1MRAA

Mandelate racemase mutant d270n co-crystallized with (s)-atrolactate
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
357
structure length
357
Chain Sequence
EVLITGLRTRAVNVPLAYPVHTAVGTVGTAPLVLIDLATSAGVVGHSYLFAYTPVALKSLKQLLDDMAAMIVNEPLAPVSLEAMLAKRFCLAGYTGLIRMAAAGIDMAAWDALGKVHETPLVKLLGANARPVQAYDSHSLDGVKLATERAVTAAELGFRAVKTKIGYPALDQDLAVVRSIRQAVGDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTWIEEPTLQHDYEGHQRIQSKLNVPVQMGENWLGPEEMFKALSIGACRLAMPNAMKIGGVTGWIRASALAQQFGIPMSSHLFQEISAHLLAATPTAHWLERLDLAGSVIEPTLTFEGGNAVIPDLPGVGIIWREKEIGKYLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANDELATE RACEMASE
publication title Mechanism of the reaction catalyzed by mandelate racemase: structure and mechanistic properties of the D270N mutant.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Racemase
total genus 131
structure length 357
sequence length 357
ec nomenclature ec 5.1.2.2: Mandelate racemase.
pdb deposition date 1996-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1mraA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1mraA01
3TJ4A 3MWCA 3SN1A 3NO1A 3TCSA 4HPNA 5FJRA 3QPEA 3VC6A 2PTXA 1JCTA 3DG7A 3JW7A 4H1ZA 3I6TA 3QKEA 4HNCA 4A3RA 3T8QA 2QQ6A 3RGTA 3R25A 3ZVHA 3DFHA 4ZA0A 2PODA 1WUEA 1MRAA 3CAWA 2PTZA 4JN7A 1KCZA 4GFIA 2OQHA 2GGEA 1FHUA 3EEZA 3SN4A 3FCPA 2GSHA 2MNRA 1MDRA 2PSNA 4GMEA 3K1GA 2PMQA 3MQTA 4HNLA 4GYPC 5FJUA 3GD6A 2PA6A 3T9PA 4IP5A 2FKPA 2CHRA 2OZ8A 1F9CA 3N4EA 3ZLHA 2P8CA 3QN3A 3TQPA 3ZVIA 2QVHA 2QDDA 3DG3A 3STPA 3TJIA 3SJNA 3DDMA 3V5FA 1KD0A 1RVKA 3GC2A 1TKKA 3RR1A 2OQYA 3R0KA 5FJTA 3MSYA 2OFJA 2OLAA 1JDFA 1YEYA 2P3ZA 1NU5A 2NQLA 2GGGA 2PU1A 3UCCA 3PWGA 3DERA 3R0UA 3DEQA 4MMWA 2P88A 2FYMA 1JPMA 3GO2A 3P93A 3UGVA 3UXLA 3ZLGA 3FV9A 3Q45A 3IJLA 4IL0A 4GYPA 3JVAA 3ZVHB 4Z17A 5ENLA 3FJ4A 1XS2A 3DG6A 3QTPA 3OPSA 3VFCA 4A6GA 2AL2B 1PDZA 3H12A 3OP2A 1W6TA 1R0MA 4K8GA 2PCEA 3T4WA 2I5QA 3VDGA 3S5SA 4ENLA 3PWIA 3OTRA 3ES8A 2ZC8A 1L8PA 3RRAA 3FXGA 4A35A 4IL2A 5J04A 3PK7A 1P43A 2QJMA 2XH2A 4DN1A 3CT2A 3BSMA 1E9IA 1BQGA 1IYXA 3UJEA 1ONEA 2MUCA 1ELSA 2OPJA 3NZGA 3UJFA 1XPYA 2AL2A 3BJSA 7ENLA 2XH0A 3RO6A 4HCHA 1DTNA 4DYEA 4F4RA 3UXKA 2O56A 6ENLA 5EU9A 4YWSA 2PP3A 3RITA 2XGZA 2OO6A 1EC7A 4KPLA 3TOYA 2P8BA 3DIPA 3U9IA 4X2PA 1SJBA 4KT2A 2ONEA 2POZA 2GGHA 2QDEA 4K1WA 2ZADA 3DESA 3SBFA 1NELA 4HCDA 3HPFA 3VA8A 3NFUA 3OW1A 3I4KA 1WUFA 2AL1A 3OZYA 4E6MA 3FVDA 1PDYA 3DFYA 4FP1A 2PU0A 1EBGA 5FJPA 4M0XA 3KUMA 2PTYA 4Z1YA 3VC5A 3QLDA 2XH4A 1JPDX 2OZ3A 3D46A 1ECQA 4EWJA 1FHVA 2HXUA 2PTWA 1BKHA 3OZMA 1SJCA 3JZUA 3EKGA 2QJNA 3N6JA 1EBHA 3RCYA 4HN8A 4M6UA 2OZTA 3SN0A 3VCNA 1KKRA 4KEMA 2OG9A 3R11A 4MGGA 4GGBA 1EC8A 3U4FA 4GISA 4HYRA 2OKTA 2PPGA 2OX4A 2GGIA 1MUCA 3MUCA 3MY9A 3N6HA 3I6EA 4G7FA 4IHCA 3SQSA 4H2HA 3TWBA 3V3WA 4H83A 2PS2A 4FI4A 3UCDA 3H8AA 2XSXA 3CB3A 3T6CA 5IDZA 3CXOA 1SJDA 4DWDA 4DXKA 5FJOA 3PFRA 4ROPA 4DX3A 3IK4A 4JN8A 3DGBA 2AKZA 3UJRA 2AKMA 4MKSA 2PP0A 4IT1A 4J1OA 2DW6A 4IP4A 5BOFA 3ZLFA 3TW9A 3V4BA 3B97A 2RDXA 3P0WA 4DHGA 2PP1A 2GDQA 3H7VA 4H19A 2HNEA 3ES7A 3BOXA 2GL5A 1KKOA 3IJIA 4KWSA 1MNSA 2PGWA 3TWAA 4E5TA 2OVLA 1OEPA 4ZCWA 1R6WA 3ENLA 4IZGA 3CYJA 3UJSA 4J3ZA 3UJ2A 4E4UA 2DW7A 2QGYA 4JHMA 2GGJA 4E4FA 4E8GA 4HCLA 3FYYA 3S47A 1TE6A 3NXLA 3MKCA 3TTEA 3V5CA 3GY1A 1P48A 3VCCA 1MDLA 1EC9A 3H70A 3R1ZA 4GIRA 3SSZA 2XH7A 2P0IA 3CK5A 2PGEA 3IJQA 4G8TA 1SJAA 3THUA 4K2SA 3Q4DA 1TZZA 3P3BA 3D47A 3R10A 3MZNA 2HXTA 3N4FA 4GGHA 2QJJA 2HZGA 5BOEA
chains in the Genus database with same CATH superfamily
4O4VA 1YXCA 1IWPA 3QPEA 4KFNA 1XD1A 4WOZA 2Z7KA 3VZZA 4DWSC 4H1ZA 2R6OA 4EIVA 1QOQA 4V2XA 1QHZA 4I9TA 5A8NA 3B9NA 2XIJA 3GNOA 4F9DA 4BR1A 3ZVHA 4JFUA 2YAUA 1M9HA 4ASTA 2Z2BA 2WCSA 4UQAA 2NVCA 3S2MA 1FOBA 4HIBA 2PWDA 1ECEA 1IZKA 1IT0A 3TTYA 4HPHA 4P8XA 1A5UA 2JKEA 1EGMA 4JTQA 4GMEA 1J2BA 5DT7A 3PTKA 4LUSA 5JIWA 3VIPA 2Y8KA 2XM2A 4YU1A 4K68A 1K8XA 1R86A 2JQXA 4ZO9A 4ZOHB 3HJZA 5G1YA 3M9YA 4O52A 3UG3A 2X7WA 4O50A 4RDZA 3S3GA 2QDDA 3LEPA 3OEXA 2CKRA 1OFBA 3NXFA 4JIEA 2IW0A 4H41A 1CZ1A 3B9DA 2ABAA 4MM1A 3VD7A 2JKPA 4GOAA 4AWSA 4EPKA 3NZ1A 2E0PA 1H5VA 2DH3A 4Q8UA 1DKWA 1H62A 1NF7A 1NU5A 2NQLA 3TYUA 1I0BA 3PJUA 4KEUA 4K36A 1ZZMA 3SCWA 4R34A 4PFMA 4YTSA 3OZOA 1HJQA 2EO7A 3BAJA 1JNEA 9CGTA 4GI9A 5FACA 3GIYA 4FX8A 2WOIA 2YBUA 4Q22A 2V5LA 4REQB 3ARPA 3C2FA 4CQCA 4PRTA 5I3IA 4A3HA 9RUBA 3BO9A 3WH8A 5I3DA 2G97A 1K9DA 4UTTC 3QTPA 2DU2A 4ICCX 5A8OA 5D33A 3OPSA 1HKWA 1PDZA 3UQNA 3GHSA 2CBVA 1SPQA 4FLOA 2WJEA 3B0XA 4GBUA 1BGAA 3RLUA 3T4WA 3KVJA 3EANA 3GG1A 1WAWA 1ZMDA 4JQ1A 3PSVA 1VDVA 1XIBA 1HZYA 3H53A 1IIHA 5GNZA 4UOZA 3PK7A 4ADWA 1KFWA 4PCSA 2YBVA 3WLTA 4UWMA 4S2BA 4GY1A 2D0HA 2X2GA 3UG8A 5LGZA 3PNUA 4LT9A 2DFAA 4XSLA 2NVAA 1QHPA 2NV9A 2F7FA 3B8TA 4D9PA 3REQA 4D8AA 3UXKA 1DHKA 5I78A 3ABQA 2D3LA 4E3TA 2XGZA 3W38A 2VHLA 2VVNA 3PTDA 1FWIC 4LCSA 3W6YA 4NASA 3MCMA 1UIPA 4O16A 3SRKA 3VZYA 5LNSA 2WQPA 3IIXA 3MO4A 1TG7A 1UIOA 1MNZA 4K39A 5CBJA 2Z28A 4ZMGA 4N9DA 2OCZA 3WG6A 1XHCA 2G8ZA 2JF6A 1H7PA 3NQCA 2J7DA 4M29A 5HWNA 4RZBA 4JZ5A 4MPKA 2WWCA 3L4WA 4OTKA 2OX1A 3AMCA 4NXKA 4LTSA 1GQKA 1AMKA 1GKQA 1GREA 