1MRVA

Crystal structure of an inactive akt2 kinase domain
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
294
structure length
261
Chain Sequence
VTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an inactive akt2 kinase domain
pubmed doi rcsb
molecule keywords RAC-beta serine/threonine kinase
molecule tags Transferase
source organism Homo sapiens
total genus 67
structure length 261
sequence length 294
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1mrvA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1mrvA02
1G5SA 3Q2MA 4XLIA 2XJ1A 4JDIA 1SVHA 4M69B 2C3IB 3MPMA 3VUKA 3E8DA 2OK1A 4H58A 3E7OA 3BYOA 4XG4A 2ITZA 3K5VA 1A06A 5BYZA 2UVXA 4IB0A 3QHWA 2WEIA 1XWSA 1Q8ZA 4CKIA 4GG5A 3EKNA 2R3FA 3MN3A 4EUTA 3PA3A 4FOCA 3MBLA 3MVMA 3HMNA 3F7ZA 4FVRA 3HVCA 1BL7A 2JFLA 5GJGA 3OWKA 4YSJA 2QODA 3DZQA 4PL4A 3VNTA 4DGMA 2NRYA 5IQFA 1PJKA 4EH2A 4FKIA 4UWBA 3UIBA 3ZCLA 3VIDA 2C5YA 1AGWA 5DEYA 1ZARA 5HE0A 4QPAA 2CPKE 5L3AA 4G6OA 4BB4A 1OITA 4MF0A 2YM8A 1LEZA 3A4PA 4U3YA 1I09A 3DAKA 5AUUA 5CSVA 4EHVA 1ZOEA 2R3LA 4M68A 3TACA 5DIAA 4A4OA 4GH2A 4G1WA 4JS8A 3LZBA 3ZO4A 5CXZA 5AR5A 3EL7A 5HG5A 4QMWA 2ONLC 4C4IA 3VWAA 4L3LA 4EZ5A 3ZXTA 4V0GB 2ONLA 4WSYA 5GNKA 1P5EA 3DTWA 4TT7A 3UO5A 1HOWA 2G01A 2PHKA 4F0FA 2XP2A 4ASEA 4D4SA 1Y8GA 5EHOA 3QGYA 3KQ7A 4FE2A 2XEZA 4Y73A 4BWXA 3TZ8A 5B2MA 5K5NA 4O7WA 4LGDA 5EDPA 4L9IA 3ORZA 5D9HA 4BTMA 2BDWA 3RPOA 3SA0A 2UW3A 4EH7A 4EHEA 3KA0A 4JQ7A 4FTIA 5D10A 3FMHA 4FOBA 4RG0A 5ANIA 4DF3A 4MKCA 1F3MC 1SVGA 3VUGA 5JEBA 1J7UA 2C3KA 4DGOA 4TNBA 2C3LA 2WMUA 4I22A 4S33A 2YWVA 3TI1A 3GB2A 3WILA 2G2FA 4FK3A 2CCHA 2WMVA 4I6FA 2EWAA 2P33A 3RPRA 4DH3A 3BLRA 1L8TA 4L7SA 2JFMA 2BKZA 5EQEA 3ZBFA 4QYFA 4A9YA 4QMQA 3OCBA 2QR7A 3FDNA 4PV0A 4YLKA 2RF9A 1SNXA 4AOJA 3ZUVA 2HZ4A 5HI2A 4E6QA 5J9YA 4CMTA 4WO5A 2JAVA 3GBZA 3FL4A 3LFQA 5G1XA 4APPA 3PVBA 1Y6BA 1VYWA 2BTSA 4O2ZA 2PZYA 2X7OA 4RA5A 3G5DA 4TZRA 2JBPA 5HO6A 4RSSA 4RWLA 1VZOA 3DA6A 3PY1A 5F94A 1STCE 3I4BA 4GSBA 3WI6A 3EZVA 5EKOA 3KVXA 4HPUE 3ZU7A 2RFEA 4BDKA 4OBQA 3VBVA 5JFWA 4IVCA 3EQBA 4IAYA 1AQ1A 5M53A 4M15A 3H0ZA 4FIHA 2W1DA 3VUIA 4O7TA 3CQUA 5HNGA 1PHKA 4F99A 2W5BA 1ZMWA 3ZM4A 4JL9A 3UOKA 5CI6A 1KOBA 4QQCA 5L8KA 4ZTMA 4I4FA 5IA2A 5I9WA 1PMNA 4QT1A 4JJRA 5J7BA 4FMQA 4HGEA 4J97A 2R0IA 4U3ZA 2CGXA 4DHFA 4ASDA 2E2BA 4QMXA 2FSTX 4P4CA 5HBJA 4FI1A 4QNYA 2FSLX 1XBCA 2A19B 4PUZA 5HHWA 5C8MA 4TKSA 3DY7A 4ACMA 4H3BA 4DFXE 4FKQA 3O50A 2VV9A 4LL5A 4O6LA 2PVHA 3HP2A 3LFSA 4MNEA 4C4HA 3CR0A 3E8CA 1YQJA 3DBQA 4C37A 2OZOA 3KXMA 3A2CA 2PVFA 3PY0A 3MVJA 4E26A 4RIOA 3U6HA 3QTRA 3ANQA 2R5TA 4AWIA 3IO7A 3D7TA 2PZ5A 3NWWA 4R7IA 4XG9A 4WA9A 4FYNA 4WNPA 1WBPA 4NWMA 1U46A 2QOBA 5JZJA 4QP4A 1REJA 3P08A 3SC1A 3LXPA 2HYYA 2OXDA 2GSFA 1ZRZA 2Y0AA 4X3JA 1QL6A 5AR7A 4D0XA 3UE4A 3WE4A 4QQJA 3EFWA 5AIRA 4YTCA 5JQ5A 3O96A 4IAKA 3I81A 5HLNA 2VTJA 4MEDA 3LOKA 3VHEA 3ZZWA 3LJ0A 3W18A 3IW6A 4GVAA 4C7TA 4F9BA 3DT1A 5FP5A 4XCUA 1OIRA 2XIRA 3EQDA 4QMSA 5AP3A 5CU0A 4O22A 4XMOA 1YI6A 3FKOA 2V0DA 3LAUA 3U4WA 3NUNA 5CTPA 3R6XA 5FEDA 1RDQE 5GJFA 4BY9E 3UDBA 3TNIA 4NUSA 4BRXA 5A6OA 2VO0A 3R8MA 4TPTA 1ZMVA 1H07A 2WTIA 1GJOA 3CBLA 4F0GA 4C4JA 2PVNA 3PXQA 3ACJA 1H00A 3CXWA 4NFMA 2GU8A 3U9NA 3QQLA 4WIHA 1OIUA 1U59A 1URWA 4JBOA 5I9UA 2V5QA 5CSHA 3TZ9A 2WD1A 1T46A 4B4LA 5DR9A 4TWCA 5HG9A 4Y5HA 3PWYA 2HY0A 2XYNA 3A62A 4C4GA 2UW6A 1U54A 3VS6A 3R30A 4Q9ZA 1PYXA 5LVPA 4PPCA 3O7LD 2PU8A 5M08A 3FAAA 4K1BA 2QU5A 4R3CA 3EFLA 3LCSA 4O38A 3BGQA 2HK5A 3C5UA 3FI2A 3D83A 4ZSJA 3L1SA 4O82A 4UY9A 3EB0A 2XS0A 3S3IA 4IADA 4RX8A 2W9ZB 4RWKA 4B7TA 5CNOA 5HG7A 1O6LA 1TVOA 4S32A 3V3VA 4BIBA 5DLSA 4HCTA 4GU9A 2QI8A 4U9AA 5BVNA 1QPCA 2RKUA 2VTSA 3D9VA 4GEOA 1UNHA 2JEDA 3QUEA 4EONA 3OTVA 1NT2A 3ID6C 1TQIA 2VO7A 2R7BA 1ATPE 1ZYCA 3HRFA 3PZEA 5EM5A 2FGIA 3ORPA 4LRJA 4CSVA 4I0SA 3QKLA 4JX7A 2O5KA 5H2UA 4E6DA 4R7BA 4FV6A 4IBMA 3O17A 4YC6A 3VO3A 2A2AA 3SD0A 2B54A 3KY2A 4UMRA 5JFVA 3A7FA 3U55A 2CMWA 2I0VA 4J53A 1KE6A 1XH8A 3OTUA 3E62A 2Z7LA 1CDKA 1QMZA 4KINA 5CYIA 5AMNA 5IA3A 2QOKA 4AP7A 1SNUA 4O7SA 4W9XA 4FTJA 4LOQA 2QC6A 3KXNA 2B4SB 3AD4A 1NVSA 3Q9XA 2LAVA 4LV8A 3QA8A 4WOVA 4JT3A 3BLHA 5AP0A 2C69A 