1MRAA

Mandelate racemase mutant d270n co-crystallized with (s)-atrolactate
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
357
structure length
357
Chain Sequence
EVLITGLRTRAVNVPLAYPVHTAVGTVGTAPLVLIDLATSAGVVGHSYLFAYTPVALKSLKQLLDDMAAMIVNEPLAPVSLEAMLAKRFCLAGYTGLIRMAAAGIDMAAWDALGKVHETPLVKLLGANARPVQAYDSHSLDGVKLATERAVTAAELGFRAVKTKIGYPALDQDLAVVRSIRQAVGDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTWIEEPTLQHDYEGHQRIQSKLNVPVQMGENWLGPEEMFKALSIGACRLAMPNAMKIGGVTGWIRASALAQQFGIPMSSHLFQEISAHLLAATPTAHWLERLDLAGSVIEPTLTFEGGNAVIPDLPGVGIIWREKEIGKYLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANDELATE RACEMASE
publication title Mechanism of the reaction catalyzed by mandelate racemase: structure and mechanistic properties of the D270N mutant.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Racemase
total genus 131
structure length 357
sequence length 357
ec nomenclature ec 5.1.2.2: Mandelate racemase.
pdb deposition date 1996-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1mraA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1mraA01
1W6TA 1SJAA 1WUEA 3UCCA 4Z17A 3HPFA 4J1OA 2PODA 3N6JA 3T8QA 4K1WA 4A6GA 3IJIA 3ZVHA 2PS2A 2XH2A 3R11A 2QJNA 4HNLA 1EBGA 3FVDA 1YEYA 4K8GA 3QN3A 3TWAA 3RCYA 2RDXA 3OPSA 3SN4A 1OEPA 5FJOA 1WUFA 2PMQA 2P8BA 3MUCA 3PWGA 1SJBA 1L8PA 3BJSA 4KWSA 3ENLA 3RO6A 3VDGA 4ENLA 4HNCA 3OZYA 5FJUA 2GGIA 4IL2A 3DIPA 3CT2A 1IYXA 1XPYA 2OQYA 3NXLA 2AL2A 1ELSA 4HCDA 2OQHA 3DG6A 3Q4DA 1DTNA 4HYRA 3DG7A 3MKCA 2I5QA 4M0XA 3UJEA 1PDZA 3D46A 3CB3A 3R0UA 3THUA 4IP5A 4DN1A 1MDRA 1ONEA 4YWSA 3OTRA 4JN7A 3V5CA 3SJNA 3FJ4A 2GSHA 4GYPC 3JW7A 2OPJA 1FHVA 3QKEA 3DERA 1TE6A 4GGBA 2DW7A 4JN8A 2GL5A 3OW1A 3T9PA 3S5SA 3MZNA 4H1ZA 4DXKA 3S47A 3V3WA 2QQ6A 3VFCA 2HNEA 3R1ZA 3SSZA 4F4RA 3TJIA 4GMEA 2P3ZA 3UXKA 4IP4A 3R0KA 1KKRA 2MUCA 2QGYA 1KCZA 5ENLA 2QJMA 3MQTA 2AKZA 1SJDA 3NO1A 1XS2A 2FKPA 5J04A 4ROPA 3DGBA 3DDMA 1EC7A 1TKKA 2XH7A 4IL0A 3FV9A 2HZGA 1RVKA 3MWCA 4E4FA 3TJ4A 4M6UA 3I4KA 3P0WA 2PPGA 2QDDA 4KT2A 3H7VA 3GY1A 3FYYA 3RR1A 2DW6A 2PCEA 1F9CA 2PP3A 5BOEA 3VCNA 3FXGA 2O56A 2PU1A 1P48A 4DHGA 3TTEA 4G7FA 1EC9A 2GGEA 3UXLA 3H70A 3ES8A 2ZADA 4IZGA 3FCPA 4JHMA 3QTPA 2PTYA 1ECQA 4HCHA 2OKTA 3GC2A 3TWBA 2PTWA 4GIRA 4KEMA 3PK7A 2OZTA 3TQPA 4IT1A 3IJQA 2MNRA 3P3BA 3EEZA 5BOFA 2XGZA 3JVAA 3JZUA 2OLAA 3DFYA 2PTZA 4MKSA 3VC5A 4KPLA 3STPA 2NQLA 2HXUA 2XH0A 1BKHA 3ZVHB 3BOXA 4E6MA 3UJRA 3VCCA 2GGGA 3T4WA 2GGJA 3RRAA 4A3RA 1SJCA 3UCDA 3MY9A 2QJJA 1JDFA 2AL1A 3B97A 2QVHA 3SBFA 3QLDA 5IDZA 2P88A 4DWDA 2PTXA 3I6EA 3DESA 3R25A 2GGHA 1FHUA 4GFIA 1JPDX 4H2HA 3U9IA 5FJTA 4MMWA 2PP0A 4H19A 1NU5A 3H8AA 1E9IA 2AL2B 3U4FA 2POZA 4K2SA 4HCLA 4IHCA 3UJ2A 3GD6A 3Q45A 4X2PA 4A35A 4GISA 3N6HA 2PP1A 2CHRA 1BQGA 4EWJA 1MNSA 3EKGA 2OFJA 1MRAA 3PWIA 3H12A 1R0MA 3NFUA 3T6CA 3SN1A 4ZA0A 3VA8A 4H83A 3UGVA 4DX3A 6ENLA 7ENLA 3TOYA 3R10A 2OO6A 1TZZA 3IK4A 1R6WA 3VC6A 3N4EA 3SQSA 3MSYA 4J3ZA 4E8GA 1JCTA 1JPMA 2PSNA 4GGHA 1EC8A 3QPEA 3UJFA 3ES7A 2OZ8A 3ZLGA 2PGEA 1MDLA 4GYPA 3CYJA 3GO2A 1NELA 1KKOA 2PU0A 3V5FA 3DFHA 3DG3A 3K1GA 3RGTA 3OP2A 3CK5A 3ZVIA 4HN8A 2AKMA 3I6TA 1PDYA 4G8TA 4FI4A 2PA6A 4HPNA 3DEQA 2FYMA 3CAWA 1MUCA 4MGGA 3TCSA 4DYEA 1EBHA 2ZC8A 2XH4A 4FP1A 3NZGA 4E4UA 2OZ3A 4Z1YA 3RITA 2GDQA 2OX4A 3BSMA 3IJLA 3OZMA 3UJSA 2OG9A 3PFRA 4E5TA 2QDEA 3V4BA 3ZLFA 1P43A 2ONEA 5FJRA 3P93A 2OVLA 3ZLHA 5EU9A 2PGWA 5FJPA 3D47A 3CXOA 3KUMA 3TW9A 2HXTA 2P0IA 3N4FA 3SN0A 4ZCWA 2XSXA 2P8CA 1KD0A
chains in the Genus database with same CATH superfamily
1QW7A 1VB9A 4Z17A 4DZ5A 5D4YA 1W54A 2WQDA 5D8WA 3CYVA 1TYGA 2Z26A 3N34A 4QDMA 4F79A 1VYPX 1PB0A 3W7HA 2V5JA 4QE1A 1ZENA 1FDYA 5FJOA 1R3RA 4QDWA 3MUCA 2WZIA 2RAGA 1T8QA 4XZHA 2Y6ZA 2HV5A 1TV7A 1E4IA 2NT0A 4ZGYA 1TJPA 3ENLA 5FD0A 4AHOA 1B3VA 1O66A 5AZ0A 1W9DM 1E6ZA 1ELSA 3HTWA 1Z48A 4PRWA 1IZKA 4XD4A 2NV2A 3Q67A 4AIOA 4CQBA 1JUBA 4YTUA 1OABA 3BLKA 1GG0A 4B90A 3WQEA 5KSWA 1YPFA 5EYWA 4JIEA 3UWVA 3RX3A 3SR6B 3EZ4A 1WBJA 4BQ2A 2E6AA 2D24A 4NX5A 1UKSA 2IKHA 2ADAA 2P76A 5CAHA 3MZ2A 2OLHA 3EGJA 4P8VA 1N82A 3PJUA 2OT1A 2DQWA 2XN1A 4GZJA 4K38A 3KWXA 4H1ZA 5KVIA 1I2RA 5I5RA 4H6EA 1J0KA 1O4UA 4DEFA 5E1QA 1XG4A 1VGAA 3VFCA 3NL6A 3P2VA 1QHZA 3DI0A 3NL5A 4DJDA 3IAQA 3G1DA 4PGLA 1TYTA 3II1A 3LMYA 1KCZA 3WSUA 2A7PA 4ZE5A 4U3CA 2D3NA 4XWUA 1XLEA 2QJMA 4Z0JA 3JR2A 2ZA2A 3HIJA 1ICPA 3HFTA 3ABZA 3CZ8A 1LOLA 1P1MA 1P0NA 4AYSA 1I45A 1HQTA 1FH8A 3BOLA 4FPSA 3WEOA 2QIIA 1NAL1 3K30A 2YA1A 2X1UA 4LC6A 1BSIA 5DN1A 1UZ1A 4LGXA 5JCNA 2QCMA 1S2VA 3OLEA 3C2OA 1U1JA 3FYYA 1B3OA 1KR1A 3FEQA 5BOEA 5E6YA 1S1PA 4NZJA 4K7VA 3BANA 4FS9A 4EX4A 1UYQA 2W62A 5D02A 1TUXA 1HKVA 2Z2UA 3GSMA 3CUHA 4EVZA 2CDUA 1HTIA 3PS7A 4DI8A 2ZWZA 1VBRA 3KHDA 3V16A 3KLJA 1LVLA 4M80A 3M16A 4TR9A 3U7VA 2YW4A 2WBGA 4CGTA 1UUQA 1TR9A 3ITVA 2WVTA 5JCKA 1ISZA 2RDUA 4B5XA 4GCXA 2QCGA 3CBWA 4CN4A 4M7TA 1QK2A 1YBQB 2D20A 2BHUA 4RDYA 3EWBX 3M46A 4G2DA 3EB4A 3VOIA 3O6CA 4LVGA 1NPXA 2X05A 3HW2A 1VEPA 1MRQA 3PJTA 3WJZA 1LRTA 2IS7A 1B5TA 2VEKA 4IX2A 4UFJA 1UW9A 4LBRA 4H4PA 4Q8VA 3HMCA 3IAPA 3S2MA 3GE7A 1N63C 9XIAA 2BVWA 1JI2A 5JIWA 3KE0A 3PFMA 1LF1A 4XSMA 