1MRVA

Crystal structure of an inactive akt2 kinase domain
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
294
structure length
261
Chain Sequence
VTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an inactive akt2 kinase domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords RAC-beta serine/threonine kinase
total genus 67
structure length 261
sequence length 294
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1mrvA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1mrvA02
4EOKA 3VS5A 1M2QA 2BZIB 2GMXA 4UXQA 4D2TA 4LMNA 4A9YA 5BUEA 5AUWA 5C27A 2PVMA 4JLCA 3RAKA 3UO6A 4P90A 3Q9YA 2BALA 4GVJA 4ZP5A 3THBA 5HIDA 3MTLA 5L8LA 5I4NA 4KIKB 2H96A 3P23A 3VBQA 5GJFA 4YHFA 5EOBA 3TIYA 4DLJA 3S3IA 4ANNA 4ZLYA 5KE0A 4AFEA 4EH8A 3L9LA 1YRPA 3R7OA 3R9RA 2UW4A 3F66A 2H9VA 3FZTA 3TNHA 3DQWA 5LXMA 2PVJA 3KGAA 4XG6A 4CZYB 5E9EA 3BU5A 2XNGA 2RSVA 1KE7A 4LOQA 5I9YA 2ITWA 4JRNA 4RIXA 2BZKB 2VWXA 5CSVA 1V0OA 3BE9A 3GGFA 1OKVA 2AUHA 4U42A 1B6CB 2JDOA 3R7GA 5K0XA 5IQBA 4D0WA 5HG7A 4ENYA 1GY3A 4KUJA 3WIKA 3HMNA 3HP2A 2J5FA 3HX4A 2VWIA 3O7LB 4RQKA 3ATSA 5ETAA 2WNTA 5HLNA 4HNFA 5FQDC 1F5QA 3ZRLA 5AIRA 4X2JA 2E9UA 4F7NA 1YHVA 4CV9A 3EJ1A 5FD2A 3FDNA 5E8XA 2Y6MA 4F0IA 4BI2A 4CZUA 4D4VA 3Q4ZA 3UPZA 4BY9E 3EFKA 4CG9A 5CF6A 3NNXA 3R9OA 1ZZ2A 4CLJA 4D28A 4XRLA 2GTMA 1GAGA 4EJ7A 1ZYDA 2WFYA 1VJYA 3Q60A 3VHEA 4IZAA 4ZIMA 3QCYA 5E8VA 1BMKA 2C3JA 3NNUA 3U9NA 4E8AA 4BZDA 3MSSA 5AIKA 5KO1A 3PXQA 4MKCA 3FL4A 4RWLA 4F4PA 4ACMA 4FG8A 4QYFA 5HE2A 4CFFA 3A60A 2OBJA 3AT3A 5J8IA 1A9UA 3G9LX 2QLQA 4JDIA 5E7RA 2XKEA 4IXPA 3R8UA 2CCHA 3GUBA 2VTRA 3WARA 3BYOA 1W0XC 2A2AA 5EKNA 4O81A 4WNKA 4QMUA 2G01A 3QRKA 4PMPA 5E92A 2C4GA 3VS6A 2NO3A 4DH3A 1M17A 3KXNA 3PG3A 3EZVA 4FKPA 4AW0A 2A4LA 4IX3A 3CGFA 4FBXA 4OR5A 4PMMA 1U54B 2GS7A 5DGZA 3QRTA 4MXAA 5HG9A 3CY3A 1SNUA 2FVDA 2DS1A 4DG3E 4G3FA 3Q2JA 4HVGA 3UZPA 2RL5A 3PY3A 1J7UA 3LE6A 4GT5A 5AP3A 4K77A 4I3ZA 4M15A 2JBPA 3QA0A 2O65A 5FEEA 2W1CA 4H1MA 5HBEA 1ZAOA 3HMPA 4UN0C 3CKWA 2R64A 5GZ8A 3R7VA 3RPYA 4W9WA 4EQMA 5LVNA 4FSTA 4RC3A 2WU6A 4RVKA 4XMOA 5CT0A 5I9UA 4YPDA 3IQ7A 2WMWA 1PMEA 4ERKA 5AUUA 2C5NA 4LUEA 2YDJA 4K2RA 4FSYA 3PXFA 3ZSIA 3F9NA 2W1ZA 3WE8A 5HIBA 2W1FA 3EMGA 3OVVA 5DFPA 4AFJA 2XB7A 2X2LA 4CVAA 4YJPA 5KHXA 4QP2A 1TQMA 3LXKA 4KSPA 4JQEA 5M4IA 2JD5A 4ZTMA 1YI4A 4FZ7A 3A4PA 4AN2A 4G9RA 4S30A 2Z60A 3IECA 4ANQA 3TNQB 2PVNA 2CN8A 2W4OA 3ZLYA 3TIZA 5BMSA 1F0QA 2HZ4A 3QGWA 5BVFA 1OBDA 4DEAA 1MUOA 1OKWA 3PZHA 4V0GB 4G3CA 3O7LD 4U44A 4ACGA 1GOLA 1M7NA 3V5JA 3FV8A 3KF7A 1UU3A 2WO6A 4BFMA 5CVHA 3LFSA 4HPTE 1BI7A 2X6DA 2X6EA 3LXPA 3AD4A 1ZYLA 2VTLA 3CPCA 3I5ZA 4M0ZA 3UPXA 4BGQA 3F3ZA 5BUJA 3B2WA 3OT3A 1NT2A 2PPQA 4L42A 1MRVA 2GNIA 2GFSA 4DTKA 5KMMA 2WTWA 3V01A 4IWOA 5CSXA 2YERA 5EK7A 4YJTA 3R7YA 2KULA 3QZFA 4EHZA 4GUEA 4ITIA 2GCDA 3VC4A 1Q62A 1S9IA 2XIKA 3OCGA 2ZV7A 4C57A 5IQGA 4KBAA 4XCUA 1YI3A 3C4EA 4BKZA 4PP7A 3AG9A 2E2BA 2BAJA 5D12A 3GQIA 4FGBA 4EJNA 4ZEGA 3VUHA 4G31A 5ACBC 1XJDA 3KCKA 4XG3A 4FTOA 4WIHA 5IQHA 2XKFA 3AMBA 2ERZE 3VF8A 2JIUA 3NUXA 4JBVA 5TE0A 4FA2A 3VJNA 1NVSA 3NYOA 3LCKA 3M2WA 4GMYA 3G90X 4JX7A 4M97A 3ZLWA 4HGLA 4E4MA 5CU0A 2CNQA 3HMMA 3QAME 4UMRA 2Y7JA 1AQ1A 4XEYA 4AACA 5CAQA 4X3FB 1OPLA 3PA4A 2JAVA 4R6VA 1UV5A 3CBLA 1M2RA 3LZBA 2I0HA 2YCFA 3BYSA 3N4VA 5L2SA 3PVUA 1F3MC 3DFAA 4YC3A 3HV7A 3Q9XA 2YJRA 5CTPA 4ZJJA 3KCFA 3VS3A 3MDYA 4ZY5A 3DTWA 2QOFA 3CE3A 1FVVA 1JKSA 3RPOA 5CU6A 3D5VA 3TUCA 4QT1A 4M7IA 5L6WL 3C0IA 4PL4A 3P4KA 4FSWA 1Q8UA 2A27A 4LYNA 3R6XA 4M0YA 4RQVA 4YZBA 3U4UA 4YJOA 4D9TA 4GH2A 4FT3A 4C4JA 3MBLA 2OFVA 4GFGA 3U9CA 5AM6A 3PPJA 1FMOE 1M2PA 4Y5QA 3AQVA 5G1XA 4FSNA 2E9NA 4FV7A 4RLLA 3QXOA 5DPVA 4YR8A 5A4QA 3F2NA 5HO8A 4PPAA 5E8UA 3NYNA 5D11A 1J7IA 3NLBA 4OTHA 4AT5A 5IF1A 4CZTA 3R02A 3MVLA 3R8MA 5I5ZA 4CCBA 4BL1A 3AC8A 2BRNA 3NW6A 4EQCA 3KKVA 4NIFA 2PZYA 4IB3A 2ZV8A 4NIFB 3ZFMA 4BWPA 3Q9WA 3BELA 2OF4A 3MPMA 5HNGA 5K3YA 2ZMDA 3KK9A 3ZTXA 2J51A 2Y4IB 4RJ8A 4YJNA 4GV1A 4JAIA 2OKRA 3DT1A 4LQMA 3LFBA 3H0ZA 5LARA 4KIOA 5HGIA 2Z7RA 3DY7A 5CSHA 3ZM4A 4APPA 4OTQA 1PXLA 1V1KA 4KBCA 3FC1X 4AZEA 3FMLA 4LL0A 3I79A 2VTOA 4S33A 4W8EA 4PV0A 2YZAA 4HGSA 4D9UA 4YZMA 1BLXA 3R8LA 2G9XA 4LL5A 2GNFA 2Z8CA 2PVHA 5J9YA 3Q52A 3WF5A 3LQ8A 4KA3A 2VWBA 3DK3A 3PPZA 3QUDA 4GT3A 4FKWA 4M69B 4C36A 3L8PA 5CT7A 4BCOA 4EOQA 3BQCA 2ACXA 3NWWA 4NEUA 3IW7A 5CEPA 1SVGA 3NEWA 4RSSA 4AAAA 3GNIB 3UODA 1FQ1B 2XCHA 3ORLA 4UMQA 4MNEB 3GCVA 4G16A 4Q9SA 3W16A 2WTCA 1PYXA 5HNBA 2W4JA 1PHKA 4YTHA 4F6SA 3EL7A 4FTMA 3CD3A 2HZIA 4NT4A 4JJRA 2E9OA 3ULZA 3C4FA 2CNVA 3CGOA 1XH8A 3MESA 1OUKA 2JC6A 3S4QA 5AEPA 5IQDA 2ZMCA 3OT8A 2FSMX 4TNBA 3E62A 1UU7A 4FKLA 2B7AA 5AM7A 1V0PA 3EKNA 5C8MA 2I7QA 4X7QA 5CI6A 1A48A 2Q0BA 3RALA 4PMTA 4BDJA 3AC5A 2WMTA 1OMWA 2YCRA 3O96A 3PA5A 1NY3A 3MY0A 3O8TA 3QRIA 4FV9A 5LMAA 4ARKA 4YZDA 4B7TA 4BKYA 4FV8A 4F99A 5JFSA 5C4LA 2ETRA 4ALUA 5AA9A 1NVRA 3RPSA 4F7LA 2EB3A 4IDVA 2VTSA 3UOLA 5A9UA 3E8NA 4C38A 1W7HA 4C35A 4XG2A 3S00A 4QTAA 2WMXA 5CANA 3KRXA 4N0SA 4GYGA 2VTHA 3MS9A 5HTCA 3A7JA 3D15A 3EZRA 3FZSA 4TWNA 