1EYEA 1ZSXA 1GOKA 5HNNA 4RE0A 4W8AA 3BC9A 4L7ZA 4XZHA 3B0VC 1AZ2A 2XIIA 1ECQA 1W5NA 1WZKA 3AS0A 3OIHA 3VYLA 1JDCA 3GVQA 1DWHM 3CTLA 3JZEA 4AD5A 3H4XA 4WF7A 3FKKA 4XKYB 1FKWA 2VT0A 4JD4A 2Y0FA 1CBGA 3VOIA 4D1IA 5EMUA 1MW1A 3GFXA 3SQMA 2CZVA 3CIWA 4IMEA 1W2VA 4WXZA 5BWAA 2YCLA 1S1RA 2X1UA 1PAMA 5FEWA 4N6FA 4W8LA 1JUEA 1U1UA 4G7FA 2ZXBA 4J35A 4AMAA 1E9YB 4GNKB 1UD3A 2IQTA 2PLMA 2UWFA 3L4TA 3ZM8A 1LQ2A 1Z8AA 1OX4A 2V5KA 3TYDA 3R12A 2OELA 3SCUA 3I7SA 4YTTA 1BWKA 4N9BA 3DFNA 5D8ZA 1T8XA 4CD6A 2EG8A 1KC7A 4S23A 4IPNB 3CZLA 3P60A 5CZSA 4LA1A 1UZ1A 4RL3A 3IANA 2Y61A 4H4RA 3CHDA 1JGIA 1M41A 3T1GA 1DIKA 3VIHA 1Z69A 5D02A 3P0WA 1OCNA 4XBJA 1XQLA 1RSCA 2VNCA 2X0YA 1ZMCA 4CEXC 3O16A 3BW4A 3INPA 2C19A 2XINA 4LBUA 1TV3A 3WJYA 1YTDA 2OU4A 1S38A 4PUEA 4FNTA 2P76A 1MNSA 4MZ8A 3M4HA 3LNMA 3QHMA 5JUVA 1V0KA 3AXMA 3IEBA 4DWSA 1K7EA 1GZGA 3UR8A 4IIFA 1TJRA 5HBFA 3MMDA 4APNA 3R58A 1IIGA 4ERAA 1OFEA 4ADUA 2D0GA 4E8GA 4H4QA 1ZBKA 2AOSA 3FYYA 4MZ1A 3G0SA 1ENUA 1QPRA 4PL1A 2CDUA 5E6YA 2XFYA 3A12A 4KWVA 3CJPA 3VCCA 1O5RA 2DEPA 4DZAA 3SIZA 2X7VA 4DUXA 1K7FA 4A29A 4O17A 1UUOA 2R94A 3VDBA 3PY2A 2PGEA 3SRDA 1UPMB 5JMUA 4Q8OA 4U33A 4HNVA 3NAVA 3SFKA 3AJXA 4HMCA 4GRTA 1P0EA 2YW4A 3LENA 4LRSA 3O63A 3VGEA 4GYFA 2V5JA 2KAUC 2ZX6A 5C7HA 3CBWA 3W2MA 3UR7A 1M7XA 1E5NA 1MFVA 1E1EA 4WGXA 5M03A 3GTXA 3NTYA 1TWDA 3R0DA 3SY5A 3W7HA 1EJSC 1JL8A 1QJWA 1FWTA 2QJIA 4MYXA 2V3GA 5HJLA 4F8XA 2DZBA 1ZNNA 4IUOA 4WGHA 3JW7A 3GC5A 4MOZA 1JEHA 4O0QA 5LIXX 4C6EA 2QEZA 4H4UA 2YYTA 2CBJA 1FBAA 2D69A 3R25A 1AFSA 2DZWA 5BNKA 2BVDA 4LUYA 5BYWA 3AI0A 1LT7A 3MUY1 1GJPA 3AU6A 3QJAA 2VDIA 3M0IA 4QGCA 1B3XA 3PG8A 2CYGA 2DSKA 2FLIA 3SECA 4JTGA 3N14A 1AJ0A 1NSJA 2GGEA 4IP7A 3DHPA 5HJXA 2C1GA 2FTYA 3PULA 4JTLA 3BARA 3M44A 1TV7A 3QRHA 1XIJA 4O4WA 5C2XA 3RLVA 4UTTA 1XG3A 4L1XA 3S5OA 2FKPA 3APGA 7PTDA 1SFJA 3VIKA 4JXCA 3TKFA 1PKMA 1T41A 3MO7A 3W7QA 1DORA 3DG3A 2WJZA 3CMFA 4Q8TA 2BBFA 2Z7GA 2ZUTA 4H4IA 3BLFA 3LGEA 4XZ9A 1DV7A 1XGZA 1TKKA 2WOQA 3EGJA 2X8HA 2OQYA 1TRDA 3TNOA 1XDIA 3BOFA 4HA1A 4GY7A 1LQAA 3EAUA 1QR7A 3VKCA 2YLAA 1JYXA 3PP7A 1OFPA 1VFTA 1RQHA 3KWXA 4GXPA 5FKYA 1KQYA 4Q8QA 1E9ZB 1E0TA 1WOBA 4JX4A 4NSBA 1QPKA 1SZNA 3AIUA 2NVDA 4BCEA 2EPOA 4WSKA 4MLJA 3ZXWA 1DIEA 2XU2A 3RMEA 2FB2A 4O15A 1DJHA 1IQ8A 2VC7A 3F5JA 3ANYA 1DJYA 4AD1A 5HMFA 3GSMA 1X96A 2INEA 3MMTA 4K8GA 5KVIA 1J96A 2X0SA 2A3EA 5B7ZA 3GIQA 4L65A 3R07C 2WLZA 3T0AA 3SR7A 1EUAA 5J5DA 1EX1A 1P43A 1A3HA 2XH2A 3ZJ6A 2O55A 5T9CE 4WEVX 4NI8A 5FL0A 1W37A 2C3CA 2NT1A 3BCFA 4JQ4A 4Q8WA 1RQBA 3AUJA 3WLOA 5IXEA 2FH8A 1SYTA 2NSXA 3TV8A 1XBVA 2XH0A 3NVVB 1XGEA 1WCGA 3BW3A 3W23A 4F4RA 3TU9A 3AXHA 1XIHA 1Q13A 1O1HA 1VAHA 2O56A 5EU9A 2VZVA 1N2VA 3B8SA 1MQQA 4O54A 3VAVA 3IGXA 3AIVA 4O8AA 2R24A 3LCIA 4D6JA 2VCBA 4IFKB 2NZLA 3Q67A 4W85A 3HBLA 1V0NA 3WCZA 1NDVA 4DUOA 4IIGA 3H2OA 4O8RA 4QG8A 5BMXA 1M53A 2HSAA 4H7VA 2ZX7A 4L61A 4PE8A 1X2HA 3OW1A 4QJ1A 1QHOA 4K37A 1F3EA 1DJIA 4AF0B 3BANA 2HVNA 3LN3A 3V1PA 5SWUA 2Y62A 4X3ZA 2HS6A 2WNQA 3DC0A 1WZLA 4QAIA 2E9MA 3W86A 3TC7A 3J7HA 2QUNA 2Y5JA 2ZUWA 4LU0A 5H8UA 4XB3A 4Z1YA 5DRIA 1UROA 4TMBA 2CIPA 2HXUA 2AAQA 4J2PA 4ZOAA 1BKHA 2PLCA 3U2OA 3KWSA 1R9YA 4GX9A 4JFTA 1EBHA 4JS3A 2QHAA 3UY7A 3NSMA 1ADOA 1Z42A 1RY8A 5LXEA 1VS1A 1FCQA 3CV7A 2A5HA 2ZA2A 3LI1A 1LG1A 1CNVA 3TA6A 4KEMA 3TJXA 1OK6A 1JFXA 3POHA 1TO3A 4V28A 1TSIA 4MGGA 1FWRA 2NV1A 3MYOA 2WNZA 1OWQA 1S1PA 2R1NA 3W3OA 1VRDA 1RXOB 3HQ1A 3M7SA 5G4EA 2EF9A 2BNJA 4AIEA 2PS2A 4M6PA 3NRZB 3KCLA 4ADSA 4XAPA 3FNDA 1EO5A 1RPKA 2EG6A 4DXKA 4JIQA 4HP5A 1EYWA 3FGCA 4GWEA 5IRPA 2C14A 2EPLX 3IK4A 3AHTA 4TO8A 4KH2A 1E0UA 3S1VA 2AKMA 1A5CA 2HPIA 4ZZ9A 2V3BA 1H7RA 2OOGA 2BHYA 4FXRA 5BOFA 1DPMA 4WD0A 3LTPA 3SIMA 1PZ1A 1V7YA 2EQDA 3QGKC 2XIQA 1KCKA 3AOFA 3NQAA 3SGGA 5CGQA 2FQIA 1FFUC 3T55A 4MZYA 2BXZA 4U3AA 1WX0A 3GR8A 1JZ3A 4JTDA 3N1AA 4X2RA 3CHFA 3E74A 1Z44A 2Y8VA 5I3KA 1EA9C 4IZGA 3VIMA 3ZSTA 2GK1B 2RDTA 4H7ZA 4B9YA 3GRTA 3LHUA 1D7YA 2PDKA 1RJRA 3PNZA 3WMCA 3LCFA 3KL0A 3WF2A 5K9CA 3G1XA 3BGAA 4H4WA 6PTDA 3ABSA 4PTVA 3LV6A 3VKAA 2E77A 4S3AA 3H70A 3CGEA 2Y2WA 3H2NA 4EQSA 3R1ZA 1XSKA 1A5BA 3EF6A 3M0MA 3KOZA 1YDOA 5U1OA 2JBMA 1HO4A 1OFAA 1KXHA 5HWMA 1YQ2A 4FPSA 3HN3A 2ZUVA 3QHNA 3WLMA 5BOEA 1H09A 5MKGB 2OYMA 3S2CA 3TYEA 1F6PA 1JCNA 1UWAA 1Q4NX 1LJYA 2GVYA 5TR3A 2R1MA 1M68A 3VOHA 2ZC1A 4PRWA 1F76A 2RGLA 4S2CA 2DGAA 2PF0A 3AXXA 3S8HA 1HGWA 2CWNA 4ZA0A 2NUWA 3BXWA 4EAMA 4ZOEA 2G50A 2BGNE 1MRAA 1SZEA 5EMJA 2PTZA 2OQHA 2TPRA 1RM6B 3QPYA 3HIJA 4D71A 2ATSA 3WLLA 1LQ0A 3U8GA 2OMAA 2EQ7A 3OQEA 3ONBA 3QV6A 1FCVA 4HNLA 1UA3A 3L5MA 1E70M 1JUKA 4IMGA 3QF0A 3LLDA 2RH9A 1UWQA 4JNYA 1NH6A 2IKJA 1H3GA 3N17A 6XIMA 2FFCA 2AAMA 2QYGA 3S5ZA 1TREA 1Q6QA 4LF1A 3O0HA 1UWIA 2CLOA 3DDMA 4S1FA 2FMOA 4K8HA 4ECLA 3BQ5A 4UTMA 3RR1A 2OXNA 5AZ0A 5GRTA 2OFJA 4AXKA 2WOWA 1Z3NA 3WK3A 3UWUA 1HKKA 5CJMA 1GZJA 4P2VA 3WUFA 3ZS4A 2DIKA 1OQFA 2PU1A 1UR4A 1UP0A 1BWCA 1R2SA 1PUDA 1A47A 4L1GA 2E1WA 4GQ0A 2ZUNA 4NZCA 1SSGA 1VFHA 3IIOA 4XD4A 5FS8A 1MVYA 1FX6A 1N8IA 4J56A 1ZFJA 3BMXA 1PXGA 4H04A 2H9AA 4BF5A 1E3XA 1Q2RA 1POJA 4GACA 4IIBA 3TYBA 1VHCA 1I6NA 3ARYA 4I5UA 3L2IA 5KVHA 1H41A 2GR0A 