5LNUA 1JCMP 2I57A 4K8EA 2TODA 2PDXA 4KERA 3PUGA 2IW0A 3DESA 1MZHA 1GEUA 2P50A 4H2HA 1EDGA 3A7RA 3U6WA 3VGDA 1QCWA 4A21A 1S3TC 4H8HA 1LG1A 1VFLA 1QPRA 3LBOA 1Z7AA 2I17A 3TYEA 1XUUA 3OC4A 3ZFHA 1EYWA 4D8AA 4R53A 4B3KA 5HA7A 4UCGA 4P8XA 4GX8A 1Q6LA 2Y61A 1JNEA 2YDAA 4DB7A 2JKAA 5M2FX 4KQNA 2BLEA 1E55A 4LYKA 4O18A 5TF0A 1XRFA 2PRMA 3E6EA 2X30A 1KQZA 4UFHA 1XDLA 1ITXA 1JOAA 3PSVA 3ERPA 3UNDA 1C7TA 1GOXA 4GFSA 5GJMA 1HIZA 2BY2A 1CECA 3MCNA 3KL0A 1JFHA 2WLZA 3IK4A 1R6WA 4RCXA 4FOUA 2G4FA 4FIRA 4GGHA 3G1YA 1TB3A 1Q5MA 2IKIA 4BFAA 7TAAA 1A5OC 1XYAA 4RNHA 1MXDA 2CCRA 4LEQA 3CL6A 3CC1A 3O7UA 5KETA 3AS3A 1JAKA 3TYDA 1MEHA 1PZ1A 2NVAA 1F3EA 2J24A 2NWSA 4O8RA 2VVNA 3CLWA 1FEBA 7REQA 1PDYA 1UASA 4UNKA 3UG4A 3T05A 2EPHA 2WOWA 3NZ1A 1PHWA 4XBJA 1W91A 1FDJA 3FHAA 1IXOA 4UOZA 2YL9A 3UY8A 3W29A 2IPGA 4US6A 1EJXC 2EGZA 2UZ9A 4RPQA 4HSHA 1LJYA 1LROA 5I6SA 4A8NA 2F8QA 4ZO9A 4AD3A 3N04A 4JTTA 1NIUA 3M6YA 3NL3A 3AHXA 2WOQA 4LS2A 5HXMA 2ZX9A 4B2DD 3N9SA 1CYGA 2NQZA 2NVDA 3TN5A 1XLHA 1FWAC 5H1WA 3HG3A 2YPIA 3S2JA 3VOHA 4PCTA 4C1NA 4CU7A 2XGBA 2OYKA 2O9PA 2ANUA 4DZAA 1MFVA 3QY6A 5EL1A 1E9ZB 1PYFA 3H21A 3P14A 4ZXOA 4C6QA 3U2EA 3OPSA 3WD0A 2WO5A 1W3TA 4IJBA 3AOFA 2VEPA 1YTKA 1MFUA 3I68A 4GNKB 2H9AA 1GOWA 1AZ1A 1X6LA 1E6SM 2P10A 1SMAA 1PYMA 1J5SA 3T08A 3M0MA 3NQ6A 3PSWA 4KFOA 1R7OA 1KCLA 1FWCC 1V0LA 2WSYA 3QR1A 2RH9A 2V3BA 2WMJA 2ZUVA 3D46A 1JUEA 1Q63A 3FJ6A 3GFXA 4YWSA 4WR3A 5LNSA 3HF3A 1BRLA 5F1VA 3S4TA 2OU4A 4GUHA 4OBSA 4ZEPA 1JCLA 3W1TA 3UEQA 4XB3A 1JXKA 3VFLA 4BURA 1FHVA 3U7BA 2A3CA 3UVAA 3L66A 4MZ8A 3D3AA 3HGOA 3SUWA 5C9UA 1RPXA 1DXLA 4HMCA 5KZMA 1PZ2A 3SCOA 3SUTA 3S5SA 1VP5A 1E40A 4DXKA 3U0HA 1S2TA 4MPKA 2W0HA 5EGRA 2FZ8A 4YXGA 4CNNA 5ENLA 1BGGA 4LUTB 4QNEA 1I2QA 1ODUA 3S5ZA 4YVPA 1F07A 3A4JA 3LV5A 1T96A 5A8NA 1GUVA 4WLCA 4KWUA 3DGBA 1CGYA 4L4OA 4CNOA 3S6TA 1WO2A 1W5PA 2FPYA 3CHEA 4AUBA 1ZTVA 3TJ4A 3H54A 1L6SA 2IUZA 1RCXB 1V51A 3ITYA 3PUEA 2DV0A 3V1PA 3VKCA 4C91A 3H7VA 4WUIA 1ZJIA 3CPRA 2DW6A 2Y8KA 1U5HA 1PX8A 2VGBA 4O14A 5D8ZA 3KBSA 3LHWA 3H55A 1NHRA 2ZX6A 4XX6A 1CZ1A 3WN6A 1UR3M 1FFRA 3L4YA 2V68A 3A9BA 4AB4A 1IXNA 3GKAA 5A2BA 2ZRVA 4M6QA 1HJQA 2X40A 5BMXA 4B9ZA 2WC4A 1KB3A 3AS1A 4KW2A 1YE4A 5KMYA 4H4VA 4GIEA 1FWRA 4JTDA 3ZSSA 1K9FA 3PJXA 4RE2A 1QO2A 4DO4A 5IFPA 4UQ9A 4P8WA 3M5XA 5BOFA 5TR3A 4YS1A 3N17A 2CLLA 2QDHA 1W37A 3OLIA 2GRTA 3T4CA 3BAKA 3C2VA 1F7BA 4Z1BA 1KM0A 5AC5A 2VGFA 4JQAA 1NWUA 1IE7C 4NYUA 2I5GA 4HNTA 5DLCA 3E5BA 3CAQA 2VJXA 4CU8A 5HJYA 4AX7A 4WSKA 4AWTA 4YU1A 2QF8A 1EF2A 3T4WA 4DAFA 2W92A 2DZUA 4F9DA 3UCDA 1JVNA 1XLJA 1JDFA 4IMCA 3CGDA 3B0UX 1VBJA 3EKZA 3IIPA 2CFYA 1I8JA 1BWLA 3NDZA 3UR8A 5HNNA 2CBVA 1EGVA 3NPXA 5A6MA 1AMKA 3A24A 1W8GA 1UC5A 3CUZA 1A3XA 1XQLA 1F76A 4CD7A 4MMWA 1C3FA 4J35A 3H8AA 5K9XA 3W7GA 2RUSA 2QMKA 4MDOA 3CMFA 1E1CA 2GZXA 1KXHA 2R6OA 3TKFA 1FHLA 5A6SA 1GOKA 3LLXA 4R3UA 2F61A 4H9ZA 2CHRA 4I5RA 1H61A 1ZK7A 4DWSC 6PTDA 3EKGA 4IIGA 3PBGA 2VXNA 1IIGA 4C7GA 2VD9A 1LL7A 1OD8A 2R24A 6TIMA 4GQGA 2VC9A 3WJXA 3QJAA 5C55A 1TYPA 1HUVA 4ILSA 4HNNA 4Q4KA 3APYA 3GWQA 2VEFA 4AW7A 4D8ZA 4J40A 2WVVB 3RLVA 4IFKA 3BH4A 3QR3A 3ANYA 2NSOA 1HFBA 4JYEA 2V2DA 3ZR4A 1TMQA 1DV7A 2HK0A 4QEEA 3D9XA 1Q6DA 3WUBA 1FH7A 1JCTA 1D3GA 3L2MA 3KAOA 5C2XA 3PP7A 3AMGA 4GQBA 5AYBA 3UWEA 1EPXA 2QLYA 3I10A 1JF6A 3SCTA 2A79A 1XICA 1UC4A 4LAKA 3KRBA 4QROA 4V33A 2VZOA 2FZMA 2WHMA 1LUCA 3F5LA 2J6VA 5FMHA 1C8XA 1QR7A 2ACUA 1FXQA 1JDEA 1B9ZA 4Y7EA 4XBKA 1IT7A 4WVXA 3RGTA 1P6WA 3VIGA 1GYNA 4WJEA 3OVQA 2JIWA 2HK1A 5LGZA 2BP1A 3H4GA 3NQVA 5F4WA 3DEQA 2CLFA 2XVLA 3P0XA 1BYCA 4O53A 1CGXA 3MI6A 1ICQA 3LYEA 2G3NA 5DF0A 3CEUA 3L4VA 4FXSA 1TMLA 1H7OA 1D2KA 2QUTA 1PAMA 3K8KA 2ZVIA 4FF5A 1GQLA 4IUOA 2IQDA 3NQMA 1JF5A 3WH8A 1E73M 3B9NA 3CGTA 2Z1XA 3W26A 2PGWA 1KBIA 1QO5A 2HROA 1V97A 2HXTA 1OQFA 3VMNA 4H4ZA 4CNPA 1K9DA 3BAXA 4GO9A 2VX7A 3GKFA 1VDVA 2O55A 3SIMA 5C70A 1GZJA 1R46A 2REQB 2PS2A 2XH2A 4HPXA 1CWYA 4X9SA 3VD4A 1LDCA 4K8GA 3PBWA 2NLYA 2VEGA 3EF6A 2OYLA 3LCGA 3BJSA 4MB4A 4KWSA 3W88A 4ENLA 1CGUA 4OOUA 3W74A 4O0ZA 4GXMA 3C5QA 3F4VA 5JCLA 1XPYA 3WL1A 4LX4A 1T5AA 2WNNA 2HRWA 4Y9AA 3DG7A 3CHVA 4U5IA 4ZTXA 4RL3A 1RLCL 2VEIA 1XWYA 2D3LA 1EGMA 4MY1A 3R58A 1TVLA 4PTXA 1CXFA 1R3SA 4OJYA 4W88A 4QE4A 5H8UA 1ME8A 3BO9A 2DZAA 1ZKQA 1LOSA 3H24A 2CXEA 2J47A 2NXGA 4O52A 3OA5A 3VPLA 2ZRXA 4J28A 2V30A 2KX9A 2BVDA 4UQAA 3PULA 3F4DA 1HL9A 3EXTA 2FMNA 3F2BA 2WP5A 2G4JA 1X97A 4AZ6A 5E93A 2CITA 1F05A 2X09A 3EMQA 3R0KA 1KKRA 1S39A 4ICMA 4HU8A 4LQ1A 3LD5A 2V63A 3DC8A 4S38A 3VNZA 3FGCA 2VFFA 4EF9A 4Q4MA 5CPSA 3VD5A 1PKLA 4QITA 4DBWA 1EBDA 4O0QA 1UH2A 4J2MA 4XVEA 1E72M 4E4FA 4GIAA 3WK3A 1ZMDA 5LIWX 1HVQA 4CQ8A 3OEXA 4N9EA 1GXFA 2YL5A 1J8VA 4DZHA 3NO3A 1XC4A 1OGBA 2Y63A 4UR7A 4S3FA 4H4RA 4C6IA 2VRJA 2Z0IA 1FWGC 3L23A 1LBLA 3NNTA 1DNCA 2GUUA 4DBDA 1ZJHA 4CNUA 4C6KA 2F84A 2AMXA 5HBFA 3URNA 4JQ3A 4M1RA 4W4QA 3ES8A 2OT0A 4D6EA 4CCCA 3F4WA 1O5QA 3P62A 3GVWA 2PTYA 4NZ3A 1TMHA 3MYOA 4ZB2A 1EJUC 1W3JA 4H6KA 1G7VA 1HXJA 1DHPA 2MNRA 4NVTA 4JTAA 1ZJAA 2CC0A 1H7NA 4H4IA 3M4HA 3WNPA 4LF1A 2V67A 2X8GA 3R43A 3B8DA 4JTHA 4PMXA 3GNPA 1M04A 1S2UA 3KL3A 5BW6A 3VGFA 1KFKA 5K2ZA 