5HCXA 1M52A 3CXWA 4W4WA 4MNFA 2GQSA 4FMQA 4Y72A 4QYHA 4HYSA 1J1BA 1PKGA 3LCTA 2YLFA 3NDMA 2IVSA 4B8MA 1J1CA 4QP6A 5IISA 3FMJA 2Z7LA 3ZO1A 3PRIA 3JS2A 4DGOA 3ZDIA 4ERWA 5AUXA 3DA6A 1WVWA 2ERKA 4I23A 1H07A 1YI6A 4G6OA 4ZTLA 3GCQA 1W84A 4GFMA 3E92A 4QMTA 3T8OA 2OFUA 2IWIA 2UZBA 4FSRA 3RBWA 4X3JA 3ZH8A 1KE6A 4NM5A 2X9FA 4LMUA 2BVAA 1BI8A 3AOXA 2J5EA 4AX8A 4XV1A 5E8SA 4WRSA 3OBJA 3TZ9A 3QC4A 1OL7A 3QTRA 5AP7A 4DT8A 4CFXA 4CYIA 3LJ1A 3GFEA 4OTFA 3UO5A 1U54A 2P0CA 4RVLA 5KMOA 4BCFA 1LPUA 3RVGA 2WTKB 3I6WA 3PJ1A 4Z7HA 3DB6A 5FBOA 3ZEWA 4RMZA 5BVEA 3RGFA 3G6GA 4XG4A 5KUPA 3D83A 4GK3A 3V5LA 2UZUE 3EFWA 2C6LA 4CT2A 2R9SA 3ZZWA 2ZV9A 5D41A 4FKIA 4MF1A 5IEXA 1LR4A 3WYXA 3ROCA 2HENA 1OKZA 3NAXA 5TT7A 4WSYA 4UMUA 1OPKA 1ZYCA 2C6TA 4BZNA 2VWVA 1ZOEA 2W0JA 3KN5A 4EHGA 4R5YA 4TYHB 4FEQA 3FBVA 3MFTA 2C0OA 1JKKA 5AX3A 3R7UA 4O86A 4Y95A 2HWPA 4YO4A 4WSQA 5I9ZA 3JPVA 5E1EA 4M66A 3DAEA 2QG5A 3LQ5A 2YIXA 2UW7A 2XIXA 2YIQA 4I93A 4UMTA 4AA0A 1KOAA 3L1SA 4QMSA 4AE6A 4BCIA 4ZTQA 3H9FA 4BIDA 2ITVA 2P4IA 3IDPA 3OG7A 1W82A 3QTSA 3C5UA 3BZ3A 2WGJA 3GVUA 5JZNA 5EDPA 3PSDA 5B2LA 5EYMA 4R77A 4ZOGA 2OG8A 1IAHA 1YDRE 3HV5A 4ASDA 2YIWA 3QRJA 4JBQA 4PUZA 4NTSA 1REKA 2WQBA 3RK5A 5JT2A 4XX9A 4XLVA 3EOCA 4YTIA 4Y46A 2WTJA 3Q4TA 4ZK5A 4BYJA 4O83A 4L8MA 3SA0A 1Q8WA 3L8SA 3V5QA 5DOSA 5KMJA 3TKUA 2BAQA 5E91A 4F1OA 5A3XA 2JFMA 5J1VA 5LMKC 2VX0A 4L9IA 2B9JA 5CASA 5HLWA 2GS6A 4HJOA 4E4NA 1YDTE 3EB0A 4EOSA 2Z02A 2UVXA 5IUGA 5M4CA 5HZNA 2HZNA 4AE9A 4L43A 4DF3A 3ZOSA 3FLYA 3HDMA 3F6XA 2OXDA 3E88A 3MJ1A 4IM2A 3PXKA 3DBFA 4C58A 3R21A 2XK3A 4AWIA 3QRUA 2V7OA 4PY1A 2JIIA 3NMUF 3Q5IA 3QQJA 5CEMA 4C2WA 4GU6A 4AA5A 2B55A 4Y83A 4F7JA 4I6FA 4E3CA 3TXOA 4IAAA 3DJ5A 2HK5A 3PSCA 2OIDA 4CTCA 5T6KA 3UG2A 1ZYSA 4A4OA 5KKRC 4K6ZA 4LG4A 1TVOA 1LP4A 3FKLA 3N9XA 2PYWA 3O51A 5JGDA 4D5HA 3F3UA 4LRMA 1WBWA 2ZM1A 2ZAZA 1NA7A 1P4FA 3NUPA 3ITZA 4J98A 3QHWA 4BDEA 5F94A 3ETAA 1Q5KA 3BHYA 3KY2A 3E7VA 3KFAA 5E8WA 4HVSA 4TW9A 3FMEA 4FYOA 1HCKA 1H8FA 4P7EA 5IA5A 5LVOA 1J3HA 2UW5A 2CLXA 4HYHA 4IE9A 2BIKB 3QD4A 4RX7A 4U80A 1APME 3E8DA 3GU7A 2GSFA 1P5EA 3MH3A 3QKKA 4IDTA 4F6UA 4BBEA 3I0OA 3IW4A 2ITPA 4ZZOA 1CKJA 3SV0A 5G6VA 2WIPA 4M8TA 4YNOA 4GL9A 3ROYA 3R9NA 2J4ZA 3I6UA 4BKJA 2NP8A 4CEGA 4ALVA 2EU9A 2VNWA 2QHNA 5IQAA 3G9NA 5CEKA 1FGIA 4C37A 3DU8A 1E1XA 1OM1A 3V51A 3FXZA 1YWRA 2BFYA 4XV3A 5FBNC 2VAGA 2IZUA 5TKDA 3CEKA 3VQUA 2WAJA 3ODYX 4BCGA 3E5AA 3B2TA 3FY0A 5LWNA 4F7SA 4F0GA 3RJCA 3F88A 2R4BA 1V0BA 2VRXA 3OCTA 5DE2A 5AFVA 1AD5A 2OJJA 3AC4A 1TKIA 5AUYA 2C0TA 4I5CA 4EL9A 5CI7A 3EFJA 3OP5A 3JVRA 4TXCA 3ERKA 4M3QA 5EQPA 2VV9A 4R1YA 3E93A 5M56A 3HYHA 2OU7A 4IZYA 5D7AA 1H08A 1Y6AA 4DEHA 5A4CA 2BRHA 3ALNA 3EKKA 2W05A 4QMYA 4O2PA 2RG5A 5IMEA 4JDJA 2BHHA 4ITHA 1YOMA 3CCNA 3KB7A 1RE8A 2JFLA 3FMNA 4BTJA 4C4EA 5HU9A 5AP4A 3QHRA 5L2TA 3IG7A 5A4EA 2R3IA 3SOCA 5JRQA 2F7XE 3PP0A 1BL7A 2C6OA 3UDBA 4HCUA 5EQYA 4GRBA 3NYXA 4FG7A 4O22A 1H1SA 5FGKA 1GIJA 3E8EA 4LV8A 3CQEA 4QPSA 4XS2A 4FEUA 4K8AA 4C3FA 4G9CA 4XJ0A 3ZBXA 2VD5A 4O0WA 4NH1A 4OLIA 2XRWA 2YM6A 2CGXA 3I0QA 3QD2B 1JOWB 5FRIA 2UVZA 3QL8A 1PMVA 4FKSA 5K4JA 5CVFA 3PVGA 5IUIA 3DCVA 3Q53A 4D5KA 2J0KA 2V0DA 2Z7QA 1JBPE 5AR8A 1UVRA 3OZ6A 5HVYA 3VVHA 3MPTA 4I6HA 2OIBA 4D2PA 5AUZA 4V05A 2CGWA 3MW1A 3W32A 3DFCB 3NUNA 2VTTA 4MYGA 3NGAA 4F08A 4ZLZA 5EW9A 4GG7A 4XOZA 1SNXA 2W1IA 4LRKA 2R3QA 3ELJA 1H4LA 3TV4A 3ZUVA 4K11A 4YBJA 5FXRA 2WTVA 2J6MA 4CKJA 2QOCA 3MJ2A 4U8ZA 2PUUA 5HO7A 5BYZA 3OWPA 5IH6A 4IEBA 1T46A 4MQ2A 4DGMA 3EYHA 5I3RA 3P86A 4PF4A 5IQEA 1XBCA 1Y8YA 5DEWA 5KMNA 4CQEA 1H0VA 3KXMA 3AGMA 3ZUUA 1U59A 4YJVA 4F9AA 5K9IA 2W5BA 1CSNA 3LAUA 4TWPA 5HG5A 4BWXA 4EOOA 4JXFA 2NRUA 2QOLA 4BDKA 2PMNX 2PZPA 2YWVA 3SXFA 5JFXA 4FV3A 2WMAA 1XH6A 3HDNA 3UE4A 3PJ8A 4U3YA 2OIQA 5DR2A 1JKLA 4O7TA 2OJFE 4KIKA 4YJQA 3NVKI 4QMWA 3VF9A 4KKGA 3BHVA 2CGUA 4F9BA 2BFXA 4O84A 5CU3A 4MBJA 3EN6A 3EQIA 5BPYA 3F7ZA 2XK9A 2CKEA 4FV4A 4FUYA 4AW5A 2VU3A 2G15A 2EB2A 3CQWA 3QZHA 4CG8A 1OL1A 4J8NA 4FK3A 3TZMA 4C4HA 4QQ5A 2XYNA 4O82A 1TQIA 4DEGA 1Q8YA 4D2WA 3LFNA 1URCA 5I9VA 5IDPA 2RFDA 4PP9A 2O8YA 3KXZA 1WBPA 3F7WA 4U81A 3EN5A 3FZ1A 5IH4A 3A8XA 3U51A 1FVRA 4QD6A 3ZMMA 4Z55A 2I40A 4L53A 4EC8A 4AN9A 4G3EA 4I5HA 3B8QA 5AP6A 3OC1A 3TN8A 5E4HA 3CJGA 3PVBA 4E6DA 2VTJA 4ENXA 1SZMA 5A4TA 4DHFA 4NCTA 4YU2A 4KIQA 3V8TA 2ZOQA 3Q4UA 4FSUA 1H1RA 2XA4A 4AZSA 4KRCA 5FEDA 5JSMA 4RG0A 4FX3A 3DZQA 2OI4X 2O64A 2WMBA 4RIOA 3LFFA 1U5RA 3IW8A 2BILB 2JAMA 4EKKA 3C0HA 3QTWA 5IKWA 1OITA 4KSQA 2PHKA 5IQIA 3CPBA 5CAVA 5DWRA 5CZIA 4AGUA 1Q8TA 4RIYB 5M57A 3AT2A 4UYAA 4X2NA 3P7AA 3RWPA 5IQCA 2WIHA 3E63A 2YFXA 3K3JA 3OY3A 4J97A 4IJ9A 5E8ZA 3UC3A 5C01A 3WF9A 1MRYA 4EOJA 4U7ZA 4QMLA 3UMWA 3HEGA 2WU7A 4QP7A 5JGBA 4FEWA 3LFDA 4JG6A 1H1QA 3JYAA 4BDHA 3FSFA 3ANRA 3LCSA 3QA8A 5LVLA 2IG7A 4HCVA 2WQOA 5DIAA 5DI1A 1Z9XA 3ZEPA 5EDQA 3UOJA 3N4UA 4XRJA 3CS9A 4Q2AA 3ULIA 4UZDA 4E4XA 3EN4A 1XBAA 1XH7A 1Q61A 3GBZA 3HLLA 4IMYA 4EWHA 4QMZA 2IW9A 1OB3A 3TNPC 5DR6A 3D2KA 4R8QA 2GHGA 4O7VA 5HTIA 4EH7A 3COMA 3FKNA 4UY9A 3SVVA 2FH9A 2QLUA 1SYKA 3MYGA 4IX5A 