1MRFL

Preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
216
structure length
216
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGKERQNGVLNSWTDQNSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2B-KAPPA JEL103 FAB (LIGHT CHAIN)
publication title Preparation, characterization and crystallization of an antibody Fab fragment that recognizes RNA. Crystal structures of native Fab and three Fab-mononucleotide complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 55
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 1994-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mrfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mrfL01
3UC0L 4I4WB 4RGNE 4JGJA 4JFED 5DUPH 3O8XB 1M71B 3X13B 5DA4A 4JFDB 1EEQA 2W0KA 2XTJC 3LB6C 1CE6B 3EO1A 2ERJB 4DN4H 1JZ5A 3ES6A 3DSNA 3IVKA 2GJ6E 1F6AA 2G75B 2RBLA 2CMRH 4UMGA 5E9DB 2VMFA 2EDOA 4YDJA 3JTSA 1S7TB 5DYOA 5A43C 3TC9A 4OB5L 4ZTPL 3G6JF 3LEYH 4OIAA 5EO0B 4ZOBA 1NUDA 2F54A 3WJLA 5MEND 2IFFL 5FYJD 5CCKL 4OD1L 5F3HB 3STBA 1DEEB 5LCVL 3CFBA 2YA0A 1Y6MR 3EFDL 2D31B 2E9IA 1UWGH 4EXPX 1H3XA 4KROC 1KN2L 3C2SA 2VQ1B 4PBVC 4X7SH 5MHSD 5LGJA 5DJ8B 3U4EA 5J9PB 4R9HA 4V2CB 1YYLL 4NO0A 4N5UA 4HPOL 5E6ID 1H3GA 2FEDC 4KVCL 3IJSB 2DM3A 4MJ5A 5ANMA 5T3ZH 2GK0B 3H9HA 1FDLH 4MSWA 5BOZG 1MAKA 4EQ2A 5C0JB 4CVZB 4NBXB 2X4OB 3VWJD 3OKLB 3LN4A 4X6EB 4ETQB 4F7EB 2PXYB 4MB5A 4D3CL 3WLBB 1NANH 2IPKB 5D1QA 1DBBH 2E5EA 3GSUA 4NQCA 3RVVD 2BVYA 1PG7H 2Z31B 5TE7H 3GHBL 4MYWB 1EO8H 1DN0B 4GLRH 5C0FB 4I2XB 5DFWH 1ULVA 1FE8L 1ETZB 4K7FB 5B8CB 3PL6B 4Q74A 1L4IA 3C08H 6FABL 5K9JL 5B3JF 3VD9A 2R23A 4BK5A 3V6OC 4QHKI 5D7KD 4DUXA 4ONHB 3L7EB 3MMEA 2OTWA 3VFOA 2NY0B 5HGHA 4U1NB 1TJIL 5T1KA 4JO1L 5HBBA 1CU4L 5T1MB 4EDWH 2R56L 4FQXB 3ZHLA 5I66A 2VDQL 2FJHA 3C6LC 4PLKD 4Y5VA 3ZDZF 4HSQA 3QISA 3QEQA 3DX7B 4OFKA 3NIFE 2XXMB 1HN1A 3DXAE 4HIXH 3PGCB 4MQ7A 3FN0H 1JTTA 1OSZA 4X98B 2R2EB 3O2WH 5IBLC 3WDHA 2I60H 2AI0H 3QIWB 4RGNC 5F9WB 2NW3B 1ZLVK 1GHFH 3LQAC 1PW3A 2W0FB 3NA9L 3MV01 4E42A 1A21A 3QUYA 2YS4A 1T21B 3ULVL 4WUUB 1FBIL 5FK9A 3SDDB 3FAWA 1FG2B 2AJXL 4P9ML 4HIHB 1BVLB 3VCLB 5IMMA 1B2WL 5L2KE 5F9AC 4HH9A 3MRMA 2Z8RA 2PCPA 4FFZH 5DC9B 3RY6C 1FGVH 1G7MB 1FZMA 4TVPD 4OZHB 4N8VG 1DVFC 2DBJA 3E0GA 4GMTL 3IJHB 1G9NC 2ZOLA 3D39B 5TDNB 3WEXB 3O2VL 3UMTA 4JM4H 1IM9B 2YPLB 1GGUA 4Z77A 3OJVC 5CSZA 5GRVK 3W5MA 4LFHG 4LSSH 5F1IB 5KZCD 1UADC 4NO2B 1MCEA 3SCMC 1JIBA 3ARBB 2BNUB 2VDMH 4FFYH 5DMJB 5K9KA 2VE6B 5GISL 4JFOB 1JTOA 3L7FA 4N0UB 2VZTA 1WTLA 4CU6A 3L9RA 3W2DL 1T2QL 2FEEI 3VWKB 1GOFA 1XR9A 5C09E 5EUKB 5TFSL 1HXYB 5HVHC 3MTRA 1GGYA 4EEEA 4NNXA 3ZO0A 1Z0MA 2H3NA 3GMNB 4YHZL 4G8EA 1FFOB 2FJFA 3V0AC 5CJ5A 1XMWA 5HYJA 5JXEA 1UJ3B 4N9OB 1SQ2N 2GKIA 2X70B 3TN0C 4JZOB 1JBJA 2BCKA 5CJQH 3CXHJ 1LEGB 4C56A 5C07A 2WNGA 5EUOF 2MMXA 1FNEB 2P44B 1G6VK 2VLRD 2EC8A 3IJYA 1N3NB 3JBG7 1FPTH 3DO3A 3GIVB 2PYFB 2FO4A 4QOKA 2DBLH 5FM5O 5IP4A 5C9JA 5HYFA 3D5OF 1VHPA 1OGAB 3ARSA 3QCTH 3ZKNC 4YXKL 3RVUD 1KB5H 3OF6A 1QR1B 5J56B 5J6HB 3DUHA 2R69H 5CINH 4OCLC 1ONQB 3NA4A 4UTAL 1MFEH 2I07B 1J9CT 2Z4QA 3E8UL 4JG1H 4BZ1L 3OR7A 3ZKXB 3RZCA 3SGKC 4KZDH 4FABH 4NCDA 4PTTB 5DZNA 3QCVH 2NY3B 1SJEA 2JJTC 2PW1B 5TH2A 3RL2A 4YC2C 3GRWH 3P0GB 4HG4K 2I9LA 4NN6B 1YEEH 3HPLA 2CSPA 2BK8A 1T20B 1A0QH 1XGRB 3NGBC 4YPGA 5CWSB 5M95B 5F93C 4WWID 4EN3B 3QIBC 3H3PH 1BZ9B 4CKVX 1GC1C 1GZQB 1ND0B 5B22A 5C6TH 3UJTH 2ADJA 4Q9BA 2FNBA 2VLME 5ESVB 3RWFB 1VFMA 3PWPB 2Y36H 1I9JH 4OLYL 4Y4FA 1FYTA 4TVPH 2W60A 3JSSA 3EHBC 4O00A 2ZSVB 5FAAA 1CK0H 4DGVH 1XGPA 3KXFB 3SDAD 3TBYB 1WEJH 2BP3A 2G2RA 3IU3A 1IEBA 3FFCA 4M6NH 4JY6B 4XMPH 5AUMA 3TH3T 2CLVA 3G5ZA 4LARH 4LASL 4M7KL 1D5MB 1SEBA 5GJSL 3AMKA 3T0AA 3D87B 5KN5B 3STLB 3P2TA 1R0AL 5I1DA 2H32H 4HC1L 1OT2A 2VXTL 5IB1B 5CKAA 1IC4L 5ESAB 1AGDB 3W39A 5CEZL 2AXFA 4RNRA 5JHDD 3ZT7A 4LPVA 4X4ZA 1F90L 5SWSA 2QQLL 4X83A 3KYAA 4X4ME 3D85B 2V2WB 4KTYA 1FORH 4ZYKB 2BNRE 4JFXA 2NY4C 5SX4I 4GW5A 3O6KH 4W6WB 3HR5B 3PWUA 4IMLA 4ZSOA 3LV3A 1F3JB 5C0BE 3MRDB 4DOHB 5GZNC 4HXAH 2Y5EA 1A64A 1TITA 2ATPA 4RGOL 4DZBB 1CDJA 1P5UA 5DD3L 3SE9L 3ROOB 4DKDC 4K9EC 5GS0D 3SQOL 5C0CA 5D1XA 1MAMH 2BOCB 1BWWA 3AS2A 2FH8A 3QUZA 4ZXBB 4S1RL 4HGWB 2DMBA 2HT4D 1TVHB 2OLDA 3DUSB 1CZ8H 3CGTA 3DYMA 4LCYA 1A6ZB 3MJ9H 3OWEA 1I3GL 3D2UA 2VLKA 2J12B 2Z92A 5ALBL 4XPTH 4NZRL 3AS0A 4UBDC 3UO1H 2WINA 1WT5C 3SJVD 2A6IB 4WHDA 1A6TB 2WBWB 4PGBA 4GAGL 4PREB 4XZUA 2DIAA 1I3UA 4XXCA 2VTFA 3HMWL 2PKDA 1RQ5A 1NAKL 1TCMA 3PDOB 2QJDA 4EBQL 1H3VA 5C0EB 2Q1EA 3P11L 4BFIA 3OKMA 5DMYA 3ILPB 1JGVL 3NCEB 5F6HJ 1FGNH 3WHE1 5BRZE 1LE9B 2F5BH 4Y1AA 3FQRB 3MLXH 2EECA 5EC2B 1U42A 1IGFL 2IADB 4QLRA 1XZ0A 4U1LB 3HR6A 3D3VD 3G08B 4JFDE 1FZKA 1G7JA 4WHTA 4MCZB 2ICWB 4F33B 5EIIB 1YEIH 2KUTA 1UB5B 4KJPD 1ZANH 3FQWA 2UUDH 1C8PA 3MV8D 4AENB 4NQDA 5E9DE 4KZEH 4M7JH 1G6RA 5KSAD 4LU5H 2VN7A 1ZHNA 2QBWA 4OI8A 3SE4C 4AEHH 4HKJB 4JQVC 4GAFB 4XPGH 1I4FB 3U30B 4LSQH 3M17A 3GMMA 1MOEA 3DO7B 4X5WB 4ZQKA 3MV11 1RVFL 3D9AH 1F3RB 4ZDHB 5HHVL 2OK0L 2D3VA 3VRJA 4XB7A 3C87A 2BRRL 4J8RA 3TNNB 2CIKB 3ALXA 4ZUWB 3G6JA 3RX5A 3OMZA 1DBAH 5C92A 1KNOB 