3P61A 2HXUA 5EBUA 3OZOA 4TIMA 4MNKA 1DJXA 1IWBA 5IHRA 5FJIA 1WXZA 2AL1A 5T8GA 2EXOA 5HQLA 1X98A 2ISWA 4K68A 3TXVA 1PTDA 3U2ZA 4C90A 3B9EA 4J3WA 3ARXA 4RDZA 4GUFA 1QAPA 2ZOXA 4OQVA 1FHUA 3BV4A 3WD3A 4C1KA 2J7CA 4W9TA 1Q3NA 4ZFMA 2P0OA 4QE5A 3BJTA 2QULA 4U2ZA 3PJWA 4ATLA 5A6JA 4HCLA 2WNQA 1EUNA 4HTYA 3L5AA 3SW6A 4S3EA 3Q45A 1XANA 4R7OA 5LXXA 4FOKA 5FS8A 1SYTA 4TVCA 3TX9A 1UJPA 3ARQA 4W87A 1VZWA 7PTDA 3EAUA 4IH3A 4B5VA 1GQKA 3R8GA 4AXKA 5LA1A 3KBVA 2YA2A 5G5HB 2VRQA 3SCWA 4FO4A 1N55A 3W00A 3N13A 1ISYA 4R34A 4AH7A 1CXLA 1C91A 1LQ2A 2WQPA 1NQ6A 1K70A 3S1UA 1TV4A 4OT7A 4BI7A 4ZA0A 3MSRA 3LN3A 3STFA 3V0TA 3MBFA 1FFVC 2EQ9A 3SCSA 3OYZA 9CGTA 5FL1A 4I90A 1TA3A 2V5KA 4C5YA 1PZ0A 4UQCA 3I7QA 4BA0A 3SI9A 3WJYA 3PZQA 2J62A 3MT1A 3T44A 4CCDA 3CUGA 1HT6A 1RJRA 2VZSA 4JKLA 1KM6A 3ARUA 4QP0A 1HG3A 2UBPC 2EAWA 3GX9A 4RZBA 5DEZA 4PODA 1NP0A 1FWDC 3MV01 1J0HA 2E6DA 3M5ZA 2FPVA 1FIQB 3WJSA 4GYPA 4HZ6A 3GD4A 1IF2A 3MDUA 3VNKA 2ALDA 4LV9A 4DNAA 2G97A 3VIMA 1ZZMA 1A5LC 1OG6A 3U3HA 2DU2A 1NDZA 2EJ1A 1F8IA 1HO1A 1GW1A 4L80A 3OP2A 4JHZA 2DUZA 3B9DA 3ZVIA 4HN8A 1A5CA 4QXIA 1E6PA 2DUXA 3K2GA 1OFPA 1RA5A 1X1OA 4Y9PA 1F3PA 1H5VA 3RILA 1XFCA 4PR4A 1B0IA 1RCQA 1XLCA 3QMTA 4J27A 1ADDA 2WCAA 4QS6A 1O5XA 4RX0A 1GG1A 4KGLA 2E5DA 1SW0A 2OX1A 4MY8A 5J5DA 5LGXA 3IIOA 1DJHA 3IVSA 4AWEA 3H4XA 3KBWA 3VIPA 3VIHA 2SFPA 2WB5A 4GC3A 4QQUA 5HWJA 1KFJA 3K4WA 1DWGM 3GD3A 3H2OA 1HP5A 4QCFA 5IRPA 3CAVA 2AQWA 3W87A 5C0QA 1LWHA 2Z1KA 1WKEA 4HPGA 3AXMA 1M03A 4I9JA 5SWUA 3CV6A 3NSMA 4H9MA 5BU9A 3VABA 1EWDA 1MMFA 1K9EA 2YDRA 2QCCA 4YTRA 1W9UA 3W75A 2X8CA 4LAZA 2VHLA 4WJXA 1GJPA 1TV5A 2JEPA 4U28A 4U31A 3LB0A 2ZRUA 1H4PA 1SGJA 3N6JA 3T8QA 4C6BA 4EQRA 3LTPA 4AIBA 2C8NA 1N62C 4C5ZA 3KVLA 1FP9A 3HM7A 3EWWA 2QNEA 2O0TA 3A4AA 3FYOA 2D73A 1US0A 2D2GA 3TWAA 4FNSA 1KTBA 5BROA 3MA8A 1VAHA 2E6FA 2F7FA 1SJBA 2C13A 3G18A 1FWEC 1VCGA 3B4YA 3LS9A 4BHYA 4HNVA 3OZYA 4F66A 4DJFD 5ECVA 5G1TA 1DXFA 1RPKA 1IYXA 1XINA 1KLZA 3B0YA 1A5UA 4ZOCA 1XYMA 1UD6A 2YVFA 3W1QA 4L9YA 4NRRA 4PCFA 3UJEA 1PWMA 3R0UA 3BCFA 1ONEA 1UD8A 3DFSA 3PBUA 4YLWA 1P0EA 4Y8EA 2JK2A 2H3BA 3OQ8A 1UWTA 3NPVA 4D6GA 2WBKA 4B5UA 3RG6A 1R5YA 1XIBA 4DYJA 1XSKA 2QKFA 3MZNA 3OG3A 4I7VA 2WWCA 3VZZA 4JL1A 3W6LA 4H4UA 1FKWA 1K03A 3L2LA 4M52A 4E2OA 3UXKA 4LNYA 1HKIA 2MUCA 2QGYA 1UHVA 4JX5A 1H51A 3BTNA 4EIVA 1CLKA 3O15A 1XG3A 5ABEA 2IMRA 3S5YA 4PBEA 4J5NA 4GQQA 4H8VA 3NO1A 4HGXA 1D9EA 5J04A 2XIQA 2XH7A 1EOKA 2JFEX 4A05A 3CPGA 3C52A 3RFAA 3AHYA 4XZNX 1VFTA 3GVRA 1XYBA 3EMCA 5C7HA 3UVIA 1KRMA 1YMYA 2PPGA 4LAUA 4PB4A 1QI5A 3FLUA 3EWUA 3FKRA 4H9UA 4GJIA 3VD7A 5C2GA 3FIGA 1UQZA 4R5EA 3CO4A 3WDIA 1O5RA 5CZTA 1GPWA 5I3GA 3A5VA 3D3FA 3BV7A 1Q4NX 3BMXA 4NRSA 2PFHA 4NAEB 2CZEA 3G2GA 1W1B1 2D0GA 2NLIA 3LPGA 1AH3A 1EC9A 2GGEA 2GQAA 1RD5A 3O6YX 3SAZA 4QCEA 1SR9A 3FYPA 3U2CA 3GXIA 4YMZA 3GRSA 4U3AA 1HX0A 4J3SA 4A3YA 3KL5A 1WBHA 4H4TA 4JR5A 1YRRA 4B2DA 1H7WA 3TQPA 2YBUA 2X7VA 4PC8A 1R87A 3F5JA 4QEHA 4V15A 5CZJA 1PIIA 4WY0F 1SZFA 4UWMA 3QFWA 2GVEA 3WQDA 4BWLA 2OLAA 3W7RA 1B3ZA 5AOUA 3RM9A 1ZY8A 4M8UA 3M5YA 1HW6A 1XIMA 4HNUA 4Z2JA 1OADA 4DQWA 4JEJA 3BLFA 1ZX9A 3NAVA 4HZMA 1RY8A 1SJCA 3LK6A 3B97A 4ZTYA 4XBSA 3MI2A 1OCJA 3THAA 1K7XA 4UBPC 4X60A 2DJLA 3E02A 1M41A 3PTQA 3GR4A 3YPIA 4GY1A 1WAUA 4XTIA 4DXXA 1W3LA 1FWJC 4KETA 4L5ZA 3EUB3 2B7PA 3S6DA 3U4FA 2X0YA 3CV1A 1BG4A 3CZJA 4IM4A 4QM1A 1NWRA 3EA1A 1UP3A 4H41A 3PBYA 4DO7A 4FALA 2R8WA 3TTYA 5E9AA 1IQ8A 2J9XA 4XAGA 2NXHA 1P6CA 2BHYA 3GB6A 1NFPA 3IRSA 2BOEX 2VFEA 1TIWA 1UR8A 2DSVA 4MB3A 1GVOA 1H09A 4WXZA 3DHPA 1KLYA 3HU7A 3L68A 1DEDA 2RDTA 3UESA 1SO4A 4PMUA 3GR8A 1Q1RA 2FHCA 4ZB5A 4WSHA 4MUZA 1ZB5A 2PD9A 2ZIDA 4NEVA 5H8PA 2YBVA 4S23A 3MWAA 4EMIA 1FWSA 1PTGA 3QGVA 4ZE4A 4I5UA 3VGHA 2OEJA 1UA7A 4EPDC 1UD3A 1JDCA 3TSMA 3VC6A 2WJEA 2PDUA 1KCXA 4EAYA 1CBGA 3LADA 2PB1A 3IV3A 1VRXA 1YXYA 1B3WA 1ESWA 1RUSA 4H8UA 2Z25A 4Q6XA 1ZMCA 2E7FA 1EJVC 4RZ4A 3T2QA 5M17A 4C65A 2VFGA 1DIDA 3I6TA 3LDVA 3W2KA 2P53A 2PAJA 3QW4B 2EEXA 3MTWA 4XV0A 3WLMA 2J27A 1P6BA 3RO8A 2C1IA 3T8LA 2GJNA 2QCHA 3TQ0A 3N2BA 4MJ4A 4XG1A 4LIIA 1ZBKA 3GUWA 4RXGA 1GHSA 5MHBA 2BTMA 4IX0A 4R88A 1QBBA 2DZSA 2DPEA 2HQMA 3KTXA 5CJMA 3ATZA 3OZMA 4HSOA 4XO7A 4AG0A 1Q6QA 3WH7A 3WLNA 3QW3A 5FF2A 1B1YA 3V4BA 1WAWA 3N29A 3UA3A 1R3VA 3Q2DA 3PB0A 2PD5A 5FJPA 3REQB 4V27A 4JTCA 2GJXA 3P8IA 3S46A 2P0IA 2V2CA 2F6XA 2G3JA 4QIUA 5ABGA 2A0NA 3AS0A 3BGAA 3DAQA 4O1CA 4JTRA 2E8ZA 4LJ3A 1ADOA 4L9XA 3A13A 4A8RA 1JPHA 3A5FA 2VGIA 5T9BG 1EIBA 1H1ZA 1PCKA 3RCYA 5DMMA 3PAJA 5GVJA 5DT7A 1UR2A 3IJ6A 2BS9A 2EG8A 1KW1A 2GUBA 4WEVX 2W3ZA 3B40A 5JU6A 4ERAA 2WMIB 1YYAA 1A5NC 2Y8VA 2GGIA 2ACSA 3DIPA 4U4MA 1VENA 3A22A 5G4EA 4YHGA 4JAWA 3GFYA 1IZCA 1JGIA 1S5MA 4REQA 2TMDA 3QEZA 1A3WA 2QIWA 4JTQA 3CB3A 1K8XA 3SY8A 2Y4SA 2JF6A 5BXSA 3WMBA 3ARPA 1E1EA 4EQSA 1QWGA 3I7RA 3GXNA 2E5AA 4HP5A 4ZR8A 4I6VA 3VX1A 2OLSA 2FTYA 1I4NA 4UUIA 1K7FA 3TMQA 3TR2A 1PVNA 2PWEA 3FA5A 5I77A 4YVXA 3GBDA 1Q66A 3BARA 3B04A 3T9PA 3P60A 3BGJA 5G5GB 3W53A 1KO0A 3D0CA 4NKCA 2A4AA 1Z42A 4JFVA 5HANA 5MF5A 3KLKA 2PBOA 3ID7A 1NF0A 3AMKA 4GVHA 4R33A 3SDOA 4F4RA 5LHFA 1KRCC 5DCEA 3MHFA 4BI5A 1QHOA 5A3HA 