3UIUA 2QOCA 3NIZA 3RPYA 3MY1A 5L8LA 4X2KA 2O2UA 4LRMA 2OGVA 5I5ZA 4NK9A 5I3OA 3UBDA 2WFYA 4FKVA 3Q3BA 3EN9A 3IGOA 3O8PA 5KMLA 3F6XA 4A9UA 5KCVA 3KF7A 5D12A 5J79A 2OJJA 3HUCA 3T9TA 1PXJA 2C6DA 4YPSA 4YO4A 4U45A 4L44A 3DKFA 4AN2A 1WBSA 3MWUA 2CKPA 4O0XA 4LI5A 2J51A 3ZLXA 3FEGA 4QP2A 4QOXA 4NFNA 3THBA 2R3NA 3VBTA 4AGDA 4NW5A 2VAGA 3NUYA 4QPMA 5BMMA 4NT4A 3ZSIA 2FUMA 4XBUA 2GNLA 4IDVA 3R8LA 5A3XA 2G1TA 4XOYA 5F4NA 4KIQA 2XIXA 4YBJA 3R1QA 4EWQA 4OTIA 5DT4A 5H3QA 4GKIA 2X6DA 5HE2A 3DKOA 4Y46A 3WBLA 5DWRA 2ITVA 4YTHA 3W2OA 2YM5A 4RMZA 4X2GA 4GW8A 2AC3A 3C5IA 2H96A 1KWPA 2HENA 2QKRA 5BYLA 3ZMMA 5DYJA 4F6UA 4CRSA 4EUUA 2BROA 3MPAA 4FF8A 3VBQA 4E5WA 3BU3A 1OIQA 2W17A 3QA0A 1Y8YA 3JUHA 4M12A 4EK4A 1BLXA 3E92A 1ZMUA 5AUWA 3ZO3A 4D5HA 5A9UA 3JVSA 2UW4A 5HO8A 4WRGA 3RK9A 5HTIA 4PP9A 3RNIA 2W1EA 4KIKB 3BYSA 5CNNA 3EJ1A 3CD3A 3G33A 4QMZA 4AW2A 2IVUA 5L2SA 1XH7A 3ZH8A 4LQMA 4CVAA 2B9HA 1ND4A 2YCFA 5ICPA 3FI4A 3PIYA 1R1WA 5ETIA 5KX8A 3NMUF 2XZSA 5D41A 5DRDA 3TV6A 3KRXA 5HU3A 2G9XA 2WIPA 2FSMX 3GU7A 2J6MA 2WGJA 3G9NA 4FG7A 1UU7A 4AFJA 5E4HA 4Y85A 3CQWA 5ANKA 3EQHA 4EOOA 1CTPE 3DDPA 4NTTA 4APCA 2VU3A 1K2PA 1GAGA 3EL8A 5HU9A 2UV2A 3KXHA 3ZUTA 5DH3A 5C1QB 4FT3A 1UKIA 4F6SA 3DJ5A 1GZ8A 4GVJA 5K3YA 5EOBA 3S2PA 4F9CA 5A54A 3GOKA 4ZY5A 3PP1A 2OJIA 4O86A 3DJ7A 3ORXA 1XR1A 2QOQA 3SG9A 2VWVA 3D94A 3E63A 3KMUA 4EK3A 3QTSA 3TNWA 1G3NA 1K9AA 4C33A 5H8BA 3AXWA 2XRUA 3FYJX 3ENHA 3KKVA 3R8PA 5CF8A 4BR3A 3QKMA 4GFOA 3VUTA 1FMKA 4G5JA 4BCOA 4PL3A 3F2RA 4I0RA 4QP1A 4NM3A 3N4TA 4BYJA 5CAUA 4IW0A 5BNJA 3F2NA 3HRCA 4F4PA 5FDXA 3UZRA 1Y6AA 3W32A 3G0FA 2R3GA 3SKCA 4BHNA 5DA3A 3QC4A 2O0UA 5EG3A 4U44A 5C9CA 2P0CA 3R7GA 3R7UA 3E64A 2VRXA 3SXRA 3M2WA 2C6OA 1M2QA 3GC7A 2QVSE 5AFVA 1CKJA 3PJ8A 2H9VA 3ZRKA 4QTDA 3TT0A 3TWJA 1URCA 4FL1A 4OW8A 3L9MA 2Z7QA 2YHVA 4HW7A 3OW3A 2WTKC 4JBPA 3WARA 1YWNA 1VJYA 3PTGA 4QYHA 4FTQA 3QCXA 2E9NA 4MXCA 2VX0A 1FQ1B 4G3DA 2PVYA 3A8XA 3FMMA 3Q6WA 3LCDA 2XCKA 4IAAA 3F66A 4GCJA 3E5AA 3TKUA 4BGGA 3QUPA 4BTJA 4CG8A 4BCIA 4G5PA 4RJ5A 5CANA 2DYLA 3H9OA 2Z60A 3MS9A 3QC9A 3FE3A 4DYMA 3I6UA 3T8OA 3KF4A 2PE0A 3F82A 4BIEA 3CLYA 3DXNA 3UPZA 4DC2A 3IGGA 3ZEWA 2R3IA 5IQDA 2UZVA 4NSTA 4OT6A 4IB1A 5ANOA 3N51A 3QD0A 4OLIA 3FZPA 2ZDUA 1KE7A 4C4FA 2UZUE 5A6NA 1XH4A 2PY3A 4LMUA 3IDCA 3TUCA 3RP9A 4YBKA 2XNNA 3QGWA 3RI1A 3PWDA 3RAIA 1O6YA 4L3PA 4CFFA 5J1WA 4IZ5A 3WF9A 1Y57A 1BI8A 4DBNA 3DAEA 1SMHA 3LM5A 4QMPA 3BIZA 2H8HA 4UMQA 4UMPA 4KKGA 5D7VA 5IG1A 4IXPA 4FIJA 1NVQA 1J91A 3EIDA 3ZTXA 2XNOA 3HYHA 1Q8WA 3MH3A 3ORNA 2HIWA 3AGMA 2VWBA 3D5XA 3E93A 5DBXA 2BDJA 5EW9A 3S4QA 4ANBA 5JGBA 1PYEA 4BBEA 4DEDA 1E1XA 4K2RA 2ERZE 2GTMA 3TTJA 3BZ3A 2H34A 1NXKA 3DKCA 5ACKA 4FKWA 3MSSA 2ZM3A 1VR2A 3IG7A 5DT0A 2XCHA 5TOZA 5AP4A 3C4WA 2WQBA 4M97A 4TYHA 3QCQA 2PL0A 5AR3A 4O0RA 2QHNA 3GU8A 5KHWA 3RK7A 4AU8A 2VN9A 4YP8A 3LM0A 4CLJA 5KMNA 2W4JA 4NU1A 2Y4IC 4EH6A 3G9LX 3PSBA 4UALA 4EK8A 2VUWA 2UW8A 3AQVA 4O96A 2IG7A 3QYZA 1R39A 2PVRA 4EEVA 4QTCA 5E8YA 3UNZA 4G3FA 3NDMA 3Q60A 1JKTA 4H1JA 5LWNA 1BMKA 3DBCA 3NNUA 3NUUA 2I0HA 4YLLA 3DNDA 4MTAA 1XH5A 2O64A 3D4QA 3ALNA 3R8UA 4ASZA 5LVMA 2XNBA 3IW4A 2Z7RA 4EOMA 5FGKA 3NZ0A 2E9VA 4CNHA 4JAIA 4ZY6A 2X9EA 3M11A 3VS3A 5AA8A 2A0CX 3PVGA 5EDRA 3PDTA 3FLSA 3BYUA 4PP7A 4YSMA 4GJ2A 2BKKA 3AC3A 4PDSA 4QP3A 5M4CA 3UQFA 5K4IA 3PLSA 2A1AB 1YHWA 3U6IA 1OL1A 4Q5HA 3F88A 4L7FA 3ROCA 3ZC5A 2C1AA 4U8ZA 4GIIA 1PMEA 2OKRA 3AC4A 3V5PA 3E3PA 4IACA 5K0XA 3O51A 3NCZA 3C9WA 4RC3A 3RALA 4BF2A 4FGBA 1R78A 2YLEA 3LVPA 3MH2A 4IC8A 5JT2A 4PTCA 4RBLA 5LMBA 3IDPA 4FSQA 1YXSA 4PY1A 3ROYA 3V5JA 4YNOA 4YJUA 4M3QA 3GQIA 4P5ZA 4PF4A 1OUYA 1YHSA 3U9CA 4E1ZA 2PMLX 3KGAA 4HYUA 3RPSA 5A4LA 4USFA 3RM6A 4U40A 4XNEA 4L45A 5LMAA 5BUJA 5IUHA 2QKWB 1APME 4NM7A 2QO9A 5F1ZA 1DI8A 2Z02A 1O9UA 3F5XA 3BPRA 3C0IA 3MTFA 5AADA 4U0IA 3SW7A 3T3VA 1Q4LA 2QU6A 3OHTA 2BTRA 2R3RA 5HE1A 4IWPA 4YGAA 3BQRA 4ZZOA 1WBNA 3JXWA 1HCLA 2QG5A 1OZ1A 2QOFA 4ALWA 4G6NA 3CY3A 4DFZE 3BX5A 3FXWA 3TIYA 5A14A 4FEQA 3K54A 4BZOA 4AGUA 1KV1A 3OVVA 4IDTA 2UVZA 2YISA 3R01A 4TTHB 4BWPA 2VTNA 5KMIA 5TR6A 2WMTA 3KK9A 3P4KA 3PE1A 4D58A 5I3RA 4XYFA 3AT4A 3C50A 4F9YA 3TG1A 4FKPA 4ZLZA 1O6KA 3OC1A 