1MRUA

Intracellular ser/thr protein kinase domain of mycobacterium tuberculosis pknb.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
284
structure length
269
Chain Sequence
TPSHLSDRYELGEILGFGGMSEVHLARDLRLHRDVAVKVLRADLARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEAETPAGPLPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIADACQALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIARAITAQYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPVSVAYQHVREDPIPPSARHEGLSADLDAVVLKALAKNPENRYQTAAEMRADLVRVHNGEPPEAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Mycobacterium tuberculosis PknB supports a universal activation mechanism for Ser/Thr protein kinases.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Probable serine/threonine-protein kinase pknB
total genus 72
structure length 269
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1mruA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1mruA01
2H8HA 3H4JA 4CLJA 4ZSJA 1P2AA 3MN3A 2OJJA 1GAGA 4H36A 4IH8A 4ZIMA 4RJ8A 4E8AA 1M2QA 3ZZEA 4H39A 5GIPE 3R04A 1Q8ZA 4O0TA 3ATSA 3UNZA 3ZO4A 4FTNA 4BDKA 3T9TA 2UW0A 5FEQA 3UC4A 2OXXA 4YHJA 5L6WL 1ZMUA 1WBWA 2QHMA 3ZH8A 5KCVA 5A3XA 3HUBA 4G3CA 4OBOA 3FLZA 4AS0A 3B2TA 2GTNA 3F61A 2QOHA 4YZBA 3QRTA 3RNYA 3UG2A 3PIZA 1FGKA 3EYGA 3QFVA 4CG9A 3OROA 4AA5A 3CLYA 4DEIA 2YN8A 4D4VA 4NZWB 3RAKA 3LKMA 4O7VA 3VUDA 5CSPA 5ITAA 2CGVA 3BYOA 3OWKA 4RVTA 4Q5EA 1UKHA 4JL9A 4RJ3A 5CASA 3PXKA 3BZ3A 2A19B 3NDMA 4WNMA 4RC3A 4U3YA 1XHAA 2VTIA 3ENHA 3PJ3A 1WBVA 3RCJA 1KE6A 4XUFA 1IAJA 3UC3A 3PDTA 4O0UA 2WTIA 2J4ZA 1OIRA 2YCFA 2XJ2A 4MX9A 3EFLA 4BCNA 5CXZA 5A4CA 2JKQA 2C47A 3DJ5A 4EH4A 5DMZA 1GIHA 3EL8A 4FGRA 3TV6A 4GV1A 2WB8A 5KUPA 1Q97A 4JOAA 3FLWA 4QPMA 4DGLC 3NYOA 4ALWA 5AR8A 4BCOA 4C3RA 3FLYA 4AE6A 3II5A 1BKXA 3QBNA 3LLTA 1P5EA 3HMPA 1UU9A 4BB4A 3FXXA 1K9AA 2VU3A 3AXWA 4HVGA 3N4UA 4FKUA 1IAHA 3NYNA 3OCSA 4R6VA 3FY2A 2QOQA 3N4VA 2XJ0A 3CGOA 4GU6A 4LUDA 2XUUA 1H26A 3VNTA 3EQFA 3QLFA 5M4UA 5BVOA 2RFDA 4A4OA 3IW4A 5ANOA 4O27B 1JWHA 1O9UA 4UMPA 5T6KA 3R63A 2I0YA 4BCPA 3ID6C 4GKIA 4H05A 5CAPA 2VWIA 5TT7A 4QNYA 2XIKA 4X3FB 4BY9E 3Q96A 2I0HA 2ETRA 4QQJA 3BHTA 2QO9A 3KXNA 2XRUA 3K3IA 5IG1A 3UVPA 1PF8A 3QRJA 1A48A 2W4JA 3NNVA 4CD0A 3LFSA 4EH3A 3UJGA 2BRHA 3LJ2A 4U43A 2QO7A 5J8IA 5FQDC 2BTSA 2EXEA 4O0VA 4I22A 1BX6A 4FIGA 4QMSA 4BI1A 2C6IA 1PMEA 2ZMCA 4X2KA 3SW7A 1FGIA 1R78A 3OWPA 1YHWA 5HLPA 5ANKA 4JG7A 2PUUA 4CMOA 5J7BA 5ETAA 2YACA 2ITYA 3DJ6A 5EDPA 3PVGA 3WZEA 4BCIA 4FEWA 3NNUA 5FLFA 5IZFA 1PKDA 2BDWA 2AC5A 3LFFA 1APME 2VRXA 5AUYA 3MI9A 3WYYA 4CT1A 4CYJA 4F1MA 1ZYJA 3KEXA 1OPLA 3H9RA 4TYJA 5M4FA 2X8IA 3IO7A 5IKWA 4PP7A 4FKPA 2XKFA 4QD6A 4AUAA 4FIEA 4GT5A 2QOIA 4DFBA 3ZLXA 3BCEA 1R3CA 5KKRC 4CFFA 3QHRA 1UKIA 1YHVA 1KV1A 5BYZA 4D1XA 4XH6A 1LP4A 3NNWA 4E7WA 5GJDA 3ZM9A 1UV5A 4JG8A 3TKIA 1B38A 4RX8A 3B2WA 3ZXZA 4BDIA 3KULB 1OL7A 2O65A 4HNFA 2JAMA 2OBJA 3R7EA 4D55A 1STCE 4CZYB 3FMHA 4I5CA 5EI2A 5KMLA 1OIYA 3EN5A 3G33A 4XBRA 4L7SA 5HD4A 1WVXA 3Q6UA 4QNAA 3LJ1A 3RZBA 5AUZA 1OBDA 2GQRA 2OFVA 4C4IA 5EYDA 4DT8A 4GU9A 5GHVA 5CAVA 5FDXA 2BDFA 4USDA 4QP4A 1T45A 2VWZA 3S4QA 4DEAA 2ZM3A 4KB8A 3UIBA 5D9HA 5F94A 3AGMA 2QODA 1J1CA 2ZOQA 4L00A 5E90A 3GFWA 4MD9E 4XCUA 4XEYA 2QG7A 2PMIA 3NUPA 4O2PA 4MAOA 3V5PA 1UNHA 2JKOA 3B8QA 4QOXA 3UZTA 3S1HA 4C3FA 3HRBA 4C7TA 4NSTA 2UZWE 1OKVA 2WMXA 4KBAA 4GUEA 5EG3A 4UXQA 2WIHA 3QC4A 1QPEA 2W0JA 5I5ZA 4QTBA 3PUPA 4XV3A 2ITTA 2HXLA 5CF8A 3U54A 2CGXA 5CNNA 5KHWA 4J99A 4BL1A 3AC8A 1UNGA 2VV9A 4Q2AA 1NXKA 3VS7A 1Q8TA 3UMXA 3ZEWA 2W1EA 5FM2A 4HYSA 5EHOA 5AR7A 4G34A 5LARA 3CP9A 3UVQA 2YWVA 3E8EA 3O71A 2JKMA 4JIAA 1OL1A 5HX8A 4I4EA 5CLPA 5M44A 2G15A 2XNOA 4GH2A 4OTRA 4X6RA 3CXWA 2NNWB 2JDRA 2R3LA 4U42A 3R8LA 2QOFA 2HOGA 2OW3A 1J3HA 5EYMA 5AV2A 5C1QB 1OECA 3PLSA 3Q5IA 4RZVA 1NVSA 4IJ9A 1BI8A 4FK3A 2IW6A 3PJ1A 4YC6A 4I0TA 3MVMA 3D7TA 4HCTA 4O7NA 3HZTA 2IWIA 3ORPA 5AM7A 2OG8A 4I93A 1M2PA 3R02A 4W8EA 4XP2A 3ORNA 4ZTSA 4AGCA 1RE8A 3FKOA 3ORXA 5DVRA 5IA5A 5CEIA 4KBCA 1AQ1A 4MXAA 4Y72A 3ZZWA 4O82A 2R3FA 4M84A 4FF8A 3FYKX 3A8WA 1PXPA 4MXYA 3BLRA 2V7AA 4C34A 3D2KA 1LR4A 5DPVA 3EN7A 3DAKA 4YHFA 3ZUVA 4DHFA 3OCTA 4QMLA 3QTRA 4WG5A 2ZYBA 3I7BA 4FTQA 2ITNA 4HPUE 5AUTA 3ELJA 5AR4A 2FO0A 1F3MC 4AW0A 2E9PA 1CDKA 3H0ZA 3A60A 1ZLTA 2YM7A 3MPAA 5EYKA 3ZEPA 3MFUA 2OIDA 3HKOA 2YIYA 2YA9A 2B7AA 3R30A 3FY0A 2C5VA 3HECA 2Z2WA 3C4ZA 4U0IA 4Z9LA 3NVKI 4ZY6A 3VBWA 2VWBA 4JDIA 4DEEA 3QKMA 4PMSA 3DBQA 1G3NA 1Y8YA 3COHA 3Q4TA 4ZY5A 2GS6A 2J5EA 4E26A 3AGLA 3PE2A 4J71A 5LVNA 4MWIA 4Y95A 4FNZA 3VJOA 4B6LA 2HY0A 3H30A 5AP7A 2RSVA 2VWXA 3VAPA 4EHZA 5BVWA 1JKSA 3ZYAA 4N4SA 1WZYA 1HCLA 1GZ8A 3G9NA 1BUHA 4IZAA 4KINA 4M8TA 4RJ4A 5J1VA 1VYWA 4EOLA 4FSZA 4RIYA 4IX3A 4XG6A 4GK3A 2PYWA 1DI9A 3UYSA 4U44A 1XBCA 2G1TA 2PWLA 4A4XA 1AD5A 3GT8A 3ORKA 3PPJA 4KIKB 1P14A 4W8DA 3Q53A 5FWKK 3KXHA 3QRKA 4ZAUA 5I0BA 3TEIA 4ZSAA 2YERA 3R22A 3G15A 3VVHA 4R1VA 4EC9A 4QQCA 3F7ZA 5ETIA 3V5LA 3FI4A 4EH5A 4IAIA 2GNFA 5LVLA 5HZNA 4RJ7A 4K11A 4EYMA 2X2KA 5H8GA 4YU2A 5CAUA 3RP9A 3BYUA 4NM0A 4D58A 4RC4A 4CQEA 5F9EA 4C62A 5KMOA 3THBA 1IA8A 