1TIWA 1JIBA 3C2YA 2CLIA 4TVCA 5LNVA 3O7UA 3CGTA 3WX7A 3UG5A 3DC8A 3TTOA 3VE7A 3GWQA 4TTUA 1R3VA 2Y24A 4Q4PA 3E0FA 4A22A 3S6OA 2DP3A 4JIRA 4ZB0A 3CC1A 5AC6A 2QAEA 3RPMA 1XISA 4TU1A 7ENLA 5AYZA 1JPKA 1KFLA 1FY6A 1LL7A 2H3BA 3D9XA 4L9ZA 5G5IA 2C91A 2CFYA 4X22A 1CWYA 4YWSA 2ZUUA 3XINA 3P81A 1EC7A 2E6AA 1RK5A 4Y90A 3TOYA 5LA1A 3UU0A 3G77A 1SJBA 1XLBA 1ZBWA 4KT2A 1TYPA 1OIFA 1RZMA 4AFYA 1CXEA 3UZZA 4UQCA 2YL9A 1O94A 1ISVA 1BTMA 3SQPA 1NTHA 3KTCA 3KBWA 3LSBA 3P5YA 1NOWA 4B91A 2OJPA 3NEHA 3UYCA 3C6CA 1TZ7A 5EGRA 1YBQB 4OKDA 1U5JA 2WK2A 1Q6DA 1X97A 3LXBA 2W0UA 4GFSA 3CGBA 3R6IA 5AVHA 4QEHA 4NRRA 4JDBA 1GG1A 1UR2A 2FPVA 3HRDC 3N25A 4EXAA 1ML1A 3M0ZA 4R7JA 1IGWA 4BJHA 3DKJA 3VMOA 4S3EA 2YYUA 1IV8A 1OCBA 3UEQA 5A6BA 4GZJA 3EWWA 3O3RA 1LRQA 1SFTA 1V6XA 1WNOA 2ZDSA 3IUDA 2GOUA 1ZTVA 2QAPA 1X8CA 2IUZA 4QQUA 3FA3A 2VFEA 4GUGA 3Q37A 1OABA 4O0KA 3H2EA 3N73A 1GVOA 1XW8A 3RM9A 3CPGA 4DBEA 1WBJA 4XZBA 5HANA 3WBYA 3WBXA 1TIMA 3L4UA 3EZ4A 3M1ZA 2ZWZA 2F84A 4YJ5A 1TX0A 2DJXA 1KBKA 4AD4A 2GLKA 4G1NA 3WLSA 4MWAE 3FKRA 2G3NA 4CVWA 4R5EA 4GINA 1IHIA 2QV4A 3V3WA 4U31A 4U2ZA 4RE4A 5IDZA 3DZ1A 4PA8A 3GZAA 4P7OA 5DQPA 2NT0A 1VZWA 4KCVA 4CGTA 2XWDA 5HJYA 2DORA 1NM9A 1XH2A 2QF7A 3W7GA 4DX3A 5C9WA 1A0DA 4JN8A 5KETA 1NEYA 2BY1A 3IACA 1L9WA 3MSDA 3R43A 2ZFAA 1F3PA 1TV4A 3T2QA 3AMGA 3FK4A 4ZQRA 5CSUA 4Q3MA 1DJWA 3LV5A 3T2OA 1FEAA 2YW3A 2WYSA 4IISA 4OJYA 5ER0A 2VM8A 1HUVA 5M2FX 2DT2A 2CZFA 3S1UA 4LS1A 2ISSA 2QCFA 4NAEA 2YOCA 3CQJA 1KRMA 4KERA 1PVNA 3UERA 3O0FA 3HQPA 2D23A 1F3XA 2DT1A 4ZCWA 1R3QA 4TUFA 2OSYA 4Z2GA 3CZJA 3QVQA 1CB2A 3OLGA 4JHMA 1F61A 3OVPA 4HCLA 2VELA 1LLOA 3CUGA 1SFSA 3W76A 4J57A 3RDKA 1JCYA 2TPSA 1FHDA 4PMZA 7XIMA 1Q6OA 3FYOA 1L6FA 4C1LA 4DRSA 1Z6KA 4ZB2A 4WSHA 4TTGA 3DXIA 2PURA 5L9FA 1E6QM 1KBIA 1SW0A 4W4QA 3KX6A 1CT5A 2PDIA 1XWYA 2Z00A 1Q1WA 3N3TA 1QASA 3H7UA 2ZIDA 1Q2SA 4Y9OA 3V36A 1G01A 4FX7A 1O60A 3TJ4A 1SB3B 2V5BA 1CGWA 4LY8A 3WNKA 5FJRA 2INFA 3K8KA 4HT3A 3OA5A 2EEXA 4XD5A 1OD8A 4G7EB 4IUGA 2C3DA 3SCNA 1TCMA 1QDSA 5AYYA 2IKGA 4YN5A 1XI3A 1HO1A 1LROA 3BAIA 5FF2A 2E6FA 1VIWA 3M7WA 4GG9A 4JHOA 3UETA 1YXYA 4GCXA 1AW5A 3CNYA 1Q7QA 3WD3A 1MXGA 4N7QA 1YPFA 3WELA 4UZUA 4J3SA 3SN4A 2WMFA 1MMFA 1Y7VA 1E6PA 1TPVA 3MQTA 3OA3A 1KBJA 3UWQA 4DO6A 4DNAA 2VOTA 1J0JA 3EWXA 2EPKX 1TMLA 2EKGA 1L0PA 2O4MA 4DJED 3KL3A 1TFVA 4IFOA 3BSGA 1R9ZA 2P50A 4AG0A 3FY1A 1NOFA 3TYZA 2OR2A 3SUUA 4PCPA 5G1MA 5CBIA 3FEQA 1V77A 1XCFA 3W22A 2ZX5A 2JK2A 1YDYA 4OUIA 4RK8A 4Y6GA 3K4DA 1VYSX 2ZOXA 1WKEA 1QWKA 4L4OA 3OVRA 1NWTA 2GYIA 2YLLA 3R0UA 3A22A 3KOWA 4MUZA 1E4NA 4J27A 4XIAA 4LIIA 4AD0A 4GYPA 4NJHA 1VJIA 2XVPA 3V1HA 4I6KA 4PCNA 3K30A 3KP0A 1HVXA 1WOAA 3LX9A 4AZ7A 8TIMA 1GVEA 2QVNA 4HK7A 4JDRA 2ZXDA 3CQHA 3U48A 3E6EA 5LXXA 1EPXA 4NKCA 2GR2A 3ZJ7A 3LBCA 1XF0A 1NQ6A 3W1RA 4ZO8A 3JU2A 3QGVA 4XUYA 1IEQA 1DWAM 3M5YA 3RX2A 2J8FA 3CT2A 1E9IA 3AMZA 3BL3A 3UJEA 1DVJA 1E6NA 1GEQA 1ZGDA 1NDZA 1P1MA 1SZGA 1QRQA 2RHGA 2QW5A 1NHRA 1RCOB 2VO5A 3GRIA 3NGJA 4NL1A 1Z32X 3L66A 1WDQA 2WXDM 4IG2A 3CT7A 2V3DA 2E28A 4LXFA 3BV4A 1VGAA 3VGHA 4WOQA 4DF2A 4PBFA 4OBSA 1AG1O 4A4AA 4WKHA 2B4GA 3JR2A 5HDRA 3WK1A 1YX1A 1KM6A 3LHZA 3VA8A 2RAGA 1NFGA 1ONWA 3SCVA 4UCFA 4S3DA 4L64A 3MKKA 4M51A 4HU0A 3OZYA 3QBUA 4LAUA 2H6RA 2WSPA 3MHUA 3ARZA 3CB8A 2VRJA 3AWNA 4HTBA 1HIZA 4AC1X 3CGCA 2I9EA 4HA4A 5FF7A 1VPXA 1M5WA 3RIKA 3APTA 2UY5A 1M7JA 3S5YA 4HSHA 1XXXA 4AYGA 3HMJG 2DUXA 4YWOA 1P4CA 4EXQA 2E6YA 3F4CA 3GNRA 3L21A 1SZFA 3NJ3A 2FVKA 5CZKA 3M6YA 3LPPA 3G1FA 6REQB 4JTKA 2F2HA 2HTMA 1XLCA 1B3ZA 3THCA 1QW7A 3ANVA 2R1PA 2A8XA 3R11A 4XAFA 3K8MA 3AQUA 3WN6A 1N8WA 1GETA 1M04A 4H2HA 3WNPA 3WF3A 3ZJKA 3AS2A 1RBAA 2REQB 4WCJA 2GJXB 3VTRA 5B7YA 5M1TA 3GDMA 1ZRQA 4XAZA 3QZEA 1GORA 5JIPA 4HKPA 2VI0A 1GW1A 3O1NA 1EJWC 2PC8A 5A8QA 2NLYA 3TFCA 4H9VA 1IXOA 3G24A 1W1IE 4LAKA 4MY9A 4C90A 4MKSA 1UMLA 4IT1A 4FR6A 2BLEA 1OG6A 4MUPA 1Q63A 4Z0JA 3FDKA 1MZHA 1ZU8A 2YJQA 1VR6A 2X40A 3ZOAA 5D4YA 1EDQA 3BVJA 3PAOA 4GUFA 5AHEA 2ISWA 4JEQA 3E2SA 4PCFA 4CCCA 3TOPA 3LHTA 1E4MM 5ECUA 1O66A 4A3YA 3HFYA 5D37A 4F0SA 4LCRA 4FSAA 4ZBCA 3VOFA 2NQJA 2OVLA 3GDLA 1FWGC 3GS6A 3RLHA 1WXJA 3FSTA 2D1ZA 4QXIA 3WF4A 2GGJA 4JTIA 1JQVA 4JKMA 4DM2A 4NHVA 1FP9A 2C8NA 3RU8X 2IPJA 1KM0A 1VPYA 3G5EA 1VF8A 4PSPA 3GY1A 1EDTA 4XG1A 3QSRA 4CD4A 1OBAA 1IXPA 5MHBA 3STEA 4JX6A 5H6HA 2J4GA 3OBKA 2KZHA 2VENA 3DGZA 5CPMA 3KP1A 3HURA 1CB7B 5A69A 1UQZA 1DL3A 2XSBA 3OLDA 5IHRA 1I45A 2ZZ5A 3EEGA 1ALDA 2PDNA 1XYMA 3W81A 4G56A 3VNMA 2A7RA 1FO4A 1ZALA 3UP8A 1W9UA 2AAAA 1E0VA 5HA7A 3KAOA 1SO4A 2PTXA 1YDNA 3GNXA 2QUTA 4PB4A 3R5EA 4B5UA 4GZIA 1PO9A 4BQ2A 3W1QA 4A3RA 4M7SA 1C90A 2XIOA 1EWEA 1WBHA 3NG3A 5C2GA 4H4XA 3RCNA 1OY0A 1TJ0A 1E6SM 4GJJA 2YKKA 1GGOA 4LC8A 3R94A 1FHUA 2C13A 3TAOA 2A85A 1JR1A 3U57A 3BV7A 1XSIA 2R91A 1AW2A 5HMDA 1X6LA 3LCWA 3TSDA 4ATDA 4AZ5A 5GNXA 4JDYA 3PHAA 1P0KA 3B8UA 4AEOA 4KCTA 4UXDA 3ID7A 3WF0A 3WUEA 1X1ZA 1KD0A 3QC3A 3C5QA 5KTLA 3GHUA 3FA4A 3VGGA 1TVNA 1TR9A 3W84A 2ZYFA 1FWCC 3SUWA 4WSJA 3NYZA 3A3HA 3POCA 3KOFA 1Q4WA 4LANA 5D9PA 1QK2A 1HF6A 4B3LA 3UZJA 3VDCA 1HKMA 2AGTA 4LNYA 1JZ6A 3L7RA 2WQDA 4PMYA 1GKPA 4UZSA 4LVFA 3NDZA 3VILA 