1EUAA 3VM5A 3M0YA 3GTHA 3ALGA 4PULA 2HE8A 3GDRA 1BKSA 5REQA 1AG1O 1S46A 2YCLA 2WKJA 3CNYA 4IFRA 3QY8A 3WG6A 1RVKA 3UF9A 2BX7A 3BOFA 5F2MA 2OWXA 3ANVA 1ISVA 3E1F1 3UERA 5AYYA 3OBAA 1GJWA 2E5BA 3VE9A 4OE7A 1KWKA 1BVNP 1GVSA 2TYSA 4D6IA 4NP7A 2WC7A 1RV8A 3KP1A 1K8CA 4S3CA 3F03K 1O1HA 2Y7GA 1Y7VA 1KGUA 1UWUA 2WWDA 5DO8A 2EQ6A 1TJRA 1KRBC 3UA4A 1M3UA 2JEQA 3RXZA 3SCVA 4QG6A 1W5MA 1R3YA 3UR5A 3ORWA 1S38A 4QSFA 4OV4A 1A5BA 1GREA 1STZA 1EH9A 1GYLA 4UIOA 3A6OA 3KBNA 5HK4A 2FJKA 2ZX7A 1H0IA 3SCQA 1Y5XA 2OZTA 3VILA 3DYPA 2PDNA 2RGMA 3WD2A 6CGTA 5HATA 2GOUA 4IMFA 3OBEA 2ZVRA 2YXGA 2J79A 5KZ6A 1VS1A 4HK5A 3AZTA 4EPEC 3UZXA 4ML4A 3EYPA 4PZVA 3W02A 5K7JA 1HL2A 3G1HA 3S2LA 2QUUA 2X1TA 2IPFA 3FA4A 4GRSA 1YKWA 4QTGA 4LALA 4QGCA 1FDZA 2QPXA 3TZFA 3B03A 3WH9A 4KCUA 1HJSA 5AHMA 3AUOA 5AFDA 4WGXA 3I6EA 4GO8A 4AZ7A 3QQ1A 5HDRA 4GI6A 1OYCA 3DZ1A 2GWGA 3W38A 4X63A 3KW3A 2PDYA 2PP0A 5M03A 4DYKA 5M5DA 2XISA 1FWIC 4RE3A 1YXCA 5EB8A 1EJTC 1FQ0A 2POZA 1XLFA 4DJDC 1MEWA 2UY4A 1ZALA 5T9CE 3GD6A 1RHCA 1W1YA 4XZWA 1XC6A 5LKYA 4CQAA 4YYCA 1PWLA 4WOZA 2JGQA 3HO8A 4W8LA 2ASHA 5G1MA 3AWNA 1Q6OA 1UR1A 4E3VA 1XGEA 2OFJA 1KTCA 5JBDA 5HNTA 1E15A 4LYRA 1XUZA 1NDVA 3UPWA 1GNXA 1XI3A 5B80A 3NOEA 1CTNA 2L5HA 1W9PA 4H83A 1TFVA 1RAKA 2E09A 3SM0A 1CDGA 3MSGA 2HE5A 4MJZA 3UT0A 5I7GA 1VC4A 1JYWA 3UFYA 3KEHA 1J2BA 2VC7A 5HINA 1ZAHA 1XISA 1KFLA 2V6OA 1LG2A 4QAIA 1O7AA 3PNZA 5D9NA 4ZVJA 4UNIA 3S1GA 4G1KA 2C14A 4QLJA 4Y9NA 3BDKA 1CXHA 4BF7A 1LRQA 3BJFA 3DH7A 4PYSA 5U7SA 2QGHA 3CZKA 1KM2A 2AAAA 4FNTA 1LL6A 1AL7A 3E2VA 3GU1A 5AHNA 3TJLA 2YDQA 4IIEA 4JTKA 1SR0A 4JXCA 1US3A 3AJ7A 3TN3A 5M3WA 2WSPA 2BOGX 1TX0A 1E6QM 4OU1A 4XZIA 3H4WA 5IBXA 1FX6A 2TPSA 5CJ5A 2OEMA 4GG9A 3TCSA 4AY7A 1LBMA 1QWKA 4GBUA 1V79A 2FGLA 3E2QA 2WHJA 2GSEA 1TZ7A 3QLLA 1GK8A 1A5SA 1JIBA 5I3IA 4DELA 2PLJA 3OGRA 2EKGA 3IGHX 2Y5SA 4NJHA 3UJSA 3ZM8A 1E9LA 5CSSA 1VBGA 1NHQA 4E5TA 3VDAA 5EFFA 5FJRA 4O50A 4GI8A 2CW6A 4F2BA 5EU9A 1OHLA 5D03A 3CXOA 4HSNA 4FA3A 3OJGA 3KLLA 3PG9A 2WPBA 5A5WA 3GDMA 4XTDA 1OX5A 3WFZA 1H7RA 1GV4A 2W0UA 4EM3A 3URQA 4LVAA 4RNFA 4IMGA 4FSAA 3G77A 3OO2A 4K1WA 4A6GA 3ZVHA 2OOFA 2DZTA 3CHDA 2C0AA 2JKEA 4XD3A 1EEXA 1DJNA 4JIHA 3TTQA 4PE8A 2E9MA 1R2SA 4KEUA 3T42A 3HURA 3FVMA 3EWYA 3VTRA 3AXKA 3GR7A 2WAGA 1LWIA 5MKGA 3CUXA 2PWUA 2WMHA 3DBNA 1R7AA 5D38A 2V69A 1KXVA 1NHSA 3T78A 4WIWA 3AIBA 3WQVA 3KRZA 1CI1A 1TV2A 3LUTA 2FZBA 2W66A 1SQ7A 2DIEA 4WRHA 1XBZA 4GQ0A 4HCDA 2VWSA 3CWNA 1N60C 5CPNA 1FCBA 4NJIA 4M0XA 3NA8A 5TNVA 1EJRC 4H4WA 5CC3A 5D2YA 2GK1A 2GVLA 4EP8C 3MI3A 3ELFA 2ZA1A 3AROA 1F3TA 1XPGA 4Y9OA 1X8CA 3MU7A 3VYLA 2GOKA 2WMGA 2OPJA 1PUDA 2ZZBA 1EIXA 1UBPC 3C3UA 1TE6A 4PRRA 4ZQCA 4LVDA 4E0CA 1T7LA 4I9AA 4NASA 4AYGA 1V02A 1QU4A 1NFBA 4B4FA 4WXYA 1V5XA 3LQLA 4IJRA 1E1FA 1XW8A 4IPJA 1WDPA 4EXQA 1J4EA 3S47A 2ZWYA 3BZJA 5GJNA 3BVJA 3LQGA 4NJKA 3TJIA 4I8DA 3HB9A 1OVDA 4GACA 4QSHA 2Z00A 2WSQA 2CIPA 1KN0A 1Q7MA 3LXCA 3V1HA 3N9KA 4QG8A 4IL0A 3SY5A 2J8GA 3GK0A 1GRBA 1VYRA 4WDTA 2FIQA 1LUCB 1JAEA 3BG3A 3L4WA 4AFYA 2HNHA 5A8OA 3ITCA 2ZZ7A 4NZ1A 4KGJA 4WOQA 3RLGA 4DBEA 3PTDA 1HL8A 3C2YA 4US5D 3RMEA 4UTLA 3R07C 5D33A 4YN5A 1C29A 3MO7A 4EOUA 1ML1A 3NQ7A 3OB8A 2BWGA 3E9AA 4GZ7A 3R4IA 4D6HA 2A8XA 1RR2A 3BQ6A 3WF4A 4ZMGA 1YIXA 4AZIA 1DJYA 1YNPA 3FSTA 4IZGA 4X22A 4AIUA 2OZ0A 1Q6EA 1ECQA 1WDWA 1LQ0A 1VLWA 3BAWA 3GC2A 3HG4A 5DBUA 3IJ8A 4AD4A 4GIRA 5HPCA 4QRNA 3FY1A 3BZGA 3GTNA 4Q8UA 2B31A 4JFSA 2BY3A 2PLMA 4R85A 4E2DA 3VKAA 4KCTA 2O7SA 3BCDA 1OJXA 2WPFA 1QPNA 3L5LA 4AEFA 5HMDA 2OWWA 4GUJA 5FF3A 3U2OA 1Q65A 4NI8A 2DT3A 3LSBA 2D23A 3STPA 4QAWA 1ZY9A 3PF3A 4F0HA 2RHGA 4UTKA 1Z69A 1SZRA 4W7WA 4MZ1A 1WZKA 5DRIA 3JZEA 2QVHA 4C6MA 3R8RA 2GH5A 1L9WA 3D6NA 1HKMA 4HYVA 4F2UA 1YW1A 4DJFA 3DK4A 2GGHA 2HS6A 2F6UA 3HRDC 4U2YA 5D37A 1HKWA 4LW7A 3NSXA 4X3ZA 4G7EB 1WYGA 1XD0A 1OY0A 2WNZA 3PUOA 3WQCA 4JHOA 4IGNA 3EB3A 1K1DA 4WGHA 5I09A 2VR2A 2ALRA 2BXYA 2I16A 1TSIA 3WQ6A 1UKPA 1SB3B 4M1BA 2G41A 1CGVA 4EWJA 4PTDA 2XYLA 3CGCA 1EDTA 5C5YA 3G1AA 5E6ZA 1FWTA 4W93A 2QCLA 1BQCA 2OB3A 2Y7EA 1QPKA 1UG6A 1O6IA 2ZDSA 3VA8A 3DN5A 2FGZA 1F3WA 1KM4A 3MMWA 6ENLA 1AK5A 3QZEA 1G4SA 2G3IA 1GRFA 1ONXA 2EPLX 4K8HA 1SMDA 4P7OA 4PTVA 2BASA 5AECA 1VFHA 1V3HA 3VM7A 3ZO9A 2NUXA 3WLPA 4RR4A 3GRTA 5EA9A 3DGZA 3FX4A 1JPMA 3O6AA 2PSNA 3NVTA 4D6CA 5I06A 3GXTA 4Z42C 4RDWA 3FGCB 2V5DA 3BUVA 1H7PA 6A3HA 1OGGA 1BYDA 3ES7A 2Z1WA 1NOFA 1A0EA 4I8YA 3E38A 3W2LA 4NU7A 2W27A 4C1LA 3CYJA 3GVGA 3QC3A 4N02A 5AVHA 4Q7NA 4EXAA 2ZZ0A 3DFHA 3NG3A 1FWWA 4S2BA 3NVVB 3LCIA 4UFMA 3NVZB 2DQXA 4JTUA 4TQTA 1VRDA 3IRDA 3LSCA 1XJBA 4FI4A 3M0IA 4HBKA 3D5HA 4JTJA 3KS5A 3CAWA 3LU2A 1GQIA 2VX4A 2J7BA 4Y6GA 5G2IA 2HEJA 2CYGA 4L4MA 4HOZA 3LENA 2C16A 2FH6A 1QHPA 3NZRA 3GIYA 1XLIA 2GDQA 4C7DA 4JIQA 4FXJA 4H8NA 2V9DA 2XG9A 3W76A 1QBAA 1C7SA 5BCAA 1SU5A 3I6RA 3LLFA 2E6YA 5LZLA 3UWQA 1CNVA 3WK1A 1X39A 3TOPA 1AZ2A 2DSUA 4PBFA 1KBKA 1SFJA 2XGIA 1VHCA 3T0BA 4IWWA 1O95A 3L8KA 2P8CA 7ODCA 1Y8BA 2PODA 3GH7A 2ZCGA 4D1JA 1W5QA 5C9WA 3B8UA 1XV8A 2YOCA 3WUGA 4ZQNA 3O07A 7CGTA 3F2CA 2XSBA 2X7WA 3QF0A 5U4NA 4JTFA 1T8XA 4JIIX 3K46A 4O4VA 2IXUA 3EOLA 1JEZA 2NWRA 2YCIX 4UTHA 3NEVA 