3MZTA 1FL5B 4LHUB 4PJ5B 5JPNA 4RMTA 5AYUL 4UIMA 4P4KB 2MCPH 3O3UN 2A9NH 4KRPC 4DKEL 4KJQC 2EH8L 1RULL 2J3SA 5E24E 2QSQA 2EYTA 1MJUL 2BJML 5E8EB 3ESVF 4BFBD 3D0LB 4RDQF 1IRAY 3IKCB 1RZGB 3QWRD 3GHEL 4MLIA 1JPSL 3WUWB 5DTFB 3X3FH 4M5ZL 3MLWL 2FJGB 4Q58C 5GGVH 2NXYB 2YUZA 4NYLB 4PRPB 1FZJA 4KI5F 2YPKA 2E7LC 4LSUH 1MCWW 3GI8H 4JVWA 1DLHA 4U3CA 5CUSL 4KDVA 4MGXA 5GS0H 3MLZH 4I2XE 1LK2B 1VFAB 4X4XA 2XQYG 3SY0A 4GMSL 3G5VA 1N7MH 4BSVA 1RHFA 4JN2A 1E28A 3C9NA 4LEXH 4EKXA 3QIUD 4EUPA 3QQ4B 1Q9WA 1Z3GL 2FX8L 4OJFL 4F3FB 1YMMB 1ZTXL 4MNQD 3T09A 1TJGL 1QFUL 4R97B 5EH1A 1N5AB 3TBVA 1RFDH 1VACA 4ZG1A 3S4SA 4U31A 2ADFH 3D18B 3F5WA 3ARFA 3NIDF 4D0CB 1Z5LA 4YHOH 1WZ1L 4EI5D 4GG6F 3LN9A 2R2CA 3L5JA 5C7XL 3GNMH 4U1JA 3M45A 3RHWF 2CD0A 4POZD 4ALAH 4YR6A 3UYRH 4PP2A 3ES6B 2NX5D 3N0PB 5JPMA 3N9GL 1F6AB 4NC2B 5ITFB 1L9MA 5BS0D 1HHGA 1X5YA 2KDGA 4POUB 4YDJB 5DJXB 4CVXB 1FZOA 3MC0A 1MPAH 3V5HA 4PJXF 1C7SA 1YC8A 4U33A 1X5LA 2ADGB 2F54B 4Y16A 4WUUE 4QRRA 2JCCB 3S34L 3M1BA 3ZYJA 3HB3C 3FQNB 4XHJD 4HJJH 4Y19B 3GI9L 4MJ4A 4XC1H 3HC4H 3DMMA 3Q6GH 3I2CH 4ODXA 1RIUL 2EXYD 1KXTB 3QDHA 4MVBC 5CKGA 3KPSA 2W91A 5LGJB 1F11B 1MHEA 2WUBL 4UB0H 2X89D 1A9EA 4PJ8A 4OGYL 2HFTA 1UA6H 1J0ZA 4MJ5B 5ANMB 4MXWH 4RRPA 3LS4L 2D03L 2HFGL 5BMFL 32C2A 2O5ZL 3D39E 4LP4A 4XWGH 2XKNB 2YPLE 3WIFA 2H6PA 2GITA 5CEYA 2BOBA 4ZODA 5C08B 4P46C 3HTLX 3GJFH 4GBXB 3HE7B 2DQCH 4F57L 3GSUB 5EB9A 1ZGLA 2QSVA 5JIIA 4P9HH 2PXYC 3C6SA 1OQOA 3ARRA 5EIQA 4Q9RL 1RIVL 4N0UE 4RCAA 4Z0BH 2XKSA 4MNHB 3GJEB 3K46A 9CGTA 1A4JB 5DMGD 3U7AA 2ID5A 4Y4KC 3MRGB 3QXAA 4ORZC 4X7FC 5HI3D 2HVJA 1F4WH 4OQTL 2Z31C 4PYGA 5J3HD 4APQA 5I76A 1U3ZA 1O7VA 4JQXC 5GGTA 2DOCA 4RAVA 1ZOXA 3NFSH 1MH5A 3B5HA 3MACL 4HFUH 2MFNA 3EFFA 5K59F 2OTWB 1IGJB 4PJEB 5T1KB 1ZK9A 1DUZA 1UKSA 5FF6B 1K6QL 1UM4L 1YNLL 5AEAA 1DQML 5I66B 5IESL 1AGCB 3KPQA 1J1XL 1KGCE 4XCCH 1NMAL 4IOFD 4Y5VB 1A1OA 5CFHA 3QEQB 1G9MC 2ZNWA 2GFBA 2BSRB 43C9B 4TULL 1OP3H 4NNPL 3Q48A 1MJJA 3P40A 3UBXG 2P8PA 4FQXC 1LO2H 5DD1H 4MQ7B 2OJEB 4ZS7H 4RFEB 3S7GA 2HMID 3F58L 3K81A 4TUKH 5IFHH 1BBJA 1KXVC 2ESVD 1OGAE 4GUPB 5EUOA 4NQEE 1F00I 3F7VB 5EDXA 3VXRA 2UWEF 2WP3T 3MCKA 1JTPA 3JTTB 4E42B 1GVIA 2YN5A 1QTYT 3QIWC 4GW4B 3RY5A 3ARTA 2DTMH 2VR4A 3BDYH 5FUCC 1KEGH 5DJCA 1PLGL 4NKOA 1S9XA 3FN9A 5IMMB 2VQUA 4MA3B 3MRMB 4TSCH 2QQKL 3WS3B 3SDDC 2X4SB 3ARGD 4V1DB 3QQ9C 1RJLA 2AABL 4D9QD 1AQKH 2QQNH 1FNAA 5A1AA 5FGCB 4J3WA 2O5XH 3CH1A 5L88L 5JOFB 3CJJA 4WFGE 2ZUQB 2P5WD 1CFVL 5FO8B 5F1NA 2J1KA 1HHJA 5IGXL 4Z77B 5CBEA 5CSZB 1HHIA 5C1MB 3WLWC 4GSDL 4JANA 4D94A 3WFBH 1KIQA 3KXFE 4Z7OE 3J7HA 4RGMB 3SN6N 5K9KB 3OAYH 2DMCA 4D0BA 5JW4Q 5MERB 4XHQA 5ADOH 1JPTL 2HN7A 4XP9L 3L9RB 4Y88A 2I5YH 3ARBC 3MRQA 1XGTA 2BZDA 4JVUA 3UZVB 1XIWA 2H3NB 2CQVA 1KPVB 4U2ZA 1B90A 3B5GA 4NRZA 3SE8H 1P7QA 4PY8J 1QKZH 2J6EH 2BCKB 5FYLL 4UT9L 4U1IA 5CJXC 1LD9A 5AWNH 3QDGD 1ZKAA 1VFBA 2PYEA 4KK5C 3GSNL 3ARUA 3OJMB 1UJ3C 4NOFA 1JYXA 1ROWA 4Q2ZA 4JO1H 3ZT5A 4F58H 3IJYB 3DHJA 5DVKA 3U9PL 1D6VL 4DOHE 4RMQA 3CX5K 4Q6YA 3RVTC 2CDEA 3PJSB 1A47A 2EZ0D 2XWJA 3CVIH 2XN9D 4NWTH 2H26A 3RJQB 4KK6C 4MX7B 2XXCB 3RVWC 4IJ3B 2Z4QB 3GGWB 3MRJA 2A6JB 1J0KA 3ISWA 2VKXA 4OCSH 1ZLSH 4FXGA 1A7OL 1KCRH 2HAZA 1SJEB 3TBSB 3RL2B 1Q9OA 2R0WL 2QTEA 3F12A 1YEJH 3ZKXC 3BO8B 3L3GA 1JHKL 2M8XA 1SYVA 1MI5B 3G5XA 4YBQC 3MLSH 3NZ8A 3MNWB 4NFCA 4PRDA 3UTTD 4NN6C 2WANA 3WUZA 3EJJX 3BZ4A 1EO5A 4CGTA 3DRQA 3T3PE 5E2WH 1KXQE 3VWJA 4ZUUB 2ADJB 1T6WA 4JPIB 1X5FA 4QHUA 1GCFA 5DGRA 3LKSA 4ZPTB 4I3RH 3HG1A 3Q6FA 1SY6H 4Y4FB 3AAZA 1IEAA 1XGPB 3F62A 3FB8B 4QNPF 1R5WB 1EV2E 1DQQB 3QUMB 1IAKB 3FFCB 3IFLL 4JN1L 5A16A 5SV4A 2CLVB 1H0DA 3SDCD 5LAXB 3AM8C 5JZ7C 2HVKA 3QA3B 1XH3A 5IBUG 2PUQT 4OTXL 3SE3A 1IKNA 4M02A 4O2CA 5DJ2B 3P9LB 5JW3L 4EIZC 4XBGA 4TQEH 2Q86A 3MJGX 4QRUB 1PX4A 3SGDH 3VRLE 2IPTL 1KN4L 1INEH 4PJIE 4RNRB 2VITA 5T5FL 4IRJD 5SWSB 1WAAA 3INUL 3MBXH 5C0AE 4TUJA 2NZ9C 3MA9L 3OKEB 1KB5A 4Z7UF 3TA3D 2ZG3A 2VISB 5BQ7A 4PJ5E 5DEFA 1F4HA 1FO0H 4IMLB 4Z6AT 4ZSOB 4LOUC 1VGEL 4XTRC 1U3HB 1OP5H 5T1LA 2IFGA 2EC9T 3BJLA 1PY4A 5KS9A 5D93B 2ATPB 4K3JL 3V4PH 1MLCB 4J3TA 4IDLA 2VLJA 1MEXL 3I6GA 3Q1SH 2ITCA 1VADA 5C0CB 5DHVB 5KVEH 3BKCH 4MQSB 5D9SB 3O9WC 1KJ2L 3QG7H 4GRWF 3GK8L 1E6JH 3UP1A 3MRKA 4LCUA 4PRPE 1U6AL 4HHAA 2VLKB 1T1XA 2Z8VC 2OSLB 4XP6H 4QXGL 4UT6L 3SOBH 1EO7A 3PUCA 3CSYA 5JHLL 4PGBB 5E5MB 3VFNB 2CGRL 4PV8A 4I3SL 1EAPB 3QDJE 1MIML 1HOCB 1U8PB 3NFPA 3GMQA 4MA7H 1XF1A 4KU1A 3OHXB 4OFPA 3BEWB 4O58L 2BNQA 1KCSL 1E6OH 4NUGL 3VI4F 1CDCA 3OKMB 3VDAA 3PNWA 3VFTA 3TF7C 2UV3A 1D5IL 3IF1A 3KYMB 4Y1AB 4JRXA 4WDIB 1PSKH 5KJRL 3BKYH 4NO3A 5J12C 2H32A 3P9MA 4FG6D 4MJIB 1ZT1A 3RUGA 4GG6A 2ATKB 2JKXA 2X4QB 2YSSA 4PJGF 5D70H 4NQDB 1MCBA 1QQDB 3B9VA 5E5UB 1G6RB 3I75A 1ZHNB 1U8HB 4JGUA 1QEWA 1MJ8H 3S6CA 1NMCC 5E2JA 2DLTA 2P49B 3M17B 3GMMB 2F54E 4ZQKB 1GIGL 2FEEL 1A1NB 1T5XA 2JCCE 5BVJB 4PGCA 1J0HA 3VRJB 4Y19E 4ZFFA 3RIAF 3F8UB 1EEZB 3PGDB 3EYFA 4RA3A 3KAAA 3MCLL 4J8RB 3TYFA 4PRBA 4NT6A 4KWUA 2VLRA 3ZTJG 1KJ3L 2Y6SC 2Q76B 2OTUB 4OLVL 3ULSA 4UIMB 5CD5C 2DQIH 3MLUH 2R15A 1TXKA 5JUEL 1A14H 5ANME 