1MREL

Preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
218
structure length
218
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGKERQNGVLNSWTDQNSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2B-KAPPA JEL103 FAB (LIGHT CHAIN)
publication title Preparation, characterization and crystallization of an antibody Fab fragment that recognizes RNA. Crystal structures of native Fab and three Fab-mononucleotide complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 52
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 1994-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mreL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mreL01
2AJUH 3V79C 3P11L 4JFHD 5T1DH 1I9IH 2X7LA 2Z91A 3RJQB 3JWDL 3PNWB 2IEPA 1U95B 2YUVA 5E8DL 4OLWL 3MROA 2DQGL 2P5EA 3W2DL 1X9QA 1V7MH 2FECI 5EC2A 4AZ8A 1SYSB 2BRRH 4JPKL 4P9HC 4ZSOE 1I8LC 2PUQT 3S37L 2KH2B 2W92A 3C5ZB 2I07A 3LHPL 3ZE2F 4O2CB 5I2IA 1XCQB 3PDOA 4PGDA 2QEJA 4JR9L 3T2NH 3PGFH 5JW5A 2YUXA 4A6YH 4LLVA 5TE4L 4GAJL 4ODVH 1LD9B 1XGRA 1SY6L 2WLYA 2JJVA 4M02A 3SDCB 4LNRB 3QO0A 3C60C 5CBEA 5GRJH 3VJ6A 3TBWB 4N0RA 3V4PL 4Z76A 1K4CA 2A6IB 3QJHB 5DMGD 2XT1B 3SO5A 2XZQH 4ZUWB 5K9KA 2YPKA 2UY6A 4P46B 3KPSD 4I3GA 1X3DA 3K0WA 5IESL 2R4RL 4LSPL 5EOQH 2KBGA 4U1HB 3ALXA 3GZKA 2ZSWA 4QRSA 3LV3B 3U4BH 3N9GH 2FZ3B 4OF0A 5DJ6A 5FGBC 1U58A 3K2UL 2JIXA 5EBLA 3UO1L 3P4MB 3C8KA 4QOKE 3SDAA 1BD2E 4U1JB 3L3IB 4L8DB 1EVTC 2XZZA 2V2XB 4EN3A 1RQ5A 1C8PA 1FN4A 1K4DA 3KLDA 4XBGB 4NKIH 1GJIA 1ITBB 3NZHH 1K9TA 43C9A 2W59A 1SVCP 1MCPH 4WTXA 4L4TB 5DI8A 3V6OE 5B8CB 1NCTA 4NM8H 1NUDA 3C60D 2ZCKL 3GI9L 5AAWA 2Z8RA 4Y7MA 3BP5B 3ARFA 4HLJA 3EDJA 1QFUH 1P9MC 1WWWX 1NJ9B 3TIDA 5IM7B 2VL4A 1CF8L 4NQED 3RWJB 3LKPB 4WO4B 5CILH 4CNIB 2Q76A 2DI8A 1IGTB 4U7MA 3I85A 3RZCC 1J88A 3OKDA 4U1LB 2V6HA 1QLFB 1LP9F 4NOFA 3K80A 3UJIH 1HK6A 4ZUTA 4NC0B 3AY4A 2FO1A 3S36X 4X83A 5I66B 4RFOH 1Q94B 5I76A 2O5ZH 4QRQA 1NAMH 4Z95H 3QDJB 3I2CL 4Z7WA 4Y5VC 5I8OH 5JW4N 4JFFA 4PJGB 4JZOA 2W9DL 5D2LA 3QB7C 4WW2C 3H3PL 4NJAH 3IDIB 5FYLE 1YECH 3MLTB 1DR9A 3F7VB 4Y4FB 4AENA 3UTZB 5T3XH 4MNQA 2ESVA 4PY7B 3SCMC 2DQTL 1OARH 3MR9A 4L29B 3VGHA 5JO5A 2MJWA 3HUJF 3DBXA 4U2ZA 5JNYB 2LABA 4PJBF 4KV5E 2EDNA 3LH2H 4TTGA 1FZJA 4KUCD 4LU5L 2IMMA 3HZKA 5BRZA 4HUNB 2Z0BA 4I9WE 1WTLA 4OGXL 3RZCD 2RHEA 2NY2C 4HXBL 4RRPA 1G6RL 5HDOA 2IADA 3G6JA 1MLCB 3MLUH 2WSKA 1H3UA 1FE8H 3VXPA 3WCYA 3LQAL 3BP6B 2ZPKL 5BZWA 3MXVL 4E9LA 1WWCA 1CIUA 1LVEA 4M7ZB 1M1SA 3TZVA 3X3FL 1RJYB 2I60L 2HFTA 5ITFB 1F97A 4HH9B 3W0WB 3PL6D 4PRAA 1JYNA 1BFOA 4OT1H 3DVNB 3N50A 1LQSR 3GIZH 2X4QA 4F8TA 2VUOA 3U7AA 1UZ8B 2DYPD 3SCMD 3MFGB 4MQSB 3RKPA 4ZAKD 5KSVB 1I9RH 2A73B 1XH3B 3S8WA 5ICXB 1QRND 1V8HA 2OTWB 3KPNB 3IETB 5JHDD 3KWWA 4HLZG 5FA3A 4TQEL 4UAOB 1I9JL 4Y16A 5JIIA 2W9EL 1CFSB 3WFDH 4AT6A 4F7PA 4JZNA 3FFCB 2NY2D 4XXCC 1OD7A 1CXHA 1ZTXH 4JFEA 3VG0H 3D2UA 4PJEB 1A6TB 3IGAA 3MA7A 4Z7UB 2FEDC 1HOCB 4ZTPL 2D9CA 2VO5A 3FRPG 5CINH 3BRDA 3U0TB 2P5WB 5E7BA 5E4EC 3MRBA 2XNAA 3MJ9L 3P4OB 4PJHE 1WITA 1CXFA 3S36L 3BRGC 2YZ8A 3KVQA 4HQQL 3RVTC 4GOSA 4JANB 1ZT7A 4ELKA 3FO0H 1JFQL 3DSNA 4QHLA 5IWLC 1CDCA 4GBXA 4TNWK 3AU1A 4H0HB 1P4BL 1P5VA 5IQ7H 1D6EB 1U3JA 4KQ4H 5GSRA 3ZKNC 3SDXA 3VGBA 4I18C 2QHRL 5T3ZD 4NKOB 4XNXL 4TUKL 3L7EA 4LVOB 1H3TA 3C5JA 3UTPD 2HTLC 3GJFB 2QQLL 4F7CA 1A6WL 5HPMB 3MV7D 5IVNA 4MQTB 4JFOB 2NLJB 1NBQA 5CGYD 1KLUB 3IB4A 2FEDD 2B0SL 3DTXA 3VXME 2CRMA 1A7PH 4FQXB 3CFJB 5LGJA 4HWZB 4ALAL 1H15A 2VR5A 2QR0B 5MERA 3LD8B 3WDIA 1IL1A 2HFEA 3RVTD 3MREB 3GI8H 5FHBL 4U1MA 1Y6KR 3QRFM 3BZEA 2B1AL 4P49A 3FT2B 4MCZA 4DTGL 4YPGA 4U1SA 1GRWA 3T3PE 1OGAA 1HHKA 3BQUB 2DDQL 3VXSA 4O5LL 4ODXB 2A83B 3QEGH 3PWNB 4UU9A 5L2JA 3G04A 3SN6N 2YXMA 4D9RE 5F44A 1G7JA 5DQ9B 3FHQA 1NANI 2P24B 4NQCA 3NPSB 5EUKB 3HE7B 3TV3H 1U8IB 5D7JC 5J7CC 1BF8A 2DL2A 1CL7L 1JGDA 1TQBC 1NUGA 3MLRL 5EO9B 1AGFA 3HZYB 2BDNH 4HC1H 2IH3B 1TPXC 5HHVL 3MJ7B 1ZV5A 1FCCA 4QTIL 1BAFH 3IAGC 5H35B 3FQNB 3VGFA 5IIEA 1EJ6A 4WI4A 4XCFH 3EO0A 4Z7VA 1JF6A 1WZ1H 4PJ8B 5E03A 5I1IL 4OCRH 1YN6B 3DIFB 4P9MH 4HUXA 4M8VA 5DD5L 4F15B 2UZYB 3BP7B 2A77H 2GITA 3DRTB 4HWEH 4DKFL 4JFDD 1T20B 1DVFC 4G43B 5EZJB 3GMNB 5F1IA 1S7UB 2DM4A 4LPUA 1MAKA 4S2SA 1CLZL 1URLA 4RAVB 1ED3A 3CK0H 4LP5A 2EICA 4BJLA 5L9DL 6CGTA 4LSTL 2VDRH 1INDL 3L95B 3TYGH 4K3DL 4MNGA 5GGTH 2DWEB 5D7JD 2IFGA 2VQTA 3MJ8A 4L4TE 5CIPB 1UKSA 3HMXA 1E6JH 4F7EB 1A1NB 3PHSA 3UXFA 3A0OA 5IW1B 4TNVK 5J1TC 3VXTA 2VSCA 3K3QA 1KXVC 4TRPL 2E7HA 3LY6A 4GG6F 1F8TL 3ZHLA 3EFDL 3U36A 1J1XL 3MV9A 2FB4H 2X44D 4GO6B 1S7SA 1YPZA 2BSRA 4NBYB 5FK9A 4XCNA 1EUUA 3KPRA 3CZJA 4LLUA 1JPGB 5HXMA 4JAMB 4GMSH 3BEVA 1DVFD 4MJIB 2HG5B 3TA3C 1KJMA 4OFIA 4B7IA 3FO2A 4NHUA 3QDJE 4PP2B 3WFHA 3IRZA 1CT8A 3D48R 5EORL 5J1SC 4PJGE 3GNMH 1TMCB 3V5KB 3Q48A 5KW9H 3LS4H 3BH9B 3IU3A 4EI6B 4LBEA 4PJIA 1LEIA 4XP6L 5FOBA 1YYLL 4AIXA 4OGYH 4M6NL 1JCKA 5E08L 1E0OB 2JCCB 1Q9KB 1RZKH 4PJAA 1AGBB 3KLHC 3NCJH 2NY3C 1T4KB 3QIUA 3MRRB 1DDHA 4R96A 1QSED 4LSRH 5FIEA 1UYWL 3M45A 4LCYB 1CGTA 1BFVH 3ZL4L 4QHNA 4RBPK 5ADPH 1QD0A 1P7QA 2AXGB 3QHFH 2OXHA 3TA3D 4N0FB 