5IA1A 2OU7A 3UIXA 1GIIA 5L2QA 3F3TA 3WIKA 3LFBA 3PP0A 3JR1A 5EI2A 5TT7A 4PTEA 2CNQA 3DB8A 5E8SA 3ENMA 4EI4A 2QQ7A 1MRVA 4FNXA 4NIFA 4Y72A 2OG8A 4ASXA 4O27B 3P0MA 5AP5A 3QQUA 4FUXA 5AUTA 3S00A 2OLCA 2C6LA 3HUBA 3IQ7A 5IQBA 2F7ZE 1W83A 1YHVA 2ZV7A 3HMOA 4E4XA 4EWHA 2ZAZA 3NAXA 4ZEGA 5CXHA 4YURA 4A7CA 3MB7A 2QG7A 5A4QA 1WBVA 2CNUA 3WF7A 3GENA 4J98A 4QMLA 1YDTE 2PVKA 5AV3A 5A4EA 2GHGA 2WMQA 2X8IA 4XH6A 1XJDA 2GNGA 2J0KA 3F5PA 3Q4TA 5AV1A 3ZZEA 3BKBA 5IEYA 3FL5A 3HX4A 2YM4A 4LFIA 4RZVA 5TKDA 5JSMA 4FL3A 3OWPA 3SG8A 3F5UA 4U41A 2YEXA 4HPTE 4AE6A 5I4NA 3CE3A 3PJCA 4KBAA 4PPBA 1PKGA 2W06A 4FKTA 5BQ0A 1SVEA 4HCUA 3SAYA 3NNVA 5GZ9A 5FTQA 2VGPA 3W16A 4YC3A 5IH5A 3ZDIA 3FC2A 4KSPA 3ETAA 3MY5A 3QD3A 4U6RA 5AWMA 4C36A 2WTJA 5LQFA 4CCBA 4BDBA 2E9PA 4NYEA 3QZGA 3MVLA 3K3IA 2GDOA 1FGIA 1KE9A 1Q3DA 3GI3A 3IK3A 2ITTA 5AV0A 1UA2A 1H0VA 3AT2A 4ANMA 4O81A 3QAME 2AUHA 3UO4A 4JG7A 4TXCA 2JC6A 5EM8A 4MD7E 4NM5A 4GRBA 4DEEA 3LQ8A 4MXYA 4U43A 5LARA 3GFEA 2KULA 2ZB1A 2W5AA 3PRIA 4JIKA 3QFVA 4AUAA 3R63A 3KMMA 3AMAA 3WZKA 2WTWA 5EI8A 5AP1A 5IA5A 2GNJA 1Y91A 4YZ9A 3ZS5A 3FBVA 4FBXA 3SRVB 4YZCA 1NW1A 5CEMA 2OFUA 2V62A 2PTKA 3QD4A 4YZMA 2CCIA 2A4LA 3COHA 3QZFA 4CQGA 4GL9A 5AR4A 4RX7A 1IA8A 1V0OA 4JR3A 1Z5MA 3GC9A 4X6RA 4XP3A 5LJJA 2R3HA 4MNEB 5L2WA 4U97A 1CKPA 3Q52A 1H08A 3ORKA 3NYVA 5AP6A 3ZFXA 1U5QA 3TNQB 4QD6A 2C5XA 1PW2A 4FKUA 4FSNA 4G3CA 4QP6A 4U81A 5EHYA 5LCKA 5C4LA 3AC5A 4FZDB 3WOWA 4EJ7A 4FYOA 4BDCA 4HYSA 2VO6A 3OS3A 4CFVA 2JIVA 3D7TB 4EOKA 4IAZA 1W7HA 3VW6A 2PZRA 2VTLA 5IUGA 3KCFA 3FMEA 4YJQA 3FXZA 3FJQE 2YM3A 4FKOA 1XH9A 3ORMA 5F9EA 3LQ5A 3R7EA 3A7GA 5FD2A 2WXVA 4XRJA 5HOAA 4D4VA 3Q53A 2BFYA 3NUXA 4BKJA 5JMSA 4N6ZA 3VN9A 3BYMA 2R3QA 4L8MA 4KS8A 4G9RA 3UP2A 1OPJA 4RJ3A 3UC4A 2CGWA 4U79A 5D11A 1KE8A 4O83A 1OMWA 3IOKA 3V01A 5L2IA 2JIUA 4DGNA 1W82A 2BIKB 2XH5A 4EHGA 2C5OA 2VZ6A 2J2IB 3NAYA 1IEPA 4L43A 5I9XA 2EB2A 5HBEA 4AQCA 1FVTA 4MXZA 2J9MA 4WNKA 2EXCX 3QLFA 4I3ZA 3O7LB 4OBOA 1XQZA 4S34A 5E8XA 5HD4A 2OIQA 3HGKA 3VS0A 4ANSA 3OG7A 1UVRA 3P7BA 3DXPA 4RJ6A 4JVGA 5GHVA 1M14A 2OF4A 2XK4A 3MTLA 3AC8A 3EYHA 4DTKA 4EQCA 4J1RA 1MUOA 1PXOA 3F61A 3PPJA 4ONAA 3WYXA 4I93A 4FV2A 4D4YA 5KMOA 2ITYA 1PXKA 3H10A 3OCTA 3TM0A 4AN3A 4CXAA 1OI9A 2WMBA 3HAVA 4NEUA 1U54B 1P14A 2NNWB 1B6CB 2OJGA 3VULA 5EM6A 1NA7A 4FICA 2WTDA 3QZHA 4QRCA 3UG1A 4QQ5A 4W4VA 4WBOA 2ZMCA 4ORKA 2BZIB 5E8UA 5AR2A 5HVKA 5HZNA 4C8BA 5CALA 4DT9A 3VRZA 2ZMDA 3R2BA 1WCCA 3D5VA 4XLVA 3FYKX 1FVVA 2Y7JA 2QLUA 1FMOE 3NRMA 4IZAA 4F7JA 4UN0C 5EQYA 2W7XA 3C7QA 5HG8A 3NGAA 3P7CA 3BELA 4N70A 1Q5KA 4FTNA 4I5MA 5CSXA 3SW4A 3V6SA 4EQUA 4XBRA 4ZMFA 5BVOA 5FTGA 4O84A 3SRVA 5F20A 4FKRA 2R3OA 3GVUA 4D4RA 3HV4A 4IJ9A 2YIXA 2BAKA 3EFKA 3QQGA 4QYEA 4F70A 1BI7A 2Q0NA 3FZSA 4EK5A 3I0QA 4IHPA 3DGKA 4GK2A 2NP8A 3HNGA 1H25A 3RK5A 2OFVA 2ZB0A 4FNWA 3OMVA 5AX3A 4C0TA 4DAWA 4K0YA 4BCMA 1FBNA 3A7IA 5DGZA 4F9AA 3VS1A 4DEBA 4IIRA 1YWVA 2GFCA 3IW8A 3QLGA 2JKKA 2CN5A 2OWBA 4JQ8A 2QOOA 3DQXA 3TV7A 4BI0A 3HZTA 4CT2A 2O65A 4JRNA 5LOHA 3MDYA 4PQNA 2B0QA 1ZYSA 4WG3A 4G3GA 4FA2A 4C59A 2XYUA 1L3RE 3DK6A 2OIBA 4W4WA 5TE0A 3SDJA 3SX9A 4ITIA 2RL5A 4EL9A 3MESA 5FUTA 3UOJA 4USDA 3D0EA 4W4XA 4OTFA 4BFMA 3D5UA 3I0OA 4OGRA 5E8ZA 2YERA 3NUSA 2XNMA 3GEQA 2IZRA 2FSOX 4RFZA 4AA5A 5KZIA 3PUPA 3EQGA 4EKKA 3U8WA 3F3WA 3W2SA 4OBPA 4USEA 3RVGA 4XG7A 1SYKA 4KAOA 4H36A 5CEPA 2IVTA 3MA3A 5BUIA 4QQTA 4PWNA 5EYCA 2IZTA 4Y83A 4FV8A 3ZLWA 1H8FA 4AG8A 4E6CA 4Z7HA 5EM7A 5GZ8A 2XA4A 5E7RA 5H8GA 2UW9A 3R83A 2GNFA 5HLPA 4I5PA 5M56A 4CFMA 5AP7A 1S9IA 1JKKA 5M06A 3E87A 3PZHA 3ORIA 3DFAA 3ZEPA 4BKYA 3FZTA 3PXRA 4H39A 3Q9YA 5HO7A 5IF1A 3Q9WA 4PMMA 3TXOA 3GXLA 5A4TA 4E20A 3AD5A 4AW5A 3LIJA 3ZDUA 1OPKA 3TJCA 4BHZA 1Q3WA 2PUNA 1UV5A 3BHYA 3DV3A 5HORA 4HNIA 3GFWA 1R0EA 2XKEA 4FV9A 3QYWA 4GFGA 5CZIA 2Y6MA 3T9IA 4RA4A 3OP5A 4MYGA 4RIXA 3KREA 4RX9A 3FSKA 2BIYA 3S95A 3QTXA 1RJBA 4C58A 2B9JA 5M51A 4C3FA 4RX5A 2C6TA 2Y8OA 2HOGA 2IWIA 3CPBA 4ALUA 3HV3A 3K2LA 5EK7A 1YOJA 3LFCA 3C1XA 4ERKA 5I9YA 4YJPA 4GFMA 3BLQA 1CM8A 2R3MA 2YCRA 3COKA 3AG9A 4FTUA 4C2VA 5HIBA 3T3UA 5JQ8A 1G8AA 3A8WA 3C4CA 4TYGA 5DOSA 2IVVA 1Q97A 2QURA 5C8KA 4OTGA 4HVIA 3CCNA 3Q32A 