3OG4B 5HDQL 5F7WC 3MJ9A 2BHYA 4GRMA 2ZG1A 4G5ZH 5ILTH 4X7EC 3VXTA 1HYRC 3JZ7A 1R3KA 4L3ED 3BIKB 4P4KC 5C08E 3EBAA 2XZAH 5I16A 1IC7L 2FR4A 2Y7QB 4H0GA 3QDAA 2XKUA 1SYSA 4LLUA 5IT2H 2CJUH 2YUXA 2EIZA 1DLHB 1K9TA 4ZNCD 3H7BA 3BP7A 2OS7A 3OB0K 3PHSA 1FAIL 2NXYC 4X4XB 3N06B 3G5VB 3VXMB 4BSVB 5INDB 2OTPA 3SHSA 3C9NB 5HY9B 4MJ6A 5LKNA 5F6IB 1Q94B 3C8DA 4TOYL 3N50A 3RDTB 4A6YL 3I6LE 1RURH 2CH8A 2J2ZA 1U8QB 2DQJH 3C60D 4W68A 1Z5LB 3GMLA 1YUHB 3EO9H 4FQIH 3MA7B 4G43A 1L0XA 2IAMD 1S9WB 3R0NA 2FO1A 2Q6WB 3QEQE 2Y1VA 4LRIA 1HIML 4XAWL 1GGCL 3QP3A 3TFKD 1RUKL 3QQNA 1YEHL 5HHQA 5DRZA 2L4OA 5TPWH 2WBJA 1YY9C 1I1FA 4HWEL 4PP2B 4AH2B 1FQ9C 3T4YA 3GBML 5JPMB 1Q0XH 2JIXA 4M48H 4CRPA 3GUTA 1TJHH 2NXZD 1FLTX 5HDBE 1HHGB 4P59L 3MNZA 2LVCA 1S5IH 1AI1H 3HNVL 5BJTA 4YE4L 4P2OD 5FB8A 1IGYA 4KUZH 2KQMA 1MCNA 4FFWC 4LHJB 3V5HB 2VLLA 4M7ZB 2JK5A 1FFNB 4Y16B 1S7VA 1HINH 4DJMA 3KPRD 2L7UA 3DMMB 5GRYA 5HI5D 5EWIL 4OUOA 4LMQI 1U8KA 4ODXB 4OIIL 3WJLC 1CF8H 3ECBB 2FB4L 1MHEB 4V1DE 5F9JB 4GXVH 1TFHA 1YEDB 4LDOB 1JI1A 2YD6A 1WZMA 1UM6L 3GBLA 3QPXL 2DDQH 4BKLA 1KTLB 4X80H 1FVEA 2WAHA 1NBVL 32C2B 4OFIA 2JJUA 3S9DB 1MRDL 3GSVA 4NPYA 1CDBA 4LIQL 1KJMA 1FVCB 3AS3A 3REWA 4K7PH 3RTQD 2HT3D 4KUCD 3WSQH 5JXAH 3HI5L 2VC2L 4U0RB 4C54A 2DQEL 2W59A 4WI5A 3Q5OA 4ODUB 2K3TA 4PP1C 1UWEH 5D1QC 1AR1C 3RGVD 1I7TB 4N5EC 4S2SB 5IHZA 4YEFA 1ZT7A 3C5ZD 4UOW1 1EUUA 5IOPA 1IJ9A 1AGEB 3O41A 2HVJB 5DQDH 3M8OH 4Z0XA 1LHZA 5I76B 3EO0A 2O61A 2UY6A 2E9WA 3B9KB 4KTEH 4TSBL 5HYJE 1J1OH 4XH2A 3ZE2E 1DE4A 4HQQL 4F7MB 4WI3A 4NN5B 2V5TA 5HPMB 1Z9SA 4YHLL 2YA1A 1JZ3A 4H26A 4NP4L 5C07E 4KGLA 1QNZL 3D3VA 4AIZB 3MBED 3BP4B 3DYPA 1MJJB 5HHMD 4KDTA 2OL3L 3V0VA 4QOKE 3BKML 3VXOB 1LK3H 3PV6B 1J0IA 4Y5VC 3NTCH 2GUOB 3VGHA 1BBJB 3MV8A 1UXWB 3LKNA 2MPAL 1FNFA 3VXRB 5EZLA 3FRPA 4HKXB 4G6MH 3V4VH 4FA8A 1MHCA 3EJYC 1AJ7L 1KC5H 4N90E 1CT8B 4Y8AA 1DCLA 2BVOA 5DS8A 1WIUA 3VJ6B 2VZOA 4HWBL 3U7YL 2Y06L 1DUYA 1QFWL 2IQAA 3CXHK 1KCVL 4L4TD 4Z7VA 1IQWH 5T3XD 1T2JA 3QUYC 5HD8C 5C0IB 3RPKA 5IEKA 1S9XB 3O6MH 1XEDA 3H3BC 1Q0YL 3K1DA 3DX6A 1J7VR 3NCJH 4WU7A 1CICA 2PTTB 3GJFA 1MI5E 4YFDB 4NHCL 5IHLB 4KQ4L 5CILH 1I8MA 1EFXA 2ZKHH 1FFPB 4LQ1A 4XWOD 2EXWD 2R0KH 3L3IA 5F7UA 5IM7A 2VZSA 3QUXD 5JQ6L 1WISA 3CH1B 1N6QH 3PWVA 4WGVB 4AIOA 1DQJA 4P2QB 1HHKB 5F1NB 2Q7YA 3QWRA 1LDPL 1NCDH 1KBGH 1WIOA 3Q5TA 2WQRA 3T77B 5DUMH 1UJTA 1TQBB 4XPBL 3JWNC 3FOLA 1FN4A 2ZUQC 1KIQB 2V17L 1BMGA 3CLFL 3QXTA 5L2JB 5EORH 1DBMH 3G6AB 1FIGH 3LDBC 3FFCE 1NDMA 2WLYA 4BH7A 4XI5C 2HN7B 4K3HA 5FYKE 4H20L 5HPOA 4GS7B 3S4SG 1ADQL 1CGSH 3I50H 4OF7A 5ERWA 4Y0GA 1LVEA 3CFJB 3K2UH 3QIUA 5D6CB 3IAQA 4FQJL 2AJYL 3IFNH 2FBJH 2KKQA 1AQDA 3K8KA 1FG9C 1P7QB 1LWRA 2DIBA 2ZUXA 3BIBX 1S3KH 2VUYA 5SWSE 1RJZA 2LU7A 1QBLL 4TSAL 1NLBH 1ZT4A 1MY7A 5JXEC 3RU8L 1U8IA 3TBWA 1CIDA 1SMAA 1HDMA 1IZKA 2VIRB 5E8OB 4TPRL 4Q2ZB 5IMOA 3N85L 3FB5A 4JFEB 4NZTH 4NJ9L 2D9QB 1CLOL 3BZDA 4ZSOE 4TTDC 5CZXD 5A2LH 3BGFB 4RAUA 4OI9A 3GO1H 5GZOC 1NFKA 2CDEB 3RAJL 4TNVF 3TYGH 1JNJA 4JKPH 5IB2B 2H8PB 4MQTB 5BS0A 1TMCB 5TQ0H 5DWUL 4IDJH 3VA6A 3F7YA 2LE9A 1AY1L 4IEFB 5C0CE 4OCWL 4U6VH 1GPOL 2NR6D 2YPVH 5F7HA 1CS6A 2JELL 2H9GA 1KIRA 3MRJB 4HFWA 3JWDC 3GKZA 5MENB 4PRHD 1BZQK 2DQHL 2E9BA 5FECA 3VXUA 1JPGA 1OLZA 4YHIA 5GGUB 1DANU 1I7UB 2VLKE 2OP4H 4IJ3C 1WGOA 2Y07L 4UNVA 1GGIL 2BC4A 4RRPG 1I9IH 3RZCC 1DQDL 3UPRA 4PJFA 4LBEA 3GSRA 2X89A 2VERN 1NLDL 4LCIH 1A7NH 5E6IB 1MQKL 4Y4HD 3NZ8B 5BVPL 4DGIH 5DJYA 2VXQH 5GXBB 5T3XH 5DQJA 3VWJB 2DIJA 4Z95L 2IPUG 1TVBA 2HTKD 5FOJA 3O6FA 2A9ML 3VXPA 4M03A 3LKSB 4JAMA 1NCAH 5EA0H 4Y1AE 2ZPKL 3W11D 5L9DH 5DDHA 4J3SA 4N0FB 3AAZB 5TF1H 4OLXL 4MLSA 3UEZA 5ENWA 1QLFA 5CHNB 4XRCB 2WWKT 1HZHH 4Y4FC 3OKYA 3QDMD 4MJIE 1Y6KR 4QHKJ 1VSCA 2IH3A 1NUFA 4OBRA 4NQDE 1XH3B 3B2VL 4OZFG 1BQHA 3NMEA 4O2CB 5EZIL 2B1HH 4F80A 5I74C 1A6WH 4XBGB 3CFCL 2YD3A 3VXSD 1JZ7A 1FJ1A 3BFOA 1IT9L 4PJGA 1MCRA 2F5AL 2BERA 3P4NB 1AXSB 2CUMA 1D3CA 4C83B 3BHBB 2YD5A 2EDEA 2G5RA 4TUJB 3KLAA 4JGMA 1AHWA 1QSVA 4PBXA 3B3IB 4OSUH 2Y9RT 4NBZB 1KB5B 3NIFF 1JFQH 2EYSA 1IGCH 4UT9H 2GAZB 5L7XL 2FYYB 1JRHH 4PV9A 3RX7A 4HXBH 5KS9B 3KLHD 2ESVA 3PF2A 4YHKH 3MXVL 3MFGB 1PZUB 1NEUA 2ITCB 2DD8H 1S7RB 4P4RB 4ELMB 5D93C 5DD5L 4DW2H 4Z7NE 5F7DB 1T1YB 4XP1L 3MRKB 1N64L 1X4XA 2C3VA 4K55A 1U95A 4LCUB 2C1OA 4R4BB 2CK0L 5L8KB 4LSVL 4L5FH 2HKHH 4UAOB 4HHAB 5D1XC 3ZSSA 3QUZC 1H3UA 2XWBA 5KW9H 2NPLX 4K3EH 3UAJC 1F4XH 4BELD 4ZAKD 2ED8A 3W0WA 1IGIH 1NQBA 1BAFH 3I02B 4N0CD 3VXME 3ULVC 4ZS6D 3QI9A 4KQ3L 1RMFH 3WN5A 2LV4A 2QHRL 3TJHC 2I9TB 4X9BA 1FNGB 2C3XA 5BV7H 3LH2L 1K8DB 3A6CH 2AXHA 4XXCC 4YAQA 3DUUB 3PQYA 2XPGA 5KZCB 3U0TA 1KTKE 5E99H 3SDXB 4QRSA 2APBA 2VR5A 1F4YL 3CIQA 5I30H 1KIPA 4OZGA 2H32B 3T04D 2P43B 3P9MB 3HI6L 4QO1A 3FT2A 4I1NB 3MRNA 3O6LH 5J1AA 3CXDL 4PR5A 4WTWA 4YHNA 1ZT1B 2KPNA 3OKKA 4LGSB 3RUGB 3LQAL 1QBBA 1A3RH 1REIA 5E6ZA 1R5IA 3IXTB 1BP3B 1JGEA 4X99A 3LCYA 3RA7H 5IVNA 3NFNA 1QA9A 5FDWB 1N6UA 5DR5L 1FO0A 2FZ3A 5FKAA 2CRIA 5AAWA 5L6YH 2D7QA 2MQCA 3J8F7 4ZFFB 2IBGA 1K3ZA 3EYFB 4I77L 3C2AH 3WFCH 3O3BA 1NFIB 5IMKB 5BW7A 3CPLB 4GAYB 5FGBA 3TYFB 4PRBB 