JKKA 3RO8A 3AMZA 5A8MA 4RDZA 2CFYA 4Q4KA 1XBXA 4E3TA 3W7HA 5TAOA 1CEOA 4QEEA 2VL4A 4L7ZA 4IL2A 3EWBX 4LCQA 4LV4A 3GFXA 1RP9A 1R0MA 1HJQA 4FR1A 2GVGA 3KVJA 5FOOA 2CBJA 3W7LA 2XN2A 4IF2A 3A22A 2YBTA 3CASA 1E4NA 3WLTA 1XH0A 4L6OA 5A5WA 2C1HA 3SY5A 4K6AA 1YHTA 4W9TA 1CXKA 5C9WA 1J0HA 3UVIA 5I79A 4M8UA 3RM8A 4F2UA 3HGRA 2YLAA 3HFYA 1W31A 1MFUA 2FPVA 1A5OC 2HISA 3HFTA 1NEYA 3BCDA 2ATSA 1R8LA 4I6KA 2WCGA 3U9IA 5IHRA 2EQ9A 1LUCA 2HS8A 2VEMA 5DRIA 1LROA 1V6WA 5H6HA 4YTTA 2QVNA 2RH9A 3ETRB 1HVXA 1R2TA 5CGQA 4DVOA 3K30A 7ENLA 5AC6A 1SJCA 3DK8A 4E8CA 2JKEA 1LG2A 2WVSA 3IJ6A 4D6JA 1PWLA 1WA3A 3CZEA 4P2VA 4CLMA 3EPOA 2PDFA 4PBEA 3EGJA 3RCNA 2CFFA 7A3HA 1RK6A 3SQMA 1XLHA 1X7FA 1UZDA 3H12A 3B0UX 1A5LC 1X6NA 3DI1A 4M6PA 3E6EA 1TPC1 3A9BA 2O55A 2QJMA 3LENA 4DJDC 3QVQA 4EK7A 2DZPA 1JDDA 4JNYA 2HVMA 4IJRA 4PUKA 2PWGA 4XAPA 3WLLA 5FF7A 3XINA 1PKMA 2HXUA 1QI4A 4GI8A 1I2NA 1AVAA 1SVDA 1RCXB 3IEBA 1WBJA 4R7WA 3EZ4A 1QNOA 1QNPA 2VGBA 2GWGA 3AMGA 1DJHA 2J7BA 2QCEA 3BAWA 4LT9A 4BI5A 2X8RA 1H2IA 3UY8A 1MW3A 1C9DA 1GT8A 4Z2GA 5D30A 2FVLA 4K3ZA 2J9ZA 2GUBA 3M0XA 3DIPA 5FS6A 1YRRA 3T2QA 4E2VA 2QLYA 1QAPA 3RN6A 4Q33A 4L4MA 4XAGA 3EOSA 4H8VA 3A5FA 1MXSA 4J57A 3F4DA 4IOTA 1ME9A 2NUWA 5AZ0A 1NDWA 4EMWA 1BRLA 1L8NA 3STFA 3Q6JA 3D47A 4QLJA 2DSKA 5DCEA 4BHYA 3I3DA 4GGBA 2RUSA 1I2OA 3MMUA 3E02A 1GONA 3GHSA 5BU9A 3WLJA 2Z25A 4PODA 3T0AA 1YDYA 3IPWA 1YDVA 3EMZA 3UZXA 3VPLA 1FWSA 3LXBA 3MYPA 2OU4A 1D2KA 1VP5A 4B5TA 2UY5A 4K39A 5BRQA 3RF9A 3QYSA 3IIXA 5F1VA 3M6YA 1EJRC 5DF0A 1RZMA 3TTEA 1EIXA 5G4HC 1FWDC 5TBOA 3NVTA 2NQ5A 4QRNA 4YN5A 1LBFA 2WLYA 2E40A 3S0CA 4ML9A 1XFBA 3QBUA 3KAOA 4ZE4A 1VH7A 3WLPA 2NT1A 1IWPA 1LRNA 4BA0A 1GOOA 1UP2A 4AZ7A 4DF0A 4A8LA 5CAKA 4F9DA 3DK9A 2O4MA 4JL2A 4XWUA 2YCLB 4KRUA 3BSGA 4Z17A 3GR8A 1CW2A 1UW9A 4HSNA 4JGDA 1VEOA 2EQ6A 4C6PA 3B8SA 3SZ8A 5LA0A 1M1BA 1PXGA 1GORA 5AVNA 3PPFA 1Q7QA 4BQ3A 3DN5A 2YFNA 1QK0A 4JQ3A 1I0BA 1M7JA 3Q4DA 4AFYA 3NZRA 2YJQA 5IOBA 1D7YA 2VHLA 1OYAA 4Q7NA 2EEXA 4S38A 1Q6RA 1QUMA 3W29A 2EPKX 1FECA 1UC5A 2ZZ0A 1KM5A 1P43A 2DY3A 4EMJA 3LRMA 1OK4A 3IV8A 4JTJA 4EOUA 1NIUA 1XYCA 1PBGA 4RPQA 2WJFA 1ONXA 4ZO8A 2WZTA 3EXRA 1RJQA 5JCLA 3SSZA 3NOEA 1X39A 2NLIA 1ZY9A 3TR2A 2OTDA 3KLKA 5KZMA 3DJJA 1IZCA 3SY1A 2VFIA 3FN9A 3OTRA 3SN0A 5BOOA 1Y5XA 3LM3A 2QIWA 5LSMA 3LGDA 2POTA 4B16A 2CITA 3C52A 2ZUNA 4POCA 5IRPA 4K7ZA 4NJJA 5LNUA 1JYNA 1QW8A 3VOGA 3L4TA 3KOYA 5A8QA 3LHYA 1JNDA 4W85A 1LL7A 5HR6A 1DTNA 3DYPA 3S1XA 3OQEA 3DFSA 1EGZA 1GHRA 1GRBA 3N9RA 1UPPA 3V0SA 1EWEA 1RJRA 3BOXA 3MWCA 1P6BA 3IC9A 3CGTA 1OGBA 5M17A 3KTSA 4B92A 3S9IA 1IT0A 1ICSA 1DEDA 2ZRZA 3A3XA 4PUDA 2A3AA 3MWAA 3WQGA 2DIJA 1JYXA 3R12A 1MRQA 4LVGA 2DQXA 1FO4A 1LRTA 1SGJA 1J2WA