4HGLA 1CMKE 2NPQA 4DH1A 4YTFA 2Y6OA 3G15A 3MH1A 1H28A 2QCSA 2VD5A 1YXTA 2OSCA 3OWJA 5ANEA 4PMTA 1F5QA 4B6LA 4UEUA 2YJSA 2ZYBA 3NEWA 4QTAA 3TKHA 1JSVA 2WQNA 3CIKA 4FZ7A 1YDSE 1ZY5A 2HXLA 2QONA 3PXYA 2HZIA 3QCYA 5AM7A 4D5KA 3R9HA 1XH6A 4U5JA 4FR4A 3TL8A 2YCQA 4FSZA 4FSMA 4NM0A 1J7IA 5AUZA 4RFYA 3WYYA 2X6EA 5DNRA 3OY1A 4AW1A 3BHVA 4YTIA 3ULZA 5ITAA 5J95A 3FPQA 2E9UA 3O8TA 3PJ1A 4AZFA 2QOLA 1FINA 2JLDA 2RG6A 4FV3A 5CSWA 2B7AA 2VWWA 3RTPA 4ANNA 1JPAA 2UUEA 2WB8A 4RC4A 3UP7A 3QRIA 4FUYA 4EYJA 2R7IA 1Q8UA 5KMJA 2C6MA 3PIZA 2GPHA 4ACDA 4ACGA 4CYIA 4M13A 4TYIA 5L8JA 3R73A 4HZRA 4YNEA 2ZV2A 5AAGA 4AACA 3COMA 3Q4ZA 4O91A 3HV5A 3U87A 3B8RA 2HZNA 3DOGA 2I1MA 3I5NA 3MFTA 4BBFA 4L53A 3GC0A 5FBNC 3NYXA 4I23A 3SXSA 3FLZA 1H24A 2GHLA 4DN5A 2FO0A 2WQEA 3SOCA 3LJ2A 3ZLYA 5BYYA 3OWLA 5J5TA 4O6EA 5JRQA 3ZSGA 2GTNA 3BHHA 4RT7A 3VVHA 2WTKB 4WNMA 2XRWA 3FZOA 3W2CA 3MH0A 4KS7A 1CKIA 2JITA 4ZXTA 2P2HA 3DBDA 3OXZA 3Q04A 2Q83A 3C0GA 4LUDA 4ZSAA 5DMZA 3UVRA 1OBDA 1YI4A 3LFFA 3ODYX 3NVMB 2XIZA 5E90A 5HIDA 3OBGA 5CEIA 3VW8A 3GCSA 4O0UA 4ZK5A 3HMPA 4FEWA 3ATSA 5HNIX 3UO6A 1J1BA 3ACKA 3R9OA 2OH4A 3R7IA 4R77A 3RCJA 1IAHA 1YXUA 4L46A 4DH8A 2WMXA 2CGUA 3ALOA 1YXVA 2QOHA 4KKHA 4CV9A 5IQIA 3RJCA 3LMHA 3JS2A 4CZTA 4FZAB 1GZNA 3VUHA 3BYVA 3GC8A 4G17A 4BKZA 4A4XA 4Z16A 4IM2A 4NZWB 3DZOA 5CAOA 3FSFA 4D2PA 4ERWA 4JAJA 3WZEA 4DINA 5CENA 3VS4A 4TYEA 2RFNA 2VTOA 2W4KA 5CU2A 3EWHA 4ENXA 2CHLA 4OT5A 4C38A 3NPCA 5CU6A 4J8MA 5KE0A 5ETAA 3QWKA 2QLQA 3ITZA 3Q96A 1OIYA 4MAOA 3UYSA 4R3PA 1PRYA 3R7OA 2PWLA 3OW4A 2GNHA 1V0BA 3R9DA 2XNGA 4I0TA 4QP9A 3GCUA 5JFSA 5AUVA 2W1FA 4LG4A 4ACHA 1KV2A 4MHAA 3PXKA 4YZNA 3PSCA 5J9LA 1H26A 4FTMA 4X0MA 3ZO2A 5DI1A 2BZKB 5HIEA 3A60A 4TYHB 5KNJA 4H3PA 3TNPC 5M44A 3A4OX 3KC3A 3A61A 2OF2A 4JNWA 1JVPP 5BVEA 3SLSA 4CRLA 2VTHA 2HW7A 4EOJA 1W8CA 3MFRA 4RIYA 3RZFA 3G6GA 5AAFA 2Y4IB 2R3KA 2VWYA 3AC2A 3ERKA 3D2IA 1YI3A 3QUDA 2UZDA 3OCGA 4E3CA 2XM9A 2XVDA 3H0YA 3PVWA 4FT7A 4DBXA 1UWJA 2C0OA 1ZXEA 2PE2A 5M4FA 3ZM9A 2ETMA 2WTCA 5M55A 4C57A 2PMIA 4XV9A 3CTQA 4MK0A 1NVRA 1UU8A 2ACXA 4J7BA 5BVFA 3QX4A 5AM6A 1BKXA 4F7LA 5DPVA 4X2FA 4CTBA 4Z7GA 4EH8A 4CG9A 2X4ZA 3IECA 4R1YA 4GIHA 2GQRA 2EXMA 1A48A 3WF5A 4FV7A 4L52A 3JVRA 3GOPA 1YXXA 4FNZA 3TEIA 4F64A 4WNOA 4DLJA 4MX9A 3F9NA 5ACBC 4RGJA 4UYNA 3MJ1A 4EQMA 2VNYA 4D55A 4BIDA 3ZONA 3QXPA 2F2UA 4K9YA 5ANGA 5L6PA 3LCKA 4C4EA 5CF5A 3QBNA 3RHXA 3ZYAA 2YACA 3QTWA 1V0PA 5EKNA 3BV3A 5LCJA 4FG8A 3VBYA 4ANQA 4CV8A 4O7NA 4ZY4A 2W1CA 4FKLA 2PMOX 4FIGA 4M66A 3BHTA 3VC4A 1YWRA 3KRLA 4J8NA 3LLTA 4I41A 1M17A 3DTCA 1KSWA 3HECA 3VAPA 4BDJA 4ZTSA 3S1HA 3OEZA 4ARKA 1REKA 1H0WA 2BRNA 2WMWA 3HA6A 4S30A 1IA9A 3OUKA 1H1QA 2YAKA 5LVOA 2ITPA 1U5RA 3GUBA 4DFUA 3RAWA 3TUBA 1OECA 4RPVA 4WKQA 1H1RA 2JBOA 3E7VA 3PVUA 3ZRMA 5B7VA 1OB3A 1PXPA 2W5HA 3H30A 2XJ2A 3RGFA 5HVJA 1H4LA 4ZIMA 5IQGA 1CSNA 4PDYA 5DFPA 3RWQA 2YN8A 3R8ZA 4KSQA 2C0IA 2CGVA 5DVRA 4R78A 3FMJA 4FTCA 2P3GX 4PL5A 2BHEA 3O0GA 4PMPA 3ZRLA 4O7LA 1OPLA 2XJ0A 1J7LA 1IG1A 4MD8E 3EQRA 1E1VA 3UVQA 3HDNA 1OKYA 4CYJA 3P9JA 3ZFMA 4E6AA 3MIAA 4LM5A 3RINA 4GG7A 2JGZA 4LOPA 4U42A 3CJFA 4NIFB 5IQAA 3QTQA 2EVAA 1ZYJA 2CJMA 2JKMA 2QD9A 3RAKA 4KKEA 3E8NA 4EORA 5A4CA 1LEWA 4YUQA 5EI6A 4CKJA 1VEBA 2G15A 4TNDA 3Q4CA 2R0UA 4HZSA 4CEGA 3VUDA 4BCJA 1LP4A 2PSQA 2W05A 4FGRA 1M7QA 2VWXA 1GZKA 4FSUA 5K0KA 3NW6A 3FLWA 4R7HA 4FX3A 3R1YA 4DG0E 3PA4A 3HLLA 3MYGA 5GINE 5T6KA 2ITWA 3KRJA 3KULA 5JFXA 4PDPA 5KBRA 5GIPE 5EW3A 2P4IA 4U80A 2B9FA 2NRUA 3UVPA 4XEYA 5JK3A 4KD1A 5CF4A 3VJOA 3FC1X 3ZC6A 3W33A 2XM8A 1Q24A 3REPA 4GYIA 3Q6UA 2AYPA 5E8TA 4YJTA 2XKCA 2JDSA 3CEKA 3GCPA 5GZAA 4L01A 2OJ9A 3DQWA 3EN6A 4XP2A 3V8SA 5JGAA 2YZLA 2WHBA 2I6LA 2YZAA 5M4IA 4A4LA 1WZYA 2C1BA 2YIWA 4FTRA 4M7IA 4EC8A 3OXIA 4Q9SA 3HL7A 3VF8A 1ZZ2A 4YHTA 2ETKA 2O63A 1LPUA 2UZWE 2Y9QA 3LMIA 3II5A 2UVYA 4P5QA 3MI9A 4FTLA 3TCPA 4BN1A 4O7RA 3IKAA 3FPMA 4BDEA 1AD5A 4FODA 3DXQA 4L00A 4MVFA 3BRBA 3BGZA 1JBPE 4NH1A 1H01A 4NTSA 4D2VA 4ANOA 2I0YA 3DK3A 2WOTA 3R04A 4D0WA 2VWZA 1WVXA 4YHFA 2BZHB 3LKMA 5HTCA 5EYDA 5IQEA 3QU0A 3V04A 1EH4A 4FV1A 3UTOA 3KXZA 4E5BA 5LVNA 3DK7A 2QO2A 5HX8A 4FV4A 4NJ3A 2C5NA 4NCTC 3PPKA 5J87A 3VBXA 