2H45A 2VLRB 1BOGA 1QO3B 5C0ND 4KHXL 5L8JB 5HHPA 5CLTA 1EJOL 3OX8B 2EICA 4HIJA 4ZO7A 3NACH 3ULSB 4CVWA 3WO4B 5DD6B 1G9NL 2APXA 4UU9A 4YWGL 2OZ4H 3L5WA 5CP7A 2XRAL 1JN6A 4XNXL 1AO7D 4YXHL 4F37F 3LY6A 1T1WA 5LWYH 2AVGA 2DKMA 1R3KB 4RA0C 3VG9B 4HT1L 1H3PL 5I15L 1UYWH 1C7TA 2ICWI 3HE6A 1V5JA 4XVJL 5HGAB 2WUCL 3FCTB 1LQSR 5SWZD 4LLUB 1OAZH 2SEBB 3BT2H 1FL6B 4G9DA 1H15A 2EIZB 3U79A 1NGZA 4P5TD 4LQFH 4YDKL 3H7BB 3BP7B 3OKNA 2WSKA 5JOPE 1NCBL 2QQQA 3UTSD 2D7OA 2FX9H 5I1HH 2FGZA 5E2VL 5H2BB 4HLJA 4FQHB 3UTTA 5GHWL 3W9DB 4ZFGH 1TQCB 1HYSD 1ZA3A 4NKDA 4OUUB 1JNHA 4MXQD 1OB1A 3B6SA 5HGBB 4KXZI 1GGBH 1KPUA 5F6IC 1B6UA 4G43B 3N1PC 3I3DA 5SWQA 3MODH 4XPAL 4KMTH 3PABB 1MCQA 4OLWL 3IDXH 3SDAB 3ARFC 4XCFL 5HHQB 5DRZB 1NCWL 5DEGB 3PGFL 1I1FB 4CL7A 4M43H 4X6DA 3GSQB 3SDCA 1CFNA 5FKPA 1TVDA 4RBPK 3DGGA 3RNQB 3MNZB 1NBZA 3VXRE 4U1SA 3IDYC 5FB8B 3OPZH 3RPIA 3ARVA 1EEUA 1AXTL 4RWHA 1M7DB 4XP5H 3I6KA 1H9VA 3IFOB 1NKOA 4B50A 5CS7A 4H1LG 2JK5B 4Z76B 2I27N 1BBDL 5JHDB 3MRRA 3BP6B 4Z7WA 4U1KA 2AV7A 5T3ZE 3WFHA 1DL7H 1UEMA 2OR7A 3LKPB 4QHMA 3GSXA 3ULUD 1U8KB 1FH5H 3WE6A 4ZPVA 4Y16C 2Y25A 3SDYH 3LKQA 4L4VD 2V5YA 3HAEG 3GIZL 4JB9L 3DMMC 1MWAH 3QJFA 4P3CL 4XCNB 5ISZD 2XA3A 3ZYIA 4BKLB 1FVEB 1CXIA 4P2QE 2ADIA 4RDQG 3PXJA 1EHLH 4PJ8C 3DRTB 1ZS8A 4K8RD 1Q8MA 3GSVB 4JG0H 3ZTNH 4KK8D 1KFAH 1W8NA 1KJMB 1CD9B 2DQTL 3REWB 2Z93B 1FFRA 4Y7MA 5M94B 1DLFH 1BGXH 3MLYH 4M7LH 3ARDB 5DD0H 3TVMA 4DTGL 4MNGB 4WY7H 1BHGA 1FL3B 1ZT7B 3SJVB 1NL0H 1CGVA 4IS6A 4XNMA 1CN4A 3FN3A 2EO1A 4YDLB 5IOPB 5E56A 4Z0XB 2ZUYA 3FB7A 5I1CL 2EKJA 4U3XA 1J5OH 4YDIH 1J0YA 1UZ8A 5A2KH 4FXKB 5CGYD 1DDHA 1FAIH 2R2HB 2HT2C 3VH8A 4CDGC 3ME0A 3W9EB 2NYYD 4X9IA 2DLHA 3OAZK 5J1TC 1XGQA 4MD0A 4APQC 1TTGA 1E4XI 3BUTA 1JUFA 5DRNA 3T3ME 2R0LH 2YK1H 1S7QA 5GRJH 2B0SH 4H26B 2YRZA 1DP0A 4JFEE 3D3VB 2QSCL 3SBWA 1LEIA 3V0VB 4OF5A 1MCWM 4L4JA 4RMVA 4AM0B 4ODSL 2NY6C 4K9EL 1R3IL 5FYJU 4QF1B 3FZUC 5T5NF 3MV8B 3MPCA 5HSFA 2DQDL 5KSAB 3HZMA 1FFQA 3VFRB 1OAQH 3IDJB 4UNUA 2VAAA 1MCPL 2Z91A 5DS8B 5MENE 4PJHA 4LVNC 5FYJE 3JV6A 4FQ2H 4PJDB 3O3DA 3RP1A 1J1PL 5H35A 3WHE0 1PAMA 3BH9B 4Z7VB 5EU5A 4PJBB 4JJHA 3SO3B 3ZDYE 4LPUA 5MHSE 4F8TA 4PJ9D 1MRCL 5C9KA 4WU7B 4QTHB 4B53A 4M1CD 1QUNA 3KPNA 1NEZA 2BVEA 3PHOA 4OIIH 4FFVC 5IM7B 5E2TL 2OJZL 1SM3H 3ULUH 3FQUB 1BJ1J 1T0MB 4XVSL 1DQJB 3ILQC 1HQ4A 4RAHA 3QPQC 1P2CB 1BM3H 3HMXH 3EYVA 4OGXL 4HGMA 3NABL 4J6RH 5EBMA 5FM8A 3EZJB 4I0PD 1CLYH 3HNTH 4IOIB 5IUSA 2AEQH 1TZHA 4BH7B 2G9HA 2YMXL 3TO4A 1TQBC 1G7IB 1A7RL 4K8RH 2NCMA 1A3QA 4AMKH 5I8OL 3MRIB 1PX3A 5ERWB 1O7SA 4OM1H 4KKNA 3QIUB 1T7VA 2D0HA 2OBGA 4MNQB 5D7KE 3WFZA 4GS7C 4P3DA 2EH7L 4G6KL 2VDNL 4HIIB 4WI9A 1QVOA 1U91A 4XNYL 5MP6H 3KPMA 4X7TA 5ID1B 1MFAL 3OKOB 2VQTA 1XIWC 5H37G 3C60A 1WAAE 2VH5L 5DMIL 3P4LA 3WFDH 3JV5A 2X4UA 3RKPA 4EI5B 1U8IB 3TBWB 1NJ9B 1HDMB 5IMOB 4XBEL 5HYSG 4UTBL 3HFML 3TEUA 1NFDB 1S78C 5CIPH 5ICZA 3S88H 5E0QA 2XG4A 5KS9E 2NX5B 4G3YH 5LGHH 4LLDA 4ZFOB 2J4WH 1EERB 5BS0B 4G8FB 4G7VH 3HUJB 4P2OA 3BGFC 4N8CL 3RKDD 4ELME 2HJFA 3JWOL 4HUXB 2HKFL 3RWCA 1B0RA 1I8IA 4DGYH 4HFWB 5EN2B 4TRPH 5JW4R 1JGDB 2PO6A 3BMVA 3LHPL 3QULB 4MA8L 1UCBH 3KPRA 1JYVA 2BC4B 2UVEA 3TNMA 1S7WA 5I8KH 1S7UB 3BSZL 1RUAL 1VPOL 3S96A 5GGRA 4RQQA 4PJFB 4YK4B 2AK1H 4OZHF 4LBEB 3GSRB 4Z18A 4X4YB 2ICEA 1F6LL 3L3DB 2FECI 4TVPE 5D2NB 2CKBL 3VG0H 5BCAA 3B9AA 4JPKH 1WQVT 1KUMA 1V8HA 4HBCL 5I0DA 2FATH 5M7QA 3OG6B 1TVBB 3THMH 3A0OA 1IARB 4MJ2A 5CJOL 4KJWC 1P5VA 1YMMD 3FMGL 3U82B 2GTWA 5DDHB 3VWJC 1RZKH 4QRPD 1D5XA 1QBMH 3IU4L 5ENWB 3PDDA 2B4CH 2P5ED 4LK4A 2VL5A 2CUHA 1YECH 1K5NB 4R7NB 1DSFL 3RGVA 3HNSH 5D2LA 4W6XB 2IH3B 3RUGE 5BZDA 3C5ZA 4WV1A 3CDYA 5IBTL 5GS1B 2IQ9L 4NQTA 3VFSB 2AJSH 1BQHB 5ICYA 1MVUB 5C0GA 1L0QA 1GL4B 5EOCH 43CAB 1JNNH 4H8WL 5C8JA 1J87A 4WCYH 1FJ1B 5DUBA 2Q8AH 4M8QA 2CLRB 2EDNA 3SE3C 1IKNC 5E1HB 2ZWLT 1MF2H 3B5TA 2GW5A 1GAFL 1YA5A 3DVIA 1HHHB 3SKNA 1N2RB 2DMKA 2FEDD 2H1PH 1AHWB 4JZJA 5D8JH 1IE5A 4MDIB 4LEOB 2VLRE 1U8MA 4X6BA 2EYSB 4OCXL 4OGZA 3FRPG 4JO4L 1IM3A 3VE0B 1T3FA 1VB9A 4H25B 4PLKC 2HLAB 3GSWA 1PZ5A 5DMKA 2ESVB 3P4MA 4FQCH 4NJAH 4NKIL 3TZVA 1LO3L 3QZWG 4JLRA 4KTDH 1X5GA 5I1IL 3VFWB 1OPGL 7CGTA 3D69B 4NC0B 2GY7B 25C8H 1ZLVH 1UENA 2LTQB 5DWUH 5DK0B 3VMOA 2C3VB 2IG2L 4K23H 4NQXA 3T0ED 2O5YH 1U95B 4KXZH 1A6UH 2C1OB 2NTFA 2Z9TA 4L4TA 4CMHB 3DIFA 1KCUL 2XWBB 1XGYH 3VXQA 1T4KA 1OW0A 1EH9A 2FWOA 1CE1H 1OP9A 4JRWA 2J7LA 2V2XB 1ZEAL 1OCWL 3ARGB 4JFZL 4NKQB 4QRTB 2ZCLH 1I7ZB 2DAVA 3SPVB 1BEYL 1TENA 2YXMA 3TPKA 1HH9B 2Y07H 4HMDA 5D7IA 3MUJA 4R4FL 1DQLH 2V9RA 4KGJA 5D7LD 3V0WL 4DVRH 4UT7L 2GCYA 1UZ6E 1YY8A 4P57B 3RWDB 2P5WB 2WK2A 4XNQA 4XMKH 5EFIB 5AZEH 5EU4A 3MRPB 4P5MA 1G9ML 2XPGB 4PB9H 1A1MB 1KELL 3U0TB 5B3NA 4Z7OF 3NN8A 4QRSB 5IBLD 3KS0J 3CFDA 1CL7I 4JFHD 1KIPB 5HHXL 3MRNB 1N59B 4MD4A 3EDJA 4PR5B 1JK8A 4L9LB 1ACYL 2X40A 2DQGL 4QHLA 5HGDA 1CBVL 4LKXB 4JPVL 4RWYL 2X6MA 1EHAA 1E4JA 4QY8B 1U93B 3EYSH 4U1HB 1OM3H 3O2DL 3I85A 2VNCA 2VDOL 3KNBA 3ARED 4UINH 4OLUL 1ORSA 1KEML 5I1KL 1XF2A 5JHDE 1IAIL 4XNUL 3U48A 3RY4A 5FXCH 4R96A 3PIQA 3QDGB 4U6HA 5LXGH 4HZLB 5FA3A 5DT1H 