3FN9A 4NRZA 3U30B 4P5MA 3H7LA 4DWHA 3QA3A 3Q6GH 4G9FE 3SGDH 3W0WE 3BDYH 3EZ8A 1KYOJ 3IJYB 1EK3A 5D70L 5B3NA 1A6ZA 1G9NL 3HC4H 4IIQB 5CBAA 1FGNH 1P4LA 2ITDA 4Q9QH 1FIGL 3PGCB 3VXQA 3AAZB 2FJFB 4YWGH 3IVKB 1A9BB 4D9QD 1XGQB 1ACYH 1IM9B 3JBG7 4WUKH 1RUQL 5FO8B 4Z9KB 2NY3D 4E41A 3OJMB 5EN2B 3DX9B 5C0BB 1MY7A 2IAMB 4ZFZB 3ZHKA 3ESVF 1WQVT 1NFDA 2V5MA 5D1ZB 4O2FA 3TCLA 3FQRB 4CU8A 1AR1C 1IMHC 4MB4A 2P8LA 3FFCE 3VDBA 1W72A 1YEJL 4PJEE 3IFPA 1XF4B 4N5UA 5F1SA 3MLYH 5IFHL 1HYRC 1VHPA 4C4KT 4MHHG 1PY9A 3D69A 2P5WE 3FFDB 4YFLF 4ETQB 1H5BC 4YIQB 1QFWM 4OAWA 5ISZA 4YDKH 5FUOL 4YHYB 3DXAB 1R3KA 4J3UA 2XN9B 4EOWH 3BUYB 4PGCB 5CCKH 2PW1A 2VLKA 3ULSA 2DMCA 1ZT4B 2BY3A 1J1PL 2A6DA 4U1KA 5IVZB 5F1NB 2APWA 4WI2A 4XNZB 4HAGA 2V7NB 5D7KD 3DUUB 5LBSH 3SOBL 2VXQH 1DBJH 5F3BA 1F6FB 5KSBA 3ZDZE 3MLVL 1E28B 1RUPL 3GM8A 4LL9A 4XX1E 2X4SA 4HKJA 1OAUL 1OAZH 1YDPA 1AR1D 2YK1H 5LGKA 1T5XB 4GQ9H 2A6KA 3U7WL 3VD3A 1JUFA 5F7NC 3T1FB 5C08E 3KLAA 4YNYB 4X6CE 3A6CL 2O26U 4NQXA 2VXSL 2DS4A 4ODUB 1B4JL 3T0ED 3MYJB 2CRYA 3ES6B 5LJYH 5FFLA 1J0YA 4P2RB 4MD0B 3ARXA 5IW6B 5LWYH 5DJ2A 3KPMB 3AGVA 3RBSA 4PLJC 3RIFF 2APBA 2KQNA 2HJLB 5HYSA 1IEBB 1T6VN 5E6YA 2AK4B 5HHNA 5I1GH 5B38B 1YEHL 2V17H 2MCPH 2YD4A 4R6UA 2F19H 3T0XA 4Z0BH 3P0GB 4JJ5A 1F3JB 3QNZB 4JY5L 3TCXA 1DFBL 1KGCD 1DLHA 4Y8DC 3O6LL 4NHCH 1KN2H 1CDHA 3IDNA 4MXQC 4ZDHA 2AK1H 2XXMB 5KN5B 5DRXA 5HDLA 1G7PB 3AREA 4XMKL 2E27L 1XF5A 3CVIL 1IGMH 2R0ZH 2DQFB 1JE6A 5BS0B 5EIQA 4J6RL 4KDWA 4MHHI 3OAZH 3VXRD 3BZ4A 5D7LA 1RZJH 2LTQC 2NZIA 4WW2B 2VLRD 2BVEA 3S3JA 1TVHB 5IROC 1T22B 1IKFH 4PLJD 5C0IB 4TUJB 1KT2A 3OPZH 1QKZH 2CDFA 5L8KB 3P77B 3VRLE 2VZUA 4TOYL 1KEGL 4ZFOA 2SEBA 1P6FA 5J9PA 1KB9J 5TF1L 4XNMB 4APQC 3S97C 3ULVE 2X9WA 3WUZA 4HCRA 4PRDA 2J12B 3H0TB 2MQ3A 4LPVA 4OD3H 1OL0A 2LE9A 2GTZB 2R4SH 4XPHH 2XKNB 5ITBL 4L8CA 2V5YA 2GT9A 1VKXB 2B2XH 1KIRA 1R3HB 1L4IA 3A6BL 1IGIH 4MXQD 2VDOH 3HC0B 3T04D 3CFDB 4UBDC 3OXSB 2DQCL 4R3SB 4E5XA 3CPLB 3ARGC 4A6YA 1FCGA 4HFWB 1ZT1A 2H9GA 5FYJU 4GW5B 1K6QH 3O11A 1NL0H 4FQCL 3B9KB 1BQLL 3PP4H 1WT5C 1JPSH 3H9SD 5BQ7A 4NQTA 4XC1L 1Y18A 1OPGL 3IFNL 3FQTB 2EIZA 2DQHH 2ILLA 5ESAA 5CJ8A 5TE6L 5I71C 5D5MF 4WU5A 4U3XA 5BCAA 4OLXL 1JWMB 4XNYH 5MEQB 4U31A 3BKYH 4GKZB 1BJMA 2W1NA 4JRYA 4DAGL 2M8XA 4MJIE 1MCOH 1RI8A 4APQD 2EXYC 1LK3H 5EFIB 1T83A 3IXAB 4WI5A 1ND0B 4XCCH 1M71A 1KELL 4NT6A 3DURB 4PV9B 1KG0A 1XIWA 1A0QH 4AK1A 2Y6SC 2EEBA 5E8NA 1IFHH 4ZFGL 4XP1L 5CEXA 2ZCHH 2J8HA 3C6LB 1VPOH 4UBDD 3MMEA 1U8QA 3SY0B 4PJ7B 3ARGD 3KAAA 4KV5F 1CXLA 3QUXB 4LCWB 4KTDL 3W9DB 1NEZA 4PJBA 3RIAF 3M8OL 2GJ6D 5IR1A 3QDGD 2NXZC 4HKXA 5T1KD 3REVA 3DGGA 5IT2L 4OFYD 4AMKL 1S5HB 4DGYH 5EBMB 5CGTA 1I1YA 2R15A 1B90A 1UCBL 5DUBB 1DUZA 3IXTB 1JTTA 2H6PA 5HSFA 2BC4B 4HPYL 2ATPA 3DO7B 1XR8B 1G7LA 4MNHB 1TCRB 5AG9A 3D0VA 2GJZA 3GSVB 3ZKQD 3AFLA 4B0MM 3JZ7A 4PY8I 3JSSA 3GMQA 1YZZA 1NAMA 4OJFH 4MDJB 2GIYA 2OTPA 4BA8A 1BQSA 5B39A 2PO6D 5IKCA 1CD8A 1NGWA 1FBIL 4IMKA 1TETL 3TIEB 1JHKH 4RMUA 4EUPG 3RWGB 4GUPA 3LS5L 4P23A 3EDFA 3KPSE 4FZ8H 5IB3B 3O41A 2MTPA 5JDSA 5C0BE 1R0AL 2NXZD 5TPWL 3SKJL 3TBVB 1T1ZB 4OUUA 3LAFA 4L8SB 1FHGA 3WS3A 1S3KL 3DUHA 4I3SL 1EO8H 4OZGF 2WBJC 4JFDB 5AEAA 3SKMA 4ZO7A 1MHCB 3PWUA 3GMMA 4Y4HA 2DLGA 1Q9WA 4PJHF 2F5AL 3VH8G 4R90H 2D2OA 3D85D 3G5VA 4KQ3H 3RDTC 1I1RA 5JXAH 4P5TC 4K3GA 1ZA3B 2XZCL 3DXAE 1GH7A 3IFLH 1HHGA 4YDIL 5JQ6L 1KPUA 1TQBB 2ITCA 2Y06L 2ZCLH 2BNRD 4AM0A 5HHOB 3TPUB 2AV1A 1TPXB 1EEZA 2AVGA 3HMXL 3OAYH 5DQDL 1A6UL 3I75A 5DUPH 5BV7B 3ULUH 2WM0A 5F71A 4NCDA 4WV1A 5MENB 2Z9TA 5A3IC 1YMMA 4Z8FL 4XXDB 4I3RL 1XGTA 2AEQH 4I0PB 4NKQB 1CYGA 1I8IB 4HWUA 4OD2B 1LEGB 4H1LB 5KVDL 2I25N 2WBJD 1WCBB 4OKVB 5IB1A 1NKRA 4OQ1A 1NUFA 4R4NC 4AIZB 2R23B 4DVBB 5DJZA 4KDTA 5DVOA 3SPVA 5TE7H 4HJJH 1OSPL 1P4IH 3RDTD 3MV8A 4QCIA 2P5ED 4P2RE 3L3OB 2GTWB 4K9EH 4P5TD 3EJZC 5FF6A 5ENWB 1NGYA 2A2QT 3CIQA 4C56D 1QPPA 2V9TA 3HS0A 4XRCA 5DR5L 2W60B 2EDQA 4K2UL 4G6KH 2EE9A 2R39A 2YPLA 4I2XB 1UJTA 2AK4E 2CJUL 3KYKH 4LEOA 2OJZL 4XBPA 1RUMH 5DVNA 2XOTA 2Z31C 3NZ8B 1D5ZB 5A3ID 4LARH 3PJSB 1CDUA 3OG4B 2P42B 1NBYB 2AABH 1NGXA 1OAKL 5IB2B 1UXSB 2X9XA 4GRLC 4IRJC 5F7HA 1F6AA 3X3GL 3V6ZB 2WINB 2XWBA 3VFTA 2NY5C 1AXSA 3FMGH 2WW8A 1I3UA 1T21A 1WBZB 3BMVA 4R4ND 3SQBA 4N90D 1D5MB 5E8EB 5BS0E 5DSCA 1FG2B 3BKJH 3CZFB 4Z78B 1FFQA 3DLQR 4YC2C 5C09A 5JA9A 1WZMA 4FG6D 5IP4A 3BIAX 2JIXD 1LO5A 1QACA 5JPNB 3T3ME 1SEQL 2VTFA 3FCTB 5LQBL 1UC6A 3VXNA 4OCWL 3SDAD 4EDWH 1CXEA 5CLTA 1JV5B 4HS3A 1JF5A 4O02H 4EN3D 1JPTL 3WHXB 5L2KA 2Z31D 2HRLA 4J3TA 4NQSA 1IAMA 2W0FB 1A7QL 1W0YT 4FNLL 4QF1A 5JHDE 2IG2L 4LHQB 4BSJA 1GC1H 3RHWF 4NRXA 4N8CL 1KJVB 2R0LH 5CJXA 3V6FB 4GRLD 4H0IA 4IRJD 5AZEL 1AY1L 1J5OL 1OHQA 5HPOA 3CMOL 1J05A 1S9XA 2CMRH 1W72L 2YSSA 5TQ2H 3GSUB 4ZODA 3BX7C 3D18B 5GS2D 1AO7D 4NO0D 1J8HA 4EUPB 4OZHA 4YZFE 1DBAL 2EE3A 4OLVH 1EEUA 5HGDA 4F9LC 1UXWB 1IGCL 5I8KL 4HC1A 4JHWH 1FVCB 4NZDA 3NACH 4LIQE 5JIHA 5DZOA 4X6BB 3VWKB 1HKFA 2XZAH 5JW4M 3O3BA 3FOMB 5FDWA 2QBWA 1CZ8L 2W38A 5F97E 3CSYB 5T3ZE 2NCMA 4U6XB 4Y4KA 4P2OC 3PWLA 4PJGF 3L3JA 3MRGA 2P1YA 4G7VL 4WHYH 1KLGA 3KJ6L 2VXUL 