4CFNA 4JQEA 3MFUA 4DITA 1J3HA 4NCTA 3HA8A 3GQLA 4WG4A 4CMUA 5I0BA 3TDVA 2RFSA 3W55A 1PY5A 4BDDA 4CKRA 2W4OA 3P1AA 2C6EA 1WVWA 4GJ3A 2YFXA 3W2QA 1RE8A 2RFDA 3EKKA 5CU4A 4ZTHA 5HE3A 3RPVA 5GJDA 2G2HA 3OD6X 1JSTA 2W9FB 2UZLA 3JY0A 4MBIA 2W1ZA 5DRBA 5IEVA 2WQMA 4B99A 4BICA 4IAFA 2YIYA 2BCJA 4GS6A 3ELJA 3L8XA 4ID7A 5FTOA 5D1JA 4F1MA 4OAUC 3EFJA 4GU6A 4UV0A 3G90X 4KUJA 5ANDA 4NJDA 4CMOA 5CEOA 4IJPA 4A06A 4LGHA 1TKIA 4FSTA 4MBLA 3IPHA 4XP0A 1XHAA 4BDAA 4V04A 4IFGA 4LV5A 3UIMA 2UZEA 3OROA 5H9BA 5J8IA 2GS6A 5EW8A 2J5FA 4R1VA 2JDVA 3RBWA 4TWNA 4YPDA 2ITOA 1Q8TA 3P23A 5AUYA 4CFXA 4M67A 4EBWA 2HY81 1ZWSA 3NNWA 4JI9A 4M84A 5AR8A 3SQQA 2J7TA 4TL0A 2YIRA 3WZDA 3N4VA 4HGSA 5KKRB 2F4JA 4KB8A 4TYJA 3OT3A 4RFMA 5BVWA 3TN8A 2BRBA 2FH9A 3V5QA 4BZNA 4X2NA 2IJMA 5E92A 1P4OA 2IVSA 3D7ZA 4EHZA 2X2MA 1WBWA 3U4UA 4Z55A 1JOWB 1ZYDA 2OICA 3U6JA 3IS5A 4AF3A 2ZM1A 1RW8A 5CAQA 4G2FA 2JKQA 3H3CA 2VNWA 1B39A 1JLUE 3PSDA 2A27A 2GNIA 5AUXA 3V5TA 2UW0A 1OGUA 3DJ6A 3LFAA 3NUAA 3R28A 4X3FC 3ZUUA 3OT8A 3MIYA 4F63A 3QALE 4X3FA 3DNEA 1W98A 4IVAA 4ZSGA 4UYAA 3K5UA 1GZOA 2XF0A 3RCDA 4BDFA 3EQIA 4FZ6A 4KIOA 3IW7A 5D7AA 4YJOA 3L8PA 3HV7A 1QPJA 5HKMA 4DFYA 3FLQA 1DI9A 1YOLA 4JBQA 5IPJA 3EZRA 4ZSLA 3GU6A 4V01A 3FI8A 4KBCA 4YLJA 3RWPA 3NYOA 2ZJWA 4JDHA 2C3JA 2CN8A 3PJ2A 2YLFA 3I60A 2HXQA 5E1EA 2QO7A 4FKSA 4D1XA 3QD2B 2IZSA 4G3EA 1H1SA 3PLAE 1PMUA 3EQCA 1GIHA 5ETFA 5IDPA 4R5SA 3CQEA 3VS5A 4KBKA 3QQFA 2DS1A 3HP5A 4R6VA 4WUAA 4Y5QA 3VQHA 5BX0A 5IDNA 4BYIA 5DR2A 4MNFA 2WU6A 2XBAA 3FHIA 1M2RA 4I1ZA 4AGCA 1PF8A 1HCKA 3NS9A 3VF9A 2V22A 3R9RA 3BWFA 4D2SA 3OUNB 3UMXA 4FTTA 5E9EA 4N6YA 3MB6A 1UWHA 4Y95A 1UU3A 2QNJA 2NO3A 4RIWA 4ZLOA 1ZY4A 3V5LA 4K11A 2OZAA 4QP8A 3ZXZA 1LR4A 3MPTA 5FWKK 3UJGA 4ACCA 4BCPA 2UZOA 2IW9A 4BTKA 4AT4A 2XK8A 4ZS4A 1YOMA 2OXYA 3TZ7A 4CZYB 1PXMA 2KTYA 2WMAA 5AA9A 3Q2JA 2X1NA 1J1CA 3FI3A 5L6OA 2X8DA 5KBQA 1OKWA 2J0JA 1H27A 4MF1A 3C13A 3NR9A 2OXXA 4ZZMA 3N9XA 4M14A 4YR8A 2E9OA 3DKGA 5FBOA 1W84A 4FEVA 3MW1A 5KHXA 2JDTA 2R9SA 3V8TA 2GQSA 2B9IA 3DS6A 4L67A 4PNKA 1TQPA 1V1KA 3I5ZA 3MJ2A 5TF9A 4AT3A 1UNGA 2VTQA 3L9PA 4GT3A 5EH0A 3I6WA 5CSPA 4AS0A 5KKRC 2XNEA 4MQ2A 2OBJA 4DG2E 4JBVA 4R3RA 5FXQA 2PPQA 4HJOA 4ZAUA 3KL8A 2B55A 3L8SA 4FZFB 4IX5A 2BZJA 4QP7A 5DE2A 4WBBB 4F1OA 2IPXA 3POZA 2BVAA 3LCOA 5IEXA 5DT3A 2GS7A 3QKKA 4PTGA 1W0XC 4O0YA 2CKOA 4IVDA 3KU2A 5E8VA 2ERKA 4I5CA 4DFNA 5AV2A 3WF6A 1SZMA 1VYZA 1ZYLA 2YABA 1PXLA 4RIXB 4BCGA 5E1SA 5A46A 3RMFA 2WNTA 3C51A 4YHJA 3FMLA 3NW5A 5E91A 3BU6A 3BHUA 4DEIA 3DBFA 5ANJA 5KUPA 3CS9A 2UZTA 5LMKC 2F7XE 4F0IA 3DAJA 5LMKA 2CLXA 2PUPA 2DUVA 3IOPA 3RHKA 4CZUA 3FQSA 1DAYA 3HEGA 3V51A 4D1ZA 4XJ0A 3PA5A 2IN6A 3FMNA 3F3UA 4LMNA 3OZ6A 1GOLA 2SRCA 4BGQA 3NYNA 3A7JA 2WU7A 3JYAA 3PY3A 3ZOSA 4I6HA 3AMBA 5HCYA 4PX6A 2XIKA 4PNIA 3ZO1A 3VRYA 2R3PA 4J96A 4DCEA 4OTQA 3H9FA 4WSQA 3CP9A 3TIZA 5GIOE 4IAIA 5KZ0A 2XBJA 3IDBA 4BI1A 2PE1A 2YM7A 4AOIA 1BUHA 4JDJA 4M69A 3CKWA 3OXTA 1JNKA 1P4FA 4GYGA 4K77A 4CT1A 4UMUA 3ANRA 5IA0A 2X81A 4NW6A 4IE9A 5DN3A 5EYKA 4D2WA 2VGOA 3G2FA 4CTCA 2H6DA 3BBTB 4AT5A 3L8VA 3FMKA 1UKHA 3G51A 4QMOA 4Z9LA 3BE9A 3HKOA 3JY9A 3NW7A 3F5GA 2ITXA 2YCSA 3D2KA 1FOTA 4Q2AA 3Q5ZA 3A99A 4AZEA 4FIIA 2RIOA 4D9TA 3POOA 3UOHA 1JQHA 4XV3A 4E7WA 2X9FA 3MGYA 4IVBA 3KRWA 4O7VA 1G8SA 3SGCA 4OAVB 2JKOA 3HDMA 4KABA 2WEVA 3QHRA 5FRIA 4AE9A 5IQHA 3D15A 4ZS0A 4MXAA 1DAWA 4EBVA 4C2WA 1OM1A 4RZWA 2O8YA 4FSWA 3EYGA 3R21A 4AA4A 4ENYA 5EOLA 2C68A 4F7NA 2WO6A 5IH4A 3W2RA 2X0GA 5K5XA 1BYGA 3KMWA 5KMMA 2WOUA 5F95A 4RRVA 5JRSA 3FLYA 2C0TA 2J0MB 5CS6A 3W8LA 4EZ7A 3PJ3A 4P90A 5HCXA 4CQEA 3TDWA 2BRHA 3FKLA 3PG1A 4XS2A 2J50A 2BR1A 4R8QA 4V0GA 3FUPA 4E93A 2B53A 3ZBXA 4BC6A 4FVPA 4Q5EA 3LFNA 2P55A 3CC6A 4GUEA 5C03A 2XK9A 4L42A 4ZSEA 4JR7A 5AP2A 3ODZX 4MBJA 3UYTA 2CKQA 3LPBA 3DLSA 2BDFA 4DFBA 2PK9A 4MXXA 3KFAA 2DQ7X 3LXKA 1ZLTA 4MD9E 4DH5A 3R1NA 4LRKA 2VTTA 3UZPA 4JG6A 4LL0A 1YW2A 2WMRA 2AC5A 5TO8A 3SXFA 4G9CA 2PUIA 2B52A 3FWQA 3O2MA 3SOAA 1KUTA 5FQDC 5EFQA 1Q61A 2EB3A 4AA0A 5HICA 5L4QA 3U54A 2G2IA 1WVYA 3I79A 2FA2A 5AJQA 4UB7A 3PFQA 3ATTA 3OOGA 5I9VA 4N4SA 3FY2A 5EHLA 4J99A 3BWJA 2ZV8A 4XUFA 2BFXA 4MQ1A 1IAJA 4L68A 2Z2WA 3I7CA 