3MB7A 1OZ1A 1FPUA 1JOWB 4U5JA 4YC8A 3HA8A 5DEWA 1QPJA 2PMLX 1G8AA 1YXTA 1ATPE 1UU8A 4V0GA 5FG8A 3ULIA 3C1XA 4D5KA 4A9YA 5A4EA 3IDBA 1M7QA 3FC1X 3DBDA 2J6MA 5DR2A 1L8TA 4X2NA 3QA8A 2E9OA 3FZOA 2R3QA 2OF4A 1YI4A 3R71A 4RGJA 3TV7A 4EBWA 4NM7A 4X3FA 5AX9A 5IEXA 4OTQA 5HTBA 5AEPA 2EUFB 4EH2A 4AFJA 4FKGA 2WQMA 3LM5A 4L42A 1XJDA 2VO6A 3QD0A 2WAJA 3KN6A 1YWVA 2R3MA 4J52A 4PPAA 5C9CA 3LVPA 2O2UA 1RQQA 3ORIA 5AP6A 4LM5A 4BTJA 4F9CA 3MA6A 2OXDA 4IB3A 3PVWA 3R7VA 3HV7A 3SC1A 4HYUA 4X2GA 4C4FA 5E91A 2EB2A 3BGQA 2WMSA 3KGAA 5E7RA 2R3RA 1Q62A 1PHKA 1Q3WA 3VWAA 1PYXA 2R3JA 4RFYA 3PY1A 2J90A 4YPSA 4HVSA 1U54A 4U79A 3C50A 2LGCA 5KZIA 3O23A 4FNYA 5M09A 4KBKA 3TKUA 3QXOA 3FAAA 2FVDA 4HGTA 4L53A 5F95A 5LVOA 4GMYA 4I41A 5FP6A 1R39A 4EK8A 2Y4IC 4D4RA 2I40A 2YISA 2YAAA 4PL5A 4U45A 4F08A 2E2BA 4I21A 1VJYA 3FMMA 4N57A 4O0YA 2HZNA 3UYTA 2ZB0A 3QWJA 2XEYA 2WZJA 3VS2A 3KF4A 3UP2A 5HX6A 3NUYA 3TZ8A 2GS7A 1JKKA 4I23A 5L4QA 4E1ZA 4TWPA 3HV6A 4YMJA 4G9RA 3MDYA 3UQGA 4WUNA 3CR0A 1KWPA 3ORZA 2A0CX 3Q4UA 4I24A 3U9NA 3RHKA 3MH1A 1ZWSA 1XO2B 3C4FA 4TN6A 4BRXA 4FTIA 3C0IA 4CQGA 4DTKA 1BI7A 5KMJA 4X2FA 3EZVA 2XK9A 2R64A 1UWHA 2ZV2A 4PDPA 2XK7A 4CNHA 2IZUA 3R1SA 3DOGA 4K0YA 4DGOA 5I9WA 5HTCA 5BVDA 2DWBA 5KBRA 4MNFA 4OUCA 1YOJA 3F5UA 3RJCA 3QLGA 4PL4A 5CALA 3ZTXA 4MNEA 3AOXA 4P7EA 1OPJA 3TIYA 3A2CA 4CMUA 4GCJA 3WZDA 3EFKA 5M51A 2BR1A 4OTGA 3UO5A 2X7GA 3BPRA 5J9ZA 3EFWA 4KS8A 4YLJA 4IIRA 5KE0A 2R3NA 4IVDA 2BKZA 4JI9A 4YURA 4CLIA 2BIYA 1YI6A 3GENA 4FK6A 1FMOE 4EQMA 1RDQE 4Y5QA 5EK7A 2PUNA 3W8QA 3O2MA 4NW6A 3W16A 4XHKB 2UZDA 3G6GA 4UMTA 1SVEA 3RCDA 3PP0A 2FA2A 3JPVA 2B1PA 2YDKA 4KRCA 4YNEA 1XR1A 4MXCA 5AV0A 2OZAB 4FEXA 3BRBA 4RIOA 4U80A 4RLLA 4PUZA 4NM5A 2PUPA 4IWOA 2I0EA 2W5HA 3A7IA 3DV3A 3OEFX 4F9WA 2VWUA 2XIYA 3V8SA 3EB0A 3RZFA 3DBCA 3WARA 3HX4A 3VS1A 5J5SA 4WRGA 5GZAA 1DI8A 1X8BA 4AF3A 4RVLA 3VRYA 3OTVA 3JS2A 2RG6A 1H1WA 3LAUA 4XYFA 4EK5A 5EI6A 3QCXA 1FINA 4YZ9A 3MJ1A 4MF0A 2V0DA 2WMVA 5A6NA 5E92A 1LEWA 4PTEA 4MBLA 3B8RA 3P0MA 2X81A 2VTQA 1R0EA 1FQ1B 3OT3A 1JNKA 1WBOA 3P7BA 5B2KA 2P2HA 2EB3A 1OITA 4I3ZA 5H9BA 3F88A 4FKJA 4A9TA 3QTIA 4ASEA 3D7ZA 4QMQA 2PVLA 3RK9A 3E88A 1H1PA 1S9JA 3ZDIA 4IFGA 4QYYA 4MBIA 5HCYA 4D2PA 2VD5A 4IHPA 1QPCA 4G31A 3NVMB 3KY2A 4FUXA 4FC0A 4GT3A 3C5IA 2I0VA 4D28A 4QMVA 2C5XA 4EZ7A 3LFDA 1U5QA 2UZEA 3MTLA 1GZKA 4R3PA 4ZLZA 2IPXA 3ZONA 2WTDA 5D11A 2GFCA 3JY0A 4EQCA 1YVJA 4F6SA 5FBOA 3ZBXA 4UWYA 5JQ5A 4G5PA 5IH6A 3LOKA 2QNJA 3ZRMA 4AACA 3GCSA 1T46A 2UW6A 5CTPA 5IQCA 4O81A 3IECA 5HO8A 2R3KA 4FSMA 4F09A 2YIWA 4WSQA 5IH4A 3CGFA 2HCKA 4BCGA 5HVYA 5AR5A 4V0GB 4MTAA 4WO5A 1KE7A 3E7OA 4J8NA 3QHWA 2QO2A 4G2FA 4NKAA 3HMIA 1UVRA 1DAYA 2JAVA 4P4CA 4HYIA 5K0XA 4D2TA 3LXPA 4UMQA 3GUBA 3OCBA 3HDNA 4XV1A 1UNLA 4MH7A 4RIXB 3TUBA 3UNKA 5AIKA 2OFUA 3MW1A 4WNPA 3WZUA 3LJ0A 4FSTA 4N6YA 5C8KA 5IDNA 4UWBA 5GIOE 4PDOA 3TV4A 2WGJA 4BYIA 4LFIA 2QOOA 4YZCA 2IVVA 1Q8YA 3WZJA 4ANMA 4PRJA 4W4WA 4AX8A 3UDBA 3S95A 1YI3A 4Y46A 3LCKA 4ZK5A 3ZDUA 4RIYB 2PVKA 3POZA 4KIPA 5CQUA 5F4NA 3LFNA 4G3FA 4TKSA 5HIDA 4S30A 3KXZA 2VTSA 2C5NA 5CEQA 4FX3A 2WTCA 3U4WA 4O7WA 3AT4A 4PDSA 4WBBB 5FEDA 4P2KA 4AFEA 4XV9A 5CZHA 3VN9A 4O0XA 4UBAA 2YWPA 2UZBA 2VO7A 3G5DA 2Y4PA 2QI8A 4USFA 5KNJA 1Y57A 4ACDA 3LQ3A 3SA0A 4HYHA 1WBTA 2C0OA 5AFVA 4OT5A 4KSQA 4RZWA 2UUEA 3CSVA 2HIWA 2BAKA 4LYNA 2YLEA 4W4XA 2J9MA 5HNGA 3NWWA 2IVSA 5ICPA 3LMGA 4I1ZA 2W4KA 3OOMA 4IDTA 3UODA 5AR2A 1NA7A 3GGFA 5JKGA 4TWOA 2ESMA 4PQNA 3TUDA 1CKIA 2VWWA 4U81A 3RWQA 5KHXA 4C0TA 3NCZA 4O0WA 4DFXE 2OKRA 2XH5A 3P5KA 3MPMA 3Q9XA 4FZAB 3FV8A 3LZBA 2GFSA 1F0QA 3A99A 4WG4A 1KOAA 3TNQB 3CKWA 4NWMA 1A06A 3RHXA 5E8XA 5HGIA 2YITA 3QTWA 2RFNA 3VW8A 2WTWA 4NUSA 4FV2A 2C6OA 2GHMA 2CN8A 2JFLA 2XEZA 1LPUA 4FG9A 5CS6A 4G6NA 1SYKA 1XH4A 1H28A 3AC2A 3ROCA 5B2LA 2WFYA 3GCVA 3D94A 4NH1A 2BROA 4RIWA 2GCDA 3RGFA 2QG5A 3A7FA 3I1AA 4AGDA 2PVYA 4CEGA 4FOBA 3UP7A 4F9YA 1WBSA 1H24A 3A4OX 3L8PA 1ND4A 2C4GA 3BEAA 3GOPA 4YJOA 3AC5A 4AZWA 5FDPA 4MQ2A 2R0UA 3FHRA 3JXWA 3K5UA 2W1FA 2O5KA 2J0JA 3O8UA 1W7HA 3UVRA 4ENXA 1YQJA 1RJBA 4S2ZA 4ZLYA 4O7YA 1OL5A 3OVVA 1L3RE 2WHBA 3D7TB 3AD6A 3QGYA 1JBPE 3UTOA 4Y85A 4U7ZA 3LFBA 3NAXA 3QZGA 1B39A 3F6XA 2VNYA 2ZAZA 4OTFA 3AC1A 2QLUA 2E9NA 3L9MA 4OR5A 5EKOA 4RA4A 4IZ7A 2Z7SA 4UN0C 2JIIA 2YDIA 4TT7A 2H96A 3OZ6A 4ZS4A 3VIDA 4C4HA 3EQHA 4Q9SA 1H25A 1YOLA 4EC8A 1W83A 3GOKA 3MYGA 2JBOA 3CTJA 3D2IA 3OWJA 4KKEA 4FUYA 3Q4ZA 2J0MB 4OTDA 5BVKA 4D2SA 4EYJA 2BFXA 2J0IA 4LGGA 4KD1A 1IR3A 3BIZA 1CKPA 4IB1A 1V0OA 1V0PA 3PIXA 2F2CB 1U46A 4FKWA 5CU3A 1BMKA 4Y73A 4CFNA 2YEXA 5CZIA 3LPBA 3VC4A 5J9YA 4ZY4A 3FBVA 2BAJA 1PW2A 3BU6A 1JPAA 2Y6MA 3F5PA 4M97A 3PVUA 4TYEA 3V3VA 1B6CB 4BDFA 5A6OA 4LOPA 5CVGA 3KU2A 3MWUA 5T3QA 4ZZOA 1Q99A 5IMEA 3ATTA 3F2AA 3PPKA 4O86A 3FZPA 4V04A 4MHAA 3OW3A 2IVUA 4ACGA 3QRIA 4TWNA 4J8MA 2J2IB 2XK8A 5FUTA 4DFUA 3OEZA 4UALA 5CEKA 5IUGA 4YO6A 3VS3A 3H9OA 4CGAA 5JFXA 4G3EA 4E5BA 2ETMA 2UVZA 1RW8A 3GU5A 4EOPA 3R73A 3SW4A 4C2WA 2OWBA 1Q3DA 4AAAA 1OPKA 3E62A 4IAZA 1W82A 5M56A 3MTFA 5DT3A 5A54A 4BWPA 1W84A 3VQHA 5A4TA 3GI3A 1MP8A 1H1QA 2VNWA 3G9LX 2QU5A 4C3PA 4FV8A 1DM2A 3H3CA 3MESA 