4ZTSA 1UKHA 3EH9A 4CRLA 4WG3A 4O0YA 2UW0A 3KRRA 4FE2A 2PE1A 4FTIA 4XH6A 4CMOA 4L00A 2CNUA 3DTCA 5L6OA 2OZOA 4ASXA 4BRXA 4CV8A 4O2ZA 4JIKA 3PFQA 5GHVA 3F5UA 4FIEA 4CMTA 2XUUA 2WB8A 3F69A 1IA8A 4HYIA 4TWOA 1ND4A 3F3TA 1P14A 2JKKA 4BBMA 5GIOE 1OECA 2FSTX 4JI9A 4WG5A 3O23A 4EH3A 4ONAA 4EONA 3SRVA 2WZJA 2OZAB 4MX9A 4C3RA 4TYHA 5BX0A 4DFNA 2ITZA 4O7YA 4RA5A 2OJIA 2Y4IC 3BI6A 3QZGA 1VR2A 4IZ7A 4QRCA 3SAYA 3UMXA 5KBRA 4PTCA 3HAMA 1SM2A 4ZXTA 3IDCA 1ZY4A 3DAJA 3U6IA 4JX3A 2CHLA 4O27B 2B4SB 3NUUA 4ZTHA 2HELA 4F70A 4EUUA 2XK8A 3BGZA 3NSZA 2XBJA 3BGQA 3AC1A 4I6BA 5HICA 2BRBA 5JRSA 5HESA 2V7AA 3OTUA 1G8SA 5ANJA 4ID7A 3BU6A 3NCGA 4GEOA 2BZJA 3V5PA 3QQHA 4FIGA 5HE1A 5ITAA 2XEZA 3QCXA 1I09A 2Y9QA 1O6KA 3BLRA 2JEDA 1AGWA 2QOHA 1CKIA 3FHIA 3MY5A 3U55A 4FIJA 3BBWA 5FDXA 4RVTA 4U5JA 4GIHA 3W8QA 4FF8A 4OGRA 1Q3DA 4QTBA 1ZRZA 3DOGA 3D5WA 2BTSA 3BYMA 4M68A 3VAPA 3OW3A 4F65A 3NPCA 5CX9A 3FLSA 4QP9A 2UW8A 3CP9A 3MTFA 5EYKA 2Y6OA 3SW4A 3UQFA 5C1QB 4C59A 4WKQA 3OY1A 2XS0A 1DI8A 2PMIA 4IVDA 4TZRA 2PE2A 2IO6A 5CSWA 4DLIA 4FK6A 3G0EA 2QHMA 4LOPA 3L8VA 5CQWA 3WZEA 1UNLA 4RA4A 2ESMA 3QFVA 5J79A 1OIYA 2CMWA 3SOAA 5FLFA 2HW6A 4I92A 4PDPA 5ANIA 3K5UA 4BGHA 5HE3A 3UIBA 3UQCA 4E4LA 2P33A 1K2PA 4MK0A 4BDBA 4EKLA 2EVAA 3F5GA 2P2HA 4FKRA 5CEQA 3D5UA 5ANOA 3OS3A 2XH5A 4PNIA 1WMKA 4B99A 2J50A 3L9NA 4AW2A 4D4SA 5JFWA 2YZLA 3WF6A 2WMQA 2J0JA 5AR7A 3UIUA 4GS6A 2R3HA 2W1GA 4ZSAA 3NUAA 1KE9A 1IAJA 2EXEA 5J5SA 3EIDA 4U40A 1KWPA 2WMSA 4Z16A 3LIJA 4W4XA 1Q41A 4JBPA 2PSQA 4R3PA 5ICPA 3PLAE 2XK4A 4DGGA 4I6QA 5IA3A 5ETFA 4PDOA 4EK8A 5LVPA 3DDQA 4FIIA 3MFRA 4RT7A 4WD5A 3TCPA 3KULA 2FO0A 4FNXA 4AU8A 3C0GA 3ZU7A 3S0OA 1S9JA 4FVQA 3UYTA 4FKUA 3QTXA 3OOMA 5IA2A 2P3GX 3FQEA 3P1AA 4QP8A 4FL2A 4BVUA 4E7WA 2RF9A 4FOBA 1OZ1A 1LEZA 2XM8A 3FMDA 1W83A 3HAVA 5J5TA 4G2FA 2WMRA 3C4ZA 3MA3A 2R3OA 4JVGA 5F1ZA 5EG3A 3TZ7A 5DVRA 1PW2A 2E9VA 3VUIA 2OWBA 2IVUA 5CLPA 2QNJA 3R8VA 4M69A 4U0IA 4EI4A 4AZTA 2FYSA 3AT4A 4OT6A 3A7GA 5M4UA 4MH7A 3PLSA 4B6LA 4F1MA 3QWKA 3P5KA 2JDSA 4FKGA 3FMHA 2QOQA 3OEZA 5KBQA 5EM6A 1O6YA 3POZA 3W33A 1QPEA 2R3KA 4FTLA 4G1WA 5HKMA 4Q5EA 4Y8DA 3Q6WA 4BBFA 4C4FA 2GDOA 3NS9A 5KMIA 4JAJA 1JAMA 3NR9A 5CVGA 3IW6A 1PKDA 1YOLA 4J1RA 4MNEA 4B4LA 3GOPA 3DLSA 5H2UA 4JG7A 3VBWA 3LM5A 4X2GA 4EH2A 4OBOA 3VUGA 1XH5A 4U41A 5AADA 3SD0A 3H10A 4IIRA 4U97A 2V55A 1R78A 3OTVA 4CKRA 2GNGA 1GZ8A 1QMZA 4OTPA 2IW8A 1YWNA 4WNPA 2QO7A 1RW8A 3BWJA 4ZZMA 3PIXA 5C9CA 3KVWA 3T3UA 4IFGA 3EQPA 3H9OA 4FTRA 3FLWA 4YZCA 1ZARA 3FI3A 4QNYA 1PXOA 3E64A 4NCTC 5KX8A 3VIDA 4FIFA 3K54A 2W96B 2C6KA 2DQ7X 4RWJA 4IFCA 5AV3A 3LCDA 4TRLA 3HRCA 2WHBA 5A14A 1RJBA 3V5TA 4DG0E 4F63A 3ACKA 4YJUA 5B2MA 4BDIA 4ZAUA 4TNDA 3PSBA 3LFQA 3RAWA 5AR5A 2BR1A 3BYUA 4J71A 3A4OX 3COHA 3RHXA 3GC0A 1E1VA 5TO8A 5JH6A 1PY5A 5T68A 2F4JA 4FGRA 4GKIA 2GU8A 4RJ5A 3RCDA 4I5MA 3ZFYA 4HGEA 3TUBA 4O7ZA 4IB1A 4ZTNA 1SVHA 4CKIA 3RZBA 3EQRA 4CT1A 5J7HA 4EK5A 2F9GA 3NAYA 4FZFB 2J0MB 1XR1A 3DNDA 2C6DA 3QYWA 4IM0A 2CJMA 3MA6A 4WNMA 2CGVA 4QYGA 3ZYAA 4TPTA 4L3LA 4JDHA 3HECA 4PPCA 2GQRA 1OIRA 4DTAA 3Q5ZA 3E8CA 4MQ1A 3GCPA 3LFCA 4TYJA 4WA9A 4Y73A 4NUSA 5L2QA 1CMKE 2R3FA 2BROA 4BCJA 1BX6A 5AR2A 4XG9A 3QX2A 1Q8ZA 4X2FA 3R2BA 5DT0A 5A4LA 5A54A 4OAUC 2A0CX 2VX3A 4JRVA 4N6YA 3GEQA 5IQFA 1Y8GA 4YLLA 4C3PA 3UP2A 3OD6X 4MHAA 5AA8A 4XNEA 3WILA 3GP0A 3WZKA 3BYVA 3Q3BA 3PXRA 5AV0A 1NVQA 4DCAA 5HVKA 3DKCA 5HVJA 2BTRA 4HPUE 3BEAA 5BYLA 2YIYA 5GIPE 2QR8A 2WPAA 5LCKA 5H9BA 4E93A 2OLCA 3HA8A 1YQJA 4M84A 2X0GA 3EQDA 3GU6A 1JPAA 3EYGA 4UXLA 2HWOA 5CENA 3TACA 4C8BA 4GK4A 1CM8A 1JWHA 3ORMA 3DDPA 4YC8A 4H3PA 4ACCA 2ONLC 5HLPA 5F4NA 4DFUA 5FTOA 5TF9A 4MXCA 3QGYA 3CTJA 3LLAA 4QMMA 1JVPP 2C6IA 2XNOA 2J2IB 3ZHPC 3ZO3A 4RVMA 3A99A 3HV4A 4O0UA 3LFEA 4MXOA 2NRYA 4W9XA 4BI1A 5M06A 4MF0A 4FTQA 5CNNA 1YXVA 3HNGA 5IG1A 4BTMA 2J90A 4FI1A 4IACA 5GZAA 1VZOA 3HRBA 4UWYA 5CAUA 4A4LA 4E26A 3UP7A 3I60A 3QQLA 4KBKA 4YP8A 4AP7A 2GHMA 4C34A 3C9WA 2B53A 2WKMA 4QQCA 4BDGA 3F3WA 4DEIA 2QOIA 4FTKA 4TL0A 2RG6A 4LV5A 3RCJA 1XQZA 4O1OA 5TR6A 4JR7A 2F2UA 2PMOX 3ZXZA 3ZBFA 4F09A 1PMUA 2YIRA 3KRWA 3O0GA 5HEZA 4UMPA 3JVSA 1YWVA 4TY1A 3SDJA 2UZLA 2G2IA 3NRMA 4JDKA 3MI9A 3NNWA 2R2PA 3NUSA 4IWPA 3VBXA 4ANMA 5H8GA 2HY81 3JUHA 1LUFA 4FVPA 3IPHA 1JSTA 3VWAA 2QR7A 5HNIX 4F9YA 2Z7SA 3BRBA 4IAIA 3FXXA 3FZOA 1UKIA 3HVCA 4QP1A 2EUFB 4ZSEA 5TOZA 3HZTA 4BR3A 5EM8A 2C69A 4CD0A 3F2AA 3NUYA 3I7CA 3QC9A 4JG8A 4O96A 4AF3A 1XH4A 4QMQA 3SW7A 2YAAA 4AT3A 2XK6A 3F61A 2QO9A 3TV6A 3FKOA 2BDWA 1YXTA 3PUPA 3KL8A 3TT0A 4FL3A 4FKVA 3EWHA 4JOAA 5IH5A 5E8TA 2R0IA 4JQ8A 3ZRKA 3VN9A 3LCOA 3MWUA 4PTEA 3VUMA 3WZUA 2UZWE 4P2KA 5A6NA 3SG8A 2IVTA 3KU2A 3QQFA 3KRJA 3IONA 2DYLA 5B0XA 4BCQA 4LOOA 1DS5A 1H26A 4FTJA 3C4XA 4RPVA 2CKOA 4RGJA 5L3AA 1CKPA 4U45A 2XBAA 3S1HA 3LVPA 2A1AB 4LGGA 2BDFA 4ZMEA 3FMKA 4GT4A 4AGDA 5EM5A 3QLGA 3RK9A 1RQQA 1U46A 4DFZE 4B8LA 5CXZA 2W17A 4QQTA 1QPCA 2W99B 4YLJA 4LM5A 4YZNA 1G3NA 5JMSA 4P5QA 2QODA 4QPAA 2WXVA 3DNEA 1PMNA 3CTQA 3JY0A 2HYYA 1ZXEA 1KV2A 2PMLX 4FKQA 5M4FA 4BGGA 4IAZA 3RP9A 2PUNA 3C4CA 2B9IA 5JKGA 4IAKA 3R28A 