2P7TB 3G5ZA 5A2KH 1IT9L 2WNGA 4DGIH 5C71A 2FYYB 3U79A 2CLZA 4HJGA 4P3DB 4N0YH 3S35H 1T0NA 3BP4A 2R56H 3CLFH 3T77A 4CVZA 1KYOK 3ZE0E 4PJ7E 3THML 3BRFA 3PUCA 5GGTA 1RFDH 4LCWE 5GGSB 1H5BB 3IKCB 2ADGB 3WFCL 2VISB 3QWRD 3QIWC 5KVEL 1BQHG 3JVGA 1WWBX 1FL5B 4DZBA 2CIKB 4AEHH 3EOAB 4NDMA 4JJHA 4PYHA 3A67H 4W6WB 3T0VA 2K7QA 2J88H 5KVMC 1XF1A 4YXHH 1QEWA 4JFXA 15C8L 1F6LL 4XVSL 3BO8A 5L88L 1O5DT 2VIRA 5CJQH 4TSAL 5C0AB 1X5LA 2MHAA 2XQYK 4P2OD 1A3RL 1I1AC 3U6RB 1EDQA 4Z0XA 3OG6B 4HEPG 4JQVA 5A43C 2GSGB 4LGRB 3ETBF 1PKQA 5C9JA 5T1MA 5C2BL 4G3YH 1JGVL 2JELH 1FH5H 1X6LA 4QNPE 5DJCA 5CSZB 2E8ZA 3WJJC 3GKWH 1MI5D 5E2VH 2GAZA 1KB5H 1XZ0B 3HNTH 1P7HL 5DEFA 1R24A 4ODBD 1IZJA 2WLZA 1G7HB 1OB1A 1AHWA 3EO1B 4IOIB 3SJVB 3O9WB 3UPCA 1P6AB 5F7WC 4UTBL 4GG8B 3QIWD 4Y16D 1YN7A 4G8EB 3GSRA 4L1HA 2VZSA 4ACPA 4ERSH 4PJEF 1J18A 1ORSA 3F65A 4YFEA 2Z35B 1KJ3H 5KTEH 1OAQL 4Z7UF 3ARTA 3DWTA 5GRYA 3U9PL 3U0PA 5AYQA 2XG5A 4JFDE 3JTSA 2A9MH 2O5YH 3GIVB 5GJTH 4DFIA 1OSZA 3MCKA 2E3VA 4K7FA 2AJUL 4I1NB 3MFFB 4ZFOL 1ZSDB 4H5SB 4HCRL 2BRRL 2UUDH 5D71H 3M07A 1X4ZA 5CJOH 1U8PB 1FL6A 1RHFA 1TJHH 3UJTH 3LMJH 3LQMA 5HHOE 4V2CB 3UYPA 5DO2C 4K94C 4NQDB 3T2NL 5FO9A 4A6YL 3X12A 4EVNB 2NY1C 3HAEG 3H9SB 4ODVL 3MRIA 3T4AA 5MENE 4M6OL 3QPQC 5I8EB 1OCWL 1A6VH 3BESR 4ZS6C 3KXFB 1UB5B 3KJ4B 5F7FA 5GRJL 5CSGA 4JG1H 2HKHH 3AMKA 1MCCA 1RZIA 2EDFA 1INQA 2NZ9D 2XZQL 4UNVA 1T0MB 5E24E 5J12C 2AGJH 4J4PA 5DRZA 4Y2DC 5C3TA 5HBBA 2QQKH 5C0NC 1JF1A 2BHZA 5EOQL 4Q9RH 2VABB 4MA1C 2FR4A 3C9NA 1Q0XH 2ZG1A 3U4BL 2H41A 1DUYA 4X7DC 3ULVH 3QUKA 4U3CA 4H8WH 4P5KB 3DX6A 4ZSOA 1BZQK 4H20H 1OGAD 5F89B 3VXSD 4X4YB 3ARGB 4I2XE 4K07A 5JORA 3EOTH 5DO2D 2BOCA 1HNGA 4NKIL 3F12B 3FTGB 2NY1D 3NZHL 4YHKL 5TDOB 3QPQD 1MCPL 2YMXH 5I1JH 4ZYKA 3RWFA 4IDJH 4ZS6D 2W9LA 4NM8L 3VG9C 1MFNA 4D94A 1A1OA 2XG4A 1OTTC 1ZHLB 4WHDA 1NANH 5DRNA 1D9KA 1T1WB 5EOCH 3DVGA 1QFUL 4A2MA 4HLZH 1NSNL 3FOLA 3JTTA 2OJEA 1U93B 4Y2DD 5CILL 5FO7A 1VFOA 2IC2A 5C0ND 3MNWA 3CDFA 5LXGH 2X09A 3L3KB 4HF5H 1ZVSA 4NM4H 1UB6A 2LAGB 3MX0A 1FVDB 4P59H 2R1YB 5E6IB 3HR6A 5KSAB 4RFOL 3ROOB 3EDKA 2FO4B 3RY4A 3QIBB 4PJFB 4V1DB 3ZYOA 4RIRB 1I9EA 2O5ZL 4QOKA 1I1CA 2VMFA 1BD2A 2VQ1A 1NAML 4Z95L 3FKUS 4DEPB 5KS9A 2X4OB 4KDVA 4YHPB 3ZE1F 2V9RA 3V0WH 4NJAL 5FECB 2R1XB 2NXZB 1JWUB 3V6OA 1EBAA 1N8ZA 4Q6IA 2O61B 1N5YH 5T3XL 4WW1A 4R26H 1LO4H 1VA9A 1OTTD 1U3YA 3PXJA 2EYTA 3TH4T 4D0DA 1WIPA 3MGTA 1H9VA 3QDHA 1JZ5A 5GGUA 5F70A 3UZQA 4K55A 5D72L 4NSKB 4YX2H 4HUUB 3LH2L 1U3ZA 4G6FB 3VW3H 5HI4C 5IOPB 2BK8A 4C83B 4RX4A 2B1HH 1BZ7B 1ES0B 1GL4B 2NX5B 3E8UH 1KCSH 2IGFH 3BKCH 1FE8L 3EBAA 3KPRD 5DK0A 5GGVL 2FX7L 4GRMA 4X98B 3CFCH 5DRWA 1NBVH 4QRPB 2YA2A 4YDLB 1MVFA 5EU5A 1F4AA 5D9SA 4EIGB 1AKJD 3B2VL 2OR9H 1LO2L 4QGTA 1NCUA 5CEZD 5DVKA 1CFNA 2X40A 1N5AB 4YUEL 1MQ8A 4OT1L 5FKAB 1MFBL 3D39B 5CLWA 3B9VA 3HG1B 2GK0B 1JZ3A 3TLRA 4F80A 2EDOA 1ZA6A 1CGSH 2JCCF 4HIJB 1UM4H 1I9RL 1FORH 1GZQA 3PF2A 4I4WB 5GRVK 4P9HH 3HFMH 1FFPA 1UVQA 3Q3GA 1KSRA 2C1PA 2AJ3A 3GO1H 3HAEB 3WFDL 4F3FB 3LKNB 1ZTXL 3VG0L 2ARJB 2VL5B 3FZUC 4LCUB 4C56B 4H25B 5DHVH 4HK3J 3EDEA 5CINL 4X4ZA 1C08B 3VFGL 1MF2H 5HGGS 5DZNA 2EH8L 3FRUB 5GS1B 3H3BC 2BVQB 5E70A 3H7BA 3I3BA 4ZUUB 5C0AE 3ROLB 5C0DA 1J12A 3L3DB 5DUML 3HNSH 3O3AA 5GGRB 5F9JB 1KGCE 3FO0L 1EAPA 3KYAA 4PRNA 1FZOA 4G6JH 1NCWH 5IQ7L 5FHAH 4KQ4L 1N64H 4RAUA 2QSQA 2YN5A 3S4SG 4NZRH 3D9AH 3F7QA 3DNKA 1FNLA 1GAFL 4KZDH 2J8UB 1FZKA 2E9IA 4E41D 1DQDL 5F6IC 3ARDC 1HDMA 3O2VH 5EC1B 5E8PB 3SJVE 3VXRE 3MRDB 3VU2A 3O6FB 4PJDE 5J13C 5I6XB 3VMNA 3GUTB 3FZUD 1I1FB 1MJ8H 4ZNEE 2H8PA 1HXMA 2Z8WC 4X8XA 1A3QA 2VDKL 2BVPA 1N59B 3RVUC 4PG2A 1A7PL 1AP2A 1LWRA 2MQCA 2VAAA 3P73A 3WN5B 5IMOA 2FHFA 5AUMA 3LKOB 1SEBB 1A14H 3O45B 32C2A 3GI8L 2YUWA 4E0RB 3HI5H 1IBGH 4QRRB 4M8QA 1N0LA 3FB7A 5IGXH 4WEBH 1WEJH 3LQZA 2VLKD 4PRBA 4GRLB 1J9CT 4JLRB 3QEGL 3KPQB 1EO7A 3TN0A 3QCUH 1L6ZA 1G9ML 2X10A 2QLVB 4PG9A 2FGWH 4NQDE 4WWKC 2I5YH 3L6FB 5EZLA 4KJYA 3H9SE 3TV3L 3WMSA 1I7RB 1OWRM 2BMKB 3GJEA 3MZGB 1W8OA 5DMKA 4YC2B 3CFBB 5C7XL 3KXFE 1BVKB 3WLWC 4GKSA 1GXEA 3REWA 4RA3A 1Q0YH 4X9BA 2BDNL 2HLAA 3RA7H 4HC1L 3RJDA 1KENH 3RVUD 3SGEH 3VXMA 2K3TA 1HILB 1OP5K 5CWSA 1FNAA 5I1AA 3SDDB 4TSBH 4XCFL 1WZ1L 4WFHE 4LVHB 4OCRL 4P9ML 1SYSA 4S1RH 2A77L 5INDB 4HWEL 4FQLH 3WLBB 1D5BA 1VEPA 2DKSA 1GPOH 3C5ZA 2DQEL 3VMPA 4O2CA 1XCQA 4FQIL 1BFTA 1CLOH 2Y7QA 3CK0L 4GW4B 1JBJA 4WWKD 2APXA 1QQDB 2GK2A 1FSKC 1IVLA 2L7JA 2GJ6E 2I9TB 3TYGL 3QDGE 1LD9A 4JPIB 5GGTL 3UBXG 3V7AE 5BOZG 1IAII 3SDCA 1E6JL 4UTAH 2FWOB 2CDGB 2CO7B 3TBWA 4Y1AB 3TO2A 2MKWA 1A6AA 1NDGB 1F4XL 4BUHA 4ZUWA 4X99A 4LIQH 4CN4A 3QCVH 4P46A 5HYQB 2C4FT 1MRFH 2X5PA 4P2OB 4MA7H 3SHSA 2FSEB 4PRPA 2JB6B 1KNOA 4LLMB 1JGLH 1CD0A 5T3ZH 4OSUH 2CK0H 4MA3B 3BVNA 3T3MF 1Z9SA 4LSDA 5GISH 4KK9C 4OV6F 2IF7A 4XMLL 4V1DE 3OSKA 3P4MA 2V2TB 4M6AA 3PV6B 2W07A 3L3IA 4XPBH 1MLBA 5EPMB 5IJKC 4L8DA 3FO1A 4NNYB 5IF0B 4KU1A 4NZUL 4WUUB 5AYUH 5TFSH 3GNML 2B4CC 4N8VB 4CW1A 3DHMA 4XBGA 1UJ3A 4KXZI 4K3JH 2C3XA 3P0YH 2IBZX 3ARQA 3L5WA 4L4TA 3FHAA 2Q87A 1KXQE 2CH8A 1K8IB 3BP5A 2BNQB 2EKSA 2GUOA 1OOAA 3NCJL 3S4SB 