2SRCA 1YHSA 3C5UA 4IZ5A 1QMZA 5JFSA 4QYGA 5GZ9A 2QHNA 3MSSA 3W2RA 3CQEA 3TCPA 3V04A 4ERWA 3ZOSA 4E3CA 3NYVA 4F6WA 4ASZA 2P55A 2JD5A 4F9BA 2UZVA 3E92A 3ETAA 4EOSA 3KA0A 4FODA 4A7CA 2BKKA 3R28A 3ANQA 3HV3A 2P4IA 3DB8A 3F5GA 4JRVA 4LGDA 4CG8A 4FIIA 2VO0A 3G90X 4HGSA 2PE2A 2WELA 4FI1A 4JX3A 4UZDA 5L2TA 2CGWA 2R3GA 3CD8A 4UY9A 3UMWA 4BI0A 4OTPA 5IH5A 2ZDUA 4BZDA 5CU6A 1ZAOA 4ZP5A 3LE6A 2E9UA 3BV3A 3RK5A 1H1RA 3KC3A 4ZZMA 3LFEA 2PZYA 2WTKC 3KCFA 4YBKA 3OHTA 3UNJA 5JRQA 2YCSA 3NLBA 4TPTA 4QP1A 5E8WA 1DAWA 4K33A 4AXAA 4I5HA 1E1XA 1OL6A 1PXLA 4NCTC 2CLQA 3EL7A 3ORLA 5IMXA 3F2NA 1Q5KA 3GFEA 4IJPA 4DBNA 2JKKA 5AUXA 3NUAA 2JDTA 4G5JA 5HKMA 3DXPA 5M08A 3O7LB 1Q24A 5LJJA 3NX8A 4UMRA 3CY3A 1ZOEA 3PZHA 5ANIA 3GC9A 3TI1A 5E8VA 4X21A 5LQFA 2BIKB 5HE2A 4OBPA 3QU0A 3QCQA 4QTAA 4KKHA 4W4VA 5DNRA 5IA4A 2GNLA 2Z7LA 3FC2A 4HCUA 5DT0A 3T3UA 1H01A 4LUEA 4BHNA 1GNGA 2X7FA 3MS9A 5ETFA 1OVEA 1Q8UA 3MY5A 3QQJA 2LAVA 4Z7HA 2RF9A 4G3GA 3QQHA 5GNKA 3ZMMA 3RK7A 2IW9A 1U5RA 3W18A 3H10A 4G16A 2I7QA 3UGCA 2XNEA 3V01A 4GW8A 5A4QA 3NIZA 3HUCA 1YRPA 4X6QC 3U87A 3DDQA 1SM2A 2VGOA 2W1GA 2O0UA 4H3QA 4OTWA 5E4HA 5I9YA 3LXKA 2XYUA 1ZZLA 2PZRA 2WMWA 3FMKA 4JS8A 3SOAA 1HOWA 3LCTA 4C4JA 3WOWA 3I0QA 3ZLSA 3GQIA 2UZNA 1OKYA 4FSQA 2UVXA 2RL5A 1URWA 2Q0BA 4NW5A 5KMIA 3SAYA 3A4PA 4NFMA 5CSHA 4FVPA 4FEQA 4AZTA 1YWRA 3F7WA 4DC2A 3RAIA 4RX9A 1ZXEA 2R7IA 5AV1A 5IQBA 4GS6A 5EW8A 2CJMA 5C27A 4TYHA 3C0GA 3COKA 4L9IA 5HQ0A 4ACHA 3H9FA 4LGHA 3TUCA 2B9FA 4I6HA 4DGMA 5A14A 4EHVA 1O6YA 2BAQA 3NAYA 3C9WA 2BZIB 3OW4A 4ZTNA 4BCMA 5JGDA 1Y8GA 1ZZ2A 3C51A 1ZY4A 3PP1A 4QTCA 4MCVA 4C35A 2CNVA 5TR6A 4YNOA 4A07A 1CTPE 3Q5ZA 1S9IA 3VS4A 4DFLA 4RFMA 5BUJA 3ITZA 1XQZA 3AQVA 4I4FA 5DIAA 4QP9A 4BKZA 1GOLA 1H4LA 4EOMA 3PTGA 1OGUA 4JBPA 3IK3A 4R7BA 2CLXA 3WF5A 3DXNA 2OZAA 2J0KA 4Q9ZA 3A7GA 5B0XA 5HHWA 4O0RA 3EQCA 3K2LA 4AZSA 1R0PA 4AT4A 4C4GA 2UW5A 3CY2A 4X3JA 3LMHA 2QCSA 4NYEA 4XOYA 3NW7A 3QD3A 5EOBA 4USEA 3BYVA 3R1NA 2BUJA 3GU7A 4FTOA 3MB6A 4WD5A 1SNXA 3ZFXA 5HIBA 2OIQA 2JEDA 4BDCA 1UA2A 4H3PA 2JDSA 4D4SA 4DE4A 2VX0A 4RWLA 1AGWA 2QC6A 2QOCA 1PJKA 2B9JA 3I60A 4ZSLA 1G5SA 2VTJA 1PMVA 1CM8A 2C6MA 2KULA 2UZLA 3KK9A 3O8TA 4IVBA 4PMPA 1PXOA 4HZRA 5HBJA 2XS0A 4IMYA 1Q61A 3CQWA 2PZ5A 4UXLA 3E8NA 3FL5A 3PG1A 2RFEA 3KMUA 1DS5A 4FKVA 2X39A 3M1SA 5BYYA 3FZ1A 4AZEA 4G6LA 3DFCB 3OY1A 4XP3A 3SRVB 3CE3A 4LOQA 2WPAA 5EM6A 4E4MA 4IANA 4QMXA 4YJVA 4Q5HA 2UZUE 3TNWA 2JIUA 4FKQA 1I44A 4GYGA 1Y91A 3M11A 2OIBA 2IG7A 4FVRA 3TWJA 3DGKA 3DK6A 2PHKA 4O91A 4IC8A 3S3IA 4C38A 4DTBA 4IE9A 5I9UA 3PVBA 5IDPA 5EHYA 4DEDA 4C37A 4FKIA 1XBBA 3ZRLA 2XVDA 1YW2A 3JYAA 3ZUUA 4BICA 2ITXA 1FBNA 5DI1A 3DNEA 5HICA 3BHUA 5LVPA 4E6CA 2CPKE 5AWMA 4RIXA 3UO6A 3OBJA 3OXTA 5HBEA 3FI8A 5HNIX 4I0RA 3EIDA 4K77A 3FMLA 3DLZA 3I5NA 4E20A 4U41A 1SVGA 3DLSA 4BBFA 1U59A 2EXMA 2X2LA 3POOA 5LCJA 1IG1A 1PYEA 4O7ZA 2CMWA 2NRYA 1UU7A 3R8ZA 4F63A 3ZCLA 4A9RA 4PV0A 4TTHB 2VWYA 1Y6AA 4B0GA 3NUUA 5IQGA 4FSYA 3QTXA 5CSXA 5JFVA 4B9DA 2ZM1A 4PNKA 4L3LA 3V5TA 4D1SA 4M0YA 3TNIA 1YDSE 4O2ZA 4FSWA 3E93A 4LV5A 5M4CA 3DZOA 1H08A 3QD4A 4EOIA 2NPQA 3VBXA 2YAKA 3FPMA 1M17A 2W9FB 1GZOA 3MBLA 1I09A 4FBXA 2HZIA 4N6ZA 1Q41A 2B55A 3OY3A 3N51A 3ZXTA 4HVHA 4RWIA 5TE0A 3PY0A 2YM8A 4L45A 3FDNA 2CDZA 3HMNA 3PYYA 3U51A 3BYSA 5IA0A 2PL0A 3TT0A 4JXFA 2HZ4A 4P5ZA 3KRXA 4MQ1A 2WQEA 3EHAA 3MVHA 4PL3A 4RC2A 2R0IA 2VX3A 3D5WA 4LQMA 4LV8A 4YC3A 2BCJA 5DA3A 1IA9A 4ZMFA 3A61A 3OUNB 3DB6A 4J97A 1V0BA 4K18A 3NGAA 4K2RA 2EVAA 3SGCA 2W1ZA 4IB0A 4R78A 3RPVA 3LMIA 2R3HA 3EQBA 1ZYLA 4I0SA 5F1ZA 3MA3A 3LQ5A 4TY1A 3ZRKA 4F70A 5A9UA 2RGPA 3OUKA 2YIRA 5H8BA 4YZDA 5B7VA 5CI7A 4BWXA 4DT9A 1QPDA 2ZJWA 3IG7A 2C3KA 5IQEA 4DFZE 3TM0A 1PMUA 1M7NA 3QZFA 3FPQA 2UZTA 3ORMA 4AWIA 3QX4A 2XZSA 4WSYA 3BGZA 4LL0A 4UWCA 2XM9A 1FVTA 4L6QA 4M66A 3CEKA 4JR3A 4YHTA 4AZFA 4GT4A 4EOQA 4O21A 5IQAA 4YUQA 3FL4A 2C0TA 2JGZA 3UQCA 3TIZA 2IZRA 3BBTB 3EQIA 3MJ2A 5J95A 3L8XA 2BPMA 4RJ5A 2ZDTA 4C61A 3IKAA 4ITJA 2A27A 5CNOA 2WMUA 2BZHB 3EWHA 2YIXA 4MK0A 3WIGA 2WKMA 3CC6A 3EFJA 3UG1A 2ERZE 4FTMA 5T68A 3GQLA 4BDEA 4CRSA 5AMNA 4FKTA 3OD6X 4GVJA 2OI4X 3NZ0A 3BBWA 4O96A 3T3VA 4ZOGA 3ZHPC 5C26A 2AC3A 2HELA 1J1BA 5CU4A 3F5XA 3P9JA 5BQ0A 4Z16A 4MNEB 3HLLA 2DYLA 5L2WA 4M15A 3ZFYA 4XG2A 4XS2A 2O64A 1XH9A 4YLKA 5DT4A 5H8EA 4GRBA 5CWZA 3WIKA 3QAME 4W9WA 3R9DA 4IWDA 3KXMA 4R8QA 4F99A 3O96A 5EI8A 5HORA 2F4JA 4QYHA 3GEQA 3O51A 2I6LA 3WBLA 3LIJA 3S0OA 2WQOA 4BCFA 5IA2A 2YM5A 4EWHA 3FQHA 5LMKA 2BDJA 3MFRA 2YHVA 3P1AA 2XK3A 4RA5A 3QTQA 3KRRA 3R1YA 4BFMA 4C2VA 1R1WA 5D7VA 4DH7A 5ANEA 1URCA 3MIAA 1PXMA 4EUTA 3RPYA 4FTLA 1M14A 3O7LD 4O6LA 3DAEA 2XIRA 5KX8A 2OJFE 4DLJA 5L8LA 2HAKA 2QOKA 4K9YA 4LOOA 4M13A 4A06A 3U55A 2PE0A 4GJ2A 4RLKA 4E73A 5M06A 2ITPA 2IN6A 4BCKA 4BN1A 4CRLA 5IPJA 4F7LA 5J1WA 3L9NA 2Q83A 5AAEA 1U4DA 1HCKA 3VHEA 2EU9A 2HXQA 3VUGA 4DG3E 4EUUA 4EZ3A 2FH9A 1TQIA 2RFSA 2J5FA 3RWPA 1Y6BA 4J96A 4O22A 1E9HA 4IXPA 5TKDA 3IOPA 2VGPA 4FZ6A 4HPTE 3SDJA 1ZMWA 2ACXA 4AW1A 3AD4A 4YJPA 4MKCA 3HV5A 5C4LA 3VBYA 2CKQA 3RKBA 2HK5A 4MEDA 2OLCA 3KREA 3G2FA 4X2JA 4CFWA 4RVKA 3Q2JA 3DAJA 5HE1A 3ODYX 4KS7A 4APPA 4FKLA 