2YM5A 5IUHA 5CY3A 3ZC5A 3H3CA 2I6LA 3PXYA 2OGVA 3G15A 3MVMA 2REIA 4O7WA 2ETKA 3VUTA 3FAAA 3V8WA 5M55A 5IPJA 3KREA 4WUAA 5CEIA 3R8ZA 3WF8A 5A6OA 5HHWA 1GIHA 1ZMVA 1DAYA 4FZAB 2ZVAA 4FV2A 4L45A 1XO2B 2XCKA 5H3QA 3DK6A 3VO3A 4KWPA 2LGCA 2R3PA 2WEVA 4O21A 1VEBA 3M11A 4IX6A 4XP3A 2X7FA 2XZSA 3D4QA 2XNMA 4CQGA 2YA9A 4KS7A 5HU3A 2W4KA 5DG5A 5HG8A 2DWBA 3IDBA 2YCSA 4RIXB 5JK3A 2WOUA 2YEXA 4S2ZA 3V8SA 3D7ZA 5JQ5A 1OUYA 2R3LA 1JLUE 1REJA 1P2AA 2C1BA 3IOPA 5DR9A 5AAFA 4RFYA 1ZZLA 4FKOA 5A46A 5BUIA 2GQGA 2W1HA 1U5QA 5BVWA 1YW2A 2O3PA 3UVPA 1Q99A 2Z2WA 4ZSJA 3RM6A 4FR4A 3FC2A 4FTAA 3GC9A 4DFLA 5HO6A 5H8BA 3SLSA 4G3DA 4X2KA 3HA6A 1WVYA 4IWQA 2GPHA 4PTGA 2VTAA 1M14A 3MIYA 3K2LA 3I5NA 3NYVA 4J52A 4MWIA 3R7IA 4EQUA 1H25A 3C1XA 3Q32A 4AS0A 2C3LA 3LJ2A 4F9CA 3AD5A 3W8LA 3UIXA 4CLIA 4I94A 3S2PA 3VW8A 4FYNA 3TJCA 5KZIA 3LFAA 5EI2A 5FDPA 5HCYA 3TZ8A 1ZY5A 2P55A 3GQLA 5ACKA 2YDIA 2B52A 5AMNA 3W2RA 4YUQA 4ORKA 4RX9A 3O8PA 4IANA 5EOLA 3FZRA 4BC6A 1FPUA 1YOJA 2B1PA 2PZRA 3R1NA 4FKJA 3PDTA 5DMZA 3DBQA 4MBLA 3DS6A 3RMFA 4ZJIA 5IU2A 3R1YA 4BICA 4CYJA 3HL7A 4Z7GA 4DAWA 4GVAA 4MXXA 1GZOA 3QTQA 3LMGA 5JQ8A 4EYJA 4NTTA 1URWA 4AGCA 3O17A 5FXQA 3W2PA 3FPQA 3R22A 3R71A 4FL1A 2IVVA 3C4WA 2OXXA 4II5A 4ZS4A 2PVLA 5IEVA 1H1PA 4WBOA 4NJDA 1NW1A 2G2FA 4BTFA 1NXKA 2UZTA 4DEEA 3AC3A 2ITOA 4PQNA 2ITQA 4H05A 4ITJA 4JR3A 4BTKA 3MFUA 5JFVA 4NM3A 2ZYBA 1JKTA 5IZFA 3OWKA 3PZEA 2UZNA 4XUFA 5IDNA 4YSMA 3TDWA 4O91A 4FT9A 4IVBA 4I1ZA 2XJ1A 3GCUA 4RJ7A 2IJMA 3UO4A 1Q24A 3I1AA 3VS0A 2HY0A 4RC2A 1JNKA 3ZZEA 1Y6BA 3OMVA 5CYIA 2R3RA 3H4JA 3NX8A 1PXKA 4RFZA 4DFXE 4DC2A 3UVQA 4JQ7A 5CEOA 5LCJA 2OF2A 3QQGA 4UZHA 3FL5A 4DITA 3TV7A 3NNVA 3P9JA 1FINA 4NKAA 4CNHA 2HZ0A 3WZDA 5J7BA 4DTBA 3LXLA 3ZDUA 3V6SA 5GJDA 3KC3A 1Y91A 2XNNA 5E8YA 4HCTA 1PF8A 2IZRA 3C7QA 3TL8A 2PULA 1L3RE 2PK9A 1FBNA 1R3CA 1RDQE 3FLNC 3FWQA 4NM0A 3G5DA 4RZVA 2YN8A 3DAKA 4TT7A 2OH0E 2YISA 3W2QA 4BWKA 1YHWA 3E3BX 4J53A 4IJPA 3BE2A 4X3FA 5C26A 4U9AA 5D7VA 1IA9A 1OVEA 5FM2A 3ORPA 2OSCA 4I20A 3R1QA 3UGCA 5BQ0A 3QKMA 3E87A 4UV0A 2XK7A 3RNIA 5HD7A 3OCBA 4F6WA 4IM3A 4K33A 3I4BA 3LJ0A 4LFIA 4ACHA 3EN7A 3QF9A 5FUTA 2F2CB 3DV3A 4EC9A 5LQFA 1YVJA 3KK8A 4BHZA 3FE3A 3ZONA 1K3AA 2WTDA 3ATTA 4HYUA 5L4QA 5L6PA 2CKPA 1UNHA 3ODZX 4KINA 4R7BA 5EFQA 4G34A 3HMIA 4FT5A 4X6RA 5EH0A 5FP6A 4ZY6A 2CKQA 1KOBA 2YAKA 5ETCA 5JN2A 1H00A 2WOTA 5EDRA 2C6EA 2VGOA 5CF8A 3QQUA 2I0VA 4UB7A 1QCFA 2WQNA 5DRDA 5FP5A 4XG8A 2X8DA 2LAVA 5FWKK 4ASZA 4FUXA 3VW6A 5BVOA 2VTQA 2XIRA 3VS4A 2GTNA 4DH7A 2XP2A 2C5XA 2UW9A 5DNRA 4FV0A 2X81A 3NVMB 3BV3A 3TG1A 3UOHA 3A7FA 2O63A 3E7OA 1GJOA 2YHVA 3A7IA 3ZC6A 4D0XA 2W5HA 3KMWA 4ALWA 3C50A 3LQ3A 3IS5A 3M42A 3DBEA 5D9HA 2YWPA 3KMUA 4DA5A 2C3IB 5M09A 4IZ5A 5M08A 5ETIA 3ORNA 3QALE 4KRDA 4QTEA 5GZ9A 4USEA 4OAVB 1R0EA 3CIKA 4RX8A 3QD0A 1OGUA 4WO5A 4EOIA 4WUNA 3LKMA 2QKWB 4C2VA 4XP0A 4EHVA 4AW1A 1QL6A 1KE5A 4I0SA 4L44A 2OH4A 4D1ZA 2CCIA 3K5VA 4O6EA 4J8MA 3ORXA 4K1BA 1IASA 4GJ3A 3RZFA 4YMJA 1IRKA 5KCVA 3GB2A 3QLFA 2R3NA 3HMOA 4I0RA 4OBPA 3DBDA 5AP2A 5LJJA 4EHEA 2CLQA 4BCHA 3QXPA 4N4SA 5GNKA 3UVRA 2C5VA 4P5ZA 2C6MA 4ANBA 4AXAA 5AJQA 2C5YA 1OL2A 1Z57A 4O7LA 4RC4A 4G5PA 4DE4A 2XKDA 2XKCA 5DEYA 3FI4A 4XV9A 4QYEA 4I4FA 2F49A 3ACJA 3BEGA 5HQ0A 4L3JA 2E9PA 4OTDA 4W4VA 2UVYA 2XF0A 4E20A 3OHTA 2P2IA 4A9RA 1MQBA 3UOKA 4U3ZA 1YXSA 1LEWA 5CS6A 3TUDA 2YACA 5AUVA 4C7TA 4QMNA 3VUKA 2X8IA 5CALA 5E90A 3CQUA 3CY2A 2VN9A 4DFBA 4BDCA 2VTMA 4RIWA 5HI2A 4P4CA 4O0TA 4D2VA 2IZSA 3VBVA 4QPMA 2V62A 4TYEA 3Q4CA 3FI8A 3ET7A 3HV6A 3GU4A 4GCJA 4TN6A 3F5XA 3QWJA 4UWCA 2QURA 4I4EA 5DLSA 4EUTA 3UTOA 3MPAA 3G51A 4EOPA 2BDJA 2IN6A 3OUNB 2HXQA 5K0KA 3QD3A 4QNAA 1Q97A 4GKHA 2EXCX 4DYMA 3EN9A 1XWSA 4X3FC 4BZOA 5KNJA 4FTCA 5L2IA 2WELA 3D0EA 4IC8A 5HCZA 2QONA 2V22A 4QMOA 1IG1A 4O6LA 5DHJA 3I81A 3O8UA 4LRJA 3RINA 3PP1A 3BCEA 3EQHA 3GU5A 2VWZA 2WTKC 4JT3A 5HTBA 3GXLA 3DKGA 2OXYA 3QBNA 1SMHA 3BHTA 3FZPA 3LM0A 3L8XA 4EH5A 1EH4A 2XJ2A 5CU4A 5CZHA 3S95A 3WBLA 4DFYA 3QUPA 4BHNA 1ZWSA 3QCSA 2H8HA 2O5KA 4AG8A 4USFA 3KN6A 3HUCA 1UNGA 4ACDA 3H0YA 4GW8A 5H8EA 3SRVB 3P78A 4V01A 4MD7E 4FOCA 1W8CA 2YDKA 2QOOA 3QCQA 2ETMA 5L8KA 4M14A 3TKIA 2RFEA 4I24A 3MN3A 1BUHA 1H28A 1OL6A 4YTFA 2QOKA 2HXLA 2PWLA 3OCSA 3DLZA 3A7HA 4C61A 2CSNA 2H34A 3KXHA 4J95A 3R7EA 1MRUA 4YSJA 2OJGA 1GZKA 1GZNA 3AXWA 1JSVA 5DT3A 5ANKA 1PRYA 3MH2A 2PUPA 5KMKA 3C5IA 3FEGA 4DH5A 4FV6A 1OKYA 5EYDA 3BGPA 2XMYA 5FXSA 4BCKA 3P7CA 3ZS5A 5CF4A 1WBTA 3GOKA 4AOTA 3GU8A 4AZFA 2ZV2A 2FB8A 4WRGA 2UUEA 2ZM4A 5EYCA 4PRJA 3RWQA 4O7SA 2AC3A 2BRMA 3AC2A 2WMUA 2X4FA 3GC7A 4XV2A 3HP5A 3KMMA 2XNPA 3B8RA 3FPMA 4S34A 3BLHA 4FG9A 2OO8X 3OFMA 2RFNA 3CJFA 3PE1A 5J9LA 4GJ2A 2QKRA 2QU5A 5LVMA 3R0TA 2Y8OA 3UC4A 3HRFA 4RBLA 3NIZA 3ZUTA 3KXGA 3QZIA 5KKRB 3KA0A 3P79A 3GFWA 4IVAA 3VHKA 2X9EA 3MVHA 3RKBA 4NWMA 3CD8A 2XJ0A 2QVSE 4MTAA 1HOWA 3MFSA 4R7IA 3BV2A 1MP8A 4GUBA 5T3QA 3WYYA 4C0TA 5CSPA 4H3QA 2XIZA 1WAKA 1SVEA 4NZWB 3G0FA 4H36A 4ZTRA 2WMVA 4AZVA 3V5WA 4GU9A 4O0RA 4A9TA 5DRBA 1WZYA 3MB7A 3MY1A 4MXYA 2YM7A 1H01A 3BU3A 4QYYA 2PY3A 3O2MA 3PJCA 