4MPQA 3GO2A 3TONA 3NVWB 2PRHA 3GG7A 1J6PA 3SCRA 3S46A 3G1AA 7A3HA 2W3ZA 3VD3A 3FHAA 3DBNA 2NWRA 3DG6A 4EX4A 3A23A 5BCAA 5I79A 2Y7DA 4MJMA 3IPWA 4NVTA 4PMRA 5CLWA 3P84A 3M6DA 1KM4A 2VYOA 1OINA 4MHBA 4DAIA 4JFSA 4ENLA 1ODZA 2A4AA 2FZ9A 2WCGA 1TJ1A 1EKOA 4DM1A 2X09A 8CGTA 4NNCA 4CCZA 4EM3A 1W5QA 2F2KA 2VRQA 4RXFA 2QGHA 2HNHA 3WQOA 1HT6A 3M0JA 3F1QA 5A6SA 3F2CA 4FNQA 4HD5A 5CPQA 3BJSA 3W24A 4H6EA 2XFWA 3A7RA 1WA3A 5A1AA 5HQMA 2V30A 2EXOA 3MMUA 3RX3A 3E1F1 3W2LA 4NXSA 1YADA 4ZE4A 2JK6A 4ZFMA 2FJUB 4X2PA 4BZYA 1ZCCA 3L2LA 3MTWA 1B0IA 4ZR8A 1S39A 2SFPA 4DI9A 4HJWA 1E9LA 1P6BA 2FGZA 2X1IA 1H4PA 1LOLA 3LNPA 1B57A 1BQCA 2WZHA 2CFFA 2NXGA 4GNVA 3WKZA 1D7FA 3TX9A 1XH0A 4MADA 4MB5A 1OFRA 3ERPA 3KVKA 1W1PA 1DQWA 1LUCB 4QLJA 3KTSA 3B4YA 3A6OA 2OYKA 3WJZA 2DVXA 1XG4A 1EJUC 1ZXIC 3TXVA 3VC5A 1HJXA 2CCRA 2VX5A 5M5DA 1FHVA 3AMLA 3NR0A 1C3FA 3IC9A 1KBBA 4W7VA 3KRUA 4XX6A 5G1TA 3VFLA 3IIVA 2AMXA 3RCYA 4YLWA 4PODA 1Q6FA 1UASA 3N2OA 2PB1A 3CWOX 1C8VA 3DK8A 1S46A 3T0BA 5AYXA 3SN0A 1ITUA 1XPGA 1XDJA 3N2XA 1WKYA 2PTDA 4FX9A 4FOKA 4QITA 1EXBA 3SCOA 2OX4A 3MUCA 3DH9A 2VEPA 4PB5A 3I10A 1KFCA 3PJXA 5DMLA 5E93A 4IJRA 1D3HA 2XSXA 2X05A 2ZQ0A 1E40A 2PWHA 5DX7A 4GKTA 1WYGA 4L4PA 3DOPA 5A6KA 4DWDA 3ZZ1A 5BRPA 2YA0A 4U3CA 2PAJA 3CXBA 2Y7EA 1Y5XA 3BLEA 1S5TA 1B5TA 2ZICA 5AY7A 5BU6A 3U5UA 2E40A 3L0NA 3BE7A 1QUMA 1ZK7A 3W7KA 3MP4A 4EPBC 4UNLA 3URQA 3SRHA 1TA3A 1F2JA 4OUEA 3PZQA 2CPUA 2WLYA 3URBA 3MA8A 1BLIA 2G3IA 1JUBA 3O6AA 4GVIA 1IWAA 3G6MA 1AUSL 3A7AA 2V6AA 1FWDC 1S2VA 2OQLA 3L2MA 4NX5A 1GOMA 3EWYA 4MWAA 3C0QA 1OB0A 3GAKA 1RBOB 3HV8A 3P8IA 3CPUA 3WNMA 4YL2A 3TE9A 4ROQA 3Q58A 2QPSA 4C1NA 2WPCA 5J8LA 1R5YA 4M24A 2XVLA 4M1BA 3UGRA 1GZ1A 5F2IA 4DYKA 3N34A 1U83A 4H9ZA 3V0TA 3E12A 3JRKA 5CC6A 4CEUC 1DWGM 3I4EA 5AC4A 2E3ZA 3TC3A 1JGMA 2XISA 4IGSA 3TDFA 2E4TA 5BXSA 3GU2A 2VFDA 3CQKA 2YDSA 2VQUA 3QKZA 1OJXA 2QIWA 2XH7A 4G1KA 1O95A 3OQ8A 3R8RA 4GPNA 4JTSA 4QROA 4IQDA 4K2SA 4UTUA 3WF1A 3IIZA 3TN4A 3A24A 3EA1A 3C61A 1F74A 3NCOA 2XHYA 3WLJA 3RMJA 2AMGA 2IKIA 3NO1A 1QAPA 1VC4A 2DVTA 4CQAA 4O14A 2AGKA 1RD5A 1XBXA 3NWRA 1SR0A 4DPQA 4AYSA 1I0DA 1U5HA 2ACQA 2XFFA 4KFOA 2O0TA 1XDLA 1D7KA 1VENA 3KFTA 2V69A 4QCFA 5GJPA 3VIFA 3WMLA 2VX7A 1UJQA 4XWUA 4FALA 3VNIA 2EGZA 2WHLA 3DUGA 3RR4A 1FUYA 1BVNP 4INFA 4TX6A 1RK6A 1O68A 4FR1A 4WDWA 4L6DA 1R3YA 4LEQA 4DBWA 1FCBA 5K3VA 3T9PA 2CHRA 2J7EA 4V33A 1BYCA 3CZGA 3H4KA 1NJJA 1VJSA 2G96A 2QMJA 4TVDA 4GVGA 2PDLA 2ZTJA 2PDHA 3MVIA 4NAFB 1IF2A 3OGSA 3SJNA 4UNIA 2Y1HA 2OSWA 4F0HA 3P61A 4Y9PA 5JBEA 3NQMA 1QNSA 3ITXA 2IPGA 2OLAA 2ZXAA 5DANA 3N4AA 3RJYA 4E2VA 1XFBA 1JI1A 3PANA 1CW2A 1JAKA 3UWWA 3PBVA 3OVQA 4HSNA 4J3UA 3VX0A 2BMBA 1HQTA 3BMVA 1F73A 1KW1A 2CEQA 3GW3A 1DHPA 2NUXA 2Z0IA 3HG4A 3BLIA 1JZ7A 2BV9A 1BWVA 3W7LA 3C8NA 3NQ2A 1ZX9A 3GW0A 4O1EA 5D2XA 5I03A 3OHMB 4J2MA 4F0MA 3FJ4A 4FLSA 1QNOA 3MI2A 3VFCA 2WMIA 4I3GA 1E1CB 2Z27A 1PZ0A 1HJVA 2DSVA 2YL8A 4PZVA 2I5QA 4RKAA 1G69A 2ZC8A 2C1IA 1N61C 1PWLA 3WLNA 2H90A 2QNEA 5A2CA 1DWIM 1DWJM 3NUKA 2ASHA 3MZ2A 3SCTA 3DU0A 1XANA 4ICNA 2UY3A 2DSZA 4WY0F 2Z6IA 1BRLB 3W4RA 1AOGA 1CI1A 2BXVA 3WIJA 4H4YA 1IYXA 3NDOA 2CLPA 3FJ6A 3NZGA 3BLPX 3H23A 3NQ8A 3D3AA 1DTNA 1S2WA 4RZ4A 2ISVA 1WKDA 4JTJA 3QFBA 3M46A 2G3FA 3IGUA 1EP3A 1P7TA 2J7HA 4XVEA 2V6OA 1KM3A 2E5CA 2FDMA 1B9BA 3KTXA 1C7TA 4W86A 3W6MA 4ZQPA 2ONEA 2YQUA 1T6MA 1C8YA 4IGHA 4R85A 4MLRA 4KF1A 3V0SA 3VIGA 4GKLA 2WJFA 4RZ6A 4ZE5A 2P5NA 4HCDA 3LU2A 4C6BA 3HPFA 1TUXA 1LM1A 4Y9MA 3H6OA 3KW3A 3W7OA 5EBAA 1ZP3A 1CIUA 3W7MA 3PZUA 3GRSA 1TYGA 2NSOA 4V1YA 2W66A 2VJXA 4LGXA 2QCDB 3EDJA 1EBGA 4H9MA 3RILA 1UKOA 2F6XA 1N5WC 1FQ0A 1OC6A 1BF2A 4UTHA 6A3HA 4IPJA 4BURA 3HA1A 5JU6A 1TPC1 3UPBA 4L80A 1XLHA 5AKQA 4AX6A 1LTDA 3H55A 3GXPA 4GUIA 4ZGYA 4DY1A 3GDKA 4G6CA 2E5BA 2Y4SA 5K9DA 3QPZA 3TXZA 2BASA 1OGBA 1KRCC 1M01A 2VTFA 3BGGA 1KKRA 4UQDA 2OG9A 4QSFA 3QR0A 4AB4A 1ISWA 1DJZA 4NNAA 4GISA 4V27A 2YL6A 5BW6A 3ZWTA 2PPGA 5LZLA 3W7IA 2VUYA 5BXPA 2CW6A 1X6UA 1ODUA 2Q02A 4C6MA 1RHCA 1SQ7A 3D3FA 2F6KA 3CUFA 5AHMA 3U2EA 1PV8A 2Y7FA 4YTQA 3L12A 5KSWA 3QFEA 1BAGA 3PFRA 5BZAA 2HV5A 1K77A 3W1XA 1A5SA 1GESA 1FWEC 1Y5VA 3UJRA 1XD0A 2O9OA 3K8LA 4J1OA 5TBOA 5LNWA 4X61A 5C2CA 1VEMA 5DEZA 4N4QA 2RDXA 3L9CA 1C93A 1V8EA 3BK0A 2Y70A 1XUUA 2V82A 1EB3A 2V38A 3MPGA 4UR9A 4CNTA 1TPB1 3MJMA 1M6IA 3CWNA 4DJEC 3NQ6A 1GVRA 4P8UA 1KKOA 4CNNA 1EXPA 3AALA 4MB1A 3W2UA 3MHFA 2WANA 2WPEA 3L67A 1S7MA 3VD5A 4LW7A 3DYMA 3ENLA 1NP0A 4OHQA 5D2VA 4JNZA 5DY2A 3NA8A 2WNNA 1D8WA 2HQAA 4C6IA 5A6JA 4QBXA 3ZWSA 3UZXA 1CECA 4O0ZA 3TTEA 1J5TA 3SRFA 2BB0A 2PC4A 2A3HA 4KBXA 4AISA 1DBTA 4EXBA 1DQUA 1EEPA 2DSUA 2VEGA 2YCKX 3MS8A 2RJHA 5H2ZA 3T2PA 4J28A 4LRTA 5LKYA 2W91A 3OBEA 4I8DA 3R10A 4YHEA 4ZQMA 1IT8A 3GXFA 3WDHA 3VIOA 1W3JA 2CHNA 3TQKA 5GJNA 2C6QA 2VOMA 4DYJA 2FMNA 2Z2UA 1T5AA 3BAWA 1QOXA 1XH1A 4EPDC 4JCLA 4R9OA 3FIGA 1S2TA 1EWDA 2BGQA 2Q8XA 4PN2A 4RXGA 4C6LA 3R13A 5M3WA 1GJUA 4REQA 4LV4A 4DVOA 1ZS2A 2XTKA 3AIBA 3DX5A 3N04A 1EIBA 4QEEA 3WK2A 4OV4A 3GXTA 3DH7A 2V67A 5D03A 5CJ5A 3CYVA 2BX7A 3C8FA 2E9LA 2W6RA 4JIIX 3I65A 3CHEA 3UXAA 2CLFA 1A5OC 1PEZA 3K1GA 3WH6A 1LT8A 4DBSA 1I75A 3DI0A 4D6CA 