5K9OA 2AQ3A 4LSRL 5I16B 1P1ZB 5I73B 3LKPA 1BFVL 3QZWA 3NN8B 1TVBB 1I1AB 4HEME 5C2UB 2NX5E 3MRFB 3VD4A 1MFEH 2VDPH 5ADPL 3ZTJG 4OZ4A 3CDYA 4EDXA 4KK9D 4YBLC 1AQDA 5D2NC 4B41A 2QSVA 3QHFL 1TFHA 5DLML 4U0RB 4QRPE 1KC5H 3QDJA 1CE6B 4BK4A 2ADJB 1I7UA 4HK3N 4G5ZH 3Q6GL 3IKKA 4LVNB 4EI5A 1WISA 4AH2B 3V4UH 2CGRH 3VDAA 2Y07H 3WNNA 5MEOA 2E7LC 3HC4L 2ZUSA 3MLTA 3F7VA 3AMLA 4Y4FA 3UBXI 1FGNL 4Q9QL 1H8OA 5D1QB 3UTZA 2EDXA 4YWGL 5J6GB 4JKKA 3HG1E 5HYEA 2C3WA 3STLB 2D3VA 4PY7A 4W68A 5HVFB 4WUKL 3ME0A 4CADB 4LCCC 1YJDL 2QHLA 1HQ4A 5JNYA 4H88H 5DTFA 2L0DA 1AD0A 4QHUA 4K3HA 1ZLWH 2R0WH 2UWEB 5HI3C 1X5YA 2RIKA 2VOTA 5CP7A 1MLCA 4HFUH 1W0WB 3B3IA 3FQWA 4C56E 1EO5A 3FO9B 1T2XA 3NFSL 5ID1B 3MLYL 2EDWA 2UYLB 1RY7B 3BFOA 4BFEA 3LPWA 4LPCA 1IJ9A 1CK0L 1ZHNA 3IT8D 4PBVC 4G9FA 1QSFD 1GCFA 4PRHD 4QGYA 3W0WA 3G5YB 3EYOB 1J87A 1NUNB 1RZ7H 5CCKL 1AI1H 4QNPF 3OR7A 3DVNA 4KK6D 4X9HA 2LAAA 1MVUB 4JN1L 1A7OL 1MFDL 3CXDH 2VN7A 1A5FH 5L6YL 4ELMF 2PF6A 3Q5TA 5KSVA 2A73A 1XH3A 4P23D 5LBSL 5JLZA 2VXQL 1DBJL 2J8UE 4BQ6A 4XP9H 5ETUB 1E4KA 2WK2A 2HWZL 1QPXA 5IVOA 1UM5H 1ZVHA 1MHEA 4O9HH 4LLAA 2YUZA 5E8DH 2YK1L 4GQ9L 3FFCA 3GKZA 2R2EB 4BQBA 2WBKA 5HI3D 1KPRB 3FAWA 4M1GH 5AD0B 1T5WB 5E5RB 3UTQB 3EYFB 5DURD 3TM6A 1HOCA 5LAXB 3S37H 4Y4HD 3U0TA 3MUY1 4G7YL 4JRXB 3ECBA 3RP1A 1IAOA 5C6PB 4FFZH 4R4BA 5LWYL 1YEDB 1EZVX 2DJUA 1EJOL 3CGTA 3WKNA 1JYXA 4FN0A 4MSWB 4O51B 1QA9B 5I1DB 3ARVA 4QRRE 4Q2ZA 2D9QB 3HC3H 4NP4L 3W39B 1C5CH 5I1GL 3NIFE 1D6EA 2V17L 2MCPL 2F19L 4JHZA 4JVPA 3UYOD 4Z0BL 3HI6H 3DOSA 1JWSA 3CDGB 5IESH 4NRYA 1EHLH 4NHCL 1KN2L 5ICYA 1KB5A 3KGRA 5HPMA 2W0KA 1EFXB 1NMAH 2DL9A 2AK1L 3K2UH 4JFOA 5C08A 2NLJA 1I4FA 4X6CA 2I26N 3X14B 2AJXH 1IGML 2R0ZL 1A4KA 3AXLB 3TBYB 4LPWA 4TUOB 5H94B 3FL7A 4FQXA 3CFJA 3OB0H 3N85H 1G7MA 2PW2B 3VFRB 2QR0A 3ZT6A 3MV8D 2X9YA 3RWHB 1IKFL 3MREA 2AI0H 3OPZL 4BH7B 4MJ6A 1CTOA 5FYLL 3WXWH 2FIKB 3L7FB 3FT2A 1FPTH 3HZVB 3BQUA 2XWTA 3GI9H 3QFDA 3VGAC 4ODXA 2A83A 2PXYB 1DJSA 2FL5B 2Y9RT 3PWNA 1J0IA 1J0HA 4RWYH 5EUOA 1NC2A 4NKMA 3E6HB 1EV2E 4OD3L 5DQ9A 2R4SL 4HUMB 4CJ0A 3FT3B 3S5LB 1U8IA 2B2XL 2K1MA 1JHLH 3NGBC 1T1YA 2GSIA 1IEAB 5GZNC 2R2BB 5EO9A 1F3DJ 3MBEB 3DROA 4IOSD 4LDEB 4NKDA 4MAYC 1M7IB 1OTSC 4YK4C 3VRJB 4P4RB 1UADC 3WO4B 5B3JE 1K6QL 4Q0XH 2NNAA 2ZUYA 4LK4A 1TENA 2HN7A 1PDKA 3MJ7A 1AFVL 4BFIA 3PP4L 1JPSL 2E6PA 4P4KC 5H35A 4R8WH 4L3EB 2EDHA 3TPKA 1CLYL 5HVHC 3WNMA 2DQHL 4YXLH 3H3PH 5E9DB 1UWEH 2IAND 4ZTOL 4YE4H 1IGYB 3BP7A 3SO3C 3BKYL 4X6EB 2EDJA 4G8IB 1A2YB 4KRPB 4G43A 3GMNA 2DLHA 1MCOL 1S7WA 3DUSA 3QFJD 1OT2A 3U83A 1EEYA 1LK3L 3GGWB 1BLNA 4XCCL 5K9QG 1MCLA 1OWWA 5L2KD 5ILTH 4RAVA 4M4PA 4LU5H 4WUUE 1A0QL 1HHJB 5SWZB 1EHNA 2WIMA 3K8MA 1IFHL 4L4VD 5D7IE 2ZCHL 3HI1B 3Q6FB 5CIPA 4R7DB 1VPOL 1OLLA 3MNZA 5L0QC 5K59E 4HXAH 4PREB 5IB5B 3RVWC 4F7EA 5GZND 1A1NA 4HKBB 1NCCH 2GCYB 2BVTA 4W4NA 1OTSD 3NFNA 1E6OH 1N4XH 4WFFD 4LHUD 3K8LA 3QJFA 4KROC 1J8HD 5DD6A 1U2HA 4IRSC 2IFFH 4DGYL 1HH9B 1S8DB 3O6KH 3ILQC 1JPGA 4NZTH 2ICCA 5ACMA 4JAMA 2H26A 3TP4A 4MJIA 1G6VK 3WFEH 3FRPA 4YHIA 3VXOB 4JM2B 3ARDB 3T4YA 3QUYB 2YBRB 3V5KA 4TQEH 3DI2B 2B8OT 2W9EH 2D0FA 1S7TB 2XIDA 4OJFL 3KR3L 4YPJA 1GOGA 3UC0H 5D6CB 1GOHA 4HMCA 1AR2A 1G7QB 1Q9KA 5GIRB 1AXTH 1AGBA 5IHBA 5BVJB 1NGZA 4MLSA 5IB4B 2M2DA 4R0LC 1DBMH 1T4KA 2DWDB 1H3PH 1S5IH 1UM6H 4KROD 5EU6D 3LKSB 3QULA 4N5EC 3MJ9H 4MGXA 4IRSD 1B4RA 4HQQH 2BY1A 1F4YH 3B9EA 4WEUD 3H6JA 1KEMH 2UWEE 4M7LH 1TZHB 1EO8L 2AEWA 3DVFA 1WZKA 3ILQD 2RFXB 2AXGA 3L3GB 3QQ4A 1AC6A 3TNMB 2ZJSH 1X6NA 3QI9C 4R90L 2QHRH 4HUWB 3KS0J 2EXWD 4KQ3L 4WWKB 5K9QI 5JXAL 1ZEAH 5IMLB 3RWDB 4RA0C 2X4TB 1LGVA 3IFLL 3IJYA 3BSZH 3R1GH 1A6WH 2DI9A 3PGCA 4C55A 3AAZA 2FJFA 2VE6A 1PX4A 2V2WB 3LEYH 3QWQB 1G0DA 5T33H 4KI5D 5DUPL 5ADOH 3W9EB 4U6VH 5FO8A 3KPSA 5EN2A 4POZC 2NY4B 5C0BA 4N5ED 5HY9B 4UT6H 1N3NB 4Q6YA 3FQRA 1TITA 3F5WB 4FXKA 3ZDXE 3QEQB 1X5AA 4LGSB 4DTGH 1ORQA 1I8LA 5H37G 3T65A 1XF4A 1S9YB 5DJYB 2BXZA 4JB9H 1ERNA 4LDLB 4M5YH 3M1BA 2P49B 3E3QC 3TNNA 3ZO0A 3CVHH 4YHNA 4ETQA 5TE7L 4HJJL 1P4IL 2V9QA 4HK0B 4JRXE 5GSVB 4D9LL 4K9EL 5DHVA 5EBWB 4KI1A 2OP4L 5HHQB 4X80H 4NFDA 2JB5H 4PGCA 3CXHJ 4G6KL 3C60A 4JE4B 1ZT4A 1SYVA 2FECL 3MLRH 4JO4L 1NCDH 5I1EH 5F1NA 3KYKL 1QRKA 3VGDA 1RUML 2EYSB 4X5XB 1BWWA 3S35X 2V7NA 3AB0C 2Q3AA 5IEHB 3VFUB 4LARL 4KWUA 4UV4H 4QLRA 1UACH 2Q7YA 4JPVH 3VRIA 5C0JA 2AABL 4QHMB 4OTXH 4MXVF 3MV01 2W0LA 2MKLC 4QEGA 4DKEH 4L9LB 4PFEA 2P46B 3I9GH 1U8HB 1U92B 5FGBA 5C07B 3R06A 1LNUB 4OCXH 3AVEA 3FMGL 4KPHL 4P2YA 5F8RC 5DD0H 5EBGA 3QRGH 3O8XB 4FHBD 3BKJL 3P3YA 2H1PH 3MYJA 2MPAL 1OAXH 3EYUL 4P2RA 5IW6A 1T3FB 4G42B 3K7UA 2OQJB 2ZZUT 1O7SA 1BECA 2HJLA 5D8JH 3CX5J 1CBVH 1RHHB 4O02L 1P9MA 2I9LB 2CSPA 2YZ1A 1ZGLB 5FM8A 2YEZB 5GPRA 5ABDE 1GC1L 1T7VA 3RZCA 4Y5YC 2DQUH 4LLDB 2R0LL 1MCWW 3EFDH 5H2BB 1V5JA 3V8CA 1WFUA 3GSQB 1D9KD 1O0VA 2HMIC 1Q9OA 4TYUA 5MEPB 4BSWB 5D2NB 4GXVH 4MJ2A 2CMRL 5KN5A 4IDLA 1G7PA 25C8L 5TQ2L 3VFWB 1X5GA 4OCMC 1Q1JH 1GYAA 4U6HB 3WUWB 1CFQB 2ZSVA 1VFUA 2YWYA 2AERT 4PRHB 1C5DB 4L3EE 2ZOKB 4WW2A 3F6IA 5EORH 4JHWL 4PGEA 5E9DE 4TUJA 4PJFF 3FB8B 1CICB 4XPTH 4CVXB 