3WF7A 4CXAA 3U6HA 1E9HA 4FSMA 5AAEA 2B0QA 2W5AA 4EBWA 3COKA 4WHZA 1Y57A 3F2RA 2B9FA 2BHEA 2W9FB 3Q04A 5EM7A 1FOTA 4W4YA 4WG4A 4D4RA 3PG1A 5BVNA 2UW3A 3LHJA 3DZOA 3TDVA 4ZMFA 3L9PA 2F57A 3O71A 4DBXA 2VX1A 2XIYA 1B39A 4FIHA 5E1SA 1BKXA 3A61A 3VUDA 3U54A 4O0SA 4YURA 3G33A 3KF4A 4S31A 5F95A 4NYEA 1OIUA 2UZEA 4ZLOA 3PY1A 3BPRA 5K5NA 4MXZA 1X8BA 4FV1A 3MB6A 3RHKA 4I22A 4NJ3A 4QP4A 4QMXA 4R1VA 3TKHA 5CXHA 2OK1A 4ANOA 3DXPA 3Q6UA 3VQHA 1XBBA 2PVYA 2ONLA 4A06A 4JS8A 3PIZA 3R83A 2ZJWA 3GENA 3SX9A 2X4ZA 3FHRA 2XRUA 3CKXA 3CC6A 3TEIA 4HOKA 2BCJA 3BHUA 3DXNA 3BQRA 1R0PA 4UWBA 1FMKA 3R9DA 3SG9A 2UZVA 4WNOA 3PWYA 3HKOA 3QTIA 4HGTA 3FLZA 3BHHA 3JR1A 3ZO2A 1VYZA 3PRFA 3ENMA 2ZDUA 3PJ3A 2C3KA 2ZB1A 4OTGA 5DN3A 3DB8A 2PZ5A 4I41A 4NKSA 1I44A 4XLIA 3KXXA 5L8JA 3ZO4A 1OI9A 3VS2A 3VRZA 4A07A 2WTIA 2PE0A 4PX6A 5CAPA 2PVRA 3UNZA 3BWFA 1VYWA 4IAFA 4K0YA 4AUAA 2FUMA 4HVDA 3COIA 2A19B 2W9ZB 1Z5MA 4CGAA 2PVFA 4HVIA 3A8WA 2JDVA 5BVKA 4KABA 5CWZA 3AMYA 4LGHA 1JSUA 3QQKA 2I1MA 1H1WA 2CDZA 4FV5A 3CTHA 4YZ9A 1HCLA 5FG8A 2R5TA 4LI5A 2X8EA 4IBMA 4JNWA 3VBYA 4CFNA 4MVFA 1UU9A 4QQJA 5GJGA 4H1JA 5M44A 1WCCA 2HOGA 2J0LA 1KE8A 2Q83A 2QI8A 3D94A 4NFMA 4RRVA 4O1PA 5CNOA 3FMMA 4DT9A 2XM9A 4L46A 4YJSA 4F1TA 4YTCA 3F82A 3RK7A 4BYIA 4U43A 4BF2A 2OW3A 4DH8A 4CRSA 5L2WA 4IHPA 3LMHA 4FEXA 3K3IA 1YDSE 2X2MA 3ORIA 1Q3WA 3N4TA 4KKEA 4XBUA 2YABA 3FSKA 4FTNA 4E6QA 5DT4A 2I0EA 3QU0A 3SHEA 4KNBA 1QPDA 2HAKA 3U6JA 3POOA 3OOGA 4O0XA 4QTDA 5BVDA 2J9MA 3ZRMA 2UV2A 4QMPA 4B9DA 2VWUA 1J91A 2CN5A 1DM2A 5FEQA 2ZM3A 3NW5A 3Q96A 3TNWA 4RWKA 2BMCA 4Y5HA 2GS2A 5IA4A 4NW5A 1ZYJA 2FSOX 2PTKA 4FNZA 4ZS0A 4PL5A 5C03A 1U4DA 2YJSA 4ANLA 4FZ6A 2ZDTA 4NW6A 2QO2A 4DBNA 2PZIA 4YBKA 2C30A 4ZY4A 1WVXA 2O2UA 3GC8A 2UZOA 3F3VA 4PL3A 3F5PA 3W2CA 3QTUA 4FC0A 5IA0A 2FGIA 2JKMA 2F7EE 3PXZA 1BYGA 4FZDB 3RM7A 3LMIA 4MD8E 4L01A 5EI6A 4H39A 4GK2A 3UG1A 5K4IA 1T45A 3PTGA 3DQXA 4NU1A 4FICA 5D10A 5J1WA 3TI1A 5EQEA 4YJRA 3VRYA 3OBGA 2SRCA 3FI2A 5EHLA 1PXNA 2PU8A 4XP2A 4E5BA 2YM3A 4IWDA 5F20A 4R5SA 1ZMWA 5I9WA 4O7NA 4F64A 4L7FA 3BLQA 3W2OA 2UW6A 3FQHA 3EQFA 3V3VA 3D7TB 3BX5A 5HBHA 3OWJA 4IX4A 5FM3A 4EZ3A 2AYPA 4CMUA 2YCQA 5KMLA 1H0WA 3SGCA 5AX9A 3RI1A 3GI3A 4FVRA 3P0MA 3UBDA 2FSLX 2R7IA 4GFOA 3HUBA 2ITNA 3LW0A 3MIAA 4CFVA 3UZTA 4RJ4A 5I9XA 1UWJA 4XHKB 3UZRA 2XNEA 4A9SA 4BIEA 3NW7A 5CU2A 4O38A 2VNYA 3O50A 3II5A 5CF5A 4MEDA 3IOKA 2Y4PA 4AZWA 4IB5A 4A7CA 5LMBA 1CDKA 3BKBA 4OBQA 4R3RA 2GNLA 5AAGA 3HGKA 3FJQE 5DBXA 3MH0A 5C8KA 1ZMUA 3EL8A 4IW0A 4FSZA 1P4OA 4RZWA 2XVDA 4CFUA 1ATPE 4I5PA 5B7VA 3OXTA 5K5XA 2VTIA 3D2IA 1Q4LA 3PYYA 4W8DA 2QD9A 2WQMA 5F9EA 5IMXA 1STCE 4AGWA 3Q2MA 5DA3A 2BKZA 5HOAA 5BYYA 5C4KA 3W18A 3IW5A 4Z3VA 5B2KA 1XH9A 3DPKA 1WBVA 3GCSA 2J0IA 4EH9A 1FGKA 4J96A 3PIYA 4EZ7A 4FEVA 5C8NA 3SQQA 3DXQA 4D1SA 4PWNA 4L68A 3TM0A 2QOBA 4N6ZA 1KV1A 2WQEA 3JY9A 1L8TA 2JITA 3R2YA 1IR3A 5D1JA 3ID6C 2X2KA 3BIZA 3MVJA 3MV5A 2Y0AA 4CFMA 3FXWA 2IW6A 4OTIA 4HW7A 4AT4A 4K18A 2X39A 1M7QA 4UBAA 3MGYA 5KHWA 4GG5A 4R7HA 1PXMA 1CTPE 2W7XA 3OROA 3TTIA 4BB4A 5AR3A 4EWQA 5FTQA 3M1SA 4D4YA 5LMKA 4C4GA 3U8WA 3AGLA 4UEUA 5J87A 3C51A 1R1WA 3UJGA 4RX5A 4JL9A 4O0VA 4HNIA 3DGKA 3NIEA 4BDFA 5HX6A 1PYEA 4RJ3A 1W98A 2ITXA 5KZ0A 2FA2A 3R01A 4GIIA 4KB8A 4AQCA 3UNKA 3AMAA 5EHYA 1O9UA 4M13A 4BIBA 4D58A 2QU6A 4Z9LA 3RAIA 2VWWA 4OTRA 2EXMA 3T9IA 2C0IA 3Q9ZA 4EK4A 2VO7A 2VTPA 3G2FA 3OW4A 1G5SA 4NL0A 2HW7A 2JDTA 3D5XA 1G8AA 4LUDA 1OL5A 3BBTB 4X6QC 2W06A 4FODA 4GYIA 3CLYA 4YNEA 2HCKA 4D55A 5M07A 1OIQA 2OJ9A 3QX4A 4NFNA 4YHTA 2R0UA 3R04A 4UX9A 2YITA 4F0FA 4D1XA 4J99A 3ZLSA 4YC6A 2EWAA 4QO9A 4EEVA 3EQBA 4J7BA 3D9VA 5HX8A 4MWHA 4WOVA 5CAOA 4V04A 5ANDA 2KTYA 3ZLXA 5CQUA 3RAHA 3ZSGA 3VULA 3KEXA 2GFCA 5IEYA 4FTTA 1DAWA 4LGDA 3QUEA 4RJ6A 1XKKA 3OEFX 3SXSA 4MBIA 3U4WA 2V5QA 3FUPA 4PDSA 4KKHA 3ZFXA 4Q9ZA 2QQ7A 3D14A 5EI8A 3KULB 1R39A 3RPVA 2QG7A 3NZ0A 3LOKA 2HIWA 4TTHB 2R7BA 3P7BA 4PNKA 4DGNA 2H6DA 4ZSGA 5AV1A 4C4IA 1QPJA 4FNWA 4G17A 3RNYA 3ALOA 4TYGA 2NNWB 4I21A 3KQ7A 3VBTA 3OXIA 5M51A 2YLEA 4O7RA 4XOYA 4G5JA 4KS8A 5ANEA 4BCPA 1UU8A 2X7GA 3NCZA 4BDDA 4BI0A 4BCNA 4IQ6A 4RIWB 4OT5A 2VO0A 3IGGA 3PY0A 4OUCA 4RIYA 3RTPA 4CTBA 2J7TA 3ENHA 4BN1A 3UNJA 3IGOA 3PVWA 4EZ5A 3E3PA 3FYKX 3EQGA 4H58A 3SXRA 5HBJA 4EYMA 2UZDA 4G6NA 3PE2A 4IAYA 1ZLTA 5BNJA 4D2RA 1PXIA 3FQSA 4DH1A 4I0TA 3TNIA 3WIGA 4M12A 4PMSA 2G1TA 5AR4A 3DKFA 3EFLA 4L7SA 3U87A 5HIEA 4PDYA 2B9HA 2GHLA 4FT7A 3R8PA 3REPA 5BMMA 2GNJA 3SC1A 5LWMA 4E6AA 4AN3A 1JQHA 4FSQA 3ORTA 3QKLA 4RWIA 4UALA 1ZOGA 2R3MA 4FNYA 4A9UA 3DKOA 4IB0A 3IO7A 4U6RA 3JXWA 2C68A 4WT6A 2W1EA 4EBVA 1WBSA 3VNTA 4E5AX 4HVHA 2RGPA 2RKUA 1O6LA 2WD1A 3FY2A 4HZSA 4IADA 1YXUA 4EK6A 4DEDA 2BAKA 5JEBA 3ANQA 4EH4A 5I0BA 4CFWA 4XBRA 2BUJA 2XYUA 4MAOA 3CR0A 4A4XA 4R3CA 1K9AA 4ASEA 2OICA 3OWLA 4V0GA 1TQPA 2JKQA 2Q0NA 2VO6A 2X7OA 4CSVA 3KVXA 5IA1A 2VZ6A 4HZRA 4BCMA 3LLTA 3PJ2A 5AV4A 2ZB0A 3V6RA 1PXPA 2ITYA 4NK9A 5EW8A 3I7BA 3PA3A 3FLQA 2VTNA 1WBNA 3EQCA 2JGZA 3ZCLA 4DGLC 4EOLA 5AUTA 3H30A 3LPBA 3R1SA 3T3VA 4L6QA 3MH1A 4DINA 3N51A 1OBGA 4TYIA 1H27A 2PVKA 3R00A 