4OD3L 1N26A 1U8OA 2P8LA 5E8DH 2ZNXA 4UDTA 2C3GA 4XPFL 3FT4A 4X4MA 5IV2A 4ODWB 4HIJB 4FTVD 1UKQA 2BNRA 4DEPB 1YYML 4UU9B 3UDWA 2QADC 3BH8A 3O45B 3L5WB 1Q72H 1H3TA 4J3OC 1JN6B 5CP7B 4JY5H 4I48A 2UY7A 3DX8A 2VABB 2XN9B 3S8WA 1KENL 3WO4C 3LIZH 2ZCKH 5TDOA 3RWHA 1E4WH 1NBYA 15C8H 2V6HA 3NH7L 1DEDA 35C8H 1RPQA 2Z8WC 3RVUC 3NCYP 3G6DH 3CAFA 1NGPH 3U4BL 3VG9C 5DJ0A 1H15B 1NGZB 4FMFA 1DANT 1KJVA 5CMAB 4R7DA 3B4NA 3GMRA 1UM5L 4IMKA 2E27H 2YBRA 3SJVE 4UQ3A 4XC3H 3TN0D 5ETUA 3TWCH 3WD5L 2YXFA 5BXFA 1SBSH 5T33H 4GJTB 3MLTA 3T3PF 5DI8B 3UTTB 2WIIA 1S9KC 4KPHL 1L7TL 2CKBA 1BVZA 1NCNA 1P4BL 1ZA3B 2BDNL 2XNAA 4NKDB 5CJBA 1N0XL 2AK4A 1X6NA 1BVKB 1OB1B 5DFVC 3CVHH 3OZ9H 3P73A 3AMLA 1WJ3A 3BRFA 5ACZA 3X12B 5FUOL 5B4MC 5SWQB 1YEFL 4MZ3A 3HC3L 1INDH 5E4EB 3D3VE 1URLA 3ZKND 4QTIH 3HZKA 3QDMA 4NQVB 3WKMH 4X6DB 5IW3A 5T1DH 3SDCB 3U7WL 4I4WA 1JNLH 2ORBH 3O8XA 3MV8E 5FKPB 4JFDA 4LRIC 1Z0NA 3Q3GB 3GSOB 3DGGB 1CE6A 4XX1G 2Y4SA 3RVXD 2WBJC 4U1SB 5HVGB 3VXSA 2G75A 3VRLF 3L5XL 4YUEL 3I6KB 4JHAH 4PJIF 3DGCR 2B8OT 5F3BB 4XMLL 4PJDE 4P2YA 1S7TA 4IRJB 3S36H 4Z7WB 3ARXA 4U1KB 5IVZA 4RFOH 3V7AG 3GB7A 3WFHB 2A38A 4Z7VE 3IAGC 4JRYD 2VXVL 4PJBE 3O3EA 3QIBD 3EOBB 3OXRB 2W07A 4ZPVB 3CMOL 3TA3B 4PGJA 1VEPA 1RUPH 5EBLA 5BZWB 3TLRA 4JO3L 1I8KB 4HLZH 4YHMH 4M00A 2A6KA 4YQXL 3QJFB 2DI9A 2HH0H 2VQ1A 3BJ91 5IF0B 5DJ8A 2UZIH 5J9PA 2V9QA 1YEGH 4X6CB 4WIQA 3KWWB 2DJSA 1FYHB 3IJSA 1AKJD 5D1ZD 4PS4H 5C0JA 2QHLA 4CVZA 2X4OA 3OKLA 4X6EA 4BZ2L 1MRFH 4ONGL 2E7HA 4FQLH 4ETQA 4ODHH 5IWLA 2AP2A 2L0DA 2YWYA 3EJZC 5EOQH 3WLBA 4PLOB 2IPKA 3MUZ1 2IMNA 1QD0A 3SKJH 4WW2A 4ZAKA 2HT4C 4G7YH 2VDKL 3DOSA 4K71B 1DN0A 2HWZL 3N1FC 1HEZA 3QJHB 3VD5A 5C0FA 3FB7B 1BREA 2X1PA 1ETZA 4K7FA 5B8CA 3PL6A 8FABB 4ONFL 4YDLC 5KVFH 2W9LA 5E2VH 1XGQB 4MD0B 4MHHI 1OAKL 3D0VB 4PJAA 4ONHA 3L7EA 1I9RH 5GZND 3RWGB 5E1AB 4U1NA 4ZUSA 4ZMAT 1YPZA 4FHBD 2WW8A 5T1MA 4XCEA 4HS3B 1CLZH 4YGAB 1T04B 3MOQA 2NX5E 4FP8H 5CZVH 4GKSB 5BS0E 1QPPA 3QO0B 1ZMYA 3ZYOA 2IALB 3OJDB 1T83A 3S3SA 3HUJE 4K7PX 3PGCA 4KDTC 4X98A 1QYGH 2R2EA 5D6DA 3E2HB 2JCCF 1MHPH 4UBDD 2VAAB 5GGSA 1EGJL 4F9PA 2BSSA 4PJHB 1FCCA 4ZOEA 4KHTH 2YKLH 1MWAA 3JV6B 1W0VA 2W0FA 3O3DB 3ORJA 3QFJD 4JCMA 5GPRA 1X5IA 4TYUA 4U0QB 4S0TD 4QXUH 3EIFA 4U6XB 1T21A 1V3KA 4HW6A 1YN7A 4WUUA 5JQHC 2VJXA 3CLEH 4RFNB 2YC1B 5LQBH 1BBDH 4PJFE 2D0GA 5F1KC 1FG2A 3O4LD 5GGQL 1U58B 4FS0A 1BVLA 2JJVA 5D2NE 2FH6A 4J4PA 4WHYG 3VCLA 2AQ1A 1NEZB 3PHOB 2AJVH 3SO3C 1J8HD 3WIHL 2J8HA 1U9KA 1G7MA 1AE6H 4NC1C 1GC1H 1CICC 3MLRH 4OZHA 1HXMB 4L3EB 3ZL4H 1KPRB 2B1AL 4P9HC 3PWJB 5KOMC 5EBMB 1IGMH 3D39A 5TDNA 3WEXA 5SWZA 3E3QE 1U0QA 1BFSA 5F1IA 4P5TA 4NO2A 2X1XR 2C4XA 2BNUA 3BPLB 2VE6A 4LLMA 5I18H 3BRGC 4JFOA 3H9YA 5ALCH 4N0UA 5AZ2H 2YR3A 4L8CA 3MRHB 4UILH 4W81A 4LKCA 4JPWL 2D7TH 3VWKA 4P3DB 4PJEF 1IAMA 1HXYA 1U91B 1Q1JH 4X7TB 4PJGE 1NUGA 3VGAB 1FFOA 4PBWD 3QIUC 3ALWA 4HS8L 4DCQA 4Y5XB 3QUMH 2IAMB 2X70A 1CD1A 2ZJSH 4KJQD 2MKLC 2QL1A 5DK2A 4LLQB 2R0ZL 1T03L 4J3UA 1LEGA 1VEMA 1QPXA 5ICZB 2A73A 1T0PB 3V8OA 1MFBH 3VMPA 5I17A 5HDBF 3MOBL 1YDPB 2A2QT 2ESVE 2NXZB 1N3NA 3U1SL 2F15A 2DM2A 2PYFA 3GIVA 1P6FA 4P2OB 4POZC 3H9SD 2ENYA 2HJFB 5DGQA 1I8IB 4R4NC 2GHWB 5J57B 4B5EA 4BSWB 3QCUH 2I07A 2OR8A 2Q20A 3GZKA 2HTLC 4PRNA 5FM4A 3KPRB 4JR9H 2DJUA 4LFHD 3RBGA 3GKWL 3HLAA 1JGUH 7FABL 2CO7B 4L4VA 4PTTA 2PW1A 3HMXA 4NFDA 4R6UA 5DXWA 2YOCA 1A7PL 4HKBB 2KQNA 2ICEB 4HMCA 2AJUH 4MXVF 4JVPA 4D9QE 3LEVH 5DHVH 1D5BA 2EXYC 4N0YL 5ISZA 4MQXD 4HMEA 1T20A 4JDVB 2GSGB 4D8PB 2OYPA 1XGRA 2OR9H 5TDPB 2P5WE 4FQQA 4OZ4A 5CWSA 2D9CA 2ICES 4O9HL 4EN3A 4DAGH 3L1OL 4M9PA 5BRZD 2QEJA 3PQYE 5KG9B 1GZQA 3MYZA 5D72L 1ND0A 6CGTA 5FCUL 4PGEB 2GTWB 2FD6L 4PRAA 4KK9D 2OXGA 3RTQB 1A6VH 5ESVA 4FNLL 3JVGA 3RWFA 1KB9J 1D5XB 3O6FC 3PWPA 3KPTA 4OZGE 2EE3A 4LRNL 2H2PD 4JM2D 3TCXA 3FO0L 2VL5B 1OAXL 2ZSVA 3VH8G 1Y18B 5KVGL 3RGVB 5D2LB 5BZDB 3K0WA 3C5ZB 4XPHH 4WEBL 1XF3B 2IAND 1F3DJ 1S5HB 1HSBB 4M6OL 3PDGA 3HB3D 4KRNA 4JY6A 4ZOAA 2WQ8A 2JB5H 5DMGC 3BRDA 1TIUA 5C8JB 1B4JH 2HP4A 3F6LA 3ZE2F 1D5MA 4RSVA 4XVUC 3TJEL 5HI3C 4M8QB 2IH1A 2KBGA 4PG2A 4G9FD 1DFBH 5KN5A 3STLA 4PY7A 3LSOB 12E8H 4NZUL 3BPCB 3QDGE 4OI7A 1NBQA 3SKNB 3NPSC 1NSNL 5I19H 1AGDA 1WBZB 3S35L 1BJMA 1U8MB 3MBEB 1MFDH 1E4XL 1ED3A 2BVQA 3WXWH 4OCYH 1IM3B 1C08B 2V2WA 3D85A 2VDLL 1T3FB 4LAQH 5HHMB 4ZYKA 4E0RA 4K7PY 1AHWC 2X1QA 4P46D 1C1EH 1ZLUK 4HS6A 3CSBA 5DMKB 1P4LA 4UOW0 3P4MB 4TN9A 3RI5K 2XN9E 1F3JA 4G6JH 2ZZUT 4JLRB 1DQTA 4YX2H 2R4RH 4DKFL 4HUKB 4DZBA 4BM7A 3WIIH 5C0RH 4KY1H 2YWZA 1E0OB 4Y4KD 4NQXB 4XB8A 4AL8H 3MV7D 5EU3B 4HDIB 1PQZA 4JFQB 3SGEI 5EZOH 4O5LL 2BOCA 2NTFB 5FM5M 4NWUH 2E7CA 1NCCH 5B39A 5E2UL 4ZXBA 3U0WH 4L4TB 3DIFB 4HGWA 3VXQB 1T4KB 4GRLD 3VXNA 2XZQL 2FWOB 4Q0XL 4GKNA 1YNKH 1X5AA 4PJ9A 2DQFB 3CFKB 4MMXC 3DWTA 4CMHC 1F58H 3UTTE 4LVOB 1V3JA 5D7IB 3TV3L 2A6IA 3IDGB 1A6TA 3QUXB 4PREA 3QI9C 4XNQB 3HKFA 3JXAA 3WN5C 3ZE0E 1BD2D 1AIFB 4P5MB 4KRMB 3V6ZB 3PDOA 4I0PA 3B83A 1LO0L 3CFDB 4RMWA 4NM8H 1L7IL 3ILPA 4GG8A 2CXKA 1AGFB 4MD5B 3WXVH 2GI7A 5J06A 3BGMB 1LE9A 3NCCB 1I3VA 3ALPA 1B0WA 2VZUA 4ERSL 3EAKA 4X6DE 5EC2A 