1MRCL 2XZAL 3EOBB 3P77A 4RAHA 2DYPA 4LHUG 3SCMA 3G9AB 1NCAH 2I27N 5F7KC 3E2HC 4GRWE 2Q3ZA 4LCCB 1NFKA 2E6JA 4XNMA 5ERWB 3NABL 1QRNA 1X5KA 2VXTL 3D25B 1UYWH 5JHDA 2B5IB 4LPXA 5SWZE 3P30H 2DMBA 2VWEC 1ZLVH 3ZL4H 1DQTA 1VKXA 1L7TH 5GRZA 4DGIL 5F7EH 4N0YL 3S35L 3WNPA 3CLFL 2C3VA 2R56L 2XQYG 3CFDA 3HAEH 3OXSA 4GFTB 4QXGH 4R3SA 2HMID 3GHBH 1Z9OA 3TWCH 4HFWA 2VNCA 1RFDL 4GW5A 2QADB 4NIKB 5I18H 4GAGH 3WL9B 2FHBA 3B9KA 3VFSB 1NC4D 6FABH 2HFGH 3JUYA 4GH7B 4ZD3H 3GM0A 4PD4J 4UQ3B 3C8DA 1WBYA 3A67L 5D70H 3ARWA 5C0EA 3EFFB 4TTDC 1CDIA 2J88L 3L5HA 1JWMA 4YXHL 4OZIA 1AQKH 3RGVB 3V95A 4GKZA 3QO1B 5ALBL 5CJQL 3GB7B 1T03H 3T2PA 4IRZH 1RUQH 4B5EA 5EFIA 3SE9H 1DEDA 1ND0A 5FYKE 3OGCA 5F6HI 5D96B 2DLTA 3CH1B 3DURA 3LPFA 4HV8B 4HZLB 5FYLD 2JELL 2BY2A 1FH5L 2C9AA 3NCCB 4XXCA 3PWPD 5KBNC 3MRPA 4HZAA 5J1AB 3MC0A 4PUBL 5E2VL 5HDQH 1KB5L 3HNTL 4G6AC 4HIEB 4JZJB 4PJ7A 3O0RH 3HTLX 4ETYA 3U46B 2LU7A 1UEMA 1DANT 3MBXH 4LCWA 3U2SA 1KXTB 1AGEB 5E6ZA 3MACH 2I24N 5HJ3B 4HBCH 4QWWC 5FUOH 3BPNC 4LNVA 3CUPA 1MY5A 2NY6B 4ERSL 1WV7T 2X4NA 2AEIT 1KJ3L 5IWLA 5KTEL 1VADB 4OFVA 1S5HA 5EBMA 4TTDD 1HXYA 2VLJB 1RZGA 1CGUA 2O5YL 5GJTL 3MRLB 5HGHA 1VFBB 4G8FA 4I18A 3MOBH 4PS4H 1UG9A 3RUGB 2NY5H 3FT4B 5GS2H 1TCRA 1DCLA 5D71L 5DS8B 8CGTA 3GSVA 4U1IB 1BEYH 1UZ6E 2BSTB 1JNNH 3H9HA 5CJOL 3RTQB 3WE6A 3U7WH 1MCDA 4MDJA 1TJHL 3UJTL 7CGTA 3LMJL 5EIVA 2JJUA 4ONHB 5FB8B 4S1DC 3OKMA 1HEZB 3GDBA 2J8UF 3K74B 4PTUB 5DD1L 1ONQB 4X6DA 3TIEA 4PTTB 2VB5A 3S88H 4DUXA 3B8YA 3TO4B 3WEXB 3ZKXC 3RNQB 1HHIA 2AJVL 3MNVB 2AXJA 3BMWA 1B4JH 5TH2A 3HZMB 3HPJB 1A6VL 5ACLA 5C9KA 4QWWD 3STZA 3MRKA 3C8HA 3SGJC 4RMWA 1FNGA 2HKHL 1CU4H 4JG1L 1F90L 2VR4A 5E1AA 3MYZA 2YKLH 2AAVA 1K85A 3GEWB 3QEQE 5FGCB 4JFDA 2AGJL 1MHCA 2NMSA 4Y2OA 1YEHH 1T04B 5I1HH 4Q9RL 1REIA 3UTSB 1Q0XL 1JIBA 2OTUA 1ZHBA 3RQ3A 4JY5H 3ULVL 4H8WL 1U3HB 3T8XB 4U2YA 1A1MB 3QHZH 2MNUA 2YC1A 4D0BA 5D7JA 3HKFA 4NGHH 4WU7B 4BK5A 4NPYB 3MUHL 1OP3K 1LEKA 5HHOA 4MAYB 3TN0D 3EOTL 2CK2A 2FDBP 4S1DD 4XMKH 4YHOH 4LDOB 2BXYA 2LQRA 3L3HB 1CG9A 4P4KB 4WDIA 1OW0C 2YMXL 4IDJL 4XXDA 1ZLUH 4LSVH 5CEYB 1LP9E 1I8IA 1LEGA 4WI8A 1N2RB 2BFVH 1RUKL 3GMRB 5C07E 3SO3B 2ATKB 4OKVA 5MP6H 1DVFA 3QXUA 4DVBA 1P84J 2P8MB 4ZS7L 5HHMB 5LXGL 1CVRA 1G1YA 4HF5L 4M61B 4NM4L 1YUHB 2IQAA 1RURL 1ULVA 4P59L 2GTWA 2FJHB 1R5WA 5ENWA 4UIMA 4S1QH 4XP4H 3LKRB 4WHTB 2W60A 4I2XA 3C5ZD 3P9MB 3I02B 4D9RD 3KPOB 2Z92B 3IU4H 4HT1L 4YFLI 3NZ8A 5EU6B 5TDNA 1XGPA 1XGYL 4IRSB 2F8OA 4KGJA 4XC1H 1FFNA 1N5YL 1NBYA 5B8CC 4JCLA 3VFOB 3WNKA 5KANG 3OHXA 3SDCD 1LO4L 5IB2A 3H8NA 1UXSA 4X9FA 2H2SC 5TE6H 4Y19B 4F2MB 4IEFB 3V6ZA 2WINA 3NOIA 5D2NE 1IAIH 4YX2L 2Y5TB 5I9QB 1FNHA 4WO4C 1D5MA 4M3KB 2WANA 1FG2A 1RIVL 4GAFB 2DM2A 3E8UL 2X4RB 4PRHE 1FFOA 1KCSL 3BKCL 1H8SA 4UNTA 1DZBA 4RDQF 1GGUA 4DUWA 3P9LB 5JPNA 1A47A 3CFCL 3FCTA 1NBVL 3OR6A 2ICWI 4KUZH 2YR3A 1JV5A 2OR9L 3ARPA 3UPRB 2G2RB 4XH2B 4KTDH 3B5TA 4RQQB 4EXKA 7FABH 1JZ4A 2W0FA 1KULA 4R7NA 4L4TD 1KJVA 2X7LB 2Z91B 1CGSL 1E27B 2H2SD 3DPBA 3V6FA 1UM4L 2HRPL 4KXZH 3ZHDA 1FNFA 1MJ7H 1LO0H 2IPUK 4P9HL 3B9DA 3HFML 4JFPB 4PIRF 3D18A 1MCHA 3QI9B 1D6VH 4JFYA 5GGSY 4OF5A 4OM0L 4WO4D 4YXKL 5K93A 4EUPA 5JXEC 3GO1L 2R2CA 3KLSA 2I07B 4HX1A 4CDHA 4Z6AT 1IEHA 4K94H 2BHUA 5SV3A 3L9RA 5JW5B 3C6SA 4LLVB 4DKAA 3MSPA 2QQQA 3PQYD 3CAFA 1XGRB 4X6BA 2OCFD 3Q5YA 4XVUC 2QTEA 2DI7A 1MF2L 5CJ5A 1CQYA 3FOMA 3QO0B 5CBEB 1U6AH 3VJ6B 3QDJD 4HBQA 4M7ZC 3CMGA 1LE5B 1OTUC 2R2HA 1MSPA 3VH8A 5IVXA 1YYML 3C2AH 1FV1B 3HNSL 1V05A 2G75B 5K9KB 2YPKB 3O4OB 3RBGA 4NFBA 1I8KA 1NCWL 5EOCJ 5KANI 3J7HA 5FHAL 1N64L 4QRSB 3D9AL 1S3KH 5DJ6B 1RMFH 4W81A 4O4YH 3QG6B 2VQUA 2PNDA 3C8KB 5JXED 1H5BA 3IKCA 2ADGA 2X4UB 4NJ9L 1JN6A 1LK2B 4AEFA 2VISA 4UAOC 2UWEF 1Q9LA 3V5HA 1FL5A 5SX5H 1FN4B 5CD3B 2C1OB 5CJBA 2BP3A 2CIKA 1K4DB 1MJ8L 5E8OA 4U1NA 3ZLQC 5HGBA 1CR9H 43C9B 4JGMA 4XVUD 2Y06H 5EIIB 3HN3A 2VLJE 1OVZA 2W0PA 3KYNB 4CKVX 5IMKB 1QYGH 4POYA 3ARFB 4JO1H 2WZPD 1EERB 3NTCL 4JGJA 2EC9T 1A14L 1OTUD 4OQTH 4HIIB 3RI5K 4OI8A 3DMMC 3W0WD 1IBGL 5F9WB 3IFOB 3U6RA 3VD7A 4J3XA 2GSGA 2VXVL 4WEBL 1WEJL 3ZSTA 2ZUUA 1G0XA 3OKDB 4OFPA 2AJZB 3QCUL 5KVDH 4DJMA 1XZ0A 5F7DA 2FGWL 4IOFC 1IC7H 5J3HD 1G7HA 2I5YL 4XCYA 3X13A 4D8PB 3EO1A 3SJVA 3O9WA 2E8YA 2ZKHH 3VXRA 2EC8A 1KLFA 4F57L 5EH1A 2W65B 4PRIB 4PJDA 4GG8A 1UFUA 4KJPC 4G8EA 1BREA 3FFCD 4JFFB 4WI3A 3ZDXF 2FBJH 3QQ3A 1Q0YL 3MCLH 5D2LB 1U8KB 1IRAY 5CEZH 4MD4B 2Z35A 3KYOB 1IGJB 2UZIH 3RA7L 4J2XA 1KENL 2RB8A 4AENB 4KAQH 1Y0LA 1FVEA 5D1XC 5FGCE 2ESVB 2P5WD 3WSQH 3QFJE 3ARSA 1SMAA 3ZTJH 3MFFA 5DGQA 5JO5B 3LD8C 3UTSE 4KUCF 4YO0A 2WP3O 1FZJB 4S1RL 5DT1H 1OAKH 5BRZB 1FAKT 3BQUC 1XGUB 4FQLL 1U8PA 2GHWB 2IADB 5L7XH 1B6UA 2WAHA 3BWUC 4KGLA 5FUZH 1CLOL 3VXPB 4IOFD 4NQDA 5DQJA 1TXKA 1NC4B 3BPLC 4PBWD 3H9SA 1NLDH 3NPSC 5I8EA 3HE7C 3BT2H 5LVEA 1KPVB 4WY7H 3TZVB 4GG6E 4PR5A 4QYOB 3KXFA 4KJPD 5IROA 1UB5A 4UTAL 3F7YA 1F5WA 3JV6B 4PRAB 5D5MB 3R8BB 1BFOB 3EYQC 4LIQL 5LQBH 3QCVL 1T0MA 5FAAA 5LGHH 1WAAA 3S9DB 4OCWH 1QG3A 1TJGH 2X4QB 3E2HB 1AGCA 3GHEH 3SKNA 1MRFL 2ED8A 3TH2T 4FQXD 4MA7L 4APQA 2VABA 5HHME 1JGLL 1RULH 2BHYA 2M1KA 