4QYGA 3UODA 4O0WA 2ZVAA 4EC9A 4EZ3A 2W96B 5DR6A 4AGWA 4BGHA 4ZTNA 5CAVA 5CAPA 4CFUA 4ITHA 4R5YA 2ITQA 4ZTQA 1OKVA 2HELA 2XKDA 4D2TA 4F9WA 4FEUA 4KA3A 3F2AA 4O0TA 3KXXA 4C3RA 4DEHA 2PVJA 3E8EA 1WBOA 3S0OA 5C8NA 1YDRE 3TKIA 3R2YA 4JIAA 4C35A 3FLNC 3HAMA 2PVLA 2GQGA 2YDKA 1M2PA 4FTOA 4MXOA 1R0PA 4UMTA 3R71A 2ZOQA 2R3JA 4IB5A 3UQCA 4IM0A 3R9NA 2Z8CA 2R64A 4FSYA 2PVMA 2YAAA 4FIEA 3R1SA 3MFSA 2IO6A 1ZOGA 5IU2A 2BMCA 5IQCA 4WHZA 1GY3A 5CLPA 4JLCA 3P7AA 4NKSA 1WMKA 2FVDA 4U7ZA 3N4UA 4WT6A 5B0XA 4F08A 4CFWA 4IWDA 3LFEA 4I92A 3B8QA 4ZZNA 4I21A 2BUJA 3UOLA 4BWKA 4UX9A 4K8AA 4FV0A 3QRJA 2RG5A 3H4JA 3EOCA 4RIYB 4E4NA 4BCHA 4XG3A 3TZMA 5IKWA 2XEYA 4IZYA 4AZTA 4DEGA 4ZMEA 5HD7A 4EKLA 4G34A 4RVTA 4D1SA 1JSUA 5CZHA 3AC1A 3SVVA 1I44A 2HWOA 3Q5IA 4IB3A 4MH7A 4UXQA 1WBTA 3G0EA 4QMUA 4M0YA 3VQUA 4B8LA 4BDGA 1H1WA 2Q0BA 3EHAA 4HYHA 4QMNA 2IW6A 2PZIA 2VX1A 4JOAA 2X7GA 4P2KA 4WG5A 3LW0A 4O0SA 4UWYA 3NUPA 3LHJA 3COIA 4DFLA 4TWPA 1GNGA 4TWOA 4TN6A 4G31A 3AD6A 3CJGA 3GNIB 5BPYA 5AIKA 2CNVA 5HX6A 1M52A 5BVKA 4YO6A 4UWCA 3QCSA 2VTIA 4E8AA 2I7QA 5CEKA 2F57A 5K9IA 4TRLA 2W1HA 4EOLA 3CTJA 1MRYA 4B8MA 5CX9A 4ZJJA 2F7EE 5FEQA 4YJRA 4AX8A 4EJNA 5J9ZA 4JX3A 4OR5A 2J0IA 2C47A 4ZTRA 3UNKA 5CY3A 4CD0A 4DCAA 2VWIA 3ZSHA 4QO9A 4HCVA 4DT8A 1UNLA 2VTMA 5CVGA 4HVGA 1A9UA 1KOAA 3OOMA 1T45A 3WZUA 4D9UA 4A9SA 3WZJA 2ETRA 4CGAA 3QZIA 5EDQA 3QF9A 3C4FA 4OTRA 1E9HA 3DFCB 1K3AA 3R00A 4BVUA 1MQBA 3IONA 4HYIA 3O23A 1M7NA 4I20A 3BQCA 4YZDA 4HVHA 3ZLSA 2VTPA 2I40A 3W10A 3W1FA 1YVJA 3C0HA 4J95A 1Q99A 1MP8A 3EN7A 4WUNA 5T3QA 3VBWA 2GHMA 5JKGA 3W8QA 4XRLA 5J5SA 5J7HA 3P86A 3QQJA 3VJNA 4WD5A 3TUDA 4DE4A 3AOXA 4QMMA 1U4DA 4XG2A 3LQ3A 3LE6A 2EUFB 2W0JA 4FTKA 1DS5A 4H3QA 3RM7A 3R22A 2V7OA 4QMVA 4YC8A 1GIJA 3O71A 4HNFA 5HVYA 2R4BA 4FTAA 1BX6A 2JD5A 1OBGA 3QRTA 4YJSA 2WQOA 3V5WA 4C61A 2XKFA 1QCFA 1ZOHA 5FXRA 4C3PA 4ZJIA 5DG5A 2X39A 3KRRA 1S9JA 4LGGA 3UMWA 4G16A 5KO1A 2W99B 3NLBA 5J1VA 4GK3A 4F1TA 3HMMA 3OCSA 2XB7A 2YITA 4FT5A 1OL5A 4UZDA 4C34A 1Z57A 5DEWA 5LXMA 5EQPA 4M0ZA 3FZ1A 4BCFA 4OUCA 4YMJA 4IANA 2J4ZA 3FZRA 4FVQA 5M57A 5BMSA 2YDIA 4B0GA 5FG8A 2X4FA 4GUBA 4ZP5A 3KEXA 4XHKB 3UGCA 4G6LA 1Q41A 1QPDA 4BCKA 5AV4A 4KRDA 3KULB 4PPAA 4AAAA 5CU3A 1ZZLA 4HOKA 4EH5A 3C4EA 3P79A 3KN5A 4QTBA 4RQVA 4F09A 4O1OA 2FB8A 3QRUA 2I0EA 4PRJA 2WKMA 4FV5A 3WIGA 3GP0A 5H8EA 2GCDA 5CT0A 5ETCA 5HESA 3OF0A 2J90A 2C5VA 1OUKA 3QTZA 2VTAA 1IRKA 4A9TA 2IZUA 3M42A 4BCQA 2ITUA 3BGPA 3OY3A 4RJ7A 4DTAA 2CLQA 4IX6A 4J71A 5KMKA 3FY0A 4ZTLA 1PKDA 5HGIA 2C30A 4W4YA 3KN6A 5IA4A 2X8EA 4IFCA 4JRVA 2W1IA 4JG8A 4W8EA 3UPXA 2HZ0A 5CF6A 2BALA 3GCQA 5L2TA 2W1GA 3P78A 3GGFA 5K4JA 3RAHA 5JZNA 2QHMA 3CKXA 3DB6A 4RVMA 4I94A 4UBAA 3SV0A 1WAKA 3RNYA 3UNJA 4O21A 4BI2A 1MQ4A 1UU9A 3ULIA 4AZVA 4OTDA 4KIPA 3C4XA 4FKJA 4FSRA 3KVWA 1BL6A 3OEFX 5HBHA 2UZNA 4QNAA 3CSVA 3LLAA 4EOSA 3BV2A 4AFEA 3SHEA 5CVHA 2YDJA 5AEPA 4AN9A 4OTHA 4EOQA 4YJNA 3DBEA 3TJDA 3LFDA 3TV4A 4AXAA 2F9GA 4BTFA 1FVRA 2YA9A 3QQKA 2XK3A 1OL2A 4RWJA 4FK6A 3EN4A 4XV1A 2EU9A 3A7HA 2UW5A 4AW0A 3VS2A 2XMYA 5FP6A 2ZDTA 1KE5A 4XV2A 4DG3E 4IC7A 3EN5A 4P7EA 4HVSA 2YJRA 4EH9A 3D5WA 4XX9A 2JDOA 1OL6A 4IM3A 4BZDA 4N0SA 3QTIA 3K3JA 5C26A 5BVDA 3CGOA 2OW3A 2OJFE 2YM6A 4O0VA 3F7WA 4FC0A 4QMYA 2X7FA 3FKNA 2CSNA 4QTEA 4RJ8A 4FL2A 4KIKA 3PIXA 4LOOA 2X2LA 4MWHA 3KK8A 5AAEA 3OFMA 3I7BA 1QPEA 3LXNA 4FT0A 2F49A 4QPSA 3NCGA 4B9DA 3DPKA 4IQ6A 5CQUA 3QTUA 5JGDA 3CTHA 1ZAOA 2WELA 4OTPA 4O7YA 2WPAA 4GK4A 4HVDA 3B2TA 2OO8X 3WF8A 5FLFA 4L6QA 4ZJVA 3PXFA 3M1SA 1JWHA 3KCKA 1R3CA 4FIFA 4W9WA 3UZTA 3FHRA 4DGLC 3IW5A 4JDKA 4MWIA 2YIQA 3L9NA 5C4KA 4GV1A 5B2LA 2BAQA 4EH4A 5HCZA 5HQ0A 4LUEA 2VWUA 3HV6A 2GFSA 2BRMA 3MA6A 3QRKA 2Y4PA 4RJ4A 3GT8A 5E8WA 3TNHA 2ESMA 1JKSA 4IX3A 4DLIA 4ALVA 3CD8A 1JKLA 5HEZA 4EOIA 5IUIA 1XBBA 3R02A 3F69A 4UZHA 2C4GA 2JIIA 1Q8YA 4I24A 4Z3VA 3AGLA 4XG8A 2R2PA 4HGTA 3FV8A 5CI7A 1XO2B 2QOIA 3BBWA 5CEQA 4GT4A 5JH6A 2Z7SA 4K33A 4LYNA 4RC2A 4YJVA 3R7YA 5CWZA 4RLLA 5I9ZA 2GS2A 4CCUA 3RZBA 5LWMA 3PPZA 4FG9A 1XBAA 3MY0A 2RGPA 4AZSA 1DM2A 5EYMA 2CKEA 2XUUA 3FXXA 4S31A 2HWPA 3BU5A 5IISA 3GU4A 5IMXA 2WMSA 2V55A 3AT3A 3L9LA 5C01A 2HAKA 5CASA 5HLWA 4L3JA 