2WEVA 2J51A 2YDJA 2B4SB 3NW6A 3ZFMA 4A9SA 3QUEA 5IF1A 5IISA 4FG8A 4FTTA 4X3FC 3H0YA 4K1BA 3LHJA 3LFQA 5KMKA 3P7AA 3R7UA 3RMFA 3CQUA 3BGPA 2C3JA 4F9AA 3LQ8A 1VEBA 5FM3A 4BHZA 3FEGA 4L8MA 5I9VA 4JDHA 4WKQA 4AA4A 5CT0A 4NL0A 1PRYA 2W1HA 3EKKA 3SQQA 1O6KA 2PK9A 3CPBA 4DH3A 3NUXA 2WTKB 1H07A 4UMUA 2XNPA 4QTEA 4Z7GA 5L6PA 4D4YA 3F3VA 4ZJIA 4MD8E 1KOBA 3F82A 4M67A 3I6UA 5HG9A 3UE4A 4AGUA 4JVGA 4FG7A 1GIJA 5HEZA 5LXMA 2JDVA 3R8PA 5KMNA 2XNMA 4JBQA 5E8UA 3BYMA 3PSCA 5AA9A 1YWNA 3R7OA 3SOCA 3BQCA 4HGLA 3HYHA 3P23A 4NU1A 4XG9A 5EFQA 4ACMA 5J9LA 4K8AA 4IQ6A 3I4BA 3DY7A 5ANGA 3SXSA 3FQSA 5J7HA 4FV0A 3BU5A 4LRJA 4U6RA 5JGBA 3R8UA 2E9VA 5I4NA 4V01A 2DS1A 5LMKC 2R5TA 3JY9A 2PU8A 4NT4A 2R3OA 5CSVA 4TXCA 5I9XA 3KN5A 4O6EA 3N9XA 4ONAA 3VUHA 5G1XA 3A8XA 4GK4A 3KVWA 3NRMA 3ROYA 3RI1A 3HV4A 1CMKE 3NPCA 4HOKA 2YFXA 3Q6WA 2PMNX 4J95A 3BHVA 1ZYSA 3R2BA 4XNEA 2ZMDA 3BE9A 5AP1A 3UOHA 3ZO1A 5CQWA 4PX6A 5EW9A 3UIMA 3MVJA 4BIDA 2QKWB 3DNDA 1WMKA 3DZQA 3RNIA 5CF4A 5JSMA 4I6BA 2VTLA 3NMUF 3E3BX 3PZEA 3CTQA 4GJ3A 2BZKB 1KSWA 2XJ1A 2Z60A 3IQ7A 3UBDA 4ZSGA 4JRNA 3VS0A 1ZARA 4QYFA 5CI6A 1NVQA 1M2RA 4EOOA 4FT5A 2VAGA 3WF6A 2JDOA 2PZIA 4TNDA 2OH0E 4MXOA 3BX5A 2QR7A 5DR9A 3ALOA 4E6AA 3L8SA 4E4XA 3PSBA 1JKLA 1FMKA 4BDJA 2ZM4A 4DFYA 4PDYA 2X2MA 4KA3A 3F3TA 5DH3A 3QGWA 4FEVA 3GC7A 3V8TA 4DEHA 1O6LA 2UW7A 2Y8OA 3E8CA 4TRLA 3VF8A 4YJTA 5BMSA 2RG5A 5J79A 3FYJX 4KSPA 4CXAA 3R7GA 2YCRA 3W2OA 3PRIA 3ZSHA 4F6UA 1UU3A 2YABA 3TG1A 4YGAA 3KMWA 5HU9A 3U6IA 2XIZA 3V6RA 4CT2A 4EKLA 3Q9ZA 3R1QA 4UX9A 3EN9A 5FTQA 4OW8A 4CSVA 2PSQA 4ZTRA 1ZYDA 2C3LA 2Q0NA 3U6JA 2PVMA 4ZXTA 2C3IB 4EK6A 3SG9A 3NS9A 1MRUA 3OT8A 4FR4A 3E63A 4QP3A 3TZMA 4AZVA 3BI6A 3SRVA 3FI2A 5HO7A 2X8EA 3QQUA 4JAIA 4ZJVA 5KMMA 1OM1A 3C4CA 3PIYA 4H3BA 3V8WA 1XBAA 4YZMA 4ALVA 4E93A 2GQSA 3ACJA 5HNBA 4CTBA 3UPZA 2PY3A 3P79A 4UB7A 1J7LA 4BTKA 4L44A 4EKKA 3NUNA 2FSMX 3P4KA 3R6XA 2DQ7X 5CVFA 4K6ZA 1OBGA 3E3PA 3BEGA 3Q04A 1Z9XA 2OSCA 2H34A 2W1DA 2PPQA 1XWSA 3FMDA 5LMAA 2XNGA 4YO4A 4FOCA 4RT7A 2CNUA 1FVVA 4L7FA 3SVVA 4TW9A 2XBJA 4ANBA 1ZYCA 5DR6A 3G51A 3F3WA 3TNHA 5HLNA 5DEYA 3R21A 3GC0A 2RIOA 4ZMEA 5AP2A 4QMNA 3VUTA 2W17A 2A1AB 3E87A 4FTRA 4L3PA 4RMZA 4OAVB 4DA5A 2XMYA 5EKNA 3NUSA 1H8FA 4XMOA 4CKJA 3HAMA 3VULA 5C4KA 4IAKA 2X4ZA 4RFZA 3NSZA 2GNIA 3U6HA 3VS6A 4WOVA 3Q52A 4FV3A 4LMNA 3Q2MA 3G6HA 3WILA 5L2SA 2ITQA 3AMYA 4IVCA 4QTDA 4JJRA 1SZMA 3QCSA 5FP5A 2H9VA 1XH6A 2F49A 4LRMA 3NYXA 4U3ZA 2PMOX 3W1FA 3WZKA 1VYZA 4YJNA 3ZU7A 4E5AX 2ZB1A 3LCOA 3KL8A 3PXQA 2XM8A 5E8TA 3RVGA 4MWHA 5KBQA 3RPSA 5CXHA 5J5TA 1FOTA 3BELA 2F7ZE 4BGQA 4DFNA 3DKFA 3UIUA 4TL0A 4G17A 5DRBA 2BFYA 3AD5A 3VS5A 2GPHA 3HMMA 5LVMA 4A4LA 2W7XA 1JKTA 3RALA 4ZEGA 3V5QA 4JT3A 5M07A 1WCCA 3SD0A 3VBTA 4IX6A 5D10A 4FIJA 3OG7A 4G1WA 2XNBA 2ITUA 5ANDA 3V5JA 1MUOA 2VTMA 4C8BA 4BIEA 5B2MA 4QP6A 4F0GA 4IX4A 2B9HA 4ZTQA 3FMNA 4IM3A 4I5MA 5DG5A 3SKCA 4BGGA 3I6WA 2YM6A 2WIPA 3F3ZA 2IZSA 3UOJA 3I79A 1WBNA 4RQKA 2VTPA 4FT9A 1H0VA 2GU8A 4M0ZA 3UIXA 3QQFA 4J1RA 1QL6A 5E8ZA 3DDPA 3FXZA 4FZ7A 3DA6A 3I81A 4IVAA 5FXQA 4EH7A 3R0TA 3TJDA 3PE1A 2B52A 5IA1A 3UQFA 4CMTA 4IAFA 4AA0A 4D2WA 3O17A 4DCAA 4FTCA 2O8YA 3KRWA 5IEVA 4ANQA 4BR3A 3EJ1A 5BUIA 2Y7JA 1VZOA 4NK9A 2RKUA 3GC8A 3WE4A 2WTVA 2QURA 4IDVA 5A46A 3QKLA 2FB8A 3ZO2A 3P7CA 3W8LA 5AUUA 5L8JA 5EW3A 4O0SA 2XRWA 2WTJA 3TNPC 1Z57A 4XG8A 2PVJA 3UO4A 2G2IA 5H3QA 3RM6A 4FV4A 2OGVA 4NIFB 2IVTA 3VBQA 3MY1A 3Q60A 5HE3A 1JSUA 1FVRA 4KIKA 1PMNA 2R9SA 2JC6A 4NJDA 5FXSA 4EH6A 3TDWA 3R8VA 4BKYA 4L46A 2BVAA 2OZOA 2WQBA 1H27A 4TZRA 5JZJA 3FZSA 4FTJA 5ANJA 2C30A 5BVFA 4FZDB 5JK3A 4EBVA 4TYIA 5JFWA 3R01A 4IADA 4FGBA 3N4TA 3GVUA 2V55A 4DGGA 5IQIA 3WE8A 3ZSGA 1WBPA 3ZUTA 2PUIA 3OP5A 4FT3A 2W06A 3FE3A 5CU0A 3D83A 3KXGA 3RTPA 5K5NA 4IBMA 3VUIA 2A4LA 1MQBA 3PWDA 1LEZA 5D1JA 4I6QA 2R3PA 4BIBA 4IC7A 3T8OA 4I20A 4KABA 5D41A 4KRDA 5AR3A 4D1ZA 2F7XE 4DITA 3DU8A 1IASA 3OCGA 4ERKA 1OB3A 2OK1A 5JH6A 3DBFA 5HG7A 5CEMA 3VW6A 2Y4IB 3FSFA 4FYNA 4RVMA 3MH2A 5ETCA 4GG5A 3RINA 3FLNC 3QALE 3QC9A 3IDCA 4QT1A 5D7AA 1YDTE 4ID7A 4ASXA 5FTGA 4WHZA 2F57A 2W4OA 2V22A 4QO9A 2EWAA 2W5AA 5IEYA 3COMA 4ARKA 3C4EA 3R2YA 2BRBA 4RWKA 2H6DA 2GNGA 1IRKA 2BZJA 2ZVAA 4ZTLA 4ORKA 5FRIA 2ITVA 4FL1A 4TNBA 2J50A 4U40A 3TDVA 4CVAA 1NW1A 1WVWA 2C6KA 4EHEA 5HD7A 4HGEA 5IUIA 3UOKA 4AGWA 4R77A 2C1BA 4AOTA 4PNIA 3VBVA 2XCHA 3V5WA 1NY3A 3QYZA 3R9NA 4C58A 3ORTA 5HLWA 3OWLA 3BU3A 2C5OA 3IW8A 2CHLA 2XA4A 5BX0A 4CKRA 5EYCA 4D5HA 4FYOA 3PA5A 3LXLA 3W2CA 4B99A 4UZHA 4QRCA 3AT3A 4XG4A 3Q9YA 4DH5A 2YZLA 4AW2A 4L01A 4CFXA 1SVHA 5DHJA 3IDPA 3DXQA 3ERKA 3NIEA 2UZOA 3V51A 2X9EA 4FV1A 4QPSA 4ZJJA 3NW5A 4JBVA 4EWQA 2X4FA 5M55A 3RM7A 4R5YA 4FV5A 3AC3A 3KB7A 4WNKA 4S31A 2ITZA 4JG6A 5HESA 4CZUA 4G3DA 2BMCA 4PPCA 1OIQA 4O38A 3I7CA 3ZC6A 3PRFA 4BBEA 4BBMA 5EQPA 3QX2A 4IM2A 3Q3BA 1K3AA 4YP8A 5L2IA 5LWNA 3E64A 3FHIA 3AMAA 4QP7A 4AN9A 3PSDA 1PKGA 5K9IA 5FD2A 4M12A 4J53A 4N0SA 3LM0A 1JLUE 4M68A 4DH8A 4BC6A 4ENYA 2XKDA 4R5SA 4A9UA 4QQTA 3FUPA 4Y5HA 3DKOA 3T9IA 5IQFA 4EHGA 1OI9A 2W96B 3ET7A 3MV5A 3ZS5A 4D0WA 3R9RA 4QP2A 4O7RA 1JAMA 4MVFA 5HCZA 3SG8A 2IZTA 2Z8CA 5AP5A 1V1KA 