2RR3A 4GRWH 4OSUL 1B0RB 5T3ZL 4PJ8C 3BN3B 2CK0L 2YD3A 5DWUH 2IG2H 2VZOA 5GISL 3PWPB 1KN4H 4DVRH 3KWWB 4F15C 5FA3B 3CVHA 3NA4A 5C1MB 3BQUD 4R2GC 4AT6B 5F89A 4F7PB 1Z0NA 3WFZA 4X4YA 4XPBL 1J5OH 3ARGA 2NW2B 3D2UB 3IGAB 5AYUL 3QISA 3PIQA 1S7VB 2ADFH 1JP5A 2GJ6A 1YNLH 1WT5A 3FTGA 4K3JL 5EU6E 2CIIA 2EDEA 3P0YL 3QDGA 4X5WB 3HE7D 1GHFH 1CXIA 3MRBB 5I8KH 5KAQF 1JYVA 1VDGA 4Q74A 4FTVB 1ZHLA 5A40E 1ZT7B 4ELKB 1T1WA 5E56A 1JYWA 4QHLB 1FL3A 4GBXB 3AU1B 2E9BA 4J3SA 1QZ1A 4WNQB 3QUZC 2YN3A 1RZ8A 4G80A 5TF0A 2XY2A 3BD3A 2ZUTA 4PJ8D 1MFEL 1NMCB 4XAWH 5FYKH 2VDPL 3B5HA 1BQHA 4F7MB 4F33A 2R1YA 1J11A 1Z2KA 3KJ6H 1W8NA 3C5JB 2DBLH 3BEWB 5CZXC 1CDYA 1IT9H 3BN9C 4R2GD 1B88A 4MD5A 2AXHA 5GS0L 1XR9B 1KC5L 2GI7A 1Q8MA 2X4OA 4Z7OE 4G5ZL 4YHPA 3V4UL 1P7KB 2CGRL 2Y07L 3MRCA 4LGPB 3DTXB 5FECA 4JCMA 3AS2A 4JVUA 3RX5A 1H15B 2O61A 5AWNH 4ZOBA 5MERB 5DXWA 3EHBD 3S34L 1EAJA 2ADIB 3GMOA 2EDBA 3QAZC 4OZGB 4YBQD 4MCZB 4U1SB 4XC3H 4H88L 1HHKB 2WWMC 1TVDA 2LVCA 1B0GA 1R5IA 2PYFB 4C83A 5L2JB 3G04B 2R0WL 1ES0A 3LPGA 3D6GA 1M05B 5DFTA 4HFUL 5CMAB 5B22A 5B4MC 3MLXH 4X98A 1QBBA 3BHBB 1JGDB 4MJID 4QRPA 2JTDA 2KZWA 2X1QA 2J5LC 3U30C 1RV6X 4JM2F 4NC1E 1IC1A 4HIXH 1NQBA 3CFKB 1XEDA 4JFQA 1RZ7L 3QNXA 1EMTL 4BZ2H 1AI1L 4UTBH 3HE6B 4IIQC 1QUNA 5CKGA 3HG1A 2GK0A 1A5FL 2BY0A 1E4XI 4M43H 4Z7QE 1U8NB 4ZO6A 4XP9L 1QLRB 1Y6MR 2WWMD 4OF3A 1UM5L 4XCEB 2IAMC 3BIKA 4O9HL 3RDTA 3HAEA 4P5TA 5D1ZC 1ED3B 2ARJA 2BOBA 4HCRH 3VA6A 3TT1L 4DGVL 4M1GL 4LCUA 4C56A 4H25A 5B4MD 4MNGB 2D03H 4X8JB 1C08A 2ZUVA 4IMLA 2IBGA 5DA4A 5D6DC 1PYWB 4JQIH 4FFYH 3V9FA 1X44A 4FFZL 4NN7B 2FRGP 1TDQA 4ZUUA 3ROLA 4YHYC 4DUVA 1FDLH 4DOHB 4M6OH 5GGRA 1UZ6F 1OCWH 4P2CG 5BO1H 4M9OA 3HC3L 1C5CL 3DX8A 3BI9X 1PZ5B 4Q7DA 4XNZC 1S7SB 5I74C 1YPZB 1IM9D 1BGXL 1BJ1H 1JHTA 3HI6L 3VFPB 1JJUA 1KCVH 1WFTA 1EHLL 5C0BD 5BXFA 2IAMD 3MRDA 4MJ4A 3FO2B 3MLSH 4I0CC 4PRIE 3LSOB 4RFEA 4NHUB 2Q6WB 2D7OA 1NMAL 5D1ZD 4JPWH 1CN4A 3WFHB 4JFFE 2NY7L 1JRHI 2B4CH 5D2LE 5E00B 2AJXL 5JIKA 4LBEB 1LEIB 2X4PA 1V3LA 3N85L 2ESVE 1ADQH 3E6FA 1MCKA 2Z31A 1M7DB 4NWTL 4PJAB 1GOFA 2CLVA 3LKOA 4XX1G 1SEBA 1S7RB 1J1OH 2EZ0C 2AI0L 3DXAD 4YHKH 2X70B 3QIUB 2ID5A 1DDHB 4R96B 3I6GB 3WXWL 4AEIL 2XN9D 4XP5H 4XWGL 1UT9A 1FPTL 4GRLA 5BRZE 3MGAA 4IRJA 4UUJB 1TTFA 1Z0MA 3KPQA 4RWYL 1U8LA 4UMGA 1NSNH 1AO7A 1P7QB 4NO0A 1L9MA 2BCKA 2YD5A 4X7TA 5TQ0H 3BW9B 1W0VA 5EU7C 1I7RA 2BMKA 3BJLA 4NRZB 1JHLL 1U41A 3QA3B 4EEEA 3PQYB 2P43B 2JJTC 1LDPH 3RVXC 1A6ZB 5D5ME 2P44B 3I84A 4Q0XL 1P4LB 5IBTH 1JGEA 3IJHB 4KHXH 4RISH 4R8WL 4NUGH 2IALB 4RGMB 4P2RD 4YXLL 4KKAC 4JHBA 2EZ0D 1F2QA 2NR6C 1NKOA 1UWEL 4F7TA 1JZ7A 4YE4L 4ORGA 2VWEE 2AEPH 4NO5A 4BM7A 3PWPE 3JWNC 4FQQB 2HVJB 4PY8J 2K7PA 4O2FB 4EKXA 2AK4D 1SJHA 3IDJB 3BE1H 1MREH 3B6SA 2KUTA 5ILTL 5D72H 3IFPB 4YR6B 4WENB 1QQDA 3QWRA 2I9TA 1A7BA 4JPIA 4F9LA 4HXAL 2OM5A 4YDVA 4OCLC 1FP5A 1R3KB 2CDGA 1NCCL 4FTVE 1WIOA 4H0GA 5GGVH 2FX7H 1N6UA 1E6OL 1N4XL 3RVXD 1MAMH 1YEFH 5IV2A 2CLRA 2PW1B 4JVWA 2RQ8A 5BS0D 3B9KC 2ICEA 4P2OA 3B2VH 1H3XA 1LO2H 4XI5C 4GXUN 5DJ8B 2IFFL 4KKAD 4X7EC 1HE7A 2HTKC 4YUEH 1PBYA 1MOEA 2NR6D 1MFBH 5F3BB 4LRIC 4MA3A 5KSBB 4JN2A 3O6KL 4NZTL 3V5DB 3MRNA 3X11A 2XFXA 1EHAA 2X4SB 4K71C 3GSNB 1MI5A 3AS3A 4HKJB 2KZ1B 1YDPB 1MFAH 3WFEL 3WJLC 3GSXB 3PV6A 5EPMA 3ZYZA 3OWEA 5DHYA 4AQ1B 4KC3B 2DBJA 2FHCA 3QIWA 1KTDB 5KZCB 4N0CC 5D7IA 3BGAA 1OY3B 4L5FL 3TJEH 3UC0L 3MRHA 2ARJQ 3C6LC 1K8IA 1RZKC 1NCNA 3MCG1 1UH2A 3NCYS 5DJ2B 1AXTL 1WICA 4F8QA 3VFGH 4MXWH 4OZGE 2X1XR 1DBML 3S4SA 2DKUA 3QUXC 1H3PL 1HINH 1S5IL 1UM6L 2EH8H 2P8PA 2XACC 5HYSB 5HHNB 3B9KD 3SE3C 4ODTH 4OFKA 4X5LA 3NN8A 1TVBA 5E2WH 4XNQB 4XI5D 1I1AA 1F4YL 3DMMB 1KEML 5DUMH 4M7LL 2HTKD 4MB5A 1MCSA 1MQKH 1ZS8A 3DYOA 2YHGA 3CD4A 3R4DA 1DLHB 4OCSH 4P0DA 8FABB 3WJJA 4OV5B 2ZJSL 1M6OB 4PJCF 3QUMH 3TGXA 3ZKSD 2PYEB 4KHTH 1GAFH 2QKIA 1CE6A 4GT7A 5DJ0B 5IFAL 2ADJA 1ZEAL 1DQDH 3RWEB 2HJFA 1XF5B 2MQ0A 4NBXB 1U8MB 4PV8A 3BSZL 3PHOA 3R1GL 4N0CD 2WWKO 1IM3A 1VENA 3BZ4B 5GS0C 1YEGH 5D7LB 1NAKH 4P2QD 5CHNA 3C6LD 3LEYL 3STLA 4MA8H 5T33L 1A21A 5ADOL 2VDKH 3LDBB 3QPXL 5D1XB 5F88A 3IJSB 4U6VL 4OF6A 2BVUA 3CFEA 3QUXD 4LCWD 3P4NB 3HPLB 1G7IA 3DSFH 5J9PB 2OL3H 3NPZB 4UT6L 2YD9A 1OQXA 4PRDB 2VC2H 4L8SC 4M1DH 5EOTA 2NY0B 5DJAB 3LIZH 5LKNA 3CSPA 3U9UB 3QEUB 4U6YA 4JB9L 4M5YL 4MNGE 3ZKND 1KIRB 2UYLA 3CVHL 4OZFG 1G9MH 2E7BA 4E5XB 3RUGF 1KCUH 5D7SH 3BPLB 2GYSA 3WDJA 3KDMB 3MRMA 2H9GB 2HTLD 3L1OH 4MVBC 3EYOA 3G5YA 4NZJA 4X80L 3RY6C 1LE9B 2JB5L 3QQNA 3IDMB 3T2OA 3BGMA 5ALCH 5GS0D 1Y18B 4YHZH 5C7XH 1CE1H 2O5XH 1NCDL 2XTJB 5I1EL 1VB9A 1TTGA 2EIZB 2D7TL 5ESAB 1YPZE 5BV7C 1HNFA 5INCB 4Y2DA 4YHMH 4UV4L 1UACL 2F8XC 4JPVL 3NAAL 4P3WA 2AJSH 1QBLH 1QR4A 4JRYB 4OTXL 4JM4H 1AE6H 4DKEL 3I9GL 4I0PC 4ZUVA 3NA9L 2VDNH 3CX2A 1M71B 3OF6D 2ZUQB 3UBXA 3SE4C 5IEKA 4HHAB 4FABH 4OCXL 5AD0A 5E8NB 4R2GB 5DD0L 3QRGL 5LAXA 5CEXB 4LLYB 2CR3A 2DQEH 1FJ1A 1IAKA 3MMEB 2H1PL 1OAXL 3BPCB 1U8QB 4FQIH 4P57B 4PJAE 4RSVA 3VD5A 1YEDA 3TVMC 3GSOA 1Z6JT 2WIIA 1RK1B 4MVBD 4MSWA 4O51A 1KTLA 2CUMA 2FCBA 3S7GA 4JQXA 5HGAB 2VZVA 5IR1B 5HDBE 1ETZB 5D8JL 4HKXB 3W39A 1CBVL 3QXWA 