4NUWA 2Z7GA 3KHJA 3TA9A 3TA6A 3AN1A 1Y5WA 3U48A 1JYNA 3LZ5A 3O3RA 1X7FA 4FB7A 2OQYA 3NXLA 1TPDA 1E51A 4FF7A 1DTNA 3DHUA 3ISIX 3KBJA 4ADSA 3N18A 3DFOA 1JDAA 1I6NA 2JF7A 1LP6A 1C9DA 3F4CA 1XF0A 4F0RA 3RM4A 4DN1A 2AAQA 1KC7A 3HA1A 3I3EA 4YNGA 4RJEA 3AS2A 5E09A 2B4GA 3V5CA 3FJ4A 2W54A 2UWFA 1NH6A 1GQNA 3G0XA 1S1RA 5GNZA 1A53A 4RV3A 4JNMA 4MNMA 1D7FA 2OEKA 3IUHA 3UCQA 2X1IA 4LUIA 2XN2A 1P0KA 5LNWA 1TA3B 1NDYA 4HZ7A 5FACA 3V3WA 2R1MA 1XSJA 1EKOA 4K8DA 4H7CA 2BG5A 5I0DA 1XIDA 2AMGA 3GW0A 1EHNA 2AKZA 3O2LA 3Q58A 1YBQA 3C8NA 4W8BA 2C7FA 2J4GA 3B05A 1N8IA 3E3HA 2ZUSA 4B3LA 1KA9F 3TW6A 2QJHA 3H6OA 1PE1A 4TXEA 4MVAA 3SURA 4O8AA 3BAIA 4UTMA 4PUKA 1IEVA 1VBUA 4YPJA 3SO7A 3HPSA 3WNNA 1LPFA 3VCNA 3DFTA 3CLMA 5HMSA 4DHGA 1OFAA 2YKKA 4PMJA 1D7KA 3UBPC 4XZLX 1FFUC 3CEPA 3K8LA 3KBMA 3GAYA 2OXNA 4WF7A 2Z29A 3FCPA 1QNPA 3TSDA 1HJUA 3PZNA 2IQTA 3QTPA 3TYUA 4CD8A 1TV8A 1UZHA 3PZ9A 1L6YA 2QV5A 2CLHA 1W31A 5HWMA 2ISVA 3TP4A 3AIEA 1OG0A 4HT3A 3WQ4A 2WMKA 4URIA 1AW5A 1W2VA 2V3AA 3PZOA 2XUCA 2PTZA 4LVFA 1OFQA 2D1ZA 5CSYA 3E0VA 3HQNA 4L4PA 3FG2P 3VDHA 1T99A 2XH0A 5EMMA 1BKHA 1UP0A 3WBAA 4JIRA 1XIGA 1OZQA 2XINA 1M1BA 2X99A 1VPQA 1TJ1A 7A3HA 3N12A 5DY3A 3NGJA 4IPLA 3AFBA 3SB0A 3KTSA 2P88A 3KRSA 2OGYA 4ERGA 1NTHA 4WKHA 3KTCA 1NM9A 1QI0A 3UPMA 2V8ZA 4GFIA 2FFIA 4A3UA 3DHFA 4GC4A 3WNLA 3WLOA 3EWZA 3N6QA 2WBAA 3KCJA 1QI2A 3CL7A 4G56A 3NYZA 1JPKA 3EDEA 4HB7A 4A35A 5H8MA 5ABFA 2EG6A 3LGDA 4OBRA 5IHSA 2VP8A 1LCOA 4UOQA 1BQGA 4MADA 2Y70A 4L61A 3G1VA 1HKJA 3H12A 1VEOA 3RNDA 1R0MA 2GYIA 3M7SA 4AEEA 3O05A 2W3SA 3WLKX 2Y85A 2GQ9A 2H6RA 5DMYA 3LERA 2PWDA 3W72A 3UGVA 2XM2A 1TTPA 3TN4A 2Y88A 2VENA 4ATDA 4B4HA 5LIUX 1TTQA 2VFHA 1LT7A 1JCJA 3GM8A 1AH0A 3BLEA 1XL9A 3KWSA 6REQA 3SQSA 4UTWA 3ZS4A 1FBAA 3UYCA 1RBLA 3UG3A 3AHVA 3LM3A 1TWIA 2Q8ZA 3A4XA 3GH5A 2R9ZA 1BTMA 4YTSA 1KBBA 2XPKA 1KRAC 4N7QA 4J7RA 5DXXA 3LHUA 5TD4A 3DK8A 5GJPA 5CLTA 1NELA 4B5SA 1FA2A 3V5FA 2F2KA 2Y8UA 2FGBA 5DY2A 4JFWA 4QG9A 3UZJA 1R8LA 1XYCA 1NWTA 2AKMA 1BF2A 2A3BA 1MQQA 2XDFA 1K4HA 2C3DA 1GQJA 3EANA 1JNDA 3LTYA 1SZNA 3MDWA 4A22A 3L5OA 4C60A 2PDKA 4NJJA 4Q6JA 2DZXA 1EBHA 3QMRA 3IIVA 4W85A 1E0VA 1OCQA 2EG7A 5IDIA 1MYRA 1B9BA 4GVIA 4Q8WA 2XH4A 5LIYX 3HOJA 4C6OA 3RITA 3EBVA 3O6DA 5I3HA 4KWWA 3KCLA 2HWGA 3LHTA 2PGRA 3NTYA 2ATMA 3NR0A 3EOUA 1VH7A 3NQBA 5C9XA 3DFPA 3MP4A 1TVPA 1FH9A 4D2JA 3TW9A 1Y5VA 2ZXQA 3BLOA 1QJWA 3CM4A 2XSXA 4QHRA 1KD0A 3K8MA 2HPIA 1W6TA 2NUWA 1X1ZA 3HPFA 3NVWB 4CQ9A 3O0KA 1GKRA 5CH9A 1QDSA 2QJNA 3ZR6A 1VYSX 3OYXA 3QN3A 2G3MA 3G1SA 5JMUA 2RDXA 4CQCA 3SN4A 3FJNA 1WUFA 2C1GA 2DZBA 2O4MA 3PWGA 4D6JA 4LUTA 2ZYFA 3LBMA 3UR7A 3AIVA 4H00A 1PX4A 4CCZA 1QK0A 5EPDA 1WV2A 4HKPA 4YVVA 4TO8A 2FQIA 4H9YA 1SW7A 4ACZA 2BVYA 5I79A 1GOIA 2QS8A 4J2PA 4H4XA 2C3CA 4J3VA 1RP9A 4Z2HA 1VCVA 3TE9A 1EHAA 5DX7A 4MYXA 3WK2A 2HBVA 4JCLA 1PDZA 4C7FA 4XD5A 2GWNA 3SRHA 2ZXBA 2R14A 1OM0A 2POTA 4V28A 2VM8A 2WSKA 4JBRA 4UTJA 4GYPC 3ICJA 1ECEA 2ZZ6A 4HIBA 2DVUA 1M6JA 1YPIA 4GKTA 4L6DA 2WW5A 2CPUA 3P5YA 5D05A 4PCPA 2HBXA 1TR1A 3L4ZA 2PF0A 3UZ5A 4KEVA 2C71A 4GH1A 2ZE0A 3NOYA 4PMZA 4E2BA 4BY3A 5AYIA 1EF3A 4IP4A 4ORMA 2QXWA 4DI9A 1R30A 4MSSA 2J9YA 3OHMB 1MSSA 1VLIA 4Q8QA 1LM1A 2A3LA 3AIRA 2E1DA 4AMCA 1BWVA 1XDJA 1XLDA 2PWHA 3VI2A 1GOQA 3POHA 1E4NA 2BB0A 3W7MA 3H2AA 3VMOA 4CKQA 1B4KA 3TZNA 1WZLA 3H7UA 4LF2A 4DBSA 3EPOA 2W55A 5T26A 1Q2SA 1ZAIA 2G0WA 3THDA 2O9OA 4JY8A 2P3EA 1EGZA 3W2JA 4FMVA 2Q8XA 3IGXA 1AW2A 1AUSL 1G7UA 3GC4A 1VEMA 3VAVA 5FCZA 1W3KA 3NS1B 2PRLA 3F7JA 2EKCA 2EQ7A 2C79A 1I1WA 1WNOA 4HTBA 3GIQA 3P6LA 1W5NA 2ZADA 1UROA 3SQLA 1S3HA 1E0TA 3BXWA 1UMLA 2PC8A 1ZNNA 4HA0A 1F4HA 2OTDA 2A2IA 5EBAA 1QNOA 1E5NA 2ISFA 1ZFJA 4HCHA 3WNOA 1JD9A 1TVNA 2PDPA 1A50A 4H01A 3TWBA 1DTUA 4LWWA 1PO9A 2CLIA 4PSPA 4B15A 3EEZA 3OA3A 3QY7A 1MW2A 4J57A 3EOEA 3W7OA 5FL0A 4DWSB 2J3NA 4HA1A 3EPMA 3RYSA 1RJQA 1UCWA 2VUYA 3CWHA 2R9RA 1KGXA 4KFPA 2QPUA 2OO0A 4MKSA 4UFLA 3VIOA 4KPLA 3URHA 1DWAM 1QT1A 2OWCA 1AQMA 1OC5A 1XLLA 1D3HA 4KF1A 4UQBA 4M7SA 2WVVA 1B3XA 5TIMA 3LLDA 2B7OA 1BFNA 3RRAA 4LBSA 5E5CA 5FEWA 2QJJA 5J8LA 3PC0A 3RJYA 2QVNA 1DWHM 5BU6A 5CZKA 4IGMA 3W6YA 3TFCA 4Q4SA 2RKXA 2D2HA 3O9NA 1AJ0A 5DCBA 2WJZA 3L7RA 3LNPA 3R0DA 1EOMA 5A2CA 4WQ6A 2ZX5A 4IHCA 4IJCA 3APTA 1I60A 4JY9A 4MNLA 3VKBA 2VR5A 5L9FA 4TMBA 3F2DA 2VFIA 1W17A 3DBPA 1NARA 4F40A 1A3HA 1PJ9A 1WDRA 2BHZA 2PGFA 2ZUUA 3PBMA 3WFAA 3WY1A 4NHVA 3T09A 4A8LA 1GEQA 3IGUA 2YYUA 1GONA 3OVRA 4NT0A 5HWNA 7ENLA 3RUBL 3AQUA 1ZCCA 2HTMA 2E25A 2E3ZA 3LHVA 4FXFA 5DBTA 1HJXA 4PN2A 1XBYA 1I75A 2BFGA 2Z6JA 2GSJA 2DJXA 1ZHAA 4QQ3A 1CPUA 4E8GA 3GH4A 5I00A 1X7IA 4PFMA 2VCCA 3E2RA 4ZQMA 1DIKA 3GZAA 4XZMX 2VL4A 4ADUA 3CL8A 1E6XM 3TVAA 4J3UA 2EPNA 4GWEA 3T2PA 3GG7A 2G3FA 1Q4WA 4AY8A 1ZP3A 1XYFA 4APNA 1KCKA 2WVSA 3M1ZA 3WBEA 3W86A 3DG3A 4US5A 1GEHA 1OWQA 3KVJA 1C90A 1OFOA 4MFEA 4BWLC 1UWQA 1UWAA 3GNRA 5H6HA 3G1FA 3UXDA 1FP8A 1GT8A 3C2FA 3P8JA 1PKMA 4PBGA 4BK9A 4W7UA 4BQ3A 1IHIA 3H22A 3ZIZA 1OYAA 1V6TA 3QHMA 5HR7A 3ABSA 3JU2A 2QAFA 4OFCA 1XM3A 2JGYA 1PCWA 4E4UA 4H7VA 1XGZA 1N5WC 1Z41A 4KKXA 1EZ2A 3IJLA 4NAFB 3LCWA 2VRKA 1X2GA 2FB3A 3ZLFA 1G0CA 1R38A 1L2QA 3WBWA 3EWCA 1H6VA 1S5TA 