3OC1A 3E7VA 2GHGA 3CCNA 5K0KA 4BDAA 5DYJA 4CCUA 1GY3A 5E9EA 3QTZA 4XRLA 4D2RA 2P2IA 4JQ8A 5LWMA 2ITOA 3BV2A 2PVHA 4Y8DA 2EXCX 3FSKA 5M53A 3WYXA 4IX5A 4RSSA 4D9UA 3K3JA 3O8PA 2QKRA 3NNXA 1YXSA 5A4LA 4PTGA 3OBGA 2FSTX 3TACA 3VRZA 4AQCA 2WMAA 2BILB 3BHYA 3BKBA 5DFPA 5GZ8A 3HGKA 3GP0A 2WMTA 3LLAA 2J0LA 4FKSA 4DEGA 4F0IA 2G9XA 1TQMA 4IW0A 3EH9A 1KE9A 4IZYA 2JIVA 2UW4A 4WBOA 4JX7A 4QMYA 3FZTA 4RPVA 3FMJA 2KTYA 4FSUA 4MYGA 4BZOA 1H1SA 3K54A 2VTAA 5LCKA 4ANSA 3VHKA 2UV2A 3Q4CA 5TOZA 2WQNA 4O7SA 1YXUA 2GDOA 4YSJA 3IONA 5CANA 5CF6A 1EH4A 2CN5A 3PWYA 4AP7A 2PULA 1PXNA 3FWQA 2QVSE 4IAAA 5E1SA 3SX9A 2QOLA 2WNTA 3TXOA 4YTCA 3HAVA 3BLQA 2JITA 4DTAA 3DQWA 4RG0A 2ZV8A 3OOGA 2VZ6A 2CCHA 3BLHA 3KK8A 4L68A 4V05A 1MQ4A 1MRYA 3NCGA 2J7TA 2X7OA 3R00A 2Y9QA 3ANRA 2ONLC 2R4BA 1BL7A 2HWOA 2VTHA 4U9AA 5AX3A 4EK3A 4M7IA 2JFMA 4QP8A 3IS5A 4OBQA 3ZSIA 4D2VA 3FLSA 1A9UA 3OFMA 5HG8A 3ZO3A 4F65A 3PLAE 5IQDA 2P3GX 5HI2A 4GG7A 4HJOA 5HVJA 4C36A 4CZTA 2W05A 2OICA 2QU6A 3RPRA 1PXKA 3PFQA 3PJCA 4LI5A 1ZMVA 4F64A 2C6TA 4G6OA 3DBEA 3LCDA 3MPTA 4BCQA 2A2AA 5CENA 5GINE 3MIYA 4JQ7A 3KFAA 3IW7A 2VUWA 3ZM4A 2C0IA 3IGOA 4BTMA 4ZZNA 5K4JA 1GIIA 2WEIA 5CAQA 1TKIA 4WA9A 4GIIA 2OJIA 2REIA 3UZPA 5HG5A 4CKIA 4QMZA 5BNJA 5JQ8A 2C6EA 3QWKA 3D5VA 3ENMA 3FKLA 3P08A 4IFCA 3R7IA 2YJSA 4AW5A 4EJNA 3W2SA 1OIUA 1Q8WA 3QQLA 3HVCA 5BPYA 2W99B 4FSNA 4JLCA 4OAUC 4S33A 1NVRA 3C4XA 3LFAA 5KKRB 3W2QA 4PY1A 4YTIA 4DG0E 3ULZA 3MH0A 3D15A 4XOZA 3KQ7A 1OKWA 3TN8A 4YJRA 2W1IA 3EQRA 3FI3A 4IACA 4QMMA 3QF9A 4WT6A 2O63A 4ITIA 4B4LA 5CEPA 3ZLWA 4IWPA 3D14A 4EONA 4M69A 3TJCA 4E6DA 4O83A 4AOJA 1H0WA 4JBOA 5CSWA 2HWPA 5JRSA 4GEOA 5ACKA 1REKA 4IM0A 3LCSA 3PY3A 4ZSEA 5JN2A 4BF2A 5AUWA 2VO3A 3L1SA 4BDDA 2YLFA 3HNGA 3EN6A 4BDBA 4H1MA 3MGYA 2Y0AA 4XLIA 2HZ0A 3RBWA 2IJMA 2XCKA 3CPCA 2FSLX 5CVHA 3DKGA 5HE0A 5CU2A 2GNHA 4EI4A 4OLIA 4N70A 1YKRA 2ITWA 4I92A 2C5YA 5JGAA 1OL2A 5HOAA 1TVOA 3W55A 4NFNA 3MVLA 3VJNA 2XKEA 2YM3A 3P86A 4DCEA 4YZNA 1PY5A 3L9PA 2OJGA 1XH8A 4KUJA 3OTUA 2BALA 3GB2A 2GQGA 4U8ZA 5AP0A 4ZLOA 2CKPA 2CKOA 4QYEA 5CAOA 1LUFA 3QQGA 4GL9A 5CEOA 4LL5A 3QZHA 5AUVA 1YOMA 2W1CA 3GCPA 4L3JA 4I6FA 4TYHB 2GNJA 2QOBA 2Z7QA 4JDKA 4PMTA 4R3CA 4BGHA 2F7EE 2QR8A 4FL3A 4FTAA 4P5QA 2C6LA 5L8KA 3EQGA 2ONLA 4FV7A 5TO8A 2B0QA 2DUVA 4EQUA 3BWFA 4GKHA 3GBZA 3BE2A 4D9TA 4YR8A 4XJ0A 5EQEA 4Z55A 2BRGA 3DTWA 4AE9A 4ZTMA 4BWKA 3GCUA 2CKEA 4DH1A 4EZ5A 5HVKA 2C69A 2WU7A 2JLDA 4BDGA 4F1TA 2ERKA 3PA3A 4MBJA 2V7OA 1W8CA 4J7BA 4ANLA 4EOJA 4O7LA 3DTCA 4WIHA 3TZ7A 1BLXA 4PMMA 5DGZA 3RAWA 4AG8A 3MFTA 1OKZA 5AV3A 1G8SA 3A7JA 3BHHA 4NM3A 4YSMA 2B53A 3EQDA 2NP8A 5AP4A 5HCXA 4RIWB 3RAHA 1U54B 2VTTA 3GXLA 3D0EA 5DN3A 5GJGA 3IW6A 1ZOGA 4EORA 2IO6A 2X9FA 3QUPA 2XK4A 3OS3A 5C03A 4FTKA 4EH9A 3M42A 4JDJA 4GFOA 1VR2A 2G2FA 3O0GA 4ANNA 3R9HA 3PXYA 1KE8A 4JQEA 5HO6A 3QYWA 4OTIA 2X6EA 4UYNA 4IWQA 2B54A 2OU7A 5IUHA 3NEWA 4GFGA 3SXRA 4CV8A 3DJ7A 3TL8A 4R7HA 4JAJA 3P78A 3PJ8A 2BTRA 5BUEA 4GFMA 3JR1A 5AM6A 2GSFA 3UPXA 5DBXA 3C4WA 5LMBA 3JVRA 5EQYA 3C0HA 5C8NA 5K3YA 2R2PA 3GU6A 5AP3A 4F7JA 2C1AA 4R3RA 3ACKA 2WMQA 5AV4A 4P90A 2QD9A 4MF1A 4TWCA 3IPHA 3IOKA 4FV6A 3QL8A 4AOIA 5K4IA 4PTCA 5G6VA 3E5AA 4Z3VA 3QCYA 4FKRA 4CFVA 4MXXA 5GJFA 3PG3A 4HCVA 4FTUA 2OH4A 1PXIA 3AC4A 4AN3A 2VN9A 2ETKA 2UW9A 4KWPA 3V6SA 3PXRA 3HP5A 5K5XA 3AG9A 2OXYA 5I3OA 2PVRA 3HRCA 4BYJA 4UYAA 3TZ9A 4EK4A 2PZPA 3F2RA 4QMUA 4OTHA 3E8DA 3D5XA 3FXWA 3WI6A 4DAWA 4YLLA 5F20A 2P33A 2G01A 4ASDA 4BCHA 4E4NA 2IW8A 4NIFA 2WO6A 2Z7RA 1JVPP 4M14A 2YCQA 4R1YA 1NT2A 4F0FA 3BQRA 4AT3A 1SMHA 3CTHA 1XH5A 4DGNA 1GZNA 3A62A 3D4QA 2FUMA 5EDRA 1KE5A 4BI2A 3QKKA 4LRKA 4DBXA 2OO8X 1J7UA 2VWVA 2ZV7A 4L52A 3REPA 3SV0A 4O1PA 3R7YA 4QPAA 2GTMA 5AAFA 1Z5MA 1UWJA 2WMRA 3L9LA 2I1MA 3WF8A 4PP9A 4UEUA 2C68A 4HZSA 3FJQE 5EHLA 1JSVA 4OGRA 4B8LA 4FNWA 5BVEA 2O3PA 2AYPA 1H00A 4U97A 3EKNA 4QMPA 5KO1A 4HVDA 3I5ZA 3NR9A 3EOCA 3ZC5A 5KZ0A 3COIA 4NJ3A 5ACBC 5IQHA 4NEUA 2BHHA 3OXZA 5BMMA 2QQ7A 4OT6A 2QLQA 3HEGA 5EM7A 4L43A 3R8MA 3KMMA 4ZTHA 4CFUA 5M57A 3F66A 4W4YA 2X6DA 3AMBA 3D5UA 2WOUA 3CKXA 4XG3A 2OJ9A 2YZAA 2UW8A 3CS9A 4GK2A 4E5WA 4GUBA 4PWNA 3W32A 5LOHA 1OUYA 4X0MA 3R83A 1M52A 4AN2A 5AAGA 4FV9A 3DCVA 4FA2A 3CJFA 4MD7E 1BL6A 4C4EA 1MRVA 3KRLA 2HYYA 4RRVA 1ERKA 2WMBA 4KIOA 3PA4A 2CCIA 2XKCA 4KIQA 2F9GA 2XIXA 1J91A 4FE2A 5AIRA 2PVFA 4FZFB 3W10A 3UOLA 3VQUA 3VUMA 3DK3A 2XK6A 2QONA 1OMWA 3KKVA 4CTCA 3CJGA 1ZY5A 3EMGA 4QMTA 3LFCA 3PJ2A 5J87A 3GNIB 4M3QA 3KXXA 3DKCA 4RJ6A 1XKKA 2CNQA 4TYGA 4YPDA 4II5A 4D0XA 5I3RA 3PXFA 5IU2A 2C6DA 2R3IA 3HA6A 3KCKA 4S34A 4WG3A 2BRMA 3KRJA 5AJQA 5L3AA 1YXXA 2X8DA 4YJQA 5M4IA 1JSTA 5JMSA 1W98A 4BDHA 4EH8A 4M69B 4EJ7A 4IB5A 4DINA 2PTKA 3U4UA 4O84A 1YXVA 4HVIA 3F69A 2NRUA 4RX7A 3UZRA 3VF9A 3CIKA 4G9CA 3QXPA 2BHEA 3CBLA 4LG4A 2R7BA 3DK7A 4WRSA 3TTJA 4E4LA 4HNIA 2GMXA 3HDMA 1WAKA 1YDRE 2G2HA 4RWJA 4J98A 2VTRA 1TQPA 3DT1A 4I94A 5DE2A 3FQEA 5C01A 4F1OA 3C7QA 4XG7A 3JVSA 4B7TA 2HW6A 3Q9WA 1OUKA 4FEUA 3WF7A 4Y83A 5CY3A 2XP2A 4WNOA 5L2QA 4BCJA 3EYHA 3QRUA 3M2WA 4GVAA 4EL9A 3SHEA 3QTUA 4FICA 3W33A 5IA3A 2X0GA 4NKSA 3C13A 3U8WA 4XV2A 5BVNA 2CGUA 2GHLA 2OF2A 