3ISWA 5HHOD 4OQTA 4O2EB 4IBLT 5ICZA 1F4XH 1I1YB 2CO6B 5ID0A 3QUZB 5MEND 3DX7A 3CDGA 3RL1A 2DQUL 2H6PB 3QNYB 3L5XH 3LKQA 2F53B 4MMZC 1X5ZA 4J8RB 4I0PD 1EFXA 4V2BA 4YH6A 3RL2B 3E1F1 4GXVL 5BW7C 3PQYE 3D0VB 5B38G 4XMLH 2WP3T 1VEMA 1Q1JL 3GMQB 1NAMB 2GEEA 1GGYA 1LDSA 2XQBH 5EO1B 5H94A 1DTUA 5B39B 4TULL 1MEXH 2PCPA 3OKNB 5IKCB 1AKJA 1AD9A 1NGWB 1S7XB 1KJ2H 4NZUH 5EA0H 3VFRA 2H32B 4GUPB 1HHHA 4IJ3C 2DJ4A 3NCEB 5GS3A 3O41B 1C7TA 4XPTL 1BVZA 1U8OA 2FIKA 3L7FA 1II4E 1BMGA 3HZVA 1NCAL 4ZG1A 3QAZB 1I8MB 4OUUB 4MS8C 5EU3A 3WS3B 4RGOL 1CFBA 4GLRI 1T6WA 4PJXF 3OTTA 3SKMB 3E6HA 4BH8A 1UEYA 3GMMB 3DYPA 1KIPA 1Q9WB 1WLHA 3P30L 3ZKMC 4LKCA 5C0RH 1L7TL 4BSVB 5F7EL 2BSSA 4TPRH 1MAJA 1ROWA 4I13B 4JDVB 2CXKA 4QXGL 2OSLB 3GHBL 2R2BA 3TWCL 1JZ8A 4FFVC 1M7IA 4GKOA 4P4RA 3U0WH 5DLMH 5I18L 1CTNA 3ZZ1A 1MWAH 2ITCB 4GAGL 4DW2H 2J5LB 6FABL 2HFGL 4M6MH 4AM0B 4ZD3L 3AUVA 2AQ2A 3KNBA 4L3EA 2BJMH 4WV1B 5E9DA 4O58H 1YMMB 4I48B 2LV4A 5DGRA 5KSBE 3VWKC 4K7PH 1IGYA 3GBLA 1AQKL 1U36A 4X6EA 1XGTB 2XRAH 3KPPA 5JW3L 3K4AA 1CQKA 5FYJE 4Z7OF 3KLHD 2HT2C 4MS8D 1T03L 4IRZL 1T7XA 4ODWA 3QXTA 1YJDH 3SE9L 3SGKC 4U49A 1BHGA 1VGKA 4OZFB 5IB1B 4DN3H 2HVKA 2Q86B 3MJGX 1HHJA 5SWZA 4XNUH 4MJ5B 3HI1A 4ZUSA 2GY5A 4LPYA 2FD6H 4XZUB 5EG6C 5HDQL 4QCIB 5IB5A 4HKBA 3O0RL 2GCYA 4FFVD 4Z7UE 1F3DH 3NFSH 3MBXL 1NLBL 3HS0B 4XRCB 1WGOA 3MACL 5DK3A 1CK0H 2YPLB 4HBCL 1FO0H 2CD0A 2DQJH 1FGVL 4XBPB 2AP2A 2FEEI 4WCYH 4N0UB 2F54B 5C0FB 2NPLX 4OFDA 1HH9A 1S8DA 4X4ME 3VWKD 1QLEH 1INEH 1A7OH 4JN1H 1MFDH 1NGXB 4JHAH 3NCMA 5I74B 3RAJH 5L6YH 1VFAA 3MOBL 2HT2D 4PS4L 1IZKA 2PYEE 3WYRA 3VXOA 3H3KA 4UDTA 3VFTB 3ARDA 2NY5L 3I3DA 2HWZH 1T21B 3WKMH 1BEYL 1DBBH 3RRQA 1JNNL 1S7TA 3PDDA 3OAUH 1DQMH 3IF1B 5F72S 4Z7QF 3C09C 5C09B 1DLFH 5GIRA 4QTHA 4Q9CA 1PG7H 5BVJA 4Q97A 3S88L 5JW4Q 5IB4A 3VFMB 2X41A 1HIMH 4PB0H 4PGZA 3O9WC 1F4HA 3SKOB 4G7YH 4FXGB 5DVLA 2HFFB 4HS3B 1EJOH 1CU4L 4NQSB 4H26A 4LAJH 2YKLL 1Q72H 3ET9F 4QF1B 1T66C 3QXAB 4NP4H 5C0CB 1XMWA 4D0CB 5I1HL 1U9KA 5C0AD 3O3EA 4WWKA 4GQPH 4RMRA 5IMLA 3QHZL 1S78C 4MB3A 2X4TA 3MUGA 4NGHL 4UILH 3IDGA 2XTJE 4BKLB 5IFJA 4YHOL 3W9EA 4J1UA 4D3CL 4LRNL 3SJVD 3O9WD 4YJZL 4LSVL 4JRYE 5DFVC 3HA0A 3PWLB 3KPTA 3KJ4C 1YEEL 1N3NA 3I6LE 3L3JB 5D2LF 5I8CB 3MRGB 2BFVL 3F5WA 5FYLH 2BX5A 1T66D 3B4NA 5MP6L 3G5ZB 1PSKL 1MIMH 3H42H 4S11A 1MCIA 2R29L 3G08A 4N1HB 4HJGB 2EDYA 2IWGA 1QR1B 1T0NB 1OF2B 3T77B 4CVZB 3QXVA 5GSVA 1CDJA 3P4LA 3ZE1E 3KS0H 1SJEA 1S78D 1T89C 4S1QL 4XP4L 1GGBH 3Q0HA 4TN9A 4H1LG 5DMIH 2GQHA 5HVGB 2GKIA 1OD9A 4QHKI 3G6JF 1PEWA 2D4FA 2CUHA 4NDMB 4LF3A 4X5XA 3IU4L 4NQDD 4HJ0C 2QL1A 1AFVH 1QEWB 2OLDA 4JFXB 4UQ2B 3VFUA 4HGWA 5IEHA 3CCHB 4JDTH 2VIRB 1TCMA 4QHMA 3OKOA 1CLYH 2MHAB 5DFVD 3KXFD 2F53E 4M4RA 1LP9A 1U92A 1U8HA 2Y36H 4ZTOH 5C07A 1LNUA 4JY6A 1C1EH 1IAIL 1PKQB 1R5VA 1M7XA 4K71B 4ZNCD 2DLEA 5SV4A 5F1OB 2CQVA 4DQOL 1CLCA 2J1KA 1J7VR 2WV3A 5IJKA 2J6EH 1JTOA 2GAZB 2DIJA 1CDGA 3HR5B 4WFHD 3S3PA 1KIUA 1AHWB 4Z5RA 3U4EB 4G42A 3WIFA 2IPUG 5E6IC 1JNLH 5KSAC 5SWQA 3VA2C 2OQJA 3QIBC 4P2QB 4R97C 1ADQA 1GIGL 4KUZL 3PE9A 3VE0A 2EO9A 2JCCE 1R3JA 1RHHA 1ORSB 3C5SB 4DEPC 2I9LA 3MOQA 3RWCA 3QH3B 5IQ9A 3HUJA 2G5BA 7FABL 2VYRE 2EO1A 3VXUB 1ZGLA 4HJ0D 3U0PB 1JK8A 4POUB 4OLEA 3UX9B 4K7FB 4LLDA 3V0AC 1BQUA 4WJ5A 3PHQA 3V2AR 1MJ7L 4XB7A 5D2NA 1LO0L 4KK8C 4KY1L 5CKAA 1QOKA 2Z8SA 4R4FL 4ZXBC 3TC9A 1D6VL 4YDJB 5EZIH 4AL8H 4U6HA 1YNKH 1SJXA 3SDXF 2EXYD 4CJ1A 5IJVA 1QSFA 3G6DL 5FEBA 4NFCA 4PRHA 1ZGLP 1EX0A 3OB0K 4K94L 5GJSH 5FO9B 4QXTB 2E7LA 2Y6SD 3X12B 4L8BA 3MLWH 3GMLB 4EXPX 5E6ID 1D5IL 5KSAD 3O4LB 1CICA 3KR3H 2AV7B 3QIBD 4V1DD 4CVXA 3QT2A 5GHWH 1U6AL 4ELMB 4YDLC 4KMQA 1RZIB 5JOPE 2DIBA 4LCCA 1INQB 3C2AL 1A3LH 3LN4A 3UAJC 4AG4H 3BH8B 3FB6A 3SEPA 4KVCH 3UJJH 5F7UA 2VERN 1V7NH 3VWJC 2FR4B 3C9NB 5JIPA 5IHZB 5IMMA 1RMFL 3ARYA 4KK8D 4O4YL 4ZXBD 4RWHA 3ARUA 3CU1A 4G6FD 3EGSB 4XVTL 2NX5D 4UQ3A 1SVZA 4D2NA 2XN9E 4N0UE 1CR9L 2F54E 3EFFA 2G5RA 4ZYKB 3RWFB 4QY8B 5J11C 2QSTA 1HWGB 2IH1A 3X17A 4GAYA 4QRPD 1QYGL 3QO1A 5GS1C 5DRNB 4JO1L 3GB7A 3R8QA 4OQTL 4HDIA 1N0XH 4JKPL 3JTTB 2OJEB 4HZLA 2JK5B 1MCWM 4HV8A 5FO7B 3UAJD 3D39D 1IC5L 3EIFA 3HG1D 4Z7VF 1ZVSB 2F74A 1RUAH 5J1AA 1MNUH 3AS1A 3FN0H 2OZ4H 4YGVB 1PJ9A 4CU6A 3KG5A 3GBNH 1IC7L 2IPKA 4S0SD 3LOWA 4FFWC 2ZKHL 4QOKB 4HUVB 3FQUA 3OMZA 1JTPA 4D9LH 3O6FC 5KS9B 3TVMB 3P0VH 2FBJL 3MCLL 2OP4H 1NBZA 5I6XC 5CEZL 2A38A 2UZIL 3HB3C 3T08A 1BPVA 4LVEA 1YNTA 2FX9L 2VLJA 4KAQL 1A9EA 1N8ZB 2WWKT 5A1AA 4JO4H 3WS6C 2PTTB 5C0CE 3WSQL 3WN5C 3EYVA 5LCVH 3TFKC 3MPCA 2EYTB 3NMEA 4D0DB 3MGTB 4IS6A 3RVVC 3FT4A 4RMTA 5EU7E 5DT1L 1TQCB 1KTRL 3QUMA 2BSTA 3VFVA 1E4WL 1WBXA 3F6LA 1EGJH 1YPZF 5L7XL 4QRUA 5K33A 1PGRB 4ONHA 1PD6A 5DD3H 5FUZL 5DK0B 1HEZA 4KPHH 1FYTB 4PTUA 1K5NB 3GMPB 1YEIH 4GRMB 4WFED 4J3OC 1KF9B 2AXFA 4Y8AA 3WEXA 4FFWD 5DRWB 1NLDL 3BT2L 5HHXL 2MOVA 5EU5B 2MPAH 4WY7L 5D9SB 4RMSA 1S9VA 3EYUH 3O6FD 4IJ3B 3EJZD 2IANA 1BF2A 1XF3A 1CFNB 5EO0A 3FONB 3HB3D 2R69H 5IG7B 4L4JA 1L0YA 3BISA 4PJIF 5LGHL 1TJGL 1YQ2A 4HSQA 1B2WH 1T1XB 2OL3A 3GHEL 1NDMB 3HCVA 1ZA6B 3QFJA 1JRHH 3TFKD 1T04A 4PJAF 1AXIB 4FQJH 