4RV8A 3VGDA 4XVDA 4XBSA 3ARSA 4KS0A 2WZTA 4TVUA 3N4EA 3ZLHA 1WB0A 1IXNA 3ARRA 5A8GA 9XIAA 1TPDA 5FMHA 1BEUA 1PSCA 5JCKA 5I3FA 1RVKA 3GC2A 3AAMA 4F0KA 5I3GA 3DYPA 4DLMA 3NPXA 3FX4A 1I2PA 4NJKA 3AZSA 3F7JA 3CASA 4Q4QA 1JDEA 1ADSA 1EHNA 1VFMA 2V81A 5E1QA 1EJXC 1ITXA 3ZT7A 3PWGA 4UCGA 3ZR6A 1XSJA 1X98A 3PBUA 4MMWA 1NHSA 1JPMA 2J8GA 3NO3A 3TYCA 1XICA 1OYCA 4UB9A 3SI9A 1KTCA 4BI7A 3TR2A 1FFQA 1E55A 1U33A 4LAZA 1JAEA 4CN6A 5DCDA 3JVAA 1VCGA 3LYEA 4M7TA 4P7NA 5DXYA 1MEHA 1TPH1 1QO5A 4AW7A 4TIMA 4J9JA 2OWWA 2D20A 2J7CA 1VYPX 3WNNA 3P0XA 4KESA 2VFHA 2E67A 2FJKA 1MW0A 4AX7A 3PWIA 1R87A 4Y96A 3QYSA 2OODA 2VEIA 4E2OA 1S5WA 4D72A 1DE6A 4M56A 1LLWA 2BFGA 4XTDA 1UR3M 3V5OA 4FNUA 3HMCA 2QJMA 4RV3A 5TD4A 5E0KA 3BSMA 3NOYA 4FMVA 4DI8A 7REQB 4XKYA 3PUEA 2WHJA 4AUBA 2PDQA 1J6OA 3PR2A 1IEIA 3T44A 4E3VA 2G37A 4GQRA 3W9ZA 2I16A 1H63A 3STGA 2FVMA 5U4NA 3GKAA 4GCAA 1WDWA 1PZ2A 1A3XA 3TW6A 2O9RA 4KW2A 3R7MA 3NQGA 1H49A 2V3EA 5KZMA 2GGHA 1DXFA 3NSNA 3W1TA 3P82A 2XPKA 3U3HA 1N62C 3QR1A 1NELA 1BXBA 3NFUA 4NZ4A 3ZFHA 1CGTA 1LCOA 2V5DA 4DO7A 2AL1A 2YXOA 4PMJA 3L4ZA 5JVLA 1O6IA 4PUUA 5DF0A 4GH3A 3ELFA 3DFYA 2XUCA 3W74A 2W3RA 3WQGA 4P7QA 5I00A 3PPCA 2YDRA 3AHXA 5JBFA 1GEUA 4YXGA 1ISYA 5FD0A 4PBEA 4DJDA 5LNUA 1OT2A 3HQOA 3SCQA 4L1WA 3C3NA 4KKXA 2GSJA 3OLIA 4NYUA 3ITVA 2Y85A 5G2WA 4DO5A 3FSUA 3C56A 2QJNA 1Q5MA 1US2A 2ZA3A 1KGWA 3EWBX 2GVJA 1CLXA 3P8JA 1V02E 2DY3A 2Z1VA 3WLHA 3UWZA 3ATYA 3TW7A 4A2RA 4WY0B 2W0HA 5AC8A 1EFZA 2VDGA 3JUGA 3VCNA 3E5BA 1UUMA 2WSRA 5FL1A 3NQBA 4FX6M 1AA1B 2ZZCA 4ZQNA 4HYRA 3W07A 4H2CA 1W32A 4HHMA 3R89A 3PJTA 1MUCA 3W27A 1KLZA 1O5KA 1ZJHA 2PDUA 1YMYA 1ZUAX 1TR1A 1XR2A 3CAKA 5I3HA 3KBVA 4LVAA 4CKQA 1RALA 5FSEC 4HPXA 3E2VA 1FH8A 3NM1A 4QS6A 3PG9A 3LQGA 3YPIA 3TNBA 4P7RA 4DNMA 3B9JB 3P14A 3CH9A 1K8YA 5E9XA 1KGUA 4EANA 5CZ0A 2PP0A 5CC3A 3PB2A 3OZPA 3ATZA 4B92A 4ONVA 2TMDA 1MSSA 3RG6A 4O28A 3M41A 4LALA 3A47A 4R88A 3H7VA 4MVAA 3PG6A 3EDKA 3ES7A 3GXIA 4HMNA 1GRBA 4E2DA 3W73A 2QKFA 3IWPA 3S1XA 2X16A 3FAXA 2QCLA 4GIYA 5I24A 1TZ9A 1OEPA 1XYCA 1W9XA 3VZXA 1QVBA 1UH4A 3UJSA 3UJ2A 1I1WA 2GOKA 1YHTA 1A5KC 4E4FA 3FJNA 1K1DA 1K8ZA 5G4HC 1I9CB 4LNCA 4IXXA 4NILA 4C60A 1FWBC 3HM7A 4HYVA 3W01A 1EZWA 1SJAA 4WVXA 3OHIA 1F3WA 2GVLA 3W1UA 4AZIA 5A8PA 3TQ0A 4BWLA 1TRIA 4EM4A 3F4WA 2E8ZA 1F8WA 3WNOA 4JQ2A 3CLWA 5TAOA 1XLDA 4WDUA 1S5MA 1V6TA 1DNCA 1N8FA 4LEFA 3QKEA 1NQKA 1PE1A 4LVGA 4CU7A 4L6OA 3C0JA 4GIAA 2C3ZA 3LSCA 3MBFA 4GI6A 4M52A 3F4VA 3N12A 1QPNA 3OC4A 3CL6A 1P1XA 3B03A 3LCXA 5FA5A 4CN1A 1MQPA 3H2MA 1W0MA 2ZUMA 5A6AA 2ZZ0A 2CERA 3O0KA 1L6WA 2I5GA 4KRTA 4O11A 2PBGA 3NQFA 3BICA 4KMQA 3TQPA 1EBDA 2QVHA 1TV2A 2B7PA 2VEFA 3STPA 4CCEA 1AD1A 1OC5A 1MRQA 1YXDA 3KZSA 4UQEA 3N29A 2P3EA 3KBJA 5FI8A 1GRHA 3RN6A 1YEYA 3TN6A 1TMQA 3EKLA 3QHOA 2B7NA 4S39A 4I9AA 1W5OA 1X1NA 1QI4A 4IFKA 4LVDA 2G4FA 5LIKX 4I7VA 1ZPTA 3VX1A 1RP8A 4F2UA 1WAUA 1FHLA 2FYMA 1PJ9A 5FF3A 3DGRA 3DN5A 4V15A 4LS2A 1H50A 3ITCA 1MUMA 3HGRA 2VL4A 2PEVA 2ZZ6A 1M7OA 1EGZA 3E2RA 3EXTA 2JALA 3QY7A 1ZDLA 4R3UA 3O6DA 4IOTA 1B4EA 1V5XA 4AF0A 5ENLA 1XBZA 1XS2A 4ZOCA 1QNPA 3EOOA 4W87A 2J7BA 1E6XM 3CV1A 4TXEA 3UESA 1ICQA 1M03A 2V63A 2HMCA 4ZQCA 2QPXA 2QXWA 2PLKA 3W1PA 4AZGA 3IARA 5ABEA 3W7NA 1R47A 2J78A 1GYMA 3VD4A 1ZENA 3M64A 1XLMA 3U0HA 5ECVA 4X9YA 3V35A 4ZENA 5E6ZA 1GKRA 2E7FA 5DMYA 3AS3A 3UJFA 4F2TA 1XPYA 2DPEA 5JCNA 1EGVA 5JH1A 4Y9AA 2FHFA 5FS9A 1WZAA 2D22A 1I1XA 5D04C 1R9XA 1BXNA 3A3XA 1CYGA 4U5KA 1XFCA 5C0QA 1J4EA 3IRDA 5EA9A 1V3KA 3N2CA 3QZAA 2WC3A 5HK4A 1JZ8A 4AD2A 4LFYA 2WSYA 4JN6A 1D3CA 1DP0A 1FWAC 3MYPA 1XYZA 4QHRA 1SO6A 4AVFA 5A2BA 1ZJIA 2OEKA 1X8FA 3HU7A 3NZQA 4ZVJA 4C6NA 3AHVA 3O6CA 1XDMA 2ZBTA 1GVQA 1V51A 1L2UA 1NF0A 3O2LA 5I2UA 1A5MC 3W37A 1XIMA 1OIMA 1UZDA 3H4GA 1BFNA 1H60A 1H1NA 1JF5A 4TV6A 2Y5SA 1P0BA 2VRKA 4C7GA 8A3HA 1K9TA 1FVPA 4CLMA 1JZ2A 3OOQA 1W3LA 3AWOA 1MQRA 1TX2A 1BYDA 4MF4A 4Z1DA 3VVGA 1SGJA 2XM1A 1XV8A 3TTQA 1ZAHA 4UFHA 2I14A 1EJ7L 3GZ3A 2O9PA 2ACSA 3KUMA 1X6NA 4EP8C 2V0TA 1XYBA 2A6NA 4EWJA 2PTWA 3UCQA 1TTIA 1MZRA 3WH9A 1WYIA 3QV7A 3DCPA 1NFBA 3W1LA 2FIQA 3GH4A 1GONA 3W53A 2OWCA 4PSRA 1IEWA 4H50A 2YDAA 4XSMA 1OG0A 1W3HA 4LX4A 1EUNA 4D6IA 2HEJA 2PGRA 2ZRZA 4PTDA 1W1A1 3QY8A 4QTGA 2GK1A 3VNZA 2GJPA 2POTA 3WY1A 2D2JA 3PUDA 3AHYA 3N6HA 4YWIA 2B81A 4U28A 1JD7A 1POKA 3M0KA 1JRPA 4H83A 2W62A 2R9RA 2DQXA 3KLLA 1B4KA 1SJDA 4WZHA 2TAAA 1ME9A 2FTWA 1UD2A 1ME8A 5BXTA 4W7WA 4AIOA 1GYNA 4WDTA 4DXVA 3WJWA 1V6UA 3ITYA 3SO7A 2VD9A 3WD4A 4LWWA 5MKGA 3HFTA 3KOYA 3QZ6A 3TEVA 3QH2A 3SURA 2J47A 3LM3A 3TW9A 4U4MA 2YDQA 2X8CA 1HJUA 5EFDA 3W85A 2E25A 5GJMA 4S3GA 1C7SA 3MCNA 1IXQA 3MMWA 4MTVA 1OX5A 4H8NA 1H7NA 3N2BA 4Q32A 3SGZA 2NUYA 4U10A 3IJIA 4KWSA 3A4WA 3G6LA 4GABA 3TAKA 3VO0A 2J6VA 4IJBA 1W8SA 2GFTA 3GBDA 2W63A 1R6WA 3B0UX 3CUZA 1UWSA 4OFCA 1AL8A 3IVSA 3NVYB 1TPWA 3GUGA 4L5ZA 5FIPA 4P7LA 2NQ5A 1LBFA 5ABFB 4Y8EA 1L6SA 2PCQA 1E0WA 4H3DA 3LXCA 3MKCA 2YCJA 2GRTA 6TIMA 1UC5A 4O1DA 3HOJA 3BURA 1MW2A 4GIRA 4QIUA 3LXDA 5CG7A 3THUA 4DO4A 2HS8A 3USBA 3MW7A 1MEWA 4BQ3A 3L0GA 5DCEA 4UTIA 1CDGA 3GVWA 1FIQB 3T81A 3WFLA 3P3BA 4PTWA 4AIUA 1H5YA 4QAWA 1AZ1A 2J9YA 2JGQA 3C2OA 1TELA 3QFAA 