3DFAA 1WVYA 4FIFA 3GU8A 4APCA 4AT5A 3SXFA 4C59A 3QTSA 4C02A 4ZS0A 3EZRA 1F5QA 4O7TA 3F3UA 3IW5A 3QD2B 4NCTA 4YTHA 4R7IA 4CFMA 2Y6OA 4CV9A 2VTNA 4ACCA 1BYGA 3CD3A 3PXZA 2HENA 4XLVA 4BVUA 4YTFA 1P4OA 4QQ5A 3ZLYA 4BTFA 3QZIA 4YBJA 5I9ZA 5JZNA 4XP0A 5JT2A 2V62A 2WU6A 5H2UA 5TF9A 4ITHA 3OMVA 4EEVA 3KULA 2W5BA 5E8YA 3KVXA 4DEBA 5HBHA 2HW7A 1ZOHA 4X7QA 3U9CA 4RBLA 5FXRA 3DPKA 4FT0A 4FL2A 5FTOA 3ODZX 3O50A 4S32A 4PF4A 1J7IA 4RQVA 5E1EA 2XBAA 3JUHA 1CSNA 1XH7A 2HY81 4CYIA 3W2PA 4C57A 5D12A 3WF9A 3DS6A 2XB7A 5EDQA 2F2UA 4DF3A 2JBPA 2YJRA 4MXZA 1K2PA 5C8MA 3L8VA 3QQKA 5EM5A 4AU8A 4XRJA 5HIEA 2PE1A 3FZRA 2X1NA 3LXNA 4RX5A 3TTIA 1PXJA 1JQHA 1REJA 1E1VA 3HL7A 1W0XC 2YM4A 2NO3A 2V5QA 3BWJA 2GS2A 4W9XA 4DYMA 1QCFA 3EN4A 4H1JA 4JIKA 4QMWA 4C33A 4WUAA 4QMOA 4F7SA 3TKHA 1WFCA 2FYSA 2UVYA 4CCBA 4KKGA 2BRNA 4F7NA 3OF0A 5DLSA 4EOKA 3S00A 3LW0A 4YJSA 2WD1A 1IEPA 3G0EA 3F9NA 4IAYA 4O1OA 2FGIA 2AUHA 4NTTA 4ANOA 4BKJA 4E6QA 3MFSA 5BYLA 3EQPA 3VO3A 4FVQA 4H58A 3FKNA 3VUKA 5E8SA 1KUTA 2ZV9A 4KNBA 5FBNC 5HTIA 4DLIA 3QA0A 5DOSA 4PPBA 1KV2A 4JNWA 3PPZA 1GJOA 1Q4LA 3G0FA 4BZNA 3HMOA 4I5PA 5HU3A 4FSRA 4HW7A 5JEBA 3ALNA 4YJUA 4L67A 5CF5A 1ZRZA 4KAOA 3FMEA 3GU4A 5L6OA 4DG2E 3A7HA 5DRDA 5CT7A 4ALUA 3RPOA 2VX1A 1CKJA 5FEEA 4F4PA 3R9OA 4GYIA 4XX9A 4FNXA 3HRFA 2WXVA 5DWRA 2P0CA 2XNNA 5AADA 2VTOA 4FT7A 4NTSA 4JR7A 4LMUA 2Z02A 2FSOX 5EM8A 3DQXA 3HP2A 4IEBA 4GSBA 1P4FA 5AA8A 3MH3A 3ZBFA 1SNUA 3Q32A 4B8MA 2B9IA 3IGGA 4XBUA 3S2PA 5EOLA 5CYIA 3GCQA 3QUDA 4FKOA 2XYNA 3FLQA 2W9ZB 5CX9A 4GIHA 4UV0A 4DN5A 3AT2A 3D9VA 3K5VA 4FMQA 5FGKA 2UW3A 4FIHA 2PVNA 5EH0A 3I0OA 3SLSA 3MY0A 2YIQA 2CSNA 3KF7A 2WOTA 2XF0A 3OXIA
chains in the Genus database with same CATH superfamily
2H8HA 3H4JA 4CLJA 4ZSJA 1P2AA 3MN3A 2OJJA 1GAGA 4H36A 4IH8A 4ZIMA 4RJ8A 4E8AA 1M2QA 3ZZEA 4H39A 5GIPE 3R04A 1Q8ZA 4O0TA 3ATSA 3UNZA 3ZO4A 4FTNA 4BDKA 3T9TA 2UW0A 5FEQA 3UC4A 2OXXA 4YHJA 5L6WL 1ZMUA 1WBWA 2QHMA 3ZH8A 5KCVA 5A3XA 3HUBA 4G3CA 4OBOA 3FLZA 4AS0A 3B2TA 2GTNA 3F61A 2QOHA 4YZBA 3QRTA 3RNYA 3UG2A 3PIZA 3W0NA 1FGKA 3EYGA 3QFVA 4CG9A 3OROA 4AA5A 3CLYA 4DEIA 2YN8A 4D4VA 4NZWB 3RAKA 3LKMA 4O7VA 3VUDA 5CSPA 5ITAA 2CGVA 3BYOA 3OWKA 4RVTA 4Q5EA 1UKHA 4JL9A 4RJ3A 5CASA 3PXKA 3BZ3A 2A19B 1XMLA 3NDMA 4WNMA 4RC3A 4U3YA 1XHAA 2VTIA 3ENHA 3PJ3A 1WBVA 3RCJA 1KE6A 4XUFA 1IAJA 3UC3A 3PDTA 4O0UA 2WTIA 2J4ZA 1OIRA 2YCFA 2XJ2A 4MX9A 3EFLA 4BCNA 5CXZA 5A4CA 2JKQA 2C47A 3DJ5A 4EH4A 5DMZA 1GIHA 3EL8A 4FGRA 3TV6A 4GV1A 2WB8A 5KUPA 1Q97A 4JOAA 3FLWA 4QPMA 4DGLC 3NYOA 4ALWA 5AR8A 4BCOA 4C3RA 3FLYA 4AE6A 3II5A 1BKXA 3QBNA 3LLTA 1P5EA 3HMPA 1UU9A 4BB4A 3FXXA 1K9AA 2VU3A 3AXWA 4HVGA 3N4UA 4FKUA 1IAHA 3NYNA 3OCSA 4R6VA 3FY2A 2QOQA 3N4VA 2XJ0A 3CGOA 4GU6A 4LUDA 2XUUA 1G8KA 1H26A 3VNTA 3EQFA 3QLFA 5M4UA 3P5JC 5BVOA 2RFDA 4A4OA 3IW4A 5ANOA 4O27B 1JWHA 1O9UA 4UMPA 5T6KA 3R63A 2I0YA 4BCPA 3ID6C 4GKIA 4H05A 5CAPA 2VWIA 5TT7A 4QNYA 2XIKA 4X3FB 4BY9E 3Q96A 2I0HA 2ETRA 4QQJA 3BHTA 2QO9A 3KXNA 2XRUA 3K3IA 5IG1A 3UVPA 1PF8A 3QRJA 1A48A 2W4JA 3NNVA 4CD0A 3LFSA 4EH3A 3UJGA 2BRHA 3LJ2A 4U43A 2QO7A 5J8IA 5FQDC 2BTSA 2EXEA 4O0VA 4I22A 1BX6A 4FIGA 4QMSA 4BI1A 2C6IA 1PMEA 2ZMCA 4X2KA 3SW7A 1FGIA 1R78A 3OWPA 1YHWA 5HLPA 2IF8A 4JG7A 5ANKA 2PUUA 4CMOA 5J7BA 5ETAA 2YACA 2ITYA 3DJ6A 5EDPA 3PVGA 3WZEA 4BCIA 4FEWA 3NNUA 5FLFA 5IZFA 1PKDA 2BDWA 2AC5A 3LFFA 1APME 2VRXA 5AUYA 3MI9A 3WYYA 4CT1A 4CYJA 4F1MA 1ZYJA 4QDEA 3KEXA 1OPLA 3H9RA 4TYJA 5M4FA 2X8IA 3IO7A 5IKWA 4PP7A 4FKPA 2XKFA 4QD6A 4AUAA 4FIEA 4GT5A 2QOIA 4DFBA 3ZLXA 3BCEA 1R3CA 5KKRC 4CFFA 3QHRA 1UKIA 1YHVA 1KV1A 5BYZA 4D1XA 4XH6A 1LP4A 3NNWA 4E7WA 5GJDA 3ZM9A 1UV5A 4JG8A 3TKIA 1B38A 4RX8A 3B2WA 3ZXZA 4BDIA 3KULB 1OL7A 2O65A 4HNFA 2JAMA 2OBJA 3R7EA 4D55A 1STCE 2IEWA 4CZYB 4JMQA 3FMHA 4I5CA 5EI2A 5KMLA 1OIYA 3EN5A 3G33A 4XBRA 4L7SA 5HD4A 1WVXA 3Q6UA 4QNAA 3LJ1A 3RZBA 5AUZA 3W0SA 1OBDA 2GQRA 2OFVA 4C4IA 5EYDA 4DT8A 4GU9A 5GHVA 5CAVA 5FDXA 2BDFA 4USDA 3BL9A 4QP4A 1T45A 2VWZA 3S4QA 4DEAA 2ZM3A 4KB8A 3UIBA 5D9HA 5F94A 3AGMA 2QODA 1J1CA 2ZOQA 4L00A 5E90A 3GFWA 4MD9E 4XCUA 4XEYA 2QG7A 2PMIA 3NUPA 4O2PA 4MAOA 3V5PA 1UNHA 2JKOA 3B8QA 4QOXA 3UZTA 3S1HA 4C3FA 3HRBA 4C7TA 4NSTA 2UZWE 1OKVA 2WMXA 4KBAA 4GUEA 5EG3A 4UXQA 2WIHA 4AXCA 3QC4A 1QPEA 2W0JA 5I5ZA 4QTBA 3PUPA 4XV3A 2ITTA 2HXLA 5CF8A 3U54A 2CGXA 5CNNA 5KHWA 4J99A 3W0PA 4BL1A 3AC8A 1UNGA 2VV9A 4Q2AA 1NXKA 3VS7A 1Q8TA 3UMXA 3ZEWA 4QEBA 2W1EA 5FM2A 4HYSA 5EHOA 5AR7A 4G34A 5LARA 3CP9A 3UVQA 2YWVA 3E8EA 3O71A 2JKMA 4JIAA 1OL1A 5HX8A 4I4EA 5CLPA 5M44A 2G15A 2XNOA 4GH2A 4OTRA 4X6RA 3CXWA 2NNWB 2X0OA 2JDRA 2R3LA 4U42A 3R8LA 2QOFA 2HOGA 2OW3A 1J3HA 5EYMA 5AV2A 4AQKA 5C1QB 1OECA 3PLSA 3Q5IA 4RZVA 1NVSA 4IJ9A 1BI8A 4FK3A 2IW6A 3PJ1A 4YC6A 4I0TA 3MVMA 3D7TA 4HCTA 4O7NA 3HZTA 2IWIA 3ORPA 5AM7A 2OG8A 4I93A 1M2PA 3R02A 4W8EA 4XP2A 3ORNA 4ZTSA 4AGCA 1RE8A 3FKOA 3ORXA 5DVRA 5IA5A 5CEIA 4KBCA 1AQ1A 4MXAA 4Y72A 3ZZWA 4O82A 2R3FA 4M84A 4FF8A 3FYKX 3A8WA 1PXPA 4MXYA 3BLRA 2V7AA 4C34A 3D2KA 1LR4A 5DPVA 3EN7A 3DAKA 4YHFA 3ZUVA 4DHFA 3OCTA 4QMLA 3QTRA 4WG5A 2ZYBA 3I7BA 4FTQA 2ITNA 4HPUE 5AUTA 3ELJA 5AR4A 2FO0A 1F3MC 4AW0A 2E9PA 