2GR0A 1LORA 3P93A 1QNRA 3KS6A 3S1XA 1LL4A 4MHBA 1DQWA 5BXRA 2Q02A 3TQVA 1Q85A 1VBHA 5K9CA 3NGFA 3WIJA 1I9CB 4O57A 5FIPA 4PMYA 4PMVA 4KRTA 3AHTA 1ZBWA 2VEMA 4J1OA 1W1ZA 3DYMA 1V03A 2YCEA 4L9ZA 1PPIA 3IIXA 3WL0A 4HNOA 1NDAA 5AYXA 1EBGA 3FVDA 1O1ZA 4R27A 3VNLA 3AXHA 3TDFA 3SCUA 1XGDA 2Z24A 2C3ZA 1UJQA 2BV9A 1T0OA 1TPFA 2XIMA 4KFNA 4ERIA 2X50A 2TAAA 2O92A 1GGOA 3ONBA 3WF1A 4HNCA 2ABBA 1MZRA 2NX9A 2VDIA 4KCWA 3Q4DA 3DGHA 1CB7B 5CEWA 4MLRA 4TMCA 4FNPA 4ZBCA 2GDVA 4EPKA 1Z6KA 3N73A 3NRZB 2ZDRA 3RMJA 2WZMA 4Z2GA 1G6CA 8CGTA 4UTIA 1TX2A 2OR2A 4MJMA 2WOVA 4M56A 4RZ5A 4FOJA 4DJED 3OOQA 1THFD 3QZAA 1JQVA 4M29A 1XH2A 4QS5A 3LRLA 1BTCA 3SCPA 2RGLA 2NXIA 2QMJA 3JS3A 1JZ3A 1HGWA 1TWZA 2Q8LA 2UY2A 1KGWA 2DUAA 3GYEA 4MJ2A 4PCNA 2V5LA 3BAYA 4ROQA 3BLPX 4W84A 3JUGA 4EMWA 1GJUA 3O0HA 3I65A 3ZT5A 4ORIA 2QQ6A 1FWNA 1GVFA 2WP6A 1I2PA 4PTNA 3QFBA 3WMLA 1OT1A 1H2JA 3DXIA 3VGEA 1AA1B 3T0TA 4ZO7A 1ZUAX 2PWVA 1BVWA 1XS2A 4C6DA 3DDMA 4LTSA 3CH9A 1IEXA 3FV9A 1UUMA 3WEZA 4RE0A 2DH2A 4UB9A 1LOQA 2D2OA 3EOOA 5F7UA 2O9RA 4GABA 3CUFA 3W71A 1UQYA 1XHCA 4Z2IA 2XVKA 2DY3A 4P5UA 4EQXA 1F9CA 3G24A 3PPHA 1J0ZA 4XKYB 3CV7A 4L1WA 4LUSA 1D8WA 4QLLA 4IXXA 3G3MA 4PMQA 2I14A 3IARA 1WP6A 2CKSA 1S2AA 2G37A 2PBGA 3FEMA 3ZT7A 4P7QA 3ARSA 3VX0A 5LYRA 3UXLA 3W1NA 2PCQA 1SO5A 1ZPTA 4WSJA 4M6PA 3BCJA 2E77A 2AQVA 2CLPA 2R82A 4UMCA 4ICNA 2V5BA 4H9VA 5C2CA 5D04C 4MWAB 3HQ1A 3V0SA 1WDDA 5CBJA 2VCBA 3MS8A 3VINA 3IVUA 3URBA 3RX2A 4H9XA 3LTSA 3WNMA 3N14A 3PBVA 4L1GA 5C7VA 4LRSA 4E8CA 1JCXA 3VKDA 1FRBA 3NZQA 3SUUA 8TIMA 4S3BA 2VT0A 4V1XA 3O8AA 4RDVA 1MEIA 2Q01A 3H53A 5BMWA 1DJZA 1CT5A 2NQLA 1KBJA 3ZVHB 4IIBA 4PH6A 2Z27A 8XIAA 3T0CA 3BLLA 3UR2A 3ARVA 4RV8A 3NWRA 1UZDA 2WMFA 2H90A 4H6QA 2BBFA 3HPZA 2XWDA 1EL3A 4OZOA 2QUNA 4MYAA 1WZMA 1R9XA 4OHQA 5L6UA 2HDJA 3WBYA 1XIJA 1OZMA 2WNWA 5LHEA 1M65A 4OV9A 2HVMA 4PSRA 5MKGB 1W1TA 2Y24A 3BE7A 4LOCA 3WBXA 3RAOA 5AC6A 4UR9A 3NQEA 3O1NA 3GNNA 5H2ZA 5JQ9A 4KMQA 1NU5A 2YX0A 4PUUA 4K2SA 1H60A 1TWSA 3AWOA 2GK1B 2G95A 1JROA 2ZUTA 1KFWA 2OQLA 1MNSA 2PDGA 2F6KA 1OX4B 4EAMA 3B0XA 2V2HA 2NV1A 3HQPA 1R9YA 4A3QA 4NZ4A 5A1AA 4MWAE 4O1AA 4MPQA 3LPOA 4O1BA 2IPWA 4D8LA 3S5NA 1KQYA 1RZMA 4LB3A 3ABRA 4DM2A 2FZ9A 1UKOA 2E40A 3SQMA 2J13A 3HJEA 4FXRA 3M0KA 4OKDA 1XRSA 4ADTA 1JYVA 4WKFA 3DX5A 3QSTA 3K4DA 1GRHA 3UJFA 2EBNA 2RABA 1MW1A 3GXFA 2E68A 5KZDA 1SM9A 1NSJA 4XD6A 3O0FA 2XFYA 1IEIA 3E12A 3TYZA 3I4EA 1AJ2A 1KKOA 2Z28A 4R9XA 3WK0A 2FHFA 2E8YA 3RK8A 3ZMRA 1W1PA 3L5MA 1BYBA 1SSDA 4JX6A 3TR9A 1UH4A 5E70A 3CK5A 2BODX 1A0DA 2F38A 3UU0A 4DO5A 5E0KA 3MVTA 2BGQA 2KAUC 3W7QA 4G8TA 3EWXA 4B5NA 1G94A 4HPNA 3SCNA 1E70M 3GVQA 1D7YA 5GNYA 4HQVA 1HN1A 4DYEA 4XIMA 1ISXA 3QQWA 1ZBCA 3N2TA 1DWIM 1GETA 3AMZA 2A1YA 2ZZ1A 1XIFA 2FLIA 1P5BA 2OZ3A 1PS9A 4UR8A 4HHPA 2EPKX 1EX1A 3R8HA 4AZCA 3PN8A 2CFFA 3TEVA 3G8RA 3H7RA 5FS7A 5HPOA 1KNWA 3VGBA 4ZODA 3GS6A 5TAOA 2E67A 1DKWA 3PTKA 2OSWA 3VIIA 3EX6A 3VZXA 4O1DA 3UYIA 4CNSA 2J7GA 3W24A 1V8EA 3U57A 4P2VA 5D9PA 5F4XA 2CLEA 4Q8MA 2DT0A 2YQUA 5I3DA 3Q6JA 2E4TA 1OB0A 3ITGA 1ZBVA 3R12A 4I3GA 4B9YA 3SFWA 2DZWA 2PURA 3FK4A 1EA0A 1K4GA 1DBTA 3TAOA 3RNMA 1M9HA 2VUNA 5B7ZA 3MJYA 2X1SA 2QZRA 1Z89A 3PPGA 3RJXA 1MO9A 3N3TA 3WQ8A 4NF7A 3ITOA 4UQDA 3ZZ1A 3R13A 1F2JA 2YBTA 1NQKA 3T2OA 3KZSA 3EXRA 4MAZA 3UW6A 4IG2B 2XVNA 5A8QA 4WY0B 3NQGA 1VFSA 4PEEA 3RDKA 5DFAA 6XIAA 2O7QA 3W1AA 1KM5A 3TYCA 5E0FA 2BNJA 4U33A 3VVGA 3W22A 4X61A 3AU6A 4TTGA 2XVGA 4C6NA 5D2WA 4GY0A 3SQPA 1A49A 3W1MA 1GOOA 1BSLA 5I2UA 2NQ5A 3PZIA 2ZTKA 4JTEA 3TN6A 4N4PA 3UETA 5GQBA 4Q22A 2G8ZA 4IISA 2EJAA 4I9MA 3OTRA 4JN7A 2NW0A 3VIJA 3VXGA 2X16A 3KOYA 1K6WA 3WD1A 3LG3A 3A9IA 3NURA 1XRVA 4RNJA 2Q71A 4B5WA 2I7GA 1IGSA 1QOQA 4GGBA 4MLJA 1K7EA 5FS6A 5FF4A 2VKZG 2O9TA 1WYIA 1CW2A 3KCOA 3G6LA 4M3PA 1YLVA 3J7HA 4XZBA 1GVRA 2BC0A 2J8FA 2HNEA 3R1ZA 5LNVA 5IBXC 1D3CA 3MBDA 2EHHA 1WOAA 3QBUA 4FX9A 4GA8A 1GPFA 3AYSA 3BMVA 5FEZA 3RCNA 4Q8PA 2QDGA 3GDKA 1R86A 1EC7A 1CLXA 4FIQA 1GW9A 3T0DA 3BW2A 1AL8A 5TQLA 5KVHA 4MWAC 3W82A 3CHFA 2VQTA 1XIIA 1OC7A 5M1TA 3P0WA 4FAMA 3W2MA 3NIYA 1DYSA 4Z1AA 1EA9C 5A6LA 5LIXX 4TU1A 2BDQA 1YE6A 4FNUA 1BAGA 3GY1A 2Z2AA 2PCEA 1CX9A 4NZ5A 3ZJ6A 4O4WA 3BSGA 7XIMA 2JBMA 4EWND 3FXGA 3QV8A 4HMDA 1W1IE 3CASA 4Q8TA 2GUYA 3GLCA 3S83A 1V7AA 3R2GA 1U1HA 4XQ6A 1J93A 1FCVA 3VZYA 1NP2A 3PPCA 5HQMA 4I7WA 4BQ4A 1JL8A 5D2TA 4OVXA 4V1YA 3W07A 4JGDA 4FLRA 2E9LA 1FKXA 1AVAA 1E4LA 4S3AA 3NDOA 1YXDA 5XIAA 2YJQA 4GPNA 3WLQA 3B3DA 2V3DA 2BSLA 1CIUA 1JRBA 1NEYA 3VCRA 2XZ9A 3II4A 3IWPA 4KWVA 5BYWA 4E4PA 3FA3A 2ZKMX 1JYXA 3DECA 2HJPA 3DYOA 4CD4A 3TQKA 3GG0A 3JZUA 4O28A 3LA4A 4GJJA 2Y5EA 1P7TB 1EP3A 3OGSA 9XIMA 3AHZA 1ADSA 3VC5A 1QPOA 3ANUA 1R47A 1MI3A 2Q3RA 3A4WA 1ITCA 4JS3A 5BOOA 3K1DA 3SEPA 3EX3A 3K13A 4LXFA 4GY7A 3LMZA 1W1A1 4AZ5A 4A3RA 3VUSA 4NQ1A 1ZLPA 1T40A 3BURA 3TV8A 4BKNA 1JDDA 3GHRA 3RU8X 3G0UA 4GNJA 1SFTA 3B0PA 3GNOA 2ZZCA 1UD2A 3U9IA 1X8FA 2TSYA 1PKYA 3QC0A 3IPWA 1E9IA 1R2TA 1G9HA 3DFQA 3UJ2A 2J6XA 4TVYA 1Y65A 3HQOA 5HUPA 1KFBA 4HU4A 4MF4A 4FNQA 4Y96A 1MXSA 1K3UA 1MXGA 1XBXA 1M5WA 5F4SA 3DI1A 2ACRA 4QBXA 3M5VA 2VFDA 1ODZA 4X0VA 3AMCA 3SN1A 4FX6M 4DF0A 4RLIA 4PTMA 