1C5CH 2IADA 4U1LA 4KKCD 1MFCL 3G08A 3O0RH 5HGDB 4MCZA 2DTSA 2ICWA 5LBSL 5EIIA 2K7QA 1UB5A 4UIKL 1RU9H 4R26L 3IS1X 2Z8SA 5MEOB 1YEKH 1TZIB 1FSKB 2GT9A 4WEUD 4HAGA 1CXHA 1V3MA 4Z7WE 4WU5A 4HKJA 1IC5H 2BY0A 4U4BA 3LZFL 3HS0B 5TE4H 3DO7A 4UQ2A 1EJ6A 1XF4B 4ZDHA 2DYPD 2P8LB 3RX8A 5GGRY 3O4OC 2WLZA 4UDTB 2XZCH 1X5XA 3BKJL 1JZ6A 3KR3H 5EBWA 2CIKA 5JTWA 2A77H 3BE1L 4ZUWA 1WCBB 1IC1A 4AEFA 2FL5A 5B38B 2GQHA 5BW7C 5DHYA 5FGBC 1KNOA 4LHUA 3WLWD 1Q9LB 4M1GL 1DBJL 2R29L 4URTB 2DL2A 3DX8B 1N0LA 2DM7A 1ZWIA 1T22B 4X6CE 4CAGA 4GFTB 5TDOB 3WBDA 3EOTH 1MCOL 5FGSA 4PRHB 3TESA 4LGPB 5E8EA 3D0LA 3IKCA 1RZGA 4KRLB 5C3TA 3FAXA 2XTLA 3V52H 1FNSH 5BV7B 4L8SB 3HE6C 1BZ7B 1KJVB 1T2XA 5I1JH 3W81A 4PRPA 4NNYA 3QRGH 1CWVA 2OM5A 5ETUB 1CD8A 5TE6L 2G60H 4Y4HB 5IQ7L 4KK5D 1VFAA 2WIIB 4OFYA 1MNUL 4K3GA 4FRWA 5C0DB 2YZ1A 5L0QB 3IDNB 2XNAB 2BY3A 4N1CA 3DURA 2VDRL 3EDDA 3QQ4A 2R1WB 3IDIB 3P73B 1YMMA 4OV5B 1N5AA 1R6VA 3LN5A 4R90L 1QRND 2X44D 5D7SL 4XAKD 2ARJB 4QRPA 5F7EL 5D96B 1IZJA 3D18A 4S10A 4D0CA 3T8XB 2VXUH 5HYSB 3HZKB 2B2XH 1A7QL 2AGJL 3QDMB 4KK6D 3EYUH 1DBKH 1AFVH 3RVWD 1RZFH 1JMZA 3QQ3A 4IRZH 2AEPH 2ZP0T 3KYKL 5HVFB 4HF5L 3H0TB 4OCRH 5C2BH 3MOAL 4H5SA 3JWDL 1RZ7L 1G7HB 1ZVHA 4I0KA 3VXSB 4MDJB 3SDCC 5ITFA 3NZHL 4YHYC 1H3WM 2FDBP 1RIHL 4PJHE 5I1EH 3P0YL 5DJXA 3FO2A 4MWFB 4CVXA 3LS5H 1BLNA 5IVZB 3GB7B 4YXLH 2Z0BA 3HZVA 1KT2A 1UXSB 2ADGA 3ARPA 3O3EB 2JCCA 4QYOA 3L3OB 2DQUL 3FQNA 4Y19A 2FLBT 3VGBA 2R1XB 5EBLB 2DLFH 2MOVA 1CQKA 5DJAA 5IFAL 3SKUD 2R4SH 2A6KB 2W9EH 5FUZH 1OSPH 2IWGA 1D9KD 2D4FA 4LSTH 1F11A 2NY7L 1NGWB 5KANG 4FZ8L 4OGAD 4J2XA 4OLZH 1ZLWK 4L3EE 4Z7NF 5IW6B 4JHWL 4MA1B 1OTSD 4JY4B 3HA0A 2HRPH 2AJ3B 3R1GH 2OI9C 3T0EA 2XKNA 5SX5K 1NMBH 2XFXA 1DR9A 5C08A 3ZLQC 4GBXA 3HE7A 1QFHA 3V6OA 3KVQA 4WW2B 4ZAKB 3HCVA 2C1PB 5FDYA 4CU8A 1K4DB 4FQ1L 4EDXB 3CVHA 4JDTH 5FYKL 1EEYB 5CGMA 4UV7H 1HEZB 4MNHA 3GJEA 1A4JA 1F4AA 5GQBA 3TVMC 3TT3H 5I75B 3MRGA 2BY2A 1BJ8A 4RISL 1K4CB 2NZ9D 4XP4L 3G04A 1N6VA 2Q8BH 2KL6A 4K71C 4LOUD 1HSAA 1WIPA 4PJAB 1GOHA 4YPJA 3CMGA 3EDFA 1IGJA 2R1YA 2AJZA 3DSFH 4PJEA 4ZUSB 3PE9A 5JR1H 2DB8A 1YPZB 2DLGA 5FF6A 4XCEB 4NM4L 4MB3A 1IKFL 4DQOL 1AGCA 3V4UL 4R2GB 1YEFH 1NGQH 3O9WD 1QRKA 2BSRA 3BI9X 43C9A 1CL7L 3SBWC 2ILLA 5CSBA 3EGSA 2VKWA 2M2DA 4XGZA 2OJEA 3U2SA 4RFEA 3X11B 3QNXB 3AREA 5GGSB 4GUPA 1T7WA 1HCVA 4PGZA 3F7VA 2BSSB 2Y5TB 5EU7E 5B21A 3P30H 1MWAB 1W0VB 2F58H 2CXGA 4JO2L 1C12A 3JTTA 3KPRE 3E2HC 1F8TL 4S1SL 1XR8B 1AD0B 4K3DL 5F8RC 5GRUL 5IK3A 4GW4A 1P4IH 1YN7B 5F9OL 2Y72A 2FHCA 4AJ0A 1TZGH 4U1GB 3VW3H 5FEBA 4Q9QL 5ACLA 5DLMH 2CR6A 4MA3A 1U36A 2W9DH 3WS3A 4RFNC 4M1DL 2X4SA 4DN3L 1AO7B 4V1DA 3CK0H 5I71B 3PP4L 4WI2A 4JFFD 3MLVL 5FYJH 1D5ZA 2PETA 3OXSA 4I3GA 1J10A 5JOFA 4M93B 5FO8A 5SWZB 3AB0B 2EDXA 1D7FA 1BFOB 1V7NH 4NSKA 1L6ZA 4P5TB 3AGVA 2IBZX 1JF6A 1MVFA 5D2LE 3UTSB 3L3JB 1QFWM 4YDVA 2NLJB 4LLMB 1V7ML 1CQYA 2P48B 5MERA 3GFUA 3QEGH 5IB3B 4ZD3L 4A6YB 2YHGA 4HX1B 4L8CB 1WITA 4F7PA 3TO4C 3OB0H 4LKCB 3UZQA 1G6RL 5GJTL 1CTOA 5E08L 3KJ6L 3ET9F 3NBNA 4O2EB 1KPVA 1A9BB 5D4QA 2XY2A 4DCQB 5C0AD 5CD5D 5KVDH 3PHQB 4X9FA 4JKMA 4QRQB 1H5BA 1CD1B 3C09B 3F7RA 3SGEH 4BK4A 5F96L 1BQLH 3AU1A 3C60C 1OTTD 5DK2B 1MELA 1EA9C 4DVBB 1I85A 2COQA 5HHME 5IIEA 1QLEH 2A73B 3EZ8A 3G9VA 4PYHA 5I17B 1CXLA 3DARA 2PR4H 5T5NG 5IHUL 4K2UH 4O02L 1IFHL 3TFKC 4Z7QE 1N4XL 3VA2C 2RCSL 5D71L 3VU2A 2ZSWB 2F19L 3MJ8A 4NBYB 1MHHB 1QR4A 1CDHA 2J88H 2VDPL 3NAAH 1FC1A 3UROR 4FZEH 3PJSA 4ZTOH 3OJ2C 4HPYH 1OAYH 3UJJL 2P7TB 4AQOA 4P2OC 4MX7A 2FGWH 4M9OA 1RZJH 2EYRA 4PRNB 3GGWA 4L4TE 3P0VH 4JRYA 5EZJB 3BPNC 4WW1B 5T3XE 1LE5A 1BFVL 1JHTB 2A6JA 4N1HB 3ZHDA 3HLAB 2PO6C 5EU7C 2C26A 2PF6A 3QHZL 4L4VB 4PTUB 4NKMB 1K2DA 3S5LA 3TBSA 2EO9A 3QDJD 1MJ7H 1A5FH 1WFOA 5D7IE 5FHAL 2NY5H 1D5BB 3BO8A 2IJ0C 3MFFA 5ISZB 5J8OA 4L29A 2VUOA 1M6OA 4WNQA 5DRWB 4OZ4B 4FQQB 1MI5A 2ICCA 5MI0B 2CUIA 3MNWA 2XA8H 3S37L 1JF1B 1RUQH 1T1ZA 4OF0A 1AKJA 3GBNL 4G6AD 5D1ZA 3VFGL 4GQ9H 4ZUUA 4JPIA 1XGUB 4PRAB 4EQ3A 4PJCB 1TNNA 4ZPTA 3VFMA 1PKQB 2BFVH 1RUML 2W1NA 4FFWD 2HT3C 3FB8A 1ZHKB 1LO4H 1A4KA 1R5WA 4GAJL 1DQQA 3QUMA 1IAKA 5LGKA 4D9LH 5LAXA 3RGVC 3WYRA 4Y5YA 2N7BA 3QA3A 3C5ZC 3OQ3B 3DROB 3IFPB 4WV1C 5GGSY 5DJ2A 2IH1B 4OT1L 1HWGB 5CIPB 3T3MF 3P9LA 4F15B 1KOAA 2N1KA 4PY7B 4TNVK 1NAMH 4QRUA 4AEIH 1MIEL 5FHBH 4YBLB 2OL3B 2VZ1A 5KTEH 1ED3B 4P2RD 2BVQB 4IRSD 4NO0D 5GRWA 4E0RB 2VZVA 3OKEA 4JZJC 2XYCA 2VISA 4OM0H 4HS6B 1P4LB 1T89A 1JWMA 5ID0B 1U3HA 2X42A 2FHBA 3ZE1E 1P1ZA 5I9QC 1YQVH 1MLCA 4PP1D 3CDGB 5D1QD 1AR1D 4NGHL 4PRHE 4N5ED 2FSEA 5J11B 4NQCD 3MR9B 3V5KB 1ZVSA 1PQZB 3TZVC 5DHVA 3QFJA 3BGAA 4MS8C 5D9SA 3MXWH 5B39B 3FL7A 1CR9H 3S97C 3ZDYF 4NN7B 5CAYB 5IQ9A 3VXNB 3QHFH 5I1GL 3DYOA 4ISVA 4GKNB 1CFSA 4WEMB 1OT1A 4PJ9B 3O4LA 4ODTH 2A1WH 3CSGA 3ARDD 2OSLA 1OAUH 1HKLL 3T1FB 5F97E 3K8LA 1QHPA 1OW0C 5GIRB 1J8HA 3EYOB 3T2NH 3OAUL 2ED7A 5TQ2L 5GGTL 4M62L 5E5MA 3VFNA 3LMJH 1EAPA 2AK4E 3QWOB 5DUPL 4LMQE 5EU6D 1HOCA 1U8PA 2FCBA 3I3EA 4KVNL 4LVOC 2HJKA 3OHXA 3BEWA 2EXWC 2PTUA 5H94A 1HCFX 4I0PB 2WM0A 3B9EA 3PG2A 2IBZY 1TPXB 2CMRL 4GG8B 4JJ5B 1N5YH 3KYMA 3BVNA 