2JBOA 4UYNA 4EH6A 3LXNA 4JIAA 4AA4A 4C02A 4YO6A 4APCA 3OUKA 2C47A 2X1NA 4FTUA 3L9MA 3PPKA 2VO3A 5AWMA 4CCUA 2JIVA 4EORA 4L52A 4X0MA 3WE4A 2OZAA 2GNHA 1YHSA 4S32A 1PJKA 3P08A 4F9WA 3G6HA 4RFMA 3TJDA 3TWJA 3ZXTA 3R63A 4QMVA 5J9ZA 1UA2A 1XHAA 1KSWA 5DH3A 5HE0A 3VJOA 3W2SA 3ZSHA 4E73A 3GT8A 5JGAA 3DBCA 2YM4A 1FVTA 4MCVA 3OF0A 3W1FA 4KIPA 3AD6A 4BDAA 1GIIA 4G3GA 4U79A 5LOHA 2I0YA 3PWDA 3QYZA 4ZSLA 5EKOA 3W55A 1PXJA 4RLKA 4FT0A 3UQGA 4XYFA 4E1ZA 1WFCA 4YHJA 4YGAA 3DJ7A 4QTCA 3VS1A 5GINE 4MD9E 2R3GA 5ANGA 4B0GA 3QTZA 3ORKA 4YPSA 3VS7A 3A62A 5AP0A 3A2CA 1MQ4A 2ITUA 4WBBB 2VUWA 4GSBA 4DG2E 5HORA 2PUIA 5M53A 2B54A 4JBOA 4XG7A 5AV2A 2XEYA 1IEPA 3DJ6A 2PL0A 3CSVA 3W10A 4N57A 4PPBA 5J95A 4L67A 2BKKA 4X21A 5EHOA 3DK7A 1UWHA 3HV3A 3V04A 2G2HA 1J7LA 3EHAA 5EW3A 3R73A 4TWCA 2VGPA 5I3OA 4IC7A 2JKOA 2RFSA 2IPXA 5JZJA 2R3JA 2JLDA 1ERKA 4NM7A 4EK3A 1H24A 2C1AA 3WOWA 4ZZNA 4FKTA 2F7ZE 4NSTA 4AOIA 5HD4A 4YLKA 1OPJA 4OTWA 3FYJX 3UIMA 4EOMA 3UYSA 4E5WA 2C5OA 2CPKE 1YXXA 4TKSA 4DN5A 2NPQA 4KAOA 4Y85A 3C13A 2YM8A 4Q5HA 1ZOHA 3OXZA 2IZTA 4H3BA 2QC6A 3WZJA 4N70A 3KRLA 4L3PA 5AP1A 3IKAA 1DI9A 2JDRA 4QOXA 4ANSA 2AC5A 4OW8A 4DCEA 2BRGA 4E6CA 4ZJVA 2XNBA 3TTJA 5DYJA 3WI6A 1GNGA 4M67A 4AOJA 1A06A 2DUVA 2WEIA 2BPMA 3H9RA 2RIOA 3ORZA 3T9TA 4C33A 4D2SA 4C62A 3RPRA 3ZM9A 1BL6A 3D7TA 4USDA 2ITTA 4G6LA 2O0UA 3R9HA 1KUTA 4IVCA 5FTGA 1WBOA 2BZHB 2BIYA 2VWYA 2W1DA 4K9YA 5AP5A 4DEBA 1YKRA 3R30A 3IK3A 4QP3A 4KD1A 3SKCA 4R78A 4IH8A 2QCSA 1B38A
chains in the Genus database with same CATH superfamily
4EOKA 3VS5A 1M2QA 2BZIB 2GMXA 4UXQA 4D2TA 4DHIB 4LMNA 4A9YA 5BUEA 5AUWA 5C27A 2PVMA 4JLCA 3RAKA 3UO6A 3W0QA 4P90A 3Q9YA 2BALA 4GVJA 4ZP5A 3THBA 5HIDA 3MTLA 5L8LA 5I4NA 4KIKB 2H96A 3P23A 3VBQA 5GJFA 4YHFA 5EOBA 3TIYA 4DLJA 3S3IA 4ANNA 4ZLYA 5KE0A 4AFEA 4EH8A 3L9LA 1YRPA 3R7OA 3R9RA 2UW4A 3F66A 2H9VA 3FZTA 3TNHA 3DQWA 5LXMA 2PVJA 3KGAA 4XG6A 4CZYB 5E9EA 3BU5A 2XNGA 2RSVA 1KE7A 4LOQA 5I9YA 2ITWA 4JRNA 4RIXA 2BZKB 2VWXA 5CSVA 1V0OA 3BE9A 3GGFA 1OKVA 2AUHA 4U42A 1G8JA 1B6CB 2JDOA 3R7GA 5K0XA 5IQBA 4D0WA 5HG7A 4ENYA 1GY3A 4KUJA 3WIKA 3HMNA 3HP2A 2J5FA 3HX4A 2VWIA 3O7LB 4RQKA 3ATSA 5ETAA 2WNTA 5HLNA 4HNFA 5FQDC 1F5QA 3ZRLA 5AIRA 4X2JA 2E9UA 4F7NA 1YHVA 4CV9A 3EJ1A 5FD2A 3FDNA 5E8XA 2Y6MA 4F0IA 4BI2A 4CZUA 4D4VA 3Q4ZA 3UPZA 4BY9E 3EFKA 4CG9A 5CF6A 3NNXA 3R9OA 1ZZ2A 4CLJA 4D28A 4XRLA 2GTMA 1GAGA 4EJ7A 1ZYDA 2WFYA 1VJYA 3Q60A 3VHEA 4IZAA 4ZIMA 3QCYA 5E8VA 1BMKA 2C3JA 3NNUA 3U9NA 4E8AA 4BZDA 3MSSA 5AIKA 5KO1A 3PXQA 4MKCA 3FL4A 4RWLA 4F4PA 4ACMA 4FG8A 4QYFA 3BL9A 5HE2A 4CFFA 3A60A 2OBJA 3AT3A 5J8IA 1A9UA 3G9LX 2QLQA 4JDIA 5E7RA 2XKEA 4IXPA 3R8UA 2CCHA 3GUBA 2VTRA 3WARA 3BYOA 1W0XC 2A2AA 5EKNA 4O81A 4WNKA 4QMUA 2G01A 3QRKA 4PMPA 5E92A 2C4GA 3VS6A 2NO3A 4DH3A 1M17A 3KXNA 3PG3A 3EZVA 4FKPA 4AW0A 2A4LA 4IX3A 3CGFA 4FBXA 4OR5A 4PMMA 1U54B 2GS7A 5DGZA 3QRTA 4MXAA 5HG9A 3TMOA 3CY3A 1SNUA 2FVDA 2DS1A 4DG3E 4G3FA 3Q2JA 4HVGA 3UZPA 2RL5A 3PY3A 1J7UA 3LE6A 4GT5A 5AP3A 4K77A 4I3ZA 4M15A 2JBPA 3QA0A 2O65A 5FEEA 2W1CA 4H1MA 5HBEA 1ZAOA 3HMPA 4UN0C 3CKWA 2R64A 5GZ8A 3R7VA 3RPYA 4W9WA 4EQMA 5LVNA 4FSTA 4RC3A 2WU6A 4RVKA 4XMOA 5CT0A 5I9UA 4YPDA 3IQ7A 2WMWA 1PMEA 4ERKA 5AUUA 2C5NA 4LUEA 2YDJA 4K2RA 4FSYA 3PXFA 3ZSIA 3F9NA 2W1ZA 3WE8A 5HIBA 2W1FA 3EMGA 3OVVA 5DFPA 4AFJA 2XB7A 2X2LA 4CVAA 4YJPA 5KHXA 4QP2A 1TQMA 3LXKA 4KSPA 4JQEA 5M4IA 2JD5A 4ZTMA 1YI4A 4FZ7A 3A4PA 4AN2A 4G9RA 4S30A 2Z60A 3IECA 4ANQA 3TNQB 2PVNA 2CN8A 2W4OA 3ZLYA 3TIZA 5BMSA 1F0QA 3W0RA 2HZ4A 3QGWA 5BVFA 1OBDA 4DEAA 1MUOA 1OKWA 3PZHA 4V0GB 4G3CA 3O7LD 4U44A 4ACGA 1GOLA 1M7NA 3V5JA 3FV8A 3KF7A 1UU3A 2WO6A 4BFMA 5CVHA 3LFSA 4HPTE 1BI7A 2X6DA 2X6EA 3LXPA 3AD4A 1ZYLA 2VTLA 3CPCA 3I5ZA 4M0ZA 3UPXA 4BGQA 3F3ZA 5BUJA 3B2WA 3OT3A 1NT2A 2PPQA 4L42A 1MRVA 2GNIA 2GFSA 4DTKA 5KMMA 2WTWA 3V01A 4IWOA 5CSXA 2YERA 5EK7A 4YJTA 3R7YA 2KULA 3QZFA 4EHZA 4GUEA 4ITIA 2GCDA 3VC4A 1Q62A 1S9IA 2XIKA 3OCGA 2ZV7A 4C57A 5IQGA 4KBAA 4XCUA 1YI3A 3C4EA 4BKZA 4PP7A 3AG9A 2E2BA 2BAJA 5D12A 3GQIA 4FGBA 4EJNA 4ZEGA 3VUHA 4G31A 5ACBC 1XJDA 3KCKA 4XG3A 4FTOA 4WIHA 5IQHA 2XKFA 3AMBA 2ERZE 3VF8A 2JIUA 3NUXA 4JBVA 5TE0A 4FA2A 3VJNA 1NVSA 3NYOA 3LCKA 3M2WA 4GMYA 3G90X 4JX7A 4M97A 3ZLWA 4HGLA 4E4MA 5CU0A 2CNQA 3HMMA 3QAME 4UMRA 2Y7JA 1AQ1A 4XEYA 4AACA 5CAQA 4X3FB 1OPLA 3PA4A 2JAVA 4R6VA 1UV5A 3CBLA 1M2RA 3LZBA 2I0HA 2YCFA 3BYSA 3N4VA 5L2SA 3PVUA 1F3MC 3DFAA 4YC3A 3HV7A 3Q9XA 2YJRA 5CTPA 4ZJJA 3KCFA 3VS3A 3MDYA 4ZY5A 3DTWA 2QOFA 3CE3A 1FVVA 1JKSA 3RPOA 5CU6A 3D5VA 3TUCA 4QT1A 4M7IA 5L6WL 3C0IA 4PL4A 3P4KA 4FSWA 1Q8UA 2A27A 4LYNA 3R6XA 4M0YA 4RQVA 4YZBA 3U4UA 3UDTA 4YJOA 4D9TA 4GH2A 4FT3A 4C4JA 3MBLA 2OFVA 4GFGA 3U9CA 5AM6A 3PPJA 1FMOE 1M2PA 4Y5QA 3AQVA 3W0MA 5G1XA 4FSNA 3O5AA 4BJJA 2E9NA 4FV7A 4RLLA 3QXOA 5DPVA 4YR8A 4BJJB 5A4QA 3F2NA 5HO8A 4PPAA 5E8UA 3NYNA 5D11A 1J7IA 3NLBA 4OTHA 4AT5A 5IF1A 4CZTA 3R02A 3MVLA 3R8MA 5I5ZA 4CCBA 4BL1A 3AC8A 2BRNA 3NW6A 4EQCA 3KKVA 4NIFA 2PZYA 4IB3A 2ZV8A 4NIFB 3ZFMA 4BWPA 3Q9WA 3BELA 2OF4A 3MPMA 5HNGA 5K3YA 2ZMDA 3KK9A 3ZTXA 2J51A 2Y4IB 4RJ8A 