4PDOA 3VHKA 4H1MA 4V05A 4X3FB 4RQKA 4Y8DA 3R8VA 1PMVA 4UXLA 3F3ZA 5T68A 5M07A 4FT9A 4MCVA 4F6WA 4D2RA 4F65A 2J5EA 3QQHA 3CPCA 4IEBA 3VUMA 4EOPA 4ANLA 2PMNX 1ERKA 3PYYA 4F7SA 3UC3A 1IASA 5AX9A 4WRSA 2F2CB 3HMIA 4J52A 5BUEA 4I4EA 3Q4UA 4YZBA 3V6RA 4A9RA 1RQQA 3UQGA 4N57A 3BEGA 1TQMA 2UZBA 1Q62A 3E88A 4DA5A 2REIA 4EH3A 4C62A 3LJ1A 5L6WL 3VS7A 2BRGA 5DHJA 4I6QA 2PYWA 2O3PA 2C6IA 4DTBA 5FDPA 1LUFA 2QR8A 3ORLA 4XOZA 4E73A 1F0QA 5CVFA 4II5A 4FEXA 3FQHA 3C4ZA 3ZHPC 4O7ZA 3DLZA 2B1PA 4QYYA 3NSZA 4M8TA 4RIWB 2WTVA 4DEAA 3QXOA 4FKGA 4RVKA 2OZAB 4KNBA 3ZFYA 1PXNA 4XG6A 5B2KA 4AZWA 2PZPA 4BDHA 4RWIA 1FGKA 3P5KA 4ZLYA 4E4LA 3NX8A 3CY2A 3NVKI 4IMYA 3PXZA 3FQEA 4EK6A 2ZM4A 3PRFA 2VTRA 3CGFA 3BE2A 4X2JA 2BILB 2WIHA 5CQWA 4IZ7A 5G6VA 2P2IA 3U51A 4NL0A 3KXGA 3I1AA 4W8DA 4IWQA 3TTIA 2IW8A 2FYSA 3LCTA 4E4MA 3F3VA 4I6BA 1JAMA 4KWPA 4S2ZA 4A07A 1OL7A 4DH7A 4RLKA 5HTBA 2CDZA 4RVLA 4IH8A 3DU8A 3ET7A 1YKRA 4O1PA 2WAJA 3OBJA 2PUUA 2X2KA 2PULA 3W2PA 4BBMA 4BL1A 2ITNA 3KB7A 4K18A 3UG2A 4IX4A 2WZJA 4OTWA 2HW6A 2EXEA 1X8BA 2JDRA 3BEAA 3FMDA 3R7VA 2LGCA 4IWOA 4I5HA 2XNPA 4GT5A 4GMYA 3B2WA 5FM3A 4ZOGA 4QMTA 3EQFA 3AMYA 1H1PA 1OKZA 3V8WA 4C02A 5JN2A 3QL8A 3RKBA 4BCNA 1NY3A 5M4UA 5IMEA 4KRCA 2XK6A 1YRPA 2UW7A 3NNXA 1SM2A 2OIDA 3HRBA 3PG3A 1P2AA 3BI6A 2DWBA 4FNYA 2HCKA 2VO3A 3WE8A 4CLIA 4DGGA 5C27A 2RSVA 2JAMA 3O8UA 4BDIA 4TW9A 5IZFA 3GCVA 4JXFA 3BCEA 4X7QA 4X6QC 5IH6A 5LVLA 2V7AA 1OVEA 5FXSA 2BPMA 2J0LA 1WFCA 1MRUA 1Z9XA 3DCVA 4YU2A 4D28A 4TY1A 3E3BX 3JPVA 4X21A 4GKHA 5M09A 4EYMA 3GU5A 3PE2A 4NKAA 2ZV9A 4E5AX 2YWPA 4K6ZA 3LXLA 5FEEA 2XIYA 2OH0E 3MV5A 3R0TA 3EMGA 3D14A 3DDQA 3Q9ZA 4PMSA 4ITJA 5HNBA 4O2PA 2C6KA 5CT7A 3EQPA 1FPUA 2BAJA 2VX3A 3QX2A 4H05A 3EH9A 2OI4X 3QWJA 3H9RA 3ORTA 3G6HA 5FM2A 1PXIA 3NIEA 3MVHA 1XKKA 2XK7A 2GMXA 4AOTA 1IR3A 3LMGA 2BHHA 1B38A
chains in the Genus database with same CATH superfamily
1G5SA 3Q2MA 4XLIA 2XJ1A 4JDIA 1SVHA 4M69B 2C3IB 3MPMA 3VUKA 3E8DA 2OK1A 4H58A 3E7OA 3BYOA 4XG4A 2ITZA 3K5VA 1A06A 5BYZA 2UVXA 4IB0A 3QHWA 2WEIA 1XWSA 1Q8ZA 4CKIA 4GG5A 3EKNA 2R3FA 3MN3A 4EUTA 3PA3A 4FOCA 3MBLA 3MVMA 4JMQA 3HMNA 3F7ZA 4FVRA 3HVCA 1BL7A 2JFLA 5GJGA 3OWKA 4YSJA 2QODA 3DZQA 4PL4A 3VNTA 4DGMA 2NRYA 5IQFA 1PJKA 4EH2A 4FKIA 4UWBA 3UIBA 3ZCLA 3VIDA 2C5YA 1AGWA 5DEYA 1ZARA 5HE0A 4QPAA 2X0QA 2CPKE 5L3AA 4G6OA 4BB4A 1OITA 4MF0A 2YM8A 1LEZA 3A4PA 4U3YA 1I09A 3DAKA 5AUUA 5CSVA 4EHVA 1ZOEA 2R3LA 4M68A 3TACA 5DIAA 4A4OA 4GH2A 4G1WA 4JS8A 3LZBA 3ZO4A 5CXZA 5AR5A 3EL7A 5HG5A 4QMWA 2ONLC 4C4IA 3VWAA 4L3LA 4EZ5A 3ZXTA 4V0GB 2ONLA 4WSYA 5GNKA 1P5EA 3DTWA 4TT7A 3UO5A 1HOWA 2G01A 2PHKA 4F0FA 2XP2A 4ASEA 4D4SA 1Y8GA 5EHOA 3QGYA 3KQ7A 4FE2A 2XEZA 4Y73A 4BWXA 3TZ8A 5B2MA 5K5NA 4O7WA 4LGDA 5EDPA 4L9IA 3ORZA 5D9HA 4BTMA 2BDWA 3RPOA 3SA0A 2UW3A 4EH7A 4EHEA 3KA0A 4JQ7A 4FTIA 5D10A 3FMHA 4DDIA 4FOBA 4RG0A 5ANIA 4DF3A 4MKCA 1F3MC 1SVGA 3VUGA 5JEBA 1J7UA 2C3KA 4DGOA 4QEBA 4TNBA 2C3LA 2WMUA 4I22A 4S33A 2YWVA 3TI1A 3GB2A 3WILA 2G2FA 4FK3A 2CCHA 2WMVA 4I6FA 2EWAA 2P33A 3RPRA 4DH3A 3BLRA 1L8TA 4L7SA 2JFMA 2BKZA 5EQEA 3ZBFA 4QYFA 4A9YA 4QMQA 3OCBA 2QR7A 3FDNA 4PV0A 4YLKA 2RF9A 1SNXA 4AOJA 3ZUVA 2HZ4A 5HI2A 4E6QA 5J9YA 4CMTA 4WO5A 4AAYA 2JAVA 3GBZA 3FL4A 3LFQA 5G1XA 4APPA 3PVBA 1Y6BA 1VYWA 2BTSA 4O2ZA 2PZYA 2X7OA 4RA5A 3G5DA 3VONA 4TZRA 2JBPA 5HO6A 4RSSA 4RWLA 1VZOA 3DA6A 3PY1A 5F94A 1STCE 3I4BA 4GSBA 3WI6A 3EZVA 5EKOA 3KVXA 4HPUE 3ZU7A 2RFEA 4BDKA 4OBQA 3VBVA 5JFWA 4IVCA 3EQBA 4IAYA 1AQ1A 5M53A 4M15A 3H0ZA 4FIHA 2W1DA 3VUIA 4O7TA 3CQUA 5HNGA 1PHKA 4F99A 2W5BA 1ZMWA 3ZM4A 4JL9A 3UOKA 5CI6A 1KOBA 4QQCA 5L8KA 4ZTMA 4I4FA 5IA2A 5I9WA 1PMNA 4QT1A 4JJRA 5J7BA 4FMQA 4HGEA 4J97A 2R0IA 4U3ZA 2CGXA 4DHFA 4ASDA 2E2BA 4QMXA 2FSTX 4P4CA 5HBJA 4FI1A 4QNYA 2FSLX 1XBCA 2A19B 4PUZA 5HHWA 5C8MA 4TKSA 3DY7A 4ACMA 4H3BA 4DFXE 4FKQA 3O50A 2VV9A 4LL5A 4O6LA 2PVHA 3HP2A 3LFSA 4MNEA 4C4HA 3CR0A 3E8CA 1YQJA 3DBQA 4C37A 2OZOA 3KXMA 3A2CA 2PVFA 3PY0A 3MVJA 4E26A 4RIOA 3U6HA 3QTRA 3ANQA 2R5TA 4AWIA 3IO7A 3D7TA 2PZ5A 3NWWA 4R7IA 4XG9A 4WA9A 4FYNA 4WNPA 1WBPA 4NWMA 1U46A 2QOBA 5JZJA 4QP4A 1REJA 3P08A 3SC1A 3LXPA 2HYYA 2OXDA 2GSFA 1ZRZA 2Y0AA 4X3JA 1QL6A 5AR7A 4D0XA 