4H0HB 2O26U 4CW1B 5TF0A 3QDME 4WDIA 4CJ1A 4LPTA 4XBPB 3LQZB 4UV4H 3LEYL 1FC2D 1F45A 1QLRA 4EOWH 5KSBB 4YEEA 3I9GH 2A74B 4S11A 2Q87A 4MJIA 1WV7T 2APTA 2DI7A 3VXSE 1HKFA 2ATKA 2X4QA 4ELKB 1UWGL 3QUYD 4KC3B 1QQDA 3BD5A 4W4NA 2GT9B 1WAAF 4X7SL 1W0WB 2V7NB 2I26N 1U8HA 4HCRH 1AGBB 2EKSA 4WU5B 1TCRB 4LNRB 4W6YB 1FRGH 1MREH 5BVJA 4UQ2B 1A1NA 1FSKC 1I1YB 5EPMA 5T3ZL 1FDLL 4H88H 3L6FB 4NRYB 3TH4T 1EEZA 3PGDA 5KS9F 2X7LA 5EBWB 1OOAA 2CLZA 2FL5B 2B7DT 5DHYB 1DBBL 1YJDH 2Q76A 3WFEH 4M5YL 2OTUA 4ELMF 1PG7L 4LSPH 1ZWIB 5TE7L 2CDGB 3EKCA 1EO8L 1P9MA 4O4YH 2I24N 3UDWC 1ZV5A 4N8VA 4G8GD 3SGDI 5HI4D 3BIKA 3HPJB 1H8OA 2X2YA 2NR6C 3C08L 1C5BH 1B6DA 5HHOD 4P23D 3JWOC 2Y7QA 3WNPA 2FX7H 1NGXA 3MROB 4LCCA 4NNYB 3BAEH 2VXSL 3GDBA 2EIEA 4EDWL 4Q0XH 5JXED 4IMKC 5HYJD 4K94H 3LKOA 1LP9A 2R8SH 3VXMA 5INDA 5HY9A 1JGLH 3DURB 3KPPB 2XTJB 1OARH 4TTDD 3SDXF 2RHEA 4PJAE 4ZNEA 1Q94A 4HIXL 5A3ID 3RDTA 4Y8DC 3FN0L 1CDGA 5GZOD 5L0QC 1U8QA 3LN5B 3V2AR 3O2WL 4C56D 5C07D 4PY8I 2YD4A 3D1MC 3W5NA 3A6BH 2I60L 1YPZE 2AI0L 4QRPB 3P3YA 3RRQA 2P5EB 1YUHA 1GHFL 4JM2A 3MA7A 4JQIH 1R3JA 1S9WA 3RUGF 4NOBA 4OV6F 3LKRA 2Q6WA 3MREB 3S35X 3OV6A 5ADPH 3QQ3B 5ICXA 1U41A 2WWMC 4H5SB 2MSPA 2E7MA 4AH2A 4Z5RB 1S7SB 4N90D 1VA9A 3A67H 3O8XC 1SVZA 3CSPA 4KROB 2IGFH 4LPXA 4G9FA 3RZCD 5IVXB 3FO2B 4YLQT 3RZWA 2ERJC 3RWEB 4YO0B 4FFZL 3FO1B 1BLNB 2ZUSA 1FGVL 4S1QH 4F37K 5ECJE 1I7RB 2XG5A 3HZVB 1KT2B 5D5MB 4H8WC 1FFNA 2YRPA 4QYOB 4MAUH 1IBGH 1R5VA 1T66C 4PUBH 1G84A 4J3XA 2QSTA 4JM4L 4R8WH 5DJAB 2EE9A 4KAQH 3BESR 4LSSL 2ZCHH 3ECBA 3QUKB 1AO7E 2XY1A 5F9JA 2A6DB 1X44A 1YEDA 2VDML 4FFYL 4OZHE 4YZFE 2EEBA 2HFFA 1A3LH 1FYTD 4HEME 1KTLA 4WUKH 3T0EB 5SWZE 3MV7A 3C5SB 2XFXB 1W72H 2XACC 4MA1C 2HG5B 4Z8FH 1FVCA 4GRLA 3IS0X 3SO5A 3FFDA 3UTSE 3HCVB 2MQ3A 3CVHB 3H42H 5IWLC 4WVRA 5CJQL 3UTOA 4ODUA 2DF3A 1G1YA 3E6FA 1AP2A 1I7TA 3LPWA 1XF5B 2VSDA 4S2SA 4WW2C 4ZAKC 5MEQA 3DLQR 1UZ6F 5D7LB 3G04B 1AGEA 1EMTH 1JCKA 4ZS6C 5TE6H 3UPCA 3SQBA 3B9KA 3OR6B 1FPTL 4EXKA 1HSAB 3WHXA 3U0PB 3VD4A 1K85A 3EYQC 2DBLL 2R1YB 3PL6C 2AJZB 5F70A 5B8CC 1YNTA 4NCC1 3FQTA 4F7MA 4LSRH 4AG4H 2WZPD 3QCTL 3TIEB 5HPMA 1IGTA 1KB5L 2R69L 5CINL 1XT5A 1MFEL 2NY0C 1BECA 2GJ6B 4JG1L 4AIZA 2R2BB 2O93L 3BP4A 4ODVH 4KZDL 4FABL 3EGSB 4XGZB 3QCVL 3VXOA 3U2SB 5D1XD 3PV6A 3UPAA 3UC0H 1HH6A 3QUZD 2GUOA 3AREB 1UXWA 1M05B 5GS2D 3EOAB 1CGXA 1T83C 1YEEL 4HKXA 2RFXB 3VRIA 4WWKD 1A0QL 3ULVD 3O11B 3D2UD 2L7JA 1CT8A 1C12B 5D6DC 5A2JH 2YEZB 5F9WC 3VJ6A 3ULUE 4LHUG 3TJHD 5IK3B 3H3PL 4F9PC 1DVFB 4L4VE 3UJTL 5C6TL 4B41A 2X9XA 1UFUA 4OB5H 4ZTPH 5H8DA 4FTVB 3NCFB 5C0IA 2Y36L 1I9JL 2IMMA 4HWZA 5ISZE 1YN6A 2IFFH 3RWJA 5CCKH 2W92A 4TVPL 5IB5A 1HE7A 4OD1H 4I18A 1U8JB 5LCVH 1CK0L 2PTTA 4BSJA 4DGVL 2V5RA 3QEUA 3EFDH 5DF0A 2N4IA 1WEJL 4M61B 1D5ZB 1FFPA 2P24B 4J4PC 3WUWG 1KN2H 4M6NL 3OXSB 4XMPL 3MCG1 4LARL 4QXTB 4Q6IA 3DTXB 1YYLH 2NNAA 4P2QA 4PJCE 1HHKA 4U05A 4HPOH 1VGKA 3PWPE 5HVHB 4NSKB 4KVCH 1PKQE 3T77A 4LLVA 2UVFA 3MNVB 2PTVA 4M93C 1JHLL 4YDVB 5K9OB 3TN0B 5L2JA 3G6AA 4D3CH 4LLYA 4P5TC 1UKTA 3BOVA 5E03A 3AY4A 3MRLA 4F7PB 1FORL 4AT6B 3P4OB 2ZG2A 3GHBH 4GT7A 3MRFB 4LCWD 4HUNB 3CFJA 3O6KL 5D6CA 3X17A 3VFPB 5HTSA 2K1MA 2VRAA 1FE8H 3VWKC 4D0DA 4HXAL 1HYSC 4ZO9A 1H5BB 3FT3B 1KB9K 1PFCA 6FABH 5K9JH 3AROA 3AU1B 5J13B 5IIEB 3CCHA 1MAML 2VIRA 5E8OA 1KYOJ 5CD3B 1TJIH 4NZJA 4PLJC 2P42B 4JFEA 1PY9A 3FOMB 1CU4H 1R3LA 4BQ6A 1RZIA 2YZ8A 1NDGB 3BZFA 4L8DB 2R56H 2VDQH 3MJ9L 3MJ8B 1KG0A 4PPTA 4XPTL 5IB2A 2H8PA 2X4NA 3UO1L 2M26A 5BOPA 4PJDF 4RBPH 3CDCA 4Z7VF 1LNUB 4LSDA 4PJBF 2WIMA 2EYRB 1WZLA 4JRYB 3NCBB 1LE5B 3RWIA 3QIBB 2WP3O 5MENA 4AY0A 5GGUA 3H9ZA 1I7UA 5GS2H 3ZKMC 3NA9H 3Q5YA 1K2DB 3S5LB 1FGNL 1WBYB 3ULVH 5IR1A 1D9KA 2F5BL 1FBIH 3MFFB 5E5RB 4L29B 4NQSA 3MLXL 4H0IA 3T0BA 2NY3C 1M6OB 1EBPA 4WNQB 2AJXH 1RY7B 3CC5A 4P9MH 5E6IA 3ARFD 1B2WH 1T1ZB 1AKJB 3DV6A 5D1ZB 1YEIL 1CI5A 1ZANL 1UVQA 4X5XB 3F65A 4KZEL 1SJVA 3HI1B 4EN3C 4M7JL 5DVOA 3RIFK 3VFMB 4LU5L 4K8RC 4GMTH 4Y2DD 1TTUA 5GSRA 4N0FA 4AEHL 3MUHL 3BQUD 1ZHBB 4XPGL 1FVDA 3JVGC 3O2VH 4LSQL 1A4KB 3PP3K 5CHNA 5KSBE 4XRCA 3D9AL 1KCKA 4GXUN 3DI2B 1QSFD 4Y5YB 5J4MA 5GISH 2E6PA 4QRRD 1DBAL 5I2IB 3W2DH 1T2QH 3DNKA 5CEZD 1KTDA 5TFSH 4U6YB 4XT1C 2MCPL 3OAZH 2A9NL 1NFDF 5ESQB 4PG2C 3KPSD 4YHZH 3P4NA 1AXSA 4C83A 3LRSA 3BHBA 4GKZB 3B3IA 2AV1B 1B9ZA 1EIBA 4JKLA 4PJ8D 5IEHA 5GRZA 1MUJB 5CZKA 2AQ2A 3HUJF 3UTQB 3X3FL 2GAZA 5GGVL 1JWMB 4AQ1B 2FYYA 3DX9B 1P1ZB 4LSUL 2EIBA 3GI8L 3JUZA 2C7UB 5GS0L 3MLZL 3VFUB 1U2HA 1CTNA 2FSEB 3H8NA 2CPCA 3GRWA 1ZVSB 3QEHA 1N7ML 2RJMA 1S7RA 4P4RA 3QFJB 4ELMA 5F7DA 4LEXL 1T1YA 4PJFF 5IQ9B 5J11C 5FIEA 4YXKH 4ISVB 5D7JD 2HT2D 4R4BA 1CFSB 1RFDL 4UTAH 3O4LB 1MFNA 2ADFL 4APQD 3E8UH 4ZXBC 1CGTA 4BZ1H 4NN7C 4YHOL 3OTTA 3RJDA 2JJWA 4LF3B 1J8HB 1LO5A 2BVPA 3I02A 1RHHA 4OCMC 3GNML 5I8EB 1WVZA 2I9TA 1KLFA 1YMME 2HJKB 5DO2D 2RAMA 1FNGA 4ALAL 3UYRL 1K8DA 5H94B 2NY6D 4TNWK 2B4CC 4QRPE 4DUWA 3ZZ1A 3DUUA 2P5EE 3PWNB 1SJXA 3BVNB 3SDXA 3WNMA 4KKAD 1JP5A 4I0PC 3IRZA 1MPAL 2AKRB 1J86A 1TPXC 1QLRB 1NAMA 1BX2A 4OLYH 1RUMH 3KYNB 4HJJL 4HEPG 4XC1L 3HC4L 3UBXA 5DJZA 3Q6GL 