4YJNA 4GV1A 4JAIA 2OKRA 3DT1A 4LQMA 3LFBA 3H0ZA 5LARA 3PFYA 4KIOA 5HGIA 2Z7RA 3DY7A 4O4EA 5CSHA 3ZM4A 4OTQA 1PXLA 4APPA 1V1KA 4KBCA 3FC1X 4AZEA 3FMLA 4LL0A 3I79A 2VTOA 4S33A 4W8EA 4PV0A 2YZAA 4HGSA 4D9UA 4YZMA 1BLXA 3R8LA 2G9XA 4LL5A 2GNFA 2Z8CA 2PVHA 5J9YA 3Q52A 3WF5A 3LQ8A 4KA3A 2VWBA 3DK3A 3PPZA 3QUDA 4GT3A 4FKWA 4M69B 4C36A 3L8PA 5CT7A 4BCOA 4EOQA 3BQCA 2ACXA 3NWWA 4NEUA 3IW7A 5CEPA 1SVGA 2AQXA 3NEWA 4RSSA 4AAAA 3GNIB 3UODA 1FQ1B 2XCHA 3ORLA 4UMQA 4MNEB 3GCVA 4G16A 4Q9SA 3W16A 2WTCA 1PYXA 5HNBA 2W4JA 1PHKA 4YTHA 4F6SA 3EL7A 4FTMA 3CD3A 2HZIA 4NT4A 4JJRA 2E9OA 3ULZA 3C4FA 2CNVA 3CGOA 1XH8A 3MESA 1OUKA 2JC6A 3S4QA 5AEPA 5IQDA 2ZMCA 3OT8A 2FSMX 4TNBA 3E62A 1UU7A 4FKLA 2B7AA 5AM7A 1V0PA 3EKNA 5C8MA 2I7QA 4X7QA 5CI6A 1A48A 2Q0BA 3RALA 4PMTA 4BDJA 3AC5A 2WMTA 1OMWA 2YCRA 3O96A 3PA5A 1NY3A 3MY0A 3O8TA 3QRIA 4FV9A 5LMAA 4ARKA 4YZDA 4B7TA 4BKYA 4FV8A 4F99A 5JFSA 5C4LA 2ETRA 4ALUA 5AA9A 1NVRA 3RPSA 4F7LA 2EB3A 4IDVA 2VTSA 3UOLA 5A9UA 3E8NA 4C38A 1W7HA 4C35A 4XG2A 3S00A 4QTAA 2WMXA 5CANA 3KRXA 4N0SA 4GYGA 2VTHA 3MS9A 5HTCA 3A7JA 3D15A 3EZRA 3FZSA 4TWNA 5HCXA 1M52A 3CXWA 4W4WA 4MNFA 2GQSA 4FMQA 4Y72A 4QYHA 4HYSA 1J1BA 1PKGA 3LCTA 2YLFA 3NDMA 1OGYA 2IVSA 4B8MA 4AXEA 1J1CA 4QP6A 5IISA 3FMJA 2Z7LA 3ZO1A 3PRIA 3JS2A 4DGOA 3ZDIA 4ERWA 5AUXA 3DA6A 1WVWA 2ERKA 4I23A 1H07A 1YI6A 4G6OA 4ZTLA 3GCQA 1W84A 4GFMA 1VLRA 3E92A 4QMTA 3T8OA 2OFUA 2IWIA 2UZBA 4FSRA 3RBWA 4X3JA 3ZH8A 1KE6A 4NM5A 2X9FA 4LMUA 2BVAA 1BI8A 3AOXA 2J5EA 4AX8A 4XV1A 5E8SA 4WRSA 3OBJA 3TZ9A 3QC4A 1OL7A 3QTRA 5AP7A 4DT8A 4CFXA 4CYIA 3LJ1A 3GFEA 4OTFA 3UO5A 1U54A 2P0CA 4RVLA 5KMOA 4BCFA 1LPUA 3RVGA 2WTKB 3I6WA 3PJ1A 4Z7HA 3DB6A 5FBOA 3ZEWA 4RMZA 5BVEA 3RGFA 3G6GA 4XG4A 5KUPA 3D83A 4GK3A 3V5LA 2UZUE 3EFWA 2C6LA 4CT2A 2R9SA 3ZZWA 2ZV9A 5D41A 4FKIA 4MF1A 5IEXA 1LR4A 3WYXA 3ROCA 2HENA 1OKZA 3NAXA 5TT7A 4WSYA 4UMUA 1OPKA 1ZYCA 2C6TA 4BZNA 2VWVA 1ZOEA 2W0JA 3KN5A 4EHGA 4R5YA 4TYHB 4FEQA 3FBVA 3MFTA 2C0OA 1JKKA 5AX3A 3R7UA 4O86A 4Y95A 2HWPA 4YO4A 4WSQA 5I9ZA 3JPVA 5E1EA 4M66A 3DAEA 2QG5A 3LQ5A 2YIXA 2UW7A 2XIXA 2YIQA 4I93A 4UMTA 4AA0A 1KOAA 3L1SA 4QMSA 4AE6A 4BCIA 4ZTQA 3H9FA 4BIDA 2ITVA 2P4IA 3IDPA 3OG7A 1W82A 3QTSA 3C5UA 3BZ3A 2WGJA 3GVUA 5JZNA 5EDPA 3PSDA 5B2LA 5EYMA 4R77A 4ZOGA 2OG8A 1IAHA 1YDRE 3HV5A 4ASDA 2YIWA 3QRJA 4JBQA 4PUZA 4NTSA 1REKA 2WQBA 3RK5A 5JT2A 4XX9A 4XLVA 3EOCA 4YTIA 4Y46A 2WTJA 3Q4TA 4ZK5A 4BYJA 4O83A 4L8MA 3SA0A 1Q8WA 3L8SA 3V5QA 5DOSA 5KMJA 3TKUA 2BAQA 5E91A 4F1OA 5A3XA 4QEBA 2JFMA 5J1VA 5LMKC 2VX0A 4L9IA 2B9JA 5CASA 5HLWA 2GS6A 4HJOA 4E4NA 1YDTE 3EB0A 4EOSA 2Z02A 2UVXA 5IUGA 5M4CA 5HZNA 2HZNA 4AE9A 4L43A 4DF3A 3ZOSA 3FLYA 3HDMA 3F6XA 2OXDA 3E88A 3MJ1A 4IM2A 3PXKA 3DBFA 4C58A 3R21A 2XK3A 4AWIA 3QRUA 2V7OA 4PY1A 2JIIA 3NMUF 3Q5IA 3QQJA 5CEMA 4C2WA 4GU6A 4AA5A 2B55A 4Y83A 4F7JA 4I6FA 4E3CA 3TXOA 4IAAA 3DJ5A 2HK5A 3PSCA 2OIDA 4CTCA 5T6KA 3UG2A 1ZYSA 4A4OA 5KKRC 4K6ZA 4LG4A 1TVOA 1LP4A 3FKLA 3N9XA 2PYWA 3O51A 5JGDA 4D5HA 4JMQA 3F3UA 4LRMA 1WBWA 2ZM1A 2ZAZA 1NA7A 1P4FA 3NUPA 3ITZA 4J98A 3QHWA 4BDEA 5F94A 3ETAA 1Q5KA 3BHYA 3KY2A 3E7VA 3KFAA 5E8WA 4HVSA 4TW9A 3FMEA 4FYOA 1HCKA 1H8FA 4P7EA 5IA5A 5LVOA 1J3HA 2UW5A 2CLXA 4HYHA 4IE9A 2BIKB 3QD4A 4RX7A 4U80A 1APME 3E8DA 3GU7A 2GSFA 1P5EA 3MH3A 3QKKA 4IDTA 4F6UA 4BBEA 3I0OA 3IW4A 2ITPA 4ZZOA 1CKJA 3SV0A 2IEWA 5G6VA 2WIPA 4M8TA 4YNOA 4GL9A 3ROYA 3R9NA 2J4ZA 3I6UA 4BKJA 2NP8A 4CEGA 4ALVA 2EU9A 2VNWA 2QHNA 5IQAA 3G9NA 5CEKA 1FGIA 4C37A 3DU8A 1E1XA 1OM1A 3V51A 3FXZA 1YWRA 2BFYA 4XV3A 5FBNC 2VAGA 2IZUA 5TKDA 3CEKA 3VQUA 2WAJA 3ODYX 4BCGA 3E5AA 3B2TA 3FY0A 5LWNA 4F7SA 4F0GA 3RJCA 3F88A 2R4BA 1V0BA 2VRXA 3OCTA 5DE2A 5AFVA 1AD5A 2OJJA 3AC4A 1TKIA 5AUYA 2C0TA 4I5CA 4EL9A 5CI7A 3EFJA 3OP5A 3JVRA 4TXCA 3ERKA 3PUFC 4M3QA 5EQPA 2VV9A 4R1YA 3E93A 5M56A 3HYHA 2OU7A 4IZYA 5D7AA 1H08A 1Y6AA 4O4CA 4DEHA 5A4CA 2BRHA 3ALNA 3EKKA 2W05A 3AKKA 4QMYA 4O2PA 2RG5A 5IMEA 4JDJA 2BHHA 4ITHA 1YOMA 3CCNA 3W0NA 3KB7A 1RE8A 2JFLA 3FMNA 4BTJA 4C4EA 5HU9A 5AP4A 3QHRA 5L2TA 3IG7A 5A4EA 2R3IA 3SOCA 5JRQA 2F7XE 3PP0A 1BL7A 2C6OA 3UDBA 4HCUA 5EQYA 4GRBA 3NYXA 4FG7A 4O22A 1H1SA 5FGKA 1GIJA 3E8EA 4LV8A 3CQEA 4QPSA 4XS2A 4FEUA 4K8AA 4C3FA 4G9CA 4XJ0A 3ZBXA 2VD5A 4O0WA 4NH1A 4OLIA 2XRWA 2YM6A 2CGXA 3I0QA 3QD2B 1JOWB 5FRIA 2UVZA 3QL8A 1PMVA 4FKSA 5K4JA 5CVFA 3PVGA 5IUIA 3DCVA 3Q53A 4D5KA 2XAMA 2J0KA 2V0DA 2Z7QA 1JBPE 5AR8A 1UVRA 3OZ6A 5HVYA 3VVHA 3MPTA 4I6HA 2OIBA 4D2PA 5AUZA 4V05A 2CGWA 3MW1A 3W32A 3DFCB 3NUNA 2VTTA 4MYGA 3NGAA 4F08A 4ZLZA 3P5JC 3TYKA 5EW9A 4GG7A 4XOZA 1SNXA 2W1IA 4LRKA 2R3QA 3ELJA 1H4LA 3TV4A 3ZUVA 4K11A 4YBJA 5FXRA 2WTVA 1XMMA 2J6MA 4CKJA 2QOCA 3MJ2A 4U8ZA 2PUUA 5HO7A 5BYZA 3OWPA 5IH6A 4IEBA 1T46A 4MQ2A 4DGMA 3EYHA 5I3RA 3P86A 4PF4A 5IQEA 1XBCA 1Y8YA 5DEWA 5KMNA 4CQEA 1H0VA 3KXMA 3AGMA 3ZUUA 1U59A 4YJVA 4F9AA 5K9IA 4LV7A 2W5BA 1CSNA 3LAUA 4TWPA 5HG5A 4BWXA 4EOOA 4JXFA 2NRUA 2QOLA 4BDKA 2PMNX 2PZPA 2YWVA 3SXFA 5JFXA 4FV3A 4O4FA 2WMAA 1XH6A 3HDNA 3UE4A 3PJ8A 4U3YA 2OIQA 5DR2A 1JKLA 4AXDA 4O7TA 2OJFE 4KIKA 4YJQA 3NVKI 4QMWA 3VF9A 2X0OA 4KKGA 