1Z32X 2XIOA 1QPQA 1GZ1A 3AISA 3CQIA 3E96A 4JKKA 3LHYA 2VCAA 3LPFA 4BQ5A 4DRSA 1DQXA 3CQKA 2WKLA 2C91A 2DIJA 1UR0A 2V5CA 4F0LA 4AF0B 1YQZA 3M0ZA 4ZO8A 1DE5A 3EEGA 4UFKA 1OC6A 1A5KC 1KV5A 3UG8A 4J3ZA 3RLUA 3ARZA 3AJXA 3VNDA 4DAIA 3OU8A 3FDKA 1LZOA 4JNZA 5U1OA 3L21A 1GVIA 2EPMX 3E0IA 1V3IA 3QHNA 4GZIA 3REQA 1ZP4A 3CUIA 2W91A 1R3WA 3QH2A 1OYBA 1TWDA 2DZVA 4CLMA 4E2VA 5CC7A 2V6AA 1WB0A 1GOMA 3CZEA 1GESA 1POJA 5B7YA 3CXBA 3W83A 1WXJA 2XHYA 1OJTA 1RQEA 2P1FA 1JGMA 4X0NA 4WJ8A 4HA4A 1GRGA 3ZSTA 4HU3A 4DUVA 4POCA 1HO4A 3GZ3A 3B8WA 4W7VA 4IQLA 3KM8A 1MUCA 4XO6A 4UTTA 3KDOA 1IT8A 3L65A 3LCFA 1AQHA 4HZ8A 2WMIA 4H3DA 3N3MA 3TU9A 4GD0A 3MUIA 3GW3A 3FAXA 4Z1YA 3W1RA 2PDJA 3QV6A 1H0GA 4CQDA 1XDIA 5DRCA 4WX2A 2CEQA 3PFRA 1QVBA 3TUUA 4D9PA 4IPPA 2HSAA 1M7XA 4DJFC 3VNIA 5DELA 3H2CA 3PHAA 4A3HA 3CPUA 5AHIA 4FNRA 3D47A 1H5YA 3N9RA 3QTGA 3USBA 4FX7A 4L1XA 3OIXA 1J79A 1VJZA 4ZSTA 1POKA 1F5ZA 1PTAA 1TPH1 3QXBA 4TTUA 1LRNA 1SJAA 3MUY1 5JRBA 1WUEA 1VCFA 4KWOA 5K4XA 3IJIA 2XJ7A 3WMCA 2HVOA 3P74A 2PTDA 3R11A 3S1VA 4BI6A 4JX4A 2ESCA 4IQEA 3NEHA 3IJDA 4N9DA 2FTWA 4WKAA 4WK9A 2PMQA 2P8BA 4L65A 2ZRZA 3RO6A 4CD6A 2G96A 5CBIA 2X8HA 3NZPA 3EB2A 2VDGA 3VMPA 1XXXA 4AVOA 5EMKA 5AC7A 2AL2A 5XIMA 3CMGA 4HYRA 2J25A 1GTEA 3ME3A 5CCZA 3WKZA 3G1RA 1CXEA 2J8TA 5ABFB 3KOXA 4PUJA 3CU2A 4JPGA 1XLMA 2VX6A 4L56A 1ONFA 5A6KA 3S6OA 2X2GA 2IKGA 1ICSA 2GR3A 2FFCA 2FPTA 4G9PA 1ITUA 3JW7A 5HNUA 3EMZA 1TREA 2F2HA 1V77A 2ZQ0A 4LB4A 4MNJA 2FZDA 1N8FA 3CAKA 5E0CA 5K4ZA 3CTLA 3OW1A 1J6PA 1CXIA 2NX1A 4N6EA 2VZUA 5D9OA 8XIMA 1XKYA 7TIMA 4IOTA 3XISA 2W61A 3AO0A 1K6AA 3H2FA 4AEOA 6REQB 5BWAA 1XYZA 2EF9A 3CZGA 1EO5A 1FFQA 2Y5JA 4JDYA 1FTXA 4MKVA 4K36A 2FKPA 3UZZA 3T40A 3SUSA 1IXQA 1TKKA 1XH0A 2W79A 2HPMA 1G5AA 3ALFA 5E9XA 4M24A 3E74A 5I3FA 1UR9A 4M6UA 1QOPA 1W5OA 1R9ZA 4F0SA 3IEBA 4C6CA 3WLLA 2BOFX 3EXSA 1R3QA 3LOTA 3NPWA 2QF7A 3DJJA 1J18A 3ARRA 3RR1A 1DPMA 3A47A 3WX7A 5GRTA 3GXMA 2Y2WA 1FCUA 2CERA 4AC1X 2Z1BA 1RD6A 4BJHA 3N2CA 2XU2A 1XD1A 3ZJ7A 3LGGA 1B30A 3M0VA 4DLFA 1QNQA 1TELA 4Q3MA 3OVPA 4CCEA 2QAPA 3EPNA 2INFA 2ZRWA 1IWAA 4LA1A 4M81A 2Q3OA 4YCOA 3P84A 3GHTA 4JHMA 3SUVA 1DJIA 3C0SA 2ZICA 4IICA 3LRMA 1A5MC 2XFWA 1J9YA 2W63A 3PK7A 2QV4A 3G3DA 2A3EA 5A2AA 2DT1A 3M07A 4O54A 3THQA 3H2EA 5AC4A 3ABXA 1OT2A 2QHAA 1U5JA 1JRCA 4I6KA 3HBLA 1JCNA 1VQZA 1US2A 5CPMA 4D72A 3T07A 1V3MA 1M7PA 3LXBA 1WQ5A 3MB9A 3RCMA 2Q09A 1ENUA 3BOXA 3E5PA 3UJRA 2F5ZA 1E43A 3F1QA 2X41A 4N6FA 1IEQA 2FB2A 3W7JA 1JR1A 4R7JA 3VK5A 3QOMA 1GHRA 4EK7A 4NI3A 3SR7A 1EZWA 2AAMA 1JULA 2WZEA 1MUMA 2ZUMA 3W3OA 3L4XA 5CPQA 3DUGA 1C8VA 5LA0A 4PFHA 2Y1HA 4ACZB 5I78A 1YDVA 2QCNA 1A4MA 3UWUA 3W2UA 3C56A 5FAJA 1PIFA 3ITTA 1RA0A 1OD0A 3TC3A 3W23A 4BEQA 1NDWA 3EDKA 2WV8A 3E0FA 3M0LA 3WUEA 4DIAA 2V38A 3KVMA 3PANA 2FZNA 4DJEA 5BRBA 3PNUA 1TUFA 4ZOHB 4V2XA 4JZ5A 4O15A 1F6YA 3MCOA 3PWIA 3PUDA 2DT2A 4O10A 3CZLA 3INPA 3GBEA 3N4AA 3W25A 1NFGA 4JFUA 5FSDC 4NIRA 2I9EA 2C6QA 3M43A 4DUXA 3GDBA 4LAMA 2VELA 4DX3A 4RW5A 1OCNA 1U2YA 4ICCX 5AHLA 2CNCA 1TPVA 4P8UA 4PMOA 3ZJ8A 5JH1A 4TX8A 1QFEA 5IXEA 3NCOA 2QCDA 4QJ3B 1TZZA 2GVYA 3H2MA 3IGSA 3N4EA 2CZ5A 3WDQA 4YYFA 2PDIA 3LCLA 1L6GA 4BR1A 3VNJA 1GORA 3LV6A 3C0QA 3G1XA 1J12A 5H91A 2PGEA 3UG5A 3SGGA 1J2WA 2H3DA 1WKFA 2YYTA 4R7WA 4DWSD 3GO2A 2ZFAA 3ZWTA 5LNRA 2FVLA 1K02A 3UWYA 3KDNA 4HVXA 2GQWA 2BCPA 1VIWA 2QAEA 5A94A 4NNAA 4S3KA 4YIWA 1E71M 4JTIA 1GSNA 3A21A 4G5DA 5LIKX 4BF9A 3BG5A 4LEFA 4Q32A 4WDUA 5CGTA 3CO8A 2CLKA 5F1UA 1DQUA 1OFBA 2PA6A 3TNOA 3AZRA 1B57A 1BF6A 2CWNA 4FEZA 4QNWA 3MCMA 4O19A 4C6PA 2D69A 4NSBA 1EX5A 3OLDA 5A8GA 5G1YA 1H63A 1H49A 3FN9A 1CXKA 3KXQA 3TAKA 4FP1A 4ZO6A 1AD4A 1B31A 3R89A 1F3XA 9RUBA 4JEQA 1MWOA 3GNDA 1BEUA 4Q4PA 2A7RA 5BWFA 5DMLA 2ONEA 1JZ6A 2DSZA 3DHDA 4GKLA 2QR6A 1ZDLA 3H23A 4MZYA 5FJJA 2ICSA 1V7YA 3AI0A 8RUCA 5DANA 5FEXA 4ZOAA 1U1UA 1EQCA 3QRHA 4D6DA 4DNMA 2V3GA 3W7NA 4J4KA 5AHEA 2DVTA 1YDOA 3APGA 2WXDM 4S1FA 3NQ8A 4C6JA 4NILA 3CV2A 3BGGA 1C8YA 7REQB 4PMNA 2HQAA 4NNBA 3ZWSA 3C0JA 4MB5A 3BC9A 2Y62A 1OEPA 4IF2A 2R1LA 1MQPA 3U4AA 5T91A 4KRZA 5JXQA 3A3HA 4CN6A 4ONVA 2X0HA 2J7EA 1DIOA 2OSXA 4U10A 3ZXWA 3DCPA 2JK6A 1W56A 2VTFA 2A7NA 3OG2A 4A29A 2WM0A 3R79A 4PUWA 1Q13A 3MMUA 4ZL1A 3Q37A 4GYJA 3BQ5A 4DZIA 4PUMA 4UTWC 3UWWA 1UIOA 2I5QA 4Z08A 3AM9A 3L0KA 5HR6A 4L7ZA 5EKYA 2ODOA 4AHQA 4IP5A 4Q7BA 1NJJA 1F8MA 5PTDA 1JQXA 2WLYA 2D0HA 1FEAA 1N5XA 4GVGA 1VF8A 2I9UA 2YCJA 4B91A 3K5XA 2GSHA 1OF8A 4HYWA 4DXVA 4J9JA 4HOWA 3LM7A 4C1NB 3AIUA 2DW7A 1N8WA 4ZB0A 1PX3A 1G67A 4HHHA 3DU0A 1A47A 1W9XA 1B3YA 1BVZA 4AD0A 3AICA 2CXGA 4J56A 4P7NA 1Q6CA 1G4TA 1QI4A 5D2XA 2E9BA 1J96A 4EKJA 1TCMA 5CG0A 2YZ5A 3BAJA 5JH2A 1S5WA 2H9AB 1RBOB 5C71A 5EMJA 3HG5A 4GIYA 2DSKA 4FX8A 4GI9A 1SJDA 4NNCA 5I3JA 2OSYA 3UXAA 1V6YA 2NPXA 1XRTA 2GVJA 3AZSA 2PZNA 5LSMA 2D0FA 4GQRA 2C0HA 5FAGA 2PRHA 3M44A 3NVDA 4QR6A 3STGA 3PR2A 1WZAA 4S3JA 4KT2A 1C93A 2FVKA 4GZEA 4AD5A 3LHZA 1BRLB 3C3NA 4IMEA 2QUVA 4QISA 1TV3A 3ZYZA 4AIEA 2ZUWA 1P4CA 3QGAC 3GU9A 2PF8A 1ONWA 1P0DA 3PTMA 3GTXA 3QMSA 1GZGA 4ZFCA 1NHPA 1PSCA 3S42A 3IK2A 3NQFA 1E0WA 3TCEA 3W4RA 4G7EA 1PKNA 4UNLA 3NPUA 3DFNA 4TX9A 4W5ZA 3W84A 1E0XA 