1CDKA 3H0ZA 3A60A 1ZLTA 2YM7A 3MPAA 5EYKA 3ZEPA 3MFUA 2OIDA 3HKOA 2YIYA 2YA9A 2B7AA 3R30A 3FY0A 2C5VA 3HECA 2Z2WA 3C4ZA 4U0IA 4Z9LA 3NVKI 4ZY6A 3VBWA 2VWBA 4JDIA 4DEEA 3QKMA 4PMSA 3DBQA 1G3NA 1Y8YA 3COHA 3Q4TA 4ZY5A 2GS6A 2J5EA 4E26A 3AGLA 3PE2A 4J71A 5LVNA 4MWIA 4Y95A 4FNZA 3VJOA 4B6LA 2HY0A 3H30A 5AP7A 2RSVA 2VWXA 3VAPA 4EHZA 5BVWA 1JKSA 3ZYAA 2NYAA 4N4SA 1WZYA 1HCLA 1GZ8A 3G9NA 1BUHA 4IZAA 4KINA 4M8TA 4RJ4A 4DHZA 5J1VA 3BLAA 1VYWA 4EOLA 4FSZA 4RIYA 4IX3A 4XG6A 4GK3A 2PYWA 1DI9A 3UYSA 4U44A 1XBCA 2G1TA 2PWLA 4A4XA 1AD5A 3GT8A 3ORKA 3PPJA 4KIKB 1P14A 4W8DA 3Q53A 5FWKK 3KXHA 3QRKA 4ZAUA 5I0BA 3TEIA 4ZSAA 2YERA 3R22A 3G15A 3VVHA 4R1VA 4EC9A 4QQCA 3F7ZA 5ETIA 3V5LA 3FI4A 4EH5A 4IAIA 2GNFA 5LVLA 5HZNA 4RJ7A 4K11A 4EYMA 2X2KA 5H8GA 4YU2A 5CAUA 3RP9A 3BYUA 4NM0A 4D58A 4RC4A 4CQEA 5F9EA 4C62A 5KMOA 3THBA 1IA8A 3MB7A 1OZ1A 1FPUA 1JOWB 4U5JA 4YC8A 3HA8A 5DEWA 1QPJA 2PMLX 1G8AA 1YXTA 1ATPE 1UU8A 4V0GA 5FG8A 3ULIA 3C1XA 4D5KA 4A9YA 5A4EA 3IDBA 1M7QA 3FC1X 3DBDA 2J6MA 5DR2A 1L8TA 4X2NA 3QA8A 2E9OA 3FZOA 2R3QA 2OF4A 1YI4A 3R71A 4RGJA 3TV7A 4EBWA 4NM7A 4X3FA 5AX9A 5IEXA 4OTQA 5HTBA 5AEPA 2EUFB 4EH2A 4AFJA 4FKGA 2WQMA 3LM5A 4L42A 1XJDA 2VO6A 3QD0A 2WAJA 3KN6A 1YWVA 2R3MA 4J52A 4PPAA 5C9CA 3LVPA 2O2UA 1RQQA 3ORIA 5AP6A 4LM5A 4BTJA 4F9CA 3MA6A 2OXDA 4IB3A 3PVWA 3R7VA 3HV7A 3SC1A 4HYUA 4X2GA 4C4FA 5E91A 2EB2A 3BGQA 2WMSA 3KGAA 5E7RA 2R3RA 1Q62A 1PHKA 1Q3WA 3VWAA 3BL7A 1PYXA 2R3JA 4RFYA 3PY1A 2J90A 4YPSA 4HVSA 1U54A 4U79A 3C50A 2LGCA 5KZIA 3O23A 4FNYA 5M09A 4KBKA 3TKUA 3QXOA 3FAAA 2FVDA 4HGTA 4L53A 5F95A 5LVOA 4GMYA 4I41A 5FP6A 1R39A 4EK8A 2Y4IC 4D4RA 2I40A 2YISA 2YAAA 4PL5A 4U45A 4F08A 2E2BA 4I21A 1VJYA 3FMMA 4N57A 4O0YA 2HZNA 3UYTA 2ZB0A 3QWJA 2XEYA 2WZJA 3VS2A 3KF4A 3UP2A 5HX6A 3NUYA 3TZ8A 2GS7A 1JKKA 4I23A 5L4QA 4E1ZA 4TWPA 3HV6A 4YMJA 4G9RA 3MDYA 3UQGA 4WUNA 3CR0A 1KWPA 3ORZA 2A0CX 3Q4UA 4I24A 3U9NA 3RHKA 3MH1A 1OGYA 1ZWSA 1XO2B 3C4FA 4TN6A 4BRXA 4FTIA 3C0IA 4CQGA 4DTKA 1BI7A 5KMJA 4X2FA 3EZVA 2XK9A 2R64A 1UWHA 2ZV2A 4PDPA 2XK7A 4CNHA 2IZUA 3R1SA 3DOGA 4K0YA 4DGOA 5I9WA 5HTCA 5BVDA 2DWBA 5KBRA 4MNFA 4OUCA 1YOJA 3F5UA 3RJCA 3QLGA 4PL4A 5CALA 3ZTXA 4MNEA 3AOXA 4P7EA 1OPJA 3TIYA 3A2CA 4CMUA 4GCJA 3WZDA 3EFKA 5M51A 2BR1A 4OTGA 3UO5A 2X7GA 3BPRA 5J9ZA 3EFWA 4KS8A 4YLJA 4IIRA 5KE0A 2R3NA 4IVDA 2BKZA 4JI9A 4YURA 4CLIA 2BIYA 1YI6A 3GENA 4FK6A 1FMOE 4EQMA 1RDQE 4Y5QA 5EK7A 2PUNA 3W8QA 3O2MA 4NW6A 3W16A 4XHKB 2UZDA 3G6GA 4UMTA 1SVEA 3RCDA 3PP0A 2FA2A 3JPVA 2B1PA 2YDKA 4KRCA 4YNEA 1XR1A 4MXCA 5AV0A 2OZAB 4FEXA 3BRBA 4RIOA 4U80A 4RLLA 4PUZA 4NM5A 2PUPA 4IWOA 2I0EA 2W5HA 3A7IA 3DV3A 3OEFX 4F9WA 2VWUA 2XIYA 3V8SA 3EB0A 3RZFA 3DBCA 3WARA 3HX4A 3VS1A 5J5SA 4WRGA 5GZAA 1DI8A 1X8BA 4BJJA 4AF3A 4RVLA 3VRYA 3OTVA 3JS2A 2RG6A 1H1WA 3LAUA 4XYFA 4EK5A 5EI6A 3QCXA 1FINA 4YZ9A 3MJ1A 4MF0A 2V0DA 2WMVA 5A6NA 5E92A 1LEWA 4PTEA 4MBLA 3B8RA 3P0MA 2X81A 2VTQA 1R0EA 1FQ1B 3OT3A 3W0RA 1JNKA 1WBOA 3P7BA 5B2KA 2P2HA 2EB3A 1OITA 4I3ZA 5H9BA 3F88A 4FKJA 4A9TA 3QTIA 4ASEA 3D7ZA 4QMQA 2PVLA 3RK9A 3E88A 1H1PA 1S9JA 3ZDIA 4IFGA 4QYYA 4MBIA 5HCYA 4D2PA 2VD5A 4IHPA 1QPCA 4G31A 3NVMB 3KY2A 4FUXA 4FC0A 4GT3A 3C5IA 2I0VA 4D28A 4QMVA 2C5XA 4EZ7A 3LFDA 1U5QA 2UZEA 3MTLA 1GZKA 4R3PA 4ZLZA 2IPXA 3ZONA 2WTDA 5D11A 2GFCA 3JY0A 4EQCA 1YVJA 4F6SA 5FBOA 3ZBXA 4UWYA 5JQ5A 4G5PA 5IH6A 3LOKA 2QNJA 3ZRMA 4AACA 3GCSA 1T46A 2UW6A 5CTPA 5IQCA 4O81A 3IECA 5HO8A 2R3KA 4FSMA 4F09A 2YIWA 4WSQA 5IH4A 3CGFA 2HCKA 4BCGA 5HVYA 5AR5A 4V0GB 4MTAA 4WO5A 1KE7A 3E7OA 4J8NA 3QHWA 2QO2A 4G2FA 4NKAA 3HMIA 1UVRA 1DAYA 2JAVA 4P4CA 4FJVA 4HYIA 5K0XA 4D2TA 3LXPA 4UMQA 3GUBA 3OCBA 3HDNA 4XV1A 1UNLA 4MH7A 4RIXB 3TUBA 3UNKA 5AIKA 2OFUA 3MW1A 4WNPA 3WZUA 3LJ0A 4FSTA 4N6YA 5C8KA 5IDNA 4UWBA 5GIOE 4PDOA 1XMMA 3TV4A 2WGJA 4BYIA 4LFIA 2QOOA 4YZCA 2IVVA 1Q8YA 3WZJA 4ANMA 4PRJA 4W4WA 4AX8A 3UDBA 3S95A 1YI3A 4Y46A 3LCKA 4ZK5A 3ZDUA 4RIYB 2PVKA 3POZA 4KIPA 5CQUA 5F4NA 3LFNA 4G3FA 4TKSA 5HIDA 4S30A 3KXZA 2VTSA 2C5NA 5CEQA 4FX3A 2WTCA 3U4WA 4O7WA 3AT4A 4PDSA 4WBBB 5FEDA 4P2KA 4AFEA 4XV9A 5CZHA 3VN9A 3AKLA 4O0XA 4UBAA 2YWPA 2UZBA 2VO7A 3G5DA 2Y4PA 2A98A 2QI8A 4USFA 5KNJA 1Y57A 4ACDA 3LQ3A 3SA0A 4HYHA 1WBTA 2C0OA 5AFVA 4OT5A 4KSQA 4RZWA 2UUEA 3CSVA 2HIWA 4LV7A 2BAKA 4LYNA 2YLEA 4W4XA 2J9MA 5HNGA 3NWWA 2IVSA 5ICPA 3LMGA 4I1ZA 2W4KA 3OOMA 4IDTA 3UODA 5AR2A 1NA7A 3GGFA 5JKGA 4TWOA 2ESMA 4PQNA 3TUDA 1CKIA 2VWWA 4U81A 3RWQA 5KHXA 4C0TA 3NCZA 4O0WA 4DFXE 2OKRA 2XH5A 3P5KA 3MPMA 3Q9XA 4FZAB 3FV8A 3LZBA 2GFSA 1F0QA 3A99A 4WG4A 1KOAA 3TNQB 3CKWA 4NWMA 1A06A 1TZDA 5E8XA 5HGIA 2YITA 3QTWA 2RFNA 3RHXA 3VW8A 2WTWA 4NUSA 4FV2A 2C6OA 2GHMA 2CN8A 2JFLA 2XEZA 1LPUA 4FG9A 5CS6A 4G6NA 1SYKA 1XH4A 1H28A 3AC2A 3ROCA 5B2LA 2WFYA 3GCVA 3D94A 4NH1A 2BROA 4RIWA 2GCDA 3RGFA 2QG5A 3A7FA 3I1AA 4AGDA 2PVYA 4CEGA 4FOBA 3UP7A 4F9YA 1WBSA 1H24A 3A4OX 3L8PA 1ND4A 2C4GA 3BEAA 3GOPA 4YJOA 3AC5A 4AZWA 5FDPA 4MQ2A 2R0UA 3FHRA 3JXWA 3K5UA 2W1FA 2O5KA 2J0JA 3O8UA 1W7HA 3UVRA 4ENXA 1YQJA 1RJBA 4S2ZA 4ZLYA 4O7YA 5BV3A 1OL5A 3OVVA 1L3RE 2WHBA 3D7TB 3AD6A 3QGYA 1JBPE 3UTOA 4Y85A 4U7ZA 3LFBA 3NAXA 3QZGA 1B39A 3F6XA 2VNYA 