2WSKA 1XLKA 5CPSA 5D09A 2PRMA 3HPZA 2Q09A 1ZP4A 3N9KA 3VC6A 4MWAD 2FPTA 2YIHA 1Q3NA 4EPEC 5E0CA 4I7WA 5FJIA 2WWDA 1GXFA 1GPFA 2NW0A 1GTHA 1RA0A 4GBDA 2F61A 1W1ZA 1VBJA 5JCMA 1K4GA 4TX9A 2VR2A 3DFSA 2DV0A 4LYRA 4WJEA 1DJGA 3QR3A 1UR1A 4UOJA 3AROA 3RXZA 5EPDA 1XC6A 1DQXA 1OHLA 4Q8VA 1WKFA 5FF4A 5AB3A 3HJEA 2ALDA 1QW9A 2A0NA 3B9EA 3VMPA 1B30A 3QQ1A 1B31A 4XZNX 2WVVB 1SVDA 2PA6A 1L6GA 1VCVA 5FS7A 4O1BA 4MB4A 1PX4A 2FFIA 2OZ8A 2E1DA 5CGMA 2GVEA 3QN3A 4IPPA 1V6YA 1KFJA 4AVOA 3LCHA 1H51A 3GBEA 3H4WA 4EQRA 3L5OA 4MNKA 1BD0A 4H9TA 3CL7A 1W3IA 1XYLA 1XJBA 2GGGA 3FHQA 5C8BB 1XLJA 1DIDA 1KN0A 1RCXB 4H9YA 3ZT6A 1RJQA 4C6FA 1UPPA 1W8GA 3V16A 1R85A 4E8DA 4Z1CA 1R3TA 3P93A 3UXLA 3ZLGA 2WKGA 4HN4A 4FEZA 3VIIA 3A64A 1YBQA 5CZTA 1HL2A 1DEDA 1GUVA 4S3JA 4BEQA 4C6JA 4ERGA 9XIMA 3S2NA 3KBSA 4AH7A 1MWOA 4XUGA 1EHAA 5JCIA 4EMWA 2NX9A 1J0ZA 2GDUA 2VR5A 2Y8UA 1R0MA 4UIOA 3GC4A 4I5XA 3TH6A 5AHLA 3VDGA 1UMYA 1TVLA 4C7DA 2WP5A 4FIRA 1SU5A 1V4YA 2ZTKA 4P61A 1MEIA 1E56A 1Z7AA 4B9ZA 4OWGA 4ZQOA 1Q6EA 1WZMA 1K02A 2VGGA 1PIIA 2CESA 3A4XA 4IFRA 2YVGA 5KZ6A 3T4CA 1ICSA 3UWEA 2QDGA 3WQEA 1IT7A 2W4XA 3EYPA 4ZO7A 3BDKA 4C6KA 4H4SA 2D3NA 5C9ZA 3W29A 3G3DA 2B31A 5DT5A 3KS6A 3F4DA 1KRAC 4D2JA 3GD3A 3G0XA 6ENLA 4KFPA 3RITA 3QW3A 4KPLA 4I7UA 3W82A 1A49A 4E38A 1HG3A 2BOGX 3ITOA 1W1B1 4RDYA 2C16A 2PDPA 3L5AA 1VEOA 2D2HA 1AQFA 2HISA 2ACRA 4GUJA 2BY2A 4UBPC 1GEHA 5D2WA 3K5XA 3V7PA 2NPXA 5L6UA 5BXRA 3SB0A 2CLLA 1AVAA 2D2GA 2NQHA 3S6DA 2CU0A 4IQEA 4J5NA 1C92A 3VNDA 4GYJA 2PU0A 3UD6A 5AC5A 5FJPA 1PL9A 4M0XA 3F2BA 3CGDA 4PULA 4GQQA 1I60A 4MG4A 4RCXA 1W1TA 2WM1A 3GXNA 2OZ3A 1XIIA 3FDGA 2JIWA 2PLJA 1QI5A 1OD0A 3UY8A 1H0IA 2VDHA 4HN8A 3IUIA 1NY1A 3N2TA 4QDWA 4A3QA 2XWEA 2YPIA 2G95A 3BLOA 2Q01A 1RPXA 4OE7A 4WLCA 3OJGA 3LZ3A 1TUFA 1PX3A 3PUGA 4PMDA 3L4VA 3VK5A 4IMCA 2HVOA 3PZOA 3PUOA 3QMRA 4MJZA 4FI4A 2UY2A 3OIXA 3T42A 4ACZB 2OZ0A 3CB3A 2IMRA 2XVKA 5A6TC 4UTFA 1LL4A 4YCPA 5T91A 1JCMP 4KIRA 1LP6A 2GSEA 3W7JA 1GSNA 3MCOA 3LOTA 1B9ZA 1P5BA 3WQPA 3PPHA 2DVUA 1BXCA 1S3HA 4YVXA 2Z1BA 3QYQA 4RLIA 1F4AA 2VZUA 4TX8A 3ZR4A 4ORMA 4ZEPA 2DW6A 2IS7A 1LZOA 2Q6ZA 3TZNA 3B0YA 4G7EA 1YE4A 5CQ1A 1U5VA 1V02A 1VIZA 2WC7A 1XLEA 1U22A 5B80A 3A5FA 1T99A 5E0FA 3BQ6A 4RJEA 3WDRA 1AJ2A 4FDCB 5JH2A 2EPMX 5DY3A 4IJCA 3GE7A 5LHEA 1C29A 3AZRA 3E5PA 3DI1A 1GHSA 3L5LA 3TWAA 3CWHA 3TR9A 4DNHA 5EB8A 2E09A 1GHRA 3T0DA 4KQNA 2C1HA 1DWFM 5JCLA 3EA2A 4IPLA 2OSXA 1NDAA 3GHRA 3C2VA 2XG9A 3VNYA 3WH5A 1VBGA 3TSBA 4WJXA 4Q4KA 4CNUA 3S0CA 1QPQA 2DUZA 4LUTB 1P48A 1MDLA 1EC9A 3UR5A 3WD2A 5CPOA 2VC6A 4AZBA 3S1WA 1ONFA 1MI3A 3EWCA 3W28A 4NUWA 6TAAA 3BUVA 4PL2A 1B3YA 4DEFA 5D8WA 3MI3A 2I9UA 1QT1A 4UC5A 1CGYA 4JR5A 4AAJA 3B9AA 1S5NA 2J88A 2F6UA 3N18A 3MUZ1 3QTGA 4WRHA 3QOKA 4UMBA 3SN1A 1QFEA 3E0WA 4JCMA 4HPNA 1V0LA 2ZWYA 4ACYA 1AK5A 4WKAA 1HN1A 2A3LA 2WMJA 1V59A 4JQ9A 3GR4A 3M47A 4PMQA 2PWUA 1JCTA 3L65A 4KEZA 2NVKX 4JYDA 5F2MA 3H7RA 3OGVA 5KZEA 4UFLA 5KEZA 4L4LA 3UVIA 4QDPA 3WH7A 1J12A 2ZRVA 5F7UA 3RGTA 2HE8A 2Z26A 3GDTA 1CXIA 4ZL1A 4DZ5A 4JFWA 3GDRA 4GI8A 2FHCA 7ODCA 3HW2A 3AMKA 3S1GA 3RU6A 3FCPA 2DZUA 3NSXA 3UW6A 1OFDA 3VKJA 1PTDA 3WLIA 4W88A 1S2CA 1MYRA 3O8AA 4B5VA 4EK7A 4GYPC 3NQEA 3GD6A 3FS2A 4HU4A 4LH8A 2ZRUA 1CXKA 3FVMA 1CCWB 2GQ8A 3TN3A 1DE5A 3A5VA 1CXFA 3ZVIA 1FXQA 1B54A 2GR1A 4HYWA 3TJIA 3A3WA 4A8RA 4KCUA 2E3TA 3OB8A 2PWVA 2NXHA 3GHTA 3P80A 1IWBA 1R3RA 3OYXA 3URNA 4M80A 5CAKA 2A1YA 3HG2A 1GPWA 1L6YA 4MDPA 4C6DA 3I3BA 3UZYA 3O9NA 2OGJA 4NY2A 3TUUA 2W61A 5D30A 3EB2A 5G2IA 1FP8A 3TLLA 2NX1A 4K38A 1HKIA 4D8LA 2UBPC 3N6QA 4J3WA 2ZVIA 2Q3RA 4FOUA 5BOOA 1LRNA 4RNIA 3LHVA 3WK0A 2W92A 4O57A 2WVUA 2PBOA 4K7VA 1BTCA 1HNYA 1IR1A 4UTKA 3CEPA 3AS1A 2KX9A 4NT0A 4DZHA 1UJPA 1NIUA 2CXEA 1OJTA 1LYXA 3HB9A 1VRXA 3A9IA 3P7YA 1X2GA 4H8HA 5HR7A 4M6QA 3EPOA 1G67A 8XIAA 1JG9A 1B3VA 2XN1A 4UFKA 2UY4A 2P53A 4NNBA 2MUCA 3T0CA 2WMKA 4H4ZA 1UKPA 1HXJA 4IIHA 1PKLA 3QM3A 1W5MA 1JFHA 5K2ZA 5CXPA 2I17A 4F0LA 6REQA 4QJ3B 3RK8A 2QCMA 1VFUA 3GTIA 3IVUA 1OF6A 3UZ5A 3GFZA 4QQ3A 5C5YA 4H00A 3B8VA 1US0A 2X42A 3LM7A 4Q7BA 3UF9A 2BODX 2VFGA 3U9IA 3E0LA 5EYWA 1QI2A 4O18A 2REQA 2VQTA 4D1JA 1PZ3A 2GJXA 3AMDA 3RJXA 2WBGA 3A21A 1GVSA 3SBFA 4EAYA 3CAVA 1GQIA 3W1AA 3SW6A 5FAJA 3EX2A 3OYZA 2I1OA 3B05A 1F5ZA 3I4KA 5I0DA 3UWVA 2QZRA 2VGFA 3N3MA 1OX6A 1JCLA 4JTTA 1UWRA 3F5KA 2YFNA 4JTFA 4I5RA 3QXBA 4FP1A 3BAKA 1PKYA 3ITGA 5CCZA 1EL3A 4CNOA 1KNWA 3GXDA 3HTWA 1V3HA 2RJGA 4JFVA 1CLVA 1C9WA 3W71A 4MJ4A 2DUAA 4N02A 5D2YA 3CV6A 4PUKA 3IAPA 1VCFA 2J27A 2Z2AA 3PZIA 3AYVA 3PJWA 5C9RA 5KITA 2XJ7A 1DTUA 1EF3A 3M5ZA 3P74A 2V5CA 1TVPA 4YPJA 2WP6A 4DLFA 1OCJA 4X63A 4PB3A 1S2UA 1I2RA 2FZMA 5A2AA 3PM6A 1GVFA 1YKWA 1XHGA 2G3MA 3HPSA 3CHVA 1TWSA 3GH5A 3MY9A 2ZUSA 3ONCA 3SQSA 1V7AA 3K1DA 2TYSA 4KRUA 1AJZA 2XSAA 3T6CA 3BGJA 4S3CA 3LTSA 5G5GB 3LZ5A 5HULA 4URIA 5HNUA 1TV5A 3TC6A 2HDJA 3LGGA 3PS7A 5LA0A 4DJDD 3QMTA 3RHGA 1JXJA 4WIWA 3DYOA 1OFQA 1K6AA 3URHA 3FA5A 1QNVA 4ERIA 4QLKA 1IEVA 5HPCA 3GD4A 4N42A 4PR4A 4JL2A 4A8IA 1UC4A 4LC6A 3WDIA 4NQ1A 4UFJA 4DAFA 3GH7A 3WEZA 1J0HA 1JNDA 1YNPA 5XIMA 2I7GA 1NDWA 1CGVA 1QCWA 4RX0A 3A4AA 1X7IA 4H19A 4MKNA 2HNEA 4PCTA 