1QI3A 2RDWA 4IIHA 2PTWA 1VFUA 3UNTA 3A64A 3WNKA 4LT9A 3EX1A 1L6FA 4LCRA 4HMEA 3DH9A 1H3GA 4RW3A 4YJ5A 4NJGA 3PPFA 4Z0SA 4ML9A 1A80A 1WOBA 1CGTA 2AOSA 1J11A 4X9YA 2DP3A 2FMOA 2PI6A 4DVOA 1QATA 2BY0A 4NEWA 3STCA 3F4NA 5JBEA 1K8ZA 1WDSA 1OSEA 3BK0A 1FWHC 4O1EA 3BW3A 2XSAA 3TK7A 2ZUNA 1TPEA 2GQ3A 1V0KA 3PG8A 1RALA 1UMYA 3QLDA 1DIEA 2CHOA 4PL2A 2GDUA 4DWDA 3ZOAA 2GVGA 1B54A 2YL6A 4AC7C 4AX6A 1SZEA 3FSUA 4KIRA 2WSRA 3L12A 1PBGA 4M6VA 1UWSA 1NVMA 4H19A 3W9ZA 5A6BD 4MTVA 4DO6A 4OWGA 3CQJA 1J6OA 1OF6A 4LFYA 4GISA 4FZIA 2C18A 3WLHA 1DWFM 4LAOA 4JFTA 1YX1A 2Z6IA 1JZ7A 3SRFA 1HJVA 3QGKC 1R85A 3W7EA 3UGRA 4F3HA 1QASA 3GDTA 2AGKA 1WA3A 3NDYA 1A5AA 3CGEA 4JCMA 3BICA 2ZTJA 4ACYA 4BZYA 1TE1A 1DL3A 1O68A 4JQ2A 1E5JA 3FOKA 5G2HA 3LXAA 4ZXLA 3UQNA 2OODA 3FKKA 3L4UA 1IGWA 1H41A 3TOYA 3EDDA 4JTLA 1LT8A 3LNMA 2DGAA 3RM8A 3UP8A 4NXSA 4HJFA 3C86A 1W3NA 5RUBA 1WPCA 4S2CA 1EO7A 3UWZA 2CZVA 3OGVA 1MNZA 3MSYA 3HPAA 1I1XA 4XZ9A 4HU0A 3N15A 3LPPA 3UZWA 5CPTA 2BZNA 3GFZA 4FLSA 1JD7A 4O11A 1VQTA 4MWAD 5HQEA 1S7MA 1OBAA 1K8YA 5JIPA 1JZ5A 4EF8A 1MDLA 4JQ9A 2D22A 1E1CB 5D32A 1REQA 3LGEA 3M41A 4PUDA 4DPPA 3NM1A 2HISA 3K1GA 3P7YA 2TPRA 3G22A 4K1GA 1XQKA 5I23A 1BYAA 5FKYA 4HMNA 2OKOA 2AGTA 3T7VA 3GYCA 4LUSB 5XINA 3WUFA 1XHGA 3ARTA 4RUBA 3W6MA 1RCOB 1ZQ5A 1VFMA 2Z7KA 5FF7A 4KIEA 3S5OA 3FHQA 3MHGA 3DOPA 3WDHA 4LBUA 4IFKB 5A8PA 4I7UA 4P7LA 2PLCA 1AD1A 4JDRA 1OK6A 4TOQA 2IQ0A 3WYZA 1GVQA 2QEZA 3GHUA 3BSMA 4AZGA 2J75A 1LLOA 4S3GA 2RJGA 3VO0A 4B16A 2QDEA 1TWWA 3IJ7A 5ABTA 4IPIA 3NL2A 1RVGA 1S5VA 2KZHA 3VDCA 3HGJA 3WQOA 1K4QA 3WF2A 1UPMB 3SCRA 4QLKA 3PZGA 1RSCA 3B4UA 2MANA 2PDCA 3N4FA 2X42A 1FHDA 3S9IA 3WF0A 4CN1A 2E5CA 3Q65A 3CIXA 1V0NA 4L6HA 2VO5A 2ZA3A 5C8BB 1QMLA 3I3DA 4Y9MA 1E3XA 3H2NA 4UMBA 6ALDA 1YEYA 4ADWA 1GVEA 4M5PA 1M53A 4GX9A 3IS4A 1OX6A 4FLQA 4TV5A 2Y7FA 3VDGA 1UP2A 1XX1A 3AIQA 4N9CA 3M0HA 1BZLA 1LLWA 1EXBA 3NQAA 1JCYA 3FDGA 2B0MA 4CEUC 4LY4A 3MUZ1 3PWAA 2A6NA 3RIKA 3L0NA 3WDRA 1ZRQA 2YSWA 1RP8A 3NO5A 2PUZA 4XUGA 1GCYA 4WDWA 3W27A 1RJPA 1Z9AA 5LA2A 1EP1A 4W89A 1E6RA 1DJWA 1JUKA 4IGHA 1J0IA 4HN4A 4OIFA 3MO4A 1TPWA 1V6XA 4GUIA 4IIFA 4MOZA 4JN6A 1HJWA 3NQDA 3WCZA 2A3HA 2JQXA 3IV8A 2CWXA 4GRTA 4AU0A 2YXOA 2YFOA 3AXIA 4LANA 2CHNA 1DWJM 3CT7A 5CKSA 3SECA 4HA3A 3AIWA 5I24A 1AW1A 3B8IA 2R91A 2R1NA 4IXHA 5EY5A 1NF7A 3MVIA 2XFRA 3QM3A 1QRQA 2VOMA 4ROPA 1KM1A 3FXYA 3G0SA 2JALA 2GPTA 5C6MA 3I4KA 2QT3A 4RXFA 2BY1A 4AD2A 3N2OA 4OBTA 3AYVA 3BLDA 1A0CA 1BHGA 3RHGA 5AHFA 3TLQA 4NY2A 3LEPA 1R2RA 3VKJA 3I7SA 1PEZA 1EJ7L 4QDPA 2PZ0A 1ZCOA 1KFEA 3TTEA 4LS1A 4PMDA 3W7PA 1G4EA 1JI1A 3L4TA 5BZAA 2ZXDA 3ETRB 3H70A 2J78A 4O1FA 3EX4A 3HGSA 3LRKA 3PZMA 2NVKX 4N42A 3CWOX 2UV8G 4L64A 4QX4A 1HGYA 4AZCB 3VOFA 4G1NA 3WLRA 2DSWA 1AH4A 3IJQA 1I2NA 2XIIA 2Q6ZA 4E38A 3NYDA 3CIWA 3W28A 4E3TA 2OMAA 5C54A 5FOOA 1UWRA 1E9YB 2GQ8A 1YPXA 2WYSA 4HOXA 2PDHA 3G8EA 1DVJA 3W7CA 4RNIA 1K9TA 3P81A 2DIKA 4UTUA 2VURA 3VCCA 2HMCA 2OCZA 1MW3A 3S3GA 1EPVA 3WENA 4KS0A 3WLSA 4OGZA 1LBFA 4ZQOA 2VYOA 3ABQA 3B06A 3AUJA 3TTOA 3R25A 3COTA 3KOWA 3S9ZA 1T41A 5IOBA 2WCGA 2WPGA 3ECQA 1V4YA 5FJTA 3NUKA 3W01A 1M68A 1LLZA 2W5FA 4Y2WA 5IM51 4XUYA 3PVFA 1GVYA 2XM1A 3ITLA 4PB3A 3AU2A 3EA2A 1JG9A 4AZHA 4IIDA 4CVUA 4N9BA 3HMJG 3IC9A 5CAKA 2WOIA 3ONCA 3L67A 2NQ9A 4XIAA 1MRAA 1WKYA 3W1PA 1QNSA 2ZZ4A 3NFUA 4JKMA 5KITA 1QW8A 4DF2A 2XIJA 4AWUA 1RK5A 3N1AA 1XH1A 1IT0A 3V75A 8A3HA 4PCSA 1VPYA 5C9ZA 4XVDA 5DXYA 2BGSA 4LRTA 4F48A 4LSBA 3PY2A 3R10A 1XLBA 2OO6A 1VJIA 1EQPA 3PAOA 3HJZA 3SRDA 2VD8A 3NQCA 2I1OA 4MUPA 2G5WA 2J77A 3QPEA 5CSUA 4YL2A 4NXKA 1IZJA 4F0KA 4EE9A 2WANA 1HP4A 3IVTA 2FJUB 2OZ8A 3VOCA 4UC5A 3OQEA 1SZGA 1TG7A 2Y89A 3OODA 1TPB1 5CG7A 1V6UA 2PU0A 3RRXA 5FS9A 3SGZA 3AALA 2TRSA 5CZSA 1WXYA 1SO6A 4TVUA 1JXJA 1QOXA 5U25A 3S1WA 1FVPA 2P5NA 1Q8AA 1LTDA 4ASTA 1W1VA 2Z1SA 4LVBA 4JYFA 3FNDA 1NY1A 3CS2A 1DJGA 3CQHA 3GG8A 4AISA 4H4YA 4MGGA 3MMTA 5BRQA 1SSGA 2J66A 1UKTA 1W9BM 1JJKA 3WFLA 2CESA 3VDBA 3TSBA 1X96A 3QFEA 1ZU8A 3N2MA 3ZR5A 4QJ4B 3WD4A 5F2LA 1L8NA 4EACA 4HHLA 1UD4A 2DFAA 2HVNA 2A85A 3HGRA 2OVLA 3S2CA 1EJSC 1LWJA 1SVDA 4JNYA 5A6TC 1L6WA 1TIMA 1UR4A 3UD6A 1K77A 2DEPA 2CETA 4KRUA 2HCVA 3GQYA 2NX3A 3MJMA 3LCXA 1ITQA 5J5RA 3W1UA 4N0RA 3GAKA 3ZJKA 1A4LA 3PZTA 4NL1A 3QKZA 1VPXA 1CCWB 3LXDA 5I02A 4MDPA 2PEVA 4H50A 2WZTA 2CLMA 3S8HA 3E0WA 3MP5A 2V3FA 3TW7A 2V81A 2WK2A 2XZ7A 2VI0A 2NV9A 3W1LA 1V0MA 4EM4A 1LYXA 2WHLA 2VOTA 3DG6A 1CB2A 5A6AA 3TLLA 3QFAA 3MKCA 1ZGDA 1KFCA 1V08A 1JZ8A 1MO0A 3MKVA 2ZZ3A 2ON3A 4LCQA 2Z4GA 3V18A 1MDRA 2YVGA 2W4XA 3TC6A 1OIFA 4C6EA 4FHAA 2PDQA 2OOGA 1H62A 2BGNE 3KRUA 3S9YA 3CUJA 2NSXA 2J7HA 2CBIA 2XN0A 2ACQA 2NQHA 1YHTA 4XKMA 2YIHA 4KPRA 5ER0A 2GLKA 1X2HA 4K7ZA 1H1NA 5CPLA 3M47A 4GMEA 2P3ZA 5DCDA 3I3BA 2W67A 2J88A 3THCA 4LY8A 1AFSA 3LBCA 1W3IA 1DP0A 3N11A 4IP7A 4DWSA 3LI0A 5CC5A 4S3DA 1IR1A 4D6FA 2HZGA 6XIMA 2NQJA 3MWCA 5JVLA 3DK9A 3GXDA 1YTEA 3B9JB 5AKQA 1AODA 3DKJA 1CGWA 2EPOA 3M9YA 3WQFA 4DLMA 4L6OA 4YWIA 1B4EA 1SO3A 5BXTA 1WX0A 2VDHA 1TO3A 1B2YA 4M51A 3P80A 1UB3A 2PU1A 1P48A 2A21A 1F4AA 4PMRA 5I03A 2V82A 1G4PA 2ZRYA 5CJNA 1XKJA 3A12A 4G7FA 2GJLA 4TV6A 5EFDA 4JQ1A 4FLOA