2ZAZA 4OTFA 3AC1A 2QLUA 2E9NA 3L9MA 4OR5A 5EKOA 4RA4A 4IZ7A 2Z7SA 4UN0C 2JIIA 2YDIA 4TT7A 2H96A 3OZ6A 4ZS4A 3VIDA 3W0QA 4C4HA 3EQHA 4Q9SA 1H25A 1YOLA 4EC8A 1W83A 3GOKA 3MYGA 2JBOA 3CTJA 3D2IA 3OWJA 4KKEA 4FUYA 3Q4ZA 2J0MB 4OTDA 5BVKA 4D2SA 4EYJA 2BFXA 2J0IA 4LGGA 4KD1A 1IR3A 3BIZA 1CKPA 4IB1A 1V0OA 1V0PA 3PIXA 2F2CB 1U46A 4FKWA 4AXFA 5CU3A 1BMKA 4Y73A 4CFNA 2YEXA 5CZIA 1G8JA 3LPBA 3VC4A 5J9YA 4ZY4A 3FBVA 2BAJA 1PW2A 3BU6A 1JPAA 2Y6MA 3F5PA 4M97A 3PVUA 4TYEA 3V3VA 1B6CB 4BDFA 5A6OA 4LOPA 5CVGA 3KU2A 3MWUA 5T3QA 4ZZOA 1Q99A 5IMEA 3ATTA 3F2AA 3PPKA 4O86A 3FZPA 4V04A 4MHAA 3OW3A 2IVUA 4ACGA 3QRIA 4TWNA 4J8MA 2J2IB 2XK8A 5FUTA 4DFUA 3OEZA 4UALA 5CEKA 5IUGA 4YO6A 3VS3A 3H9OA 4CGAA 5JFXA 4G3EA 4E5BA 2ETMA 2UVZA 3TYKA 1RW8A 3GU5A 4EOPA 3R73A 3SW4A 4C2WA 2OWBA 1Q3DA 4AAAA 1OPKA 3E62A 4IAZA 1W82A 5M56A 3MTFA 5DT3A 5A54A 4BWPA 1W84A 3VQHA 5A4TA 3GI3A 1MP8A 1H1QA 2VNWA 3G9LX 2QU5A 4C3PA 4FV8A 1DM2A 3H3CA 3MESA 2SRCA 1YHSA 3C5UA 4IZ5A 1QMZA 5JFSA 4QYGA 5GZ9A 2QHNA 3MSSA 3W2RA 3CQEA 3TCPA 3V04A 4ERWA 3ZOSA 4E3CA 3NYVA 4F6WA 4ASZA 2P55A 2JD5A 4F9BA 2UZVA 3E92A 3ETAA 3UDSA 4EOSA 3KA0A 4FODA 4A7CA 2BKKA 3R28A 3ANQA 3HV3A 2P4IA 3DB8A 3F5GA 4JRVA 4LGDA 4CG8A 4FIIA 2VO0A 3G90X 4HGSA 2PE2A 2WELA 4FI1A 4JX3A 4UZDA 5L2TA 2CGWA 2R3GA 3CD8A 4UY9A 3UMWA 4BI0A 4OTPA 5IH5A 2ZDUA 4BZDA 5CU6A 1ZAOA 4ZP5A 3LE6A 2E9UA 3BV3A 3RK5A 1H1RA 3KC3A 4ZZMA 3LFEA 2PZYA 2WTKC 3KCFA 4YBKA 3OHTA 3UNJA 5JRQA 2YCSA 3NLBA 4TPTA 4QP1A 5E8WA 1DAWA 4K33A 4AXAA 4I5HA 1E1XA 1OL6A 1PXLA 4NCTC 2CLQA 3EL7A 3ORLA 5IMXA 3F2NA 1Q5KA 3GFEA 4IJPA 4DBNA 2JKKA 5AUXA 3NUAA 2JDTA 4G5JA 5HKMA 3DXPA 5M08A 3O7LB 1Q24A 5LJJA 3NX8A 4UMRA 3CY3A 1ZOEA 3PZHA 5ANIA 3GC9A 3TI1A 5E8VA 4X21A 5LQFA 2BIKB 5HE2A 4OBPA 3QU0A 3QCQA 4QTAA 4KKHA 4W4VA 5DNRA 5IA4A 2GNLA 2Z7LA 3FC2A 4HCUA 5DT0A 3T3UA 1H01A 4LUEA 4BHNA 1GNGA 2X7FA 3MS9A 5ETFA 1OVEA 1Q8UA 3MY5A 3QQJA 2LAVA 4Z7HA 2RF9A 4G3GA 3QQHA 5GNKA 3ZMMA 3RK7A 2IW9A 1U5RA 3W18A 3H10A 4G16A 2I7QA 3UGCA 2XNEA 3V01A 4GW8A 5A4QA 3NIZA 3HUCA 1YRPA 4X6QC 3U87A 3DDQA 1SM2A 2VGOA 2W1GA 2O0UA 4H3QA 4OTWA 5E4HA 5I9YA 3LXKA 2XYUA 1ZZLA 2PZRA 2WMWA 3FMKA 4JS8A 3SOAA 1HOWA 3LCTA 4C4JA 3WOWA 3I0QA 3ZLSA 3GQIA 2XANA 2UZNA 1OKYA 4FSQA 2UVXA 2RL5A 1URWA 2Q0BA 4NW5A 5KMIA 3SAYA 3A4PA 4NFMA 5CSHA 4FVPA 4FEQA 4AZTA 1YWRA 3F7WA 4DC2A 3RAIA 4RX9A 1ZXEA 2R7IA 5AV1A 5IQBA 4GS6A 5EW8A 2CJMA 5C27A 4TYHA 3C0GA 3COKA 4L9IA 5HQ0A 4ACHA 3H9FA 4LGHA 3TUCA 2B9FA 4I6HA 4DGMA 5A14A 4EHVA 1O6YA 2BAQA 3NAYA 3C9WA 2BZIB 3OW4A 4ZTNA 4BCMA 5JGDA 1Y8GA 1ZZ2A 3C51A 1ZY4A 3PP1A 4QTCA 4MCVA 4C35A 2CNVA 5TR6A 4YNOA 4A07A 1CTPE 3Q5ZA 1S9IA 3VS4A 4DFLA 4RFMA 5BUJA 3ITZA 1XQZA 3AQVA 4I4FA 5DIAA 4QP9A 4BKZA 4LDTA 1GOLA 4DLIA 1H4LA 4EOMA 3PTGA 1OGUA 4JBPA 3IK3A 4R7BA 2CLXA 3WF5A 3DXNA 2OZAA 2J0KA 4Q9ZA 3A7GA 5B0XA 5HHWA 4O0RA 3EQCA 3K2LA 4AZSA 1R0PA 4AT4A 4C4GA 2UW5A 3CY2A 4X3JA 3LMHA 2QCSA 4NYEA 4XOYA 3NW7A 3QD3A 5EOBA 4USEA 3BYVA 3R1NA 2BUJA 3GU7A 4FTOA 3MB6A 4WD5A 1SNXA 3ZFXA 5HIBA 2OIQA 2JEDA 4BDCA 1UA2A 4H3PA 2JDSA 4D4SA 4DE4A 2VX0A 4RWLA 1AGWA 2QC6A 2QOCA 1PJKA 2B9JA 3I60A 4ZSLA 1G5SA 2VTJA 1PMVA 1CM8A 2C6MA 2KULA 2UZLA 3KK9A 3O8TA 4IVBA 4O4DA 4PMPA 1PXOA 4HZRA 5HBJA 2XS0A 4IMYA 1Q61A 3CQWA 2PZ5A 4UXLA 3E8NA 3FL5A 3PG1A 2RFEA 3KMUA 1DS5A 4FKVA 2X39A 3M1SA 5BYYA 3FZ1A 4AZEA 4G6LA 3DFCB 3OY1A 4XP3A 3SRVB 3CE3A 4LOQA 2WPAA 5EM6A 4E4MA 4IANA 4QMXA 4YJVA 4Q5HA 2UZUE 3TNWA 2JIUA 4FKQA 1I44A 4GYGA 1Y91A 4DDGA 3M11A 2OIBA 2IG7A 4FVRA 3TWJA 3DGKA 3DK6A 2PHKA 4O91A 4IC8A 3S3IA 4C38A 4DTBA 4IE9A 5I9UA 3PVBA 5IDPA 5EHYA 4DEDA 4C37A 4FKIA 1XBBA 3ZRLA 2XVDA 1YW2A 3JYAA 3ZUUA 4BICA 2ITXA 1FBNA 5DI1A 3DNEA 5HICA 3BHUA 5LVPA 4E6CA 2CPKE 5AWMA 4RIXA 3UO6A 3OBJA 3OXTA 5HBEA 3FI8A 5HNIX 4I0RA 3EIDA 4K77A 3FMLA 3PUFC 3DLZA 3I5NA 1TFFA 4E20A 4U41A 1SVGA 3DLSA 4BBFA 1U59A 2EXMA 2X2LA 3POOA 5LCJA 1IG1A 1PYEA 2AEGA 4O7ZA 2CMWA 2NRYA 1UU7A 3R8ZA 4F63A 3ZCLA 4A9RA 4PV0A 4TTHB 2VWYA 1Y6AA 4B0GA 3NUUA 5IQGA 4FSYA 3QTXA 5CSXA 5JFVA 4B9DA 2ZM1A 4PNKA 4L3LA 3V5TA 4D1SA 4M0YA 3TNIA 1YDSE 4O2ZA 4FSWA 3E93A 4LV5A 5M4CA 3DZOA 1H08A 3QD4A 4EOIA 2NPQA 3VBXA 2YAKA 3FPMA 1M17A 2W9FB 1GZOA 3MBLA 1I09A 4FBXA 2HZIA 4N6ZA 1Q41A 2B55A 3OY3A 3N51A 3ZXTA 4HVHA 4RWIA 5TE0A 3PY0A 2YM8A 4L45A 3FDNA 2CDZA 3HMNA 3PYYA 3U51A 3BYSA 5IA0A 2PL0A 3TT0A 4JXFA 2HZ4A 4P5ZA 3KRXA 4MQ1A 2WQEA 3EHAA 3MVHA 4PL3A 4RC2A 2R0IA 2VX3A 3D5WA 4LQMA 4LV8A 4YC3A 2BCJA 5DA3A 1IA9A 4ZMFA 3A61A 3OUNB 3DB6A 4J97A 1W2FA 1V0BA 4K18A 3NGAA 4K2RA 2EVAA 3SGCA 2W1ZA 4IB0A 4R78A 3RPVA 3LMIA 2R3HA 3EQBA 1ZYLA 4I0SA 5F1ZA 3MA3A 3LQ5A 4TY1A 3ZRKA 4F70A 5A9UA 2RGPA 3OUKA 2YIRA 5H8BA 4YZDA 5B7VA 5CI7A 4BWXA 4DT9A 1QPDA 2ZJWA 3IG7A 2C3KA 5IQEA 4DFZE 3TM0A 1PMUA 1M7NA 3QZFA 3FPQA 2UZTA 3ORMA 4AWIA 3QX4A 2XZSA 4WSYA 3BGZA 4LL0A 4UWCA 2XM9A 1FVTA 4L6QA 4M66A 3CEKA 4JR3A 4YHTA 1VLRA 4AZFA 4GT4A 4EOQA 4O21A 5IQAA 4YUQA 3FL4A 2C0TA 2JGZA 3UQCA 3TIZA 2IZRA 3BBTB 3EQIA 3MJ2A 5J95A 3L8XA 2BPMA 4RJ5A 2ZDTA 4C61A 3IKAA 4ITJA 2A27A 5CNOA 2WMUA 2BZHB 3EWHA 2YIXA 4MK0A 3WIGA 2WKMA 3CC6A 3EFJA 3UG1A 2ERZE 4FTMA 5T68A 3GQLA 4BDEA 4CRSA 5AMNA 4FKTA 3OD6X