3MVTA 4RE2A 2PGWA 2JFEX 2VP8A 1Q7MA 3DAQA 1V03A 4AIBA 4BKNA 4IQLA 1WDDA 4XO6A 1T0OA 3LADA 4MB3A 1XLGA 3FN9A 3QSTA 1JPHA 4JKLA 3WBEA 1W17A 3STCA 4W5ZA 3T0TA 3CQIA 4E4UA 4F9JA 2WBAA 4HTYA 2J7FA 2DZXA 4D6FA 4B5XA 2GJRA 4LVBA 1GQLA 2VMFA 3RAOA 5REQB 4E2BA 1P0DA 2O7QA 1UKSA 4JYEA 3AFBA 3R8GA 2UZ9A 1KCXA 3EKZA 4D8ZA 3SSZA 1BWLA 3C0LA 4M82A 2CKSA 4JGDA 1I2OA 2WNWA 5DFAA 2OT1A 1TZZA 4NX0A 2DT0A 4YHGA 3N9SA 1GTEA 2WPBA 1GERA 1OGGA 3TCSA 1PWMA 2PFHA 5AHIA 1XLIA 2BG5A 4MFEA 2ISDA 3ME3A 5T26A 3KL5A 2PWEA 3DG7A 2BGSA 4BI6A 2HROA 2JIEA 4CD8A 1W9VA 2B7OA 5AN7A 3MT1A 1KR0A 2ACUA 3RF9A 5C9UA 3VD9A 4W7UA 3I7QA 1OK4A 1R7OA 3CAWA 3S42A 3T78A 4QCEA 2G3JA 1JEZA 2WZEA 4UOQA 1XKJA 1K8CA 4HNTA 1TQXA 2GUYA 2J7GA 4FLQA 4LV9A 1QO2A 4FNRA 1PYMA 4I6VA 3PZNA 3B3DA 3GU9A 2QCNA 3WJXA 3BCJA 1Q6CA 1ZB5A 4FXJA 3W1MA 5TQLA 3CEUA 4W9TA 4C6CA 1PIGA 5BROA 3L23A 4B5WA 5XINA 3B40A 4MDOA 3CZKA 2WHMA 4AY8A 1A5AA 1EF2A 4TR9A 3EPMA 4HPJA 3VXGA 3IIPA 3B9OA 3EX4A 1IGSA 1L8NA 3AXKA 3PPFA 1J0KA 4CD5A 1YTKA 1VP5A 4OIFA 1AQHA 1H2IA 4HVXA 3GIPA 4CU8A 4IIDA 3GXMA 1AQMA 2V68A 1KM1A 3HGSA 2PUZA 3LS9A 2OYLA 4LBSA 3ORWA 3MUIA 3EDFA 1XRFA 1R2TA 2NXIA 3A9BA 4ZTYA 5C9XA 4Y7EA 1P0NA 1TWZA 3Q45A 4DUVA 1XX1A 4HMDA 1IEXA 1MXSA 5HAOA 2P10A 3U6WA 4LPCA 3ZVHB 3ALGA 1FFVC 1S2AA 2GJLA 1G94A 3BG9A 4ML4A 1LRTA 4M81A 3EA3A 1LUCA 2JEPA 3OP2A 4US5D 1YPXA 5GNYA 5DO8A 2I5IA 2DZAA 5ABTA 1K4QA 1UOZA 4E4PA 2C0HA 3OVGA 5J04A 4LUSB 1N82A 3GVGA 2DZTA 4UQ9A 4HK5A 3VMNA 1FWWA 1RBLA 3TA9A 4DN1A 2FZDA 1ELSA 4XKMA 1I4NA 3MDWA 4N9EA 1EX5A 1OZQA 4Z2HA 3KDOA 2AL2A 2E9BA 3WDPP 3WLPA 1V3MA 1PIFA 3G1VA 3QY6A 2YZ5A 3NQ7A 3GK0A 4M19A 5JXQA 3MKVA 4DZIA 3HQNA 1OM0A 1ZHAA 5LGXA 3CPRA 3RM4A 3T09A 4FHAA 3NPVA 1VB9A 2J25A 4IX0A 1JCJA 3WENA 5MF5A 2QDHA 1YYAA 4F0RA 1U1HA 1SM9A 2BP1A 1DXIA 2QDEA 5EMMA 4K1WA 4FF5A 2J77A 1FRBA 1L2QA 2PDGA 1T7LA 2FZ8A 5DELA 1ONXA 2GQ9A 4NZ5A 3SUTA 3B0PA 5CGTA 1K70A 2WVTA 2TSYA 4Q8NA 4E6MA 3CO4A 3EX1A 4O1CA 3QC0A 1SSDA 3OO2A 4UR7A 2HBVA 1ADDA 4K7YA 2PWGA 4FS9A 1ZAJA 3HG3A 1V79A 3UWYA 2GWNA 3T8LA 2R1LA 5CEWA 3QLDA 4I9MA 1B2YA 4UMCA 2H8ZA 2Q8LA 4HOWA 1XBYA 2ZX9A 2OTDA 2Z4GA 3JZUA 3THQA 4O53A 5G5HB 3H2FA 5FF0A 2A3BA 2CWXA 2X2YA 4QS5A 4ZXOA 1W9PA 2PDBA 1CENA 1MOKA 4Z08A 4HU8A 1UH2A 1GOOA 3ZSSA 2BHZA 4U5IA 3VCRA 4MY8A 3REQB 3G8EA 2PD5A 1XIEA 2DIJA 3U4FA 3BWWA 4UQBA 5I07A 2J8TA 1JQXA 5A8MA 4JTEA 4C65A 4MWAC 4AMCA 2E6DA 1STZA 3SAZA 4DBUA 3N15A 2QULA 3WDQA 4HSOA 3CXOA 3AJ7A 2INZA 1ZY8A 2J62A 3WUBA 1AD4A 3KLJA 3IS4A 3MU7A 4C6QA 2W3SA 4JTAA 3DGBA 4NZJA 2B7QA 4X0VA 4WXYA 4F48A 4JAWA 1RV8A 4X60A 1NPXA 2QJGA 1GRGA 2YCIX 4JTHA 4LUIA 2Z1WA 3OGRA 2VEMA 4DJFD 5DMMA 4ZFCA 2PP1A 1E51A 5DXXA 5AFDA 1KFBA 3G3MA 1GOIA 2Z1SA 3EDEA 3UBPC 4XTIA 5PTDA 1KCLA 2VR4A 5EMYA 2XZ7A 4AZHA 5C6MA 5F4WA 1JZ4A 1K3UA 1TQJA 4BF9A 5F1VA 3MC5A 4XO7A 2BSLA 3LLXA 4GQGA 1JXKA 3W26A 3E49A 1JYWA 4PUMA 2G4JA 2YCLB 3AIEA 3S47A 2QCHA 3EOUA 3P62A 4Q7IA 1E71M 3RM8A 5C70A 1JI2A 2WZIA 4JYFA 4C6OA 1JPIA 2YZRA 1TPUA 4PTNA 4A21A 4EQWA 4HZ8A 3IJQA 3L0KA 1JYVA 4NAFA 1Q85A 2EG7A 3WQDA 1FH7A 1OX4B 2WM0A 3EB3A 4IPIA 2HXTA 3MP3A 2W5FA 4MY1A 2C71A 3LY0A 3DJJA 3ZJ8A 1EO7A 2QJJA 5LIUX 1Z89A 4L6HA 4PMOA 3VNJA 4H7CA 2A2IA 1MUWA 5T8GA 1WDPA 2A3AA 4N0RA 1BPLB 3BMWA 4AWEA 1RLCL 3IVTA 7TIMA 3LQLA 4K7ZA 5A5WA 4R53A 1QPOA 2WMGA 2PODA 1YNYA 3QEZA 4EWND 3W72A 4F79A 1NAL1 3KBNA 2FHBA 4GZ7A 3H2AA 1D2KA 1KCZA 3EOLA 3TMQA 1E1CA 4PTXA 2IQ0A 1FDZA 4DWSB 1IZCA 5CSYA 2DZVA 4IMDA 1FTXA 3VUPA 5CLTA 1B3WA 4AZCA 1DXEA 4B3KA 4BA0A 5K9XA 4CVUA 4R7WA 4XD3A 1DXLA 2A21A 3EBVA 3IV3A 2YB4A 3W2JA 3GYCA 3O06A 2PWFA 4HMEA 4XQ6A 8XIMA 1BRLA 3WL1A 4GVHA 1WP6A 4A3UA 2GUBA 4EE9A 1EPVA 5K4ZA 3B06A 4Q8PA 3BLLA 1T8QA 4R7OA 1BZLA 3AYTA 4O12A 4IMAA 1UB3A 5U25A 3EOSA 3CH0A 1W3TA 2J13A 2UV8G 3MSYA 4WQ6A 4B16A 1ZCOA 2GWGA 3O05A 3I68A 1UBSA 1UH3A 4D6HA 3AXIA 5HOSA 1J0IA 2PDXA 4DPPA 4H6RA 3F5LA 3EMCA 4S3KA 4LY4A 1Q66A 1W56A 4RE3A 4MFDA 4GO8A 2X0HA 4YVVA 1NHPA 1DIOA 3L4XA 3UG4A 1GT8A 3W0KA 3CV2A 1PB0A 2PRLA 2WV8A 1F7BA 2XN2A 2FTPA 3HO8A 4ZTXA 4KIEA 3V0UA 3GG8A 3RCMA 1UG6A 3E0VA 5EL1A 2QCEA 3EWDA 2X8RA 4J40A 3UVAA 2AL2B 3W2KA 1KM5A 2QCDA 2FGLA 5FEZA 3WJSA 1UOKA 1BHGA 3ES8A 1L8PA 2V2DA 3FXGA 4JICA 5BU9A 2VEKA 2VC9A 3M5VA 4EKJA 4QE4A 1CLKA 5CH9A 1BQGA 1YNQA 5I6SA 1ONEA 4DBDA 2OPJA 1K03A 4AXNA 1PS9A 2QS8A 3MJYA 3ZO9A 4XZMX 3RRXA 1KXTA 4DYEA 2C15A 1ZQ5A 3H21A 1ESWA 1LWIA 5IHSA 3TJLA 1HJWA 4AWUA 2QAFA 1V3LA 3KZPA 1J9YA 2JKAA 2QUMA 4C1KA 3A13A 3W1NA 2P8BA 2Z6JA 1M1BA 5CKSA 1G4SA 4W89A 4C5YA 4KPRA 1R3SA 5GVJA 4RDWA 1A0EA 4GJIA 1Q65A 3L68A 4LB4A 1QXLA 1SFLA 2FDSA 2QF8A 1ISXA 1CEOA 3P2VA 4ICMA 4KCWA 1TYTA 1TTPA 1FWFC 1RR2A 2V2HA 4ALDA 3DK9A 4MNLA 2NQ9A 3BG5A 3U2CA 4U2YA 3VABA 4GJ1A 1G9HA 4HK6A 4B2DD 4WHBA 1EIXA 3XIMA 2OEMA 3PN8A 3T7VA 1J0YA 4ZSUA 3E96A 2WCAA 4DF1A 4M1RA 4FXFA 4HOZA 3ZT5A 2XH4A 1J01A 4NJIA 2EBNA 1I2QA 3D46A 2R1KA 4WR3A 4HNOA 3SY1A 2IQDA 1J79A 3GTNA 3N11A 3OZMA 4MYAA 3IGHX 2OLHA 1OZMA 3EKGA 3N6JA 3G22A 3OG3A 4HNUA 5A95A 4M6UA 5FSDC 3NM3A 3AYRA 2VVSA 1PTGA 4AC7C 4HOXA 3LB8A 2Z1KA 1CXHA 2PDFA 1MW3A 3C86A 3C2RA 3DHDA 3E02A 5C55A 2OKTA 3W7EA 1JRBA 3CO8A 5EBUA 3TWBA 3MHGA 