3SDDC 1RULL 1ZXQA 1GZQB 4LVHC 5DWUL 1PW3A 3RVVD 2VITA 4QRRD 1FFPB 4L4VA 5HDBF 1UVQB 3Q3GB 4NBZB 1KN4L 4DVRL 3NFPB 9CGTA 5I1LA 2C1PB 4WU7A 4HAFA 4NPYA 4M03A 4Z7NE 4MAYA 1ODAA 4LHUA 4K8RL 25C8H 2DOCA 2ENSA 3JV4B 2ADFL 2VH5L 4DCQB 1YNLL 3WO3B 5HYJB 4WFGE 4P4KA 1VSCA 2DN7A 1GHFL 1HQRA 4GG6A 1N6QH 3BZFA 5HTSA 3H7BB 2IJ0C 4DN4L 5CEYA 5E95B 3GMRA 3KHQA 3DV6B 1MRCH 3QBTB 5ACZB 1QO3B 3S96A 2P8MA 3BGFB 3GSNH 2NXYC 3NABH 5FM4A 5FYJH 4M61A 3SDDD 3U1SH 3V7AG 3V8OA 2J8OA 4N1EA 2VXTH 4WGVB 1G84A 4XAWL 5FYKL 1FZKB 5IK3A 2FJHA 1HDMB 2DBLL 2P45B 1NFDF 1VEOA 5IHUH 2FNBA 3LKRA 5KSUB 4P2QE 4WHTA 4LKXA 2MWCA 2XWJA 1N26A 43CAA 3P9MA 3I02A 3I6KB 1HXMB 2Z92A 1GGCH 3VXUE 5EU6A 4NUJA 3OXRB 4AIOA 3N1MC 4IRSA 1AP2B 5TDPB 1S9WA 2VAAB 3BD4A 3HRZA 3LB6C 5AWNL 1OGTB 5CZKA 4U3HA 4FQ2H 2JJSC 4AYFA 4BFBD 32C2B 4Y1AD 2MSPA 4XC3L 4PRBB 4GXUM 2Y5TA 4M7KH 3MTRA 5I73C 5ALBH 3N06B 1HSAA 2NXYD 4MWFB 1VERA 2UVFA 4W6XB 2X4RA 1A4JB 4C54A 3FB5A 4PG9B 4OLZH 4JDZA 5KSBF 3MLXL 3GJEB 5T5NF 5DEZA 3O4LE 3GJFH 1L7IH 4I5BA 2XICA 4PUBH 3C09B 1KJ2A 1EEQA 1BX2A 4E42A 2LFGA 4U0RC 4ELME 4HIXL 2HLAB 4M3JA 4DZ8B 3B8SA 4R0LA 3MJ6A 3UPRA 2G2RA 5DMGC 1WK0A 4WUUD 4LVNC 4X4XA 4RQQA 4KFZC 4BZ2L 5C92A 3UEZA 3LB6D 3DETC 5CWSB 5I1AB 3UROR 5D1QC 2XTLA 3OJDA 4ZFFB 1E27A 4ONGL 1SBSH 3MRJB 2BNQD 4M43L 3ZT5A 1I3RA 3OKKA 1KIQB 1HSBB 4JG0L 3OX8B 4JFPA 5I75B 3QI9A 1X5XA 3T1WA 1D5BB 3T09A 4WHYG 1I1AD 1C7SA 2Y7QB 3S3SA 2VZ1A 3BWAB 3VFNB 2VLLB 1I7ZB 3E0GA 4ODHH 5I0DA 1MWAA 2P48B 4HKZA 2D03L 1SJVA 2B7DT 3WFBH 3N1QC 4X6FA 4JQIL 4FFYL 3HLAB 1VGEL 5DD1H 3TO2B 1A6AB 5DVMA 4MAUH 1XCTA 1LE5A 2GFBA 1QFWI 2AJVH 1FDLL 4X99B 1FV1A 5M7QA 2G75A 5GRWA 1IQWH 5BO1L 4CN1A 3DETD 5D1QD 4PRPB 4K3EL 1KNOB 1F90H 3ARZA 3G5XA 1WSST 4OCNC 1R3LA 5EZOL 1ZLVK 2DAVA 3Q1SH 5FCSH 3BVNB 2EDTA 2ICWA 2VDLH 2YD7A 3QXDB 3QG6A 1IILE 1KCVL 3CSBA 4UIKL 1UWGH 3T0BA 2X4UA 3MLSL 1CFTA 1LK2A 1BBJB 1MLBB 3O3DA 3FO1B 4JPWL 4CMMA 5KS9E 5CD3A 2FX8H 2C1OA 2NYYC 3MQIA 2D7NA 2B4CL 5ESQA 4CW1B 1UJ3B 3PP3H 2BVOA 3RPIA 4OD1L 4UDUA 3L5WB 5A2LH 5EIIA 1BIIA 1FO0A 2HYMA 4XHQA 3GSWB 3KYNA 5CIPH 1FLTX 5IMKA 1ADQL 2DTMH 3B2UC 3WD5H 4AY0A 3WHE0 2EKSB 2GUOB 1J1OL 4HIIA 1HZHH 1RJCA 3J8F7 5K9OB 3IFOA 1KB9K 4XP5L 3JV5A 3QZWB 4JQXC 3QEHA 4IHOA 5C6TH 4U1GB 2AJZA 3AM8C 1RUKH 35C8L 5EDXA 5TGBB 4OZ4B 5FUCC 4EDXB 4PGBB 1FYTE 1M4KA 1AQDB 1AGDA 5TQ0L 4D8PA 4ZS7H 2HJKB 4UB0H 2P47B 3SDYL 2W65A 4PRIA 1GZPA 3W82A 2N7BA 1RURH 1I7UB 5F3HB 4XPGH 4EI5B 2NYYD 3BPOB 3PL6C 1LDPL 1U8KA 3W5NA 4MD4A 3KYOA 1IGJA 2H32H 4R97B 5MEOB 4UOJA 1V3KA 5IBTL 4R9HA 4KHXL 4LQFH 4RISL 5JHLH 3B2UD 2YA1A 4JRXD 4HT1H 4J3VA 4NUGL 4ZAKC 3JWOC 1HQ4B 1XGYH 3MGOB 4W6YB 3MO1A 4Y5YA 5DTFB 3PWVA 2AEPL 4NN5B 4N9GA 3WHE1 1AD0B 4O00A 4QHUB 4NNXB 5E5MA 4FP8H 5BOPA 2CRIA 1Q38A 1XGUA 1ZMYA 4KTEH 3VMOA 1CGXA 2PXYC 3BE1L 1MREL 1MH5B 4KJQC 5CP7B 3OKEB 4ZXBB 3B3IB 4ESKA 3FQWB 1DE4A 1NC4A 5HYJE 1RIVH 5D4QA 3MA9H 1ZHNB 3OKLA 1KPVA 4QYOA 3W5MA 1EFXD 1UQSA 4G9FB 4MQ7B 1IKNC 3JV6A 3MBEC 1KACB 5D5MA 1MAML 1YEFL 2F9BT 2V7HB 3OR7B 1K2DB 4OM1L 3WO4C 3ALPA 4KK5C 4TSCH 2DF3A 1G1CA 4MDIA 4PPTA 1BOGB 3MRQA 2PTUA 1B0RA 3M17A 5JLZB 2FLBT 4HW6A 4OZFH 3PWPA 1MHEB 3VWJB 1RD6A 3I50H 1MCNA 5KOMC 1BJ1J 4KRPC 2HRPH 1MFAL 1P2CA 1DQJA 2PXYD 1T7WA 1I85C 4KJQD 2NW2A 2JJWA 5ESVA 3DV4A 3NH7H 5CGYC 4U0QB 4ZPVA 4OM0H 1S7VA 4YXKH 3TBTB 1QTYT 5HI4D 4XVJH 3WIIH 4B53A 3QYCA 5I30H 3TJEL 4X5WA 4GLRH 5DZLA 3ECBB 2R0KL 2F5BH 1IAOB 4F9PC 4RDQG 5F7LB 3QDMB 4R4BB 4K8RC 1J10A 4MYWB 4FTVA 1ZLUK 4GJTB 4OLUH 4UNUA 1YMHA 4LLWA 3MBED 4M5ZL 1HI6B 4MXWL 1PEZA 5J11B 4Q2ZB 3T0AA 1HINL 4KK5D 5CUSH 2G9HA 4YHLH 4ODTL 1K8DA 4WNQA 5E2WL 2X6MA 3VCLA 4N8VG 4GW1B 5JOEA 2FIRT 4L3ED 5AZ2L 1YYMH 4RNRA 1C12A 1MQKL 5E9DD 3N1GC 4F7MA 1JWSB 2A74A 4QRTA 5HHPB 4NRYB 4OCSL 2J6EA 3BEWA 3UPAA 5ICYB 1KB5B 3QUML 4KRPD 4OBRA 5CZVH 4KHTL 4NN6B 1JL8A 1XR9A 3LEXA 1NCBH 5C08B 5C8JA 5IHLB 2FH8A 1I4FB 4ORZC 4X6CB 3V52H 2BERA 3ARBB 4ONFH 4JM2C 3LZFH 4LLQB 3QUYC 1A4KB 4HS8H 1P7KA 1TZIA 4NJ9H 5SWZD 1FZMA 1G7MB 4TVPD 1YEGL 1Z3GH 1HN1A 1NAKL 1PAMA 4EIZC 2IPTH 4MA8L 4ZQKA 1DN0A 4K8RD 5BJTB 5T1LD 2ADIA 5HYFA 5DK2A 4MJ6B 4OZGA 4B50A 1YY8B 3MLZH 1PG7W 3RKDC 2XWTB 4PJHA 3DSFL 3QFDB 3IYLW 2AQ1A 3NTCH 2OL3L 5I17B 2HKFH 2PYFA 3RNKA 5EUOB 1NC2B 2DM7A 2ZG3A 4NKMB 4RZCB 2XPGA 5FDYA 2VC2L 1M05A 4M1DL 2VXVH 1EFQA 3LIZL 1Z9LA 5CMAA 5E4IA 4PGJA 3MODH 2NTFB 2EECA 2HAZA 3BHBA 5JUEH 5FKPA 1T1YB 4XPFH 2GSIB 2F58H 3ULUE 1KCUL 3HHRB 3CC5A 3DROB 4NKDB 5D7SL 5FYKD 4JM2D 1BZ9B 3ARDD 4OUOA 3CFKA 3QUYD 5SWSB 2NNAB 1FNSH 3L1OL 4F57H 2HN7B 3C2SA 4BFIB 3SGJA 4L3CA 3HE6A 5JDJA 4MXVE 4YHZL 1CE1L 2O5XL 4JREC 1J8KA 4G8GB 4PRPE 1WFNA 2DICA 1U8NA 1A8JH 1XAUA 4YHML 1C5BH 3RKDD 1QLRA 5DDHA 2AJSL 1QBLL 2NY4C 1L0XA 5FCUH 4XCEA 4JM4L 1AE6L 3JWDC 3PNWA 1S7WB 3DUSB 1EEYB 1U95A 1BLNB 1I3VA 4JY4B 2VDNL 3BUTA 1FRGH 2ZNWA 4FABL 1BVLB 4PJ5D 3Q5OA 4X8JA 4UZGA 1TNMA 3MNZB 4LPTA 4K7PX 1QFHA 1PYWA 3A6OA 5IUSA 4NCC2 3NFNB 3PABB 1OW0A 3QJFB 4BZ1H 4OZHF 3D3VD 1U91B 5DD6B 2UV3A 4LNRA 4WI6A 3WLWD 2D31B 2X89D 2EIBA 3T2QA 1PZ5A 2A6IA 3QJHA 3VD9A 2D0GA 3CDCA 2H26B 3VFPA 1RJLB 1FAIH