3BHVA 2CGUA 4F9BA 2BFXA 4O84A 5CU3A 4MBJA 3EN6A 3EQIA 5BPYA 3F7ZA 2XK9A 2CKEA 4FV4A 4FUYA 4AW5A 2VU3A 2G15A 2EB2A 3CQWA 3QZHA 4CG8A 1OL1A 4J8NA 4FK3A 3TZMA 4C4HA 4QQ5A 2XYNA 4O82A 1TQIA 4DEGA 1Q8YA 4D2WA 3LFNA 1URCA 5I9VA 5IDPA 2RFDA 4PP9A 2O8YA 3KXZA 1WBPA 3F7WA 4U81A 3EN5A 3FZ1A 5IH4A 3A8XA 3U51A 1FVRA 4QD6A 3ZMMA 4Z55A 2I40A 4L53A 4EC8A 4AN9A 4G3EA 4I5HA 3B8QA 5AP6A 3OC1A 3TN8A 5E4HA 3CJGA 3PVBA 4E6DA 2VTJA 4ENXA 1SZMA 5A4TA 4DHFA 4NCTA 4YU2A 4KIQA 3V8TA 2ZOQA 3Q4UA 4FSUA 1H1RA 2XA4A 4AZSA 4KRCA 5FEDA 5JSMA 4RG0A 4FX3A 3DZQA 2OI4X 2O64A 2WMBA 4RIOA 3LFFA 1U5RA 3IW8A 2BILB 2JAMA 4EKKA 3C0HA 3QTWA 5IKWA 1OITA 4KSQA 2PHKA 5IQIA 3CPBA 5CAVA 5DWRA 5CZIA 4AGUA 1Q8TA 4RIYB 5M57A 4AXCA 3AT2A 4UYAA 4X2NA 3P7AA 3RWPA 5IQCA 2WIHA 3E63A 2YFXA 3K3JA 3OY3A 4J97A 4IJ9A 5E8ZA 3UC3A 5C01A 3WF9A 1MRYA 4EOJA 4U7ZA 4QMLA 3UMWA 3HEGA 2WU7A 4QP7A 5JGBA 4FEWA 3LFDA 4JG6A 1H1QA 3JYAA 4BDHA 3FSFA 3ANRA 3LCSA 3QA8A 5LVLA 2IG7A 4HCVA 2WQOA 5DIAA 5DI1A 1Z9XA 3ZEPA 5EDQA 3UOJA 3N4UA 4XRJA 3CS9A 4Q2AA 3ULIA 4UZDA 4E4XA 3EN4A 1XBAA 1XH7A 1Q61A 3GBZA 3HLLA 4IMYA 4EWHA 4QMZA 2IW9A 1OB3A 3TNPC 5DR6A 3D2KA 4R8QA 2GHGA 4O7VA 5HTIA 4EH7A 3COMA 2IF8A 3FKNA 4UY9A 3SVVA 2FH9A 2QLUA 1SYKA 3MYGA 4IX5A 4ZTSA 1UKHA 3EH9A 4CRLA 4WG3A 4O0YA 2UW0A 3KRRA 4FE2A 2PE1A 4FTIA 4XH6A 4CMOA 4L00A 2CNUA 3DTCA 5L6OA 2OZOA 4ASXA 4BRXA 4CV8A 4O2ZA 4JIKA 3PFQA 5GHVA 3F5UA 4FIEA 4CMTA 2XUUA 2WB8A 3F69A 1IA8A 4HYIA 4TWOA 1ND4A 3F3TA 1P14A 2JKKA 4BBMA 5GIOE 1OECA 2FSTX 4JI9A 4WG5A 3O23A 4EH3A 4ONAA 4EONA 3SRVA 2WZJA 2OZAB 4MX9A 4C3RA 4TYHA 5BX0A 4DFNA 2ITZA 4O7YA 4RA5A 2OJIA 2Y4IC 3BI6A 3QZGA 1VR2A 4IZ7A 4QRCA 3SAYA 3UMXA 5KBRA 4PTCA 3HAMA 1SM2A 4ZXTA 4I6LA 3IDCA 1ZY4A 3DAJA 3U6IA 4JX3A 2CHLA 4O27B 2B4SB 3NUUA 4ZTHA 2HELA 4F70A 4EUUA 2XK8A 3BGZA 3NSZA 2XBJA 3BGQA 3AC1A 4I6BA 5HICA 2BRBA 5JRSA 5HESA 2V7AA 3OTUA 1G8SA 5ANJA 4ID7A 3BU6A 3NCGA 4GEOA 2BZJA 3V5PA 3QQHA 4FIGA 5HE1A 5ITAA 2XEZA 3QCXA 1I09A 2Y9QA 1O6KA 3BLRA 2JEDA 1AGWA 2QOHA 1CKIA 3FHIA 3MY5A 3U55A 4FIJA 3BBWA 1TZDA 5FDXA 4RVTA 4U5JA 4GIHA 3W8QA 4FF8A 4OGRA 1Q3DA 4QTBA 1ZRZA 3DOGA 3D5WA 2BTSA 3BYMA 4M68A 3VAPA 3OW3A 4F65A 3NPCA 5CX9A 3FLSA 3BL7A 4QP9A 2UW8A 3CP9A 3MTFA 5EYKA 2Y6OA 3SW4A 3UQFA 5C1QB 4C59A 4WKQA 3OY1A 3UDSA 2XS0A 1DI8A 2PMIA 4IVDA 4TZRA 2PE2A 2IO6A 5CSWA 4DLIA 4FK6A 3G0EA 2QHMA 4LOPA 3L8VA 5CQWA 3WZEA 1UNLA 4RA4A 2ESMA 3QFVA 5J79A 1OIYA 2CMWA 3SOAA 5FLFA 2HW6A 4I92A 4PDPA 5ANIA 3K5UA 4BGHA 5HE3A 3UIBA 3UQCA 4E4LA 2P33A 1K2PA 4MK0A 4BDBA 4EKLA 2EVAA 3F5GA 2P2HA 4FKRA 5CEQA 3D5UA 5ANOA 3OS3A 2XH5A 4PNIA 1WMKA 4B99A 2J50A 3L9NA 4AW2A 4D4SA 5JFWA 2YZLA 3WF6A 2WMQA 2J0JA 5AR7A 3UIUA 4GS6A 2R3HA 2W1GA 4ZSAA 3NUAA 1KE9A 1IAJA 2EXEA 5J5SA 3EIDA 4U40A 1KWPA 2WMSA 4Z16A 3LIJA 4W4XA 1Q41A 4JBPA 2PSQA 4R3PA 5ICPA 3PLAE 2XK4A 4DGGA 4I6QA 5IA3A 5ETFA 4PDOA 4EK8A 5LVPA 3DDQA 4FIIA 3MFRA 4RT7A 4WD5A 3TCPA 3KULA 2FO0A 4FNXA 4AU8A 3C0GA 3ZU7A 3S0OA 1S9JA 4FVQA 3UYTA 4FKUA 3QTXA 3OOMA 5IA2A 2P3GX 3FQEA 4AXFA 3P1AA 4QP8A 4FL2A 4BVUA 4E7WA 2RF9A 4FOBA 1OZ1A 1LEZA 2XM8A 3FMDA 1W83A 3HAVA 5J5TA 4G2FA 2WMRA 3C4ZA 3MA3A 2R3OA 4JVGA 5F1ZA 5EG3A 3TZ7A 5DVRA 1PW2A 2E9VA 3VUIA 2OWBA 2IVUA 5CLPA 2QNJA 3R8VA 4M69A 4U0IA 4EI4A 4AZTA 2FYSA 3AT4A 4OT6A 3A7GA 5M4UA 4MH7A 3PLSA 4B6LA 4F1MA 3QWKA 3P5KA 2JDSA 4FKGA 3FMHA 2QOQA 3OEZA 5KBQA 5EM6A 1O6YA 3POZA 3W33A 1QPEA 2R3KA 4FTLA 4G1WA 5HKMA 4Q5EA 4Y8DA 3Q6WA 4BBFA 4C4FA 2GDOA 3NS9A 5KMIA 4JAJA 1JAMA 3NR9A 5CVGA 3IW6A 1PKDA 1YOLA 4J1RA 4MNEA 4B4LA 3GOPA 3DLSA 5H2UA 4JG7A 3VBWA 3LM5A 4X2GA 4EH2A 4OBOA 3VUGA 1XH5A 4U41A 5AADA 3SD0A 3H10A 4IIRA 4U97A 2V55A 1R78A 3OTVA 4CKRA 2GNGA 1GZ8A 1QMZA 4OTPA 2IW8A 1YWNA 4WNPA 2QO7A 1RW8A 3BWJA 4ZZMA 3PIXA 5C9CA 3KVWA 3T3UA 4IFGA 3EQPA 3H9OA 4FTRA 3FLWA 4YZCA 1ST0A 3W0SA 1ZARA 3FI3A 4QNYA 4AQKA 1PXOA 3E64A 4NCTC 5KX8A 3VIDA 4FIFA 3K54A 2W96B 2C6KA 2DQ7X 4RWJA 4IFCA 5AV3A 3LCDA 4TRLA 3HRCA 2WHBA 5A14A 1RJBA 3V5TA 4DG0E 4F63A 3ACKA 4YJUA 5B2MA 4BDIA 4ZAUA 4TNDA 3PSBA 3LFQA 3RAWA 5AR5A 2BR1A 3BYUA 4J71A 3A4OX 3COHA 3RHXA 3GC0A 1E1VA 5TO8A 5JH6A 1PY5A 5T68A 2F4JA 4FGRA 4GKIA 2GU8A 4RJ5A 3RCDA 4I5MA 3ZFYA 4HGEA 3TUBA 4O7ZA 4IB1A 4ZTNA 1SVHA 4CKIA 3RZBA 3EQRA 4CT1A 5J7HA 4EK5A 4DDGA 2F9GA 3NAYA 4FZFB 2J0MB 1XR1A 3DNDA 2C6DA 3QYWA 4IM0A 2XALA 2CJMA 3MA6A 4WNMA 2CGVA 4QYGA 3ZYAA 4TPTA 4L3LA 4JDHA 3HECA 4PPCA 2GQRA 1OIRA 4DTAA 3Q5ZA 3E8CA 4MQ1A 3GCPA 3LFCA 4TYJA 4WA9A 4Y73A 4NUSA 5L2QA 1CMKE 2R3FA 2BROA 4BCJA 1BX6A 5AR2A 4XG9A 3QX2A 1Q8ZA 4X2FA 3R2BA 5DT0A 5A4LA 5A54A 4OAUC 2A0CX 2VX3A 4JRVA 4N6YA 3GEQA 5IQFA 1Y8GA 4YLLA 4C3PA 3UP2A 3OD6X 4MHAA 5AA8A 4XNEA 3WILA 3GP0A 3WZKA 3BYVA 3Q3BA 3PXRA 5AV0A 1NVQA 2X0QA 5HVKA 3DKCA 4DCAA 5HVJA 2BTRA 4HPUE 3BEAA 5BYLA 2YIYA 5GIPE 2QR8A 2WPAA 5LCKA 1XMLA 5H9BA 4E93A 2OLCA 3HA8A 1YQJA 4M84A 2X0GA 3EQDA 3GU6A 1JPAA 3EYGA 4UXLA 2HWOA 5CENA 3TACA 4C8BA 3BLAA 4GK4A 1CM8A 1JWHA 3ORMA 3DDPA 4YC8A 4H3PA 4ACCA 2ONLC 5HLPA 5F4NA 4DFUA 5FTOA 5TF9A 4MXCA 3QGYA 3CTJA 3LLAA 4QMMA 1JVPP 2C6IA 2XNOA 2J2IB 3ZHPC 3ZO3A 4RVMA 3A99A 3HV4A 4O0UA 3LFEA