3I2CL 5K33A 1X6LA 3IXTA 4PJ7B 5IVXE 3S3JA 3FQXB 3D25B 2EKSB 4UB0L 4LASH 3MJ6A 5FDWA 2LU3A 4M7KH 5C86A 5D5ME 5GJSH 1Z9LA 1UA6L 5EPMB 4MXWL 4OT1H 1R0AH 4Q9CA 4HC1H 4O51B 2GJZB 2VXTH 3ILQD 2X7LB 4XWGL 5C0BB 2NY2D 3U30C 1NFIA 1IC4H 5IMKA 4BUHA 2CLZB 3CPLA 4GAYA 5CEZH 2DQCL 5F44A 1QO3A 1EXUB 1F90H 2QQLH 2WV3A 3OX8A 4P9HL 3H9SB 1YC7A 3F7PC 5DD6A 3LRGA 1J88A 4Z0BL 4N8VB 5JMOC 4C55A 2HFEB 3T0EE 4HH8A 4E5XA 3BX7C 3FKUS 1F4WL 4ZFZB 3HRZB 1K3IA 2BXZA 4RGOH 2XQYK 2QKIB 3S37X 3DVNB 4ZUTA 4JHBA 5DD3H 3SE9H 5KOVC 3V6OE 5HGAA 3NFSL 3FCTA 3GMOA 1UB6A 4HFUL 1NGXB 3SQOH 4LCCB 1IAIM 1KLGB 2SEBA 1FL6A 1M7XA 2LU4A 4U7SA 1XIWD 2K9UA 4EI6A 4S1RH 1JRHI 3MV9D 2FRGP 2Z35B 5D7LE 1S8DB 3LKOB 1LP9B 2XIDA 4XCCL 1I3GH 3QXVA 5IFJB 5ALBH 1Y0LB 4NZRH 5H2BA 1G7LA 4UDUA 4FQHA 3W9DA 4YNYB 1S78D 2PYED 5BRZB 1LO2L 5DD1L 4ZS7L 3V79C 4GAGH 4OUUA 4PJEE 4OZGF 4TUKL 5IFHL 4JFHE 5HGBA 4KVNH 3HMWH 4JM2B 1R3JB 1NAKH 4R97C 4OZFH 3PABA 3LKRB 4EBQH 3KGRA 3SDAA 3P11H 2IANB 4HCRA 5ICXB 3M07A 1JGVH 4WO4D 2DTML 4HKZA 5DEGA 4ZFOL 3BDYL 3V5DB 3GSQA 5A2FA 1KEGL 1IGFH 5LG1A 4KH2A 3RNQA 4G9FB 4MB4A 3N1GC 4TSCL 5F9DC 4EJ1C 3TBTB 1KSRA 1M7DA 3IFOA 2BSED 4ZOCA 1AQKL 2QQNL 3BD3A 4Z76A 4PD4J 5JHDA 4AK1A 1R5VB 3BP6A 2O5XL 2XWTA 4P2RA 2W65B 4HK0B 4IRSA 4FTVE 3LKPA 1EHXA 4KJWD 1RVFH 1A7BA 4P46B 2HRLA 5HHVH 2OK0H 1C5DB 1CG9B 3AXLA 5EOTA 1VCAA 3WFBL 4TUOB 3L95A 4KJYB 2BRRH 4YHPB 3ROLB 1I9EA 4XCNA 5DEZA 4MXVE 2H41A 5JNYA 2HFFB 3HG1D 5FGCE 5ADOL 1WFUA 3IDMA 3VGGA 2I5YL 1PYWA 4M5YH 4Y4KB 5EC1A 5AYUH 2X4RB 3MV7B 3B2UC 3DRTA 3DV4B 4GQPH 4CBPA 4DKEH 2EH8H 1RULH 3FTGB 2UYLA 4GRLB 1JWSA 2Z93A 3OGOE 3FFDB 3T0EC 1MJUH 2BJMH 3SE8L 5JO5A 4WJ5B 3V95A 4WI8A 1QKZL 2J6EL 3CZJA 1NC4D 3GHEH 1JPSH 3ARDA 4GBXC 3HE7C 3TM6A 2MHAA 4MNGA 3E6FB 1AP2B 5AWNL 4M5ZH 3MLWH 1FL3A 5MEQB 3SJVA 1FCGA 4QWWC 2X4TB 1OLLA 4N1EA 5EU6A 3LQMA 3ZE0F 1UGNA 2DWDB 5CUSH 2VXSH 4F58L 3CDFA 2HLFD 4FXKA 1BD2B 3WHXB 2R2HA 4YGVB 4P3WA 4GMSH 3W9EA 4NQUA 4AIXA 1MSPA 4R0LA 1YNTB 3FQTB 2MWCA 3JV0A 1MCJA 2EC9U 3CVIL 1Z3GH 2FX8H 4OJFH 1IGTB 1ZTXH 4X6DF 5T1LD 1TJGH 1QFUH 3KHOA 4NWTL 5FA4A 3WO3B 1JJUA 4U2YA 4PRID 3QHTC 2D4DA 2AXGA 1AR2A 1ZLSL 4OCSL 3IGAA 2VLJD 5JA9A 1WZ1H 4AM0A 1KCRL 1O5DT 2FLRT 3BUYA 4QF1A 1HH6B 4QXWA 5C7XH 1YEJL 4Z7WF 5KSAA 3WL9B 1PG7X 3VRIB 1PBYA 3VFRA 1V3LA 3N9GH 3IDJA 4JRYE 3KJ4B 3AREC 3MLSL 3ZYZA 2V2TA 2DYPB 4PJDA 5E2WL 5IMLA 3BH9A 3IRPX 4KI5D 1SJHB 4OCNC 4PJBA 3T2PA 4I3RL 4HWZB 5J6GA 3S34H 1SY6L 1YN6B 3RWJB 2BNQD 1WBXB 5IB5B 4I18B 1W72A 3GI9H 4X6CF 1PD6A 1ZA6B 4QTHA 3UTPE 3QEUB 3JUYA 4OF8A 1RIUH 5IJKA 4G42B 3FO9A 4G8GA 4JRXD 3FQUA 2F9BT 2WUBH 1T0MA 1KLUB 4Q6IB 5F1OB 2J8UB 2NNAB 2Y23A 1VGKB 3WMSA 4OGYH 1IAOB 1P2CA 2EDFA 1PEWA 3WDIA 5HHOA 4LLVB 5IKCA 3LS4H 2D03H 4TQEL 2HFGH 4P23A 5BMFH 5E95B 2O5ZH 4IOIA 5IG7A 1E27A 4EUPG 1INEL 4G6FD 3TT1L 4LLYB 1OGTA 4F57H 1T0NB 1QBAA 3MBXL 2MCG1 3MRLB 1G7IA 2MJWA 1RSFA 5K9QI 4RGMC 3MRIA 1I8LA 3KDMB 4Q9RH 4XXDA 1RIVH 3C8KA 1FO0L 1SEQL 2BHUA 4MNQA 3WJJA 5E8PB 5FYLD 4HIIA 2I25N 4CDHA 4M4PA 4D0DB 1JYWA 1QRNB 3NOIA 2X4PB 4Y2OA 1Y6NR 2HA1A 4OQTH 5ID1A 1OD7A 3OKOA 3V4PL 2ITDB 2QADD 5E6YA 5JDSA 1YMHB 4PB0L 3Q1SL 4BUGA 4EI5A 1RK1A 3MACH 3CCHB 1NJ9A 5KVEL 3BKCL 1H5BC 3QG7L 1RV6X 1E6JL 1NFDA 4NQEB 4QHNB 1K6QH 1R3LB 2NQCA 1RZIB 1UM4H 1YNLH 3BZFB 1I85C 3HZYB 5J13C 1DQMH 5IESH 3QH3B 4H1LH 2NX5A 1J1XH 1KG0B 1NMAH 4NDMB 4PJHF 2X4NB 4ZFOA 2B20A 4XP6L 4TULH 4G8FA 4NNPH 3IXAB 3HUJA 3SOBL 3U46A 3RVXC 3QFJE 1U8NA 3CD4A 4LVHB 4HUXA 3F58H 3NPZB 4MHHG 3HAEH 4MA7L 3RWIB 3ZHKA 5EN2A 1JGDA 1MLBB 4IHOB 3QULA 4HJGA 4GO6B 3O4LE 4M7LT 4LVEA 1E6OL 3CX2A 5DFVD 1EPFA 1S7UA 4RZCA 1FNHA 5IR1B 1J8HE 1D9KB 4L8BA 5B4MD 5DSCA 1GOGA 4NQSB 1PSKL 5EO9B 3BKYL 3WDJA 4X4YA 3L3DA 1PLGH 1GRWA 3CC5B 3NIGE 5D2NA 4LDEB 3MJ7A 3DV6B 2QQKH 5IJVA 2OMNA 4JHZA 1J12A 1UVQB 4KKBC 3BWUC 4OZIA 2DWEA 5D70L 3V6FB 2AABH 2WBJD 4QT5B 1G7PB 3KPLB 5D1ZC 5GSRB 5L88H 1UH3A 1MJ8L 4FXLA 2JIXD 1FVDB 1L6XA 1CFVH 1CXEA 4KI1A 5IGXH 3GM8A 3VMNA 3LRHA 2VYRE 4GH7B 4MZ2A 1K5NA 3LPFA 4R7NA 4WFHD 4GSDH 2J6EA 3MX0A 1S9YA 1X5ZA 5GS1A 1JHLH 2C4FU 1OF2A 4PJ7E 1X9QA 3VFSA 1MVUA 2BMKB 43CAA 2EDJA 1JPTH 4XP9H 4A2MA 4B7IA 3CU1A 2DQIL 4Y5YC 3MLUL 1KTDB 2CLRA 3ZMRA 1A14L 4HJ0C 4XNZB 3LEXB 1BOYA 3LRSB 1HHHA 3MLPA 4G5ZL 5ILTL 3IETA 1QSED 1N2RA 1UQSA 3QNZB 5IEHB 3O9WB 4LEOA 4MDIA 5JW4N 2XZAL 5F71A 4HD9A 5FYLH 1F6FB 3VE0A 2GK2A 3GSNH 4X6FA 3H9SE 3T4AB 5IT2L 4H25A 2CJUL 3EJZD 4GOSA 2HLAA 2PNDA 3CFIC 1T89C 3OBAA 5TGBB 1U3HC 3U9PH 1D6VH 2A0LC 3VD7A 3QEHB 1S7XA 4WWKA 3L3HB 5E8NB 3VFWA 2NY1D 4HWNA 3D69A 3U9UA 3QNYB 1U3JA 5DK0A 5EBGA 1WUNT 1NCUA 1RURL 3WS6A 2DQJL 3FHAA 5DQ9B 1NGYB 1ZSDA 4PFEA 4L1DA 4FQIL 3EO9L 1VEOA 2X10A 1LO5B 2BVPB 2V2XA 4I5BA 4YH6A 1LP9E 3ARGA 1A7OH 1RHHB 4QRTA 5J12B 1I7ZA 3SPVA 1G7QB 1SY6A 1HH9A 3E6HB 2R0WH 4JFFB 2C3WA 3SKMA 4JFYB 4NUJA 4QGTA 5TPWL 4ZNEE 2C3HA 3UCRA 4KUCF 3BWAB 1JHKH 4P57A 3RWDA 1Q0XL 2P5WA 4M48L 5EFIA 1TJHL 3BP5A 3NVQA 2R39A 3MRPA 1OTUC 3MYJB 1PEZA 3KYOA 1M7IA 1S5IL 1AI1L 1A1MA 5D2LF 4HK3N 4P99A 1UH4A 4KUZL 1NMCB 2X09A 2YD7A 5MEPB 2IANE 1B0GB 1QFWI 1NAMB 1HINL 1AH1A 1N59A