2BCPA 2AQVA 5HMSA 4X0NA 5A3HA 3WLRA 3KEHA 3LERA 3U5YA 2J3NA 4MAZA 1OADA 1TWWA 4QG6A 1LDCA 3R79A 1R8LA 3ALFA 1G4EA 1RUSA 1F05A 1ME7A 4BY3A 3E2QA 3C2EA 3WQ5A 1VFFA 2VKZG 3N19B 4A05A 4TVWA 3F4NA 4JTUA 4NYYA 4NU7A 1FCUA 2D0FA 2CBUA 3ARXA 4UNKA 4FK9A 4O19A 3IJDA 1DJXA 4WK9A 4EMJA 4QJ5B 2Y7GA 4JTRA 2ADAA 1NFPA 1UZ4A 4LQ1A 3LBMA 4Z2LA 5C54A 3VKDA 4CN4A 3NOEA 1O4UA 1E6ZA 2VZTA 1LLZA 1XGDA 4IIEA 3EDDA 2DT3A 5XIAA 1PKNA 4UMAA 1HP5A 1Y5WA 3T08A 5BWFA 1FWJC 4J3ZA 3ABOA 3AYSA 2JEQA 1TMHA 2QGYA 4FNSA 4UUIA 1R38A 1AH4A 3EWZA 3AISA 3M5XA 2PD9A 3V5CA 1HFBA 4J3TA 4YTRA 5IBXC 4BFAA 2X99A 2O9TA 1JDAA 2P0IA 3CTTA 4QP0A 5CPTA 4JIHA 3WMSA 6ALDA 3W25A 5F2GA 2QR6A 2O92A 3EOEA 3THDA 3FGCB 5LNRA 4G5DA 2EQ8A 4AHOA 3ABXA 1US3A 4GLEA 4GY0A 3APYA 1H2JA 3BOLA 3MWCA 4ZB5A 4UFMA 3WZ0E 4A8NA 1UR0A 3ANUA 1FECA 4Z2JA 3ZQ9A 2YVFA 3E3HA 3KRSA 3THAA 3VNKA 2BY3A 4AZCB 2ATMA 1NP2A 3EUB3 3RPTA 4S38A 1UWTA 3T8QA 1J10A 5EFFA 4QR6A 2ZA1A 1A0CA 4JN7A 1EP1A 5IFTA 5BMWA 2WKJA 2ZVRA 2GZXA 4POCA 3W02A 4TMCA 2A7PA 3EEZA 4XBKA 3WFAA 4DIAA 1O12A 3WYZA 4D6GA 1B90A 1HKVA 3H2CA 3B8WA 1VHNA 1QNRA 4GIEA 3NZPA 3PB0A 4Q4SA 7REQA 5TF0A 3FXYA 4FXSA 1EA0A 3LXAA 3KRZA 3WBWA 3II4A 4OZOA 4O1AA 5A6MA 1JROA 1W5PA 3TSMA 1XRSA 3PBWA 1I2NA 1WXZA 1Q8JA 2H8XA 4QNEA 4CCDA 5M17A 4LJ3A 1V6VA 4UTJA 4HPGA 5FJTA 1VFLA 3CM4A 5FCZA 1X38A 5D9OA 3OODA 2ZX8A 1EDGA 2I56A 4JNMA 4NG3A 5EMLA 2QJHA 2IKHA 5AOUA 4FF7A 2VCCA 1DJQA 3OLEA 4HZMA 2D2OA 2H3DA 2EPHA 4IGMA 3BCDA 1V3JA 4YVPA 3W7PA 4QFUA 4US6A 3DEQA 3I6RA 5JQ9A 5E70A 3TMLA 3TLQA 3AN1A 3BLKA 3CZ8A 4XV0A 4K8DA 3G1SA 3DECA 4DELA 4OECA 5G2HA 3ARUA 3PBGA 4PMVA 2WMHA 3WD1A 4A6GA 4R33A 3ABZA 1A5NC 1BG9A 2ZE3A 3WUGA 4OV9A 3K46A 1ONRA 3WDJA 2PCEA 3S5SA 3VKBA 3R4IA 4AY7A 2HJPA 3SUSA 5TNVA 1ZL1A 2VCAA 2C79A 4NZ3A 2QT3A 4IL2A 5K4XA 1KO0A 2CC0A 1AW1A 3KCOA 1RY0A 3LB0A 3AM9A 1BVWA 2YXGA 2RFGA 1VFSA 2EPNA 3RLGA 2PGFA 4CNSA 3VM7A 2WW5A 3LPFA 1T96A 1OVDA 3DFPA 4GUHA 3GTFA 3RNDA 3RO6A 4PUWA 4DJDC 4WY0A 3LRKA 3U2ZA 1PHWA 5KMYA 4R27A 4PFHA 3NVZB 3W75A 2R82A 1SUXA 2WO5A 5CSSA 5U7SA 1UZHA 4PMNA 2AQOA 3CIXA 1HJSA 4YIWA 2J24A 3SY8A 1PTAA 4BS0A 2YA2A 4Y2WA 2V8ZA 1DYSA 1Z48A 1AL7A 1EZ2A 3BJTA 1EOKA 1EJVC 1QI0A 1W3KA 3NIYA 4NRSA 2OO0A 2R9ZA 3W87A 4QJ4B 5GPRA 2PDWA 3H26A 3LK6A 4BQ5A 1XLAA 1OGSA 5KINA 3PZMA 3WBAA 2NV2A 4BF7A 1XYAA 1QATA 1O5QA 1HL8A 2H9AB 4MNMA 2W55A 3P67A 3NO5A 4AHPA 3MSRA 1UBPC 1PX8A 5DMNA 4D6DA 3WLKX 5F4SA 2PTYA 1E3ZA 2WPGA 1MO9A 4ZOBA 1JPDX 3ZR5A 1KXVA 2WAGA 1K9EA 4NZFA 4AQLA 1GJWA 1F6YA 2DSWA 1UUQA 3JS3A 4PUNA 4EACA 3TFXA 3DFTA 4TV5A 2OGYA 3H54A 4Z1AA 2CZ5A 3R2GA 1SO5A 1P6WA 2EQ9A 4AZ6A 4XIMA 4S3FA 5IFPA 4IM4A 5HNRA 2XZ9A 2GQAA 3HV9A 1PCWA 5I23A 4B5NA 1KA9F 5JBDA 1TTJA 1Y8BA 2NLIA 2J66A 2HQMA 2GGIA 3I6EA 5DBUA 1JRCA 5A6LA 5HQEA 3PZTA 1AQ0A 5FS6A 3H8AA 4QRNA 2PI6A 4ADTA 1HL9A 3M0XA 1JJKA 4EF8A 2GQ3A 1UR8A 3SJ3A 1GVYA 5HNTA 2GVGA 1H7WA 4J4KA 2RUSA 1V3IA 4RNJA 3BJFA 3GB6A 4ROPA 4LOCA 1AH0A 2DH2A 1GQNA 3K4WA 5IBXA 3WMBA 4BQ4A 4G2DA 3ZLFA 4GNJA 3EXSA 2ZZ1A 4P8WA 3TZFA 4XISA 4QLLA 3VIJA 4BWLC 4KWWA 3GU1A 4C7FA 4GH1A 1THFD 4ZO6A 5D38A 4DF0A 2BVYA 4C5ZA 4W84A 2GPTA 2E5AA 4UFIA 1YPIA 4OBTA 5K7JA 3MUXA 2GL5A 5FOOA 4LAMA 1B1YA 4E5TA 3NPUA 4HA3A 3WSUA 2Y89A 2HCVA 2A3CA 1A3WA 4KEVA 4B3ZA 3MV11 1ITQA 1G5AA 1XKYA 3G1YA 4HHLA 2DW7A 2F8QA 4J7RA 3E38A 1UWUA 3CMJA 2BVTA 3SR6B 4PH6A 5ABGA 3CIVA 1EH9A 3B8DA 4MKVA 4AEEA 1TE1A 3GVRA 4AY1A 1QBBA 3MANA 3MWAA 4Y9NA 2HRWA 4G8TA 5IOBA 4MAVA 3VINA 3G0UA 3ITTA 4H9UA 1XP3A 1NWUA 2PZ0A 3Q4DA 3SCSA 3VOJA 2QLYA 3N4FA 4H8VA 4AWTA 4FZIA 2ZCGA 4K3ZA 2J9XA 4NP7A 3QFWA 1KRBC 1LWJA 2PE4A 1GCYA 2PF8A 3BZJA 4H9XA 1Q45A 1H1ZA 3D5HA 3AUOA 4IICA 2YR1A 1FDJA 1G7UA 1MO0A 4LYKA 3LHYA 2CXGA 2RDUA 4PMUA 3SCPA 2C0AA 5CC5A 3G18A 1KFEA 1LBLA 3VM5A 3VOCA 3NQDA 1XQKA 2OB3A 3O15A 3I6TA 4HNCA 2VC5A 2VGBA 2ANUA 5F2LA 3M0LA 2GUUA 1QU4A 2G5WA 4OBRA 1JVNA 4NF7A 4NAEB 1QMLA 4HBKA 1HP4A 3CU2A 4TOQA 4WX2A 1XUZA 3NL6A 3WO8A 3ZIZA 5AECA 3WNLA 3ARVA 3WQ8A 5HUOA 2MNRA 1GOQA 1OYBA 3HF3A 3IJ6A 1SO3A 2W27A 4RPPA 4MJ2A 5FJUA 5D2TA 1EQPA 4RDVA 4X9SA 5G4WA 4B90A 1V08A 4AU0A 1F9CA 2XYLA 4HQVA 2V3AA 3B04A 5HQLA 4B5SA 1TWIA 3TYAA 4Q33A 3FEMA 4F3HA 3UT0A 3V5FA 3W83A 4BHYA 2YSWA 3KDNA 4LBRA 4RUBA 3LBOA 3SUVA 1ICPA 1FEBA 3EAOA 3TTSA 3HG5A 3K13A 4YMZA 2P3ZA 3H22A 3QLLA 1D8CA 2XDFA 3FJLA 3RYSA 2GH5A 3QMSA 1E6RA 1FWHC 5F1UA 4M5PA 4ILSA 3UCCA 3H24A 4K6AA 3GM8A 3CUXA 5IM51 4GR1A 3RUBL 3DERA 3LRLA 3E0IA 3GNPA 3UNDA 2P88A 3BW2A 5HINA 4N9CA 3UGVA 4HU3A 3FV9A 3GUWA 5LIYX 3AZTA 1UP2A 2HVMA 2WHKA 3IJLA 4G9PA 4IL0A 4QE1A 4CQBA 2RKXA 5LHFA 4ZXLA 3T40A 1N7KA 1YTEA 3HZ3A 4NIRA 3XISA 4Z17A 3PZVA 4D6EA 2Q3OA 2VFFA 3VDAA 1WXYA 2MANA 4JBRA 3H12A 1X39A 3TIMA 5LYRA 1E15A 1S3TC 1XIGA 1VPQA 1W6TA 4HJFA 1F4HA 1JYNA 4XD6A 3VUSA 2XIBA 1PCKA 3LMZA 4YNGA 4H4VA 2HWGA 2IXVA 1VFOA 2YVJA 3VGFA 3DFOA 5LA2A 2VX4A 4GI4A 2Y88A 1PYFA 2DZSA 1R7AA 4DWSD 2Z24A 3LMYA 1H1YA 1QTWA 4RPQA 4KGJA 4JY8A 2B0MA 4HB7A 1GRAA 2QCCA 5HUPA 3M16A 4M3PA 2YFOA 1WO2A 1IR2A 2E8YA 3NL5A 1M6JA 4M8UA 3EX3A 1XRTA 3I7RA 3UPWA 4RNHA 4HNNA 2PZNA 1OC7A 1WDSA 3LPGA 2CETA 2O7SA 1ZKQA 1BGGA 2TODA 2PP3A 1JOAA 1UP3A 1W91A 4E8CA