3UE4A 3WE4A 4QQJA 3EFWA 5AIRA 4YTCA 5JQ5A 3O96A 4IAKA 3I81A 5HLNA 2VTJA 4MEDA 3LOKA 3VHEA 3ZZWA 3LJ0A 3W18A 3IW6A 4GVAA 4C7TA 4F9BA 3DT1A 5FP5A 4XCUA 1OIRA 2XIRA 3EQDA 4QMSA 5AP3A 5CU0A 4O22A 4XMOA 1YI6A 3FKOA 2V0DA 3LAUA 3U4WA 3NUNA 5CTPA 3R6XA 5FEDA 1RDQE 5GJFA 4BY9E 3UDBA 3TNIA 4NUSA 4BRXA 5A6OA 2VO0A 3R8MA 4TPTA 1ZMVA 1H07A 2WTIA 1GJOA 3CBLA 4F0GA 4C4JA 2PVNA 1G8KA 3PXQA 3ACJA 1H00A 3CXWA 4NFMA 2GU8A 3U9NA 3QQLA 4WIHA 1OIUA 1U59A 1URWA 4JBOA 5I9UA 2V5QA 5CSHA 3TZ9A 2WD1A 1T46A 4B4LA 5DR9A 4TWCA 5HG9A 4Y5HA 3PWYA 2HY0A 2XYNA 4MUQA 3A62A 4C4GA 2UW6A 1U54A 3VS6A 3R30A 4Q9ZA 1PYXA 5LVPA 4PPCA 3O7LD 2PU8A 5M08A 3FAAA 4K1BA 2QU5A 4R3CA 3EFLA 3LCSA 4O38A 3BGQA 2HK5A 3C5UA 3FI2A 3D83A 4ZSJA 3L1SA 4O82A 4UY9A 3EB0A 2XS0A 3S3IA 4IADA 4RX8A 2W9ZB 4RWKA 4B7TA 5CNOA 5HG7A 1O6LA 1TVOA 4S32A 3V3VA 4BIBA 5DLSA 4HCTA 4GU9A 2QI8A 4U9AA 5BVNA 1QPCA 2RKUA 2VTSA 3D9VA 4GEOA 1UNHA 2JEDA 3QUEA 4EONA 3OTVA 1NT2A 3ID6C 1TQIA 2VO7A 2R7BA 1ATPE 1ZYCA 3HRFA 3PZEA 5EM5A 2FGIA 3ORPA 4LRJA 4CSVA 4I0SA 3QKLA 4JX7A 2O5KA 5H2UA 4E6DA 4R7BA 4FV6A 4IBMA 3O17A 4YC6A 3VO3A 2A2AA 3SD0A 2B54A 3KY2A 4UMRA 5JFVA 3A7FA 3U55A 2CMWA 2I0VA 4J53A 1KE6A 1XH8A 3OTUA 3E62A 2Z7LA 1CDKA 1QMZA 4KINA 5CYIA 5AMNA 5IA3A 2QOKA 4AP7A 1SNUA 4O7SA 4W9XA 4FTJA 4LOQA 2QC6A 3KXNA 2B4SB 3AD4A 1NVSA 3Q9XA 2LAVA 4LV8A 3QA8A 4WOVA 4JT3A 3BLHA 5AP0A 2C69A 3UIUA 2QOCA 3NIZA 3RPYA 3MY1A 5L8LA 4X2KA 2O2UA 4LRMA 2OGVA 5I5ZA 4NK9A 5I3OA 3UBDA 2WFYA 4FKVA 3Q3BA 3EN9A 3IGOA 3O8PA 5KMLA 3F6XA 4A9UA 5KCVA 3KF7A 5D12A 5J79A 2OJJA 3HUCA 3T9TA 1PXJA 2C6DA 4YPSA 4YO4A 4U45A 4L44A 3DKFA 4AN2A 1WBSA 3MWUA 2CKPA 4O0XA 4LI5A 2J51A 3ZLXA 3FEGA 4QP2A 4QOXA 4NFNA 3THBA 2R3NA 3VBTA 4AGDA 4NW5A 2VAGA 3NUYA 4QPMA 5BMMA 4NT4A 3ZSIA 2FUMA 4XBUA 2GNLA 4IDVA 3R8LA 5A3XA 2G1TA 4XOYA 5F4NA 4KIQA 2XIXA 4YBJA 3R1QA 4EWQA 4OTIA 5DT4A 5H3QA 4GKIA 2X6DA 5HE2A 3DKOA 4Y46A 3WBLA 5DWRA 2ITVA 4YTHA 3W2OA 2YM5A 4RMZA 3BL9A 4X2GA 4GW8A 2AC3A 3C5IA 2H96A 1KWPA 2HENA 2QKRA 5BYLA 3ZMMA 5DYJA 4F6UA 4CRSA 4EUUA 2BROA 3MPAA 4FF8A 3VBQA 4E5WA 3BU3A 1OIQA 2W17A 3QA0A 1Y8YA 3JUHA 4M12A 4EK4A 1BLXA 3E92A 1ZMUA 5AUWA 3ZO3A 4D5HA 5A9UA 3JVSA 2UW4A 5HO8A 4WRGA 3RK9A 5HTIA 4PP9A 3RNIA 2W1EA 4KIKB 3BYSA 5CNNA 3EJ1A 3CD3A 3G33A 4QMZA 4AW2A 2IVUA 5L2SA 1XH7A 3ZH8A 4LQMA 4CVAA 2B9HA 1ND4A 2YCFA 5ICPA 3FI4A 3PIYA 1R1WA 5ETIA 5KX8A 3NMUF 2XZSA 5D41A 5DRDA 3TV6A 3KRXA 5HU3A 2G9XA 2WIPA 2FSMX 3GU7A 2J6MA 2WGJA 3G9NA 4FG7A 1UU7A 4AFJA 1TFFA 5E4HA 4Y85A 3CQWA 5ANKA 3EQHA 4EOOA 1CTPE 3DDPA 4NTTA 4APCA 2VU3A 1K2PA 1GAGA 3EL8A 5HU9A 2UV2A 3KXHA 3ZUTA 5DH3A 5C1QB 4FT3A 1UKIA 4F6SA 3DJ5A 1GZ8A 4GVJA 5K3YA 5EOBA 3S2PA 4F9CA 5A54A 3GOKA 4ZY5A 3PP1A 2OJIA 4O86A 3DJ7A 3ORXA 1XR1A 2QOQA 3SG9A 2VWVA 3D94A 3E63A 3KMUA 4EK3A 3QTSA 3TNWA 1G3NA 1K9AA 4C33A 5H8BA 3AXWA 2XRUA 3FYJX 3ENHA 3KKVA 3R8PA 5CF8A 4BR3A 3QKMA 4GFOA 3VUTA 1FMKA 4G5JA 4BCOA 4PL3A 3F2RA 4I0RA 4QP1A 4NM3A 3N4TA 4BYJA 5CAUA 4IW0A 5BNJA 3F2NA 3HRCA 4F4PA 5FDXA 3UZRA 1Y6AA 3W32A 3G0FA 2R3GA 3SKCA 4BHNA 3ML1A 5DA3A 3QC4A 2O0UA 5EG3A 4U44A 5C9CA 2P0CA 3R7GA 3R7UA 3E64A 2VRXA 3SXRA 3M2WA 2C6OA 1M2QA 3GC7A 2QVSE 2XANA 5AFVA 1CKJA 3PJ8A 2H9VA 3ZRKA 4QTDA 3TT0A 3TWJA 1URCA 4FL1A 4OW8A 3L9MA 2Z7QA 2YHVA 4HW7A 3OW3A 2WTKC 4JBPA 3WARA 1YWNA 1VJYA 3PTGA 4QYHA 4FTQA 3QCXA 2E9NA 4MXCA 2VX0A 1FQ1B 4G3DA 2PVYA 3A8XA 3FMMA 3Q6WA 3LCDA 2XCKA 4IAAA 3F66A 4GCJA 2XALA 3E5AA 3TKUA 4BGGA 3QUPA 4BTJA 4CG8A 4BCIA 4G5PA 4RJ5A 5CANA 2DYLA 3H9OA 2Z60A 3MS9A 3QC9A 3FE3A 4DYMA 3I6UA 3T8OA 3KF4A 2PE0A 3F82A 4BIEA 4LV7A 3CLYA 3DXNA 3UPZA 4DC2A 3IGGA 3ZEWA 2R3IA 5IQDA 2UZVA 4NSTA 4OT6A 4IB1A 5ANOA 3N51A 3QD0A 4OLIA 3FZPA 2ZDUA 1KE7A 4C4FA 2UZUE 5A6NA 1XH4A 2PY3A 4LMUA 3IDCA 3TUCA 3RP9A 4YBKA 4I6LA 2XNNA 3QGWA 3RI1A 3PWDA 3RAIA 1O6YA 4L3PA 4CFFA 5J1WA 4IZ5A 3WF9A 1Y57A 1BI8A 4DBNA 3DAEA 1SMHA 3LM5A 4QMPA 3BIZA 2H8HA 4UMQA 4UMPA 4KKGA 5D7VA 5IG1A 4IXPA 4FIJA 1NVQA 1J91A 3EIDA 3ZTXA 3PUFC 2XNOA 3HYHA 1Q8WA 3MH3A 3ORNA 2HIWA 3AGMA 2VWBA 3D5XA 3E93A 5DBXA 2BDJA 5EW9A 3S4QA 4ANBA 5JGBA 1PYEA 2XAOA 4QDEA 4BBEA 4DEDA 1E1XA 4K2RA 2ERZE 2GTMA 3TTJA 3BZ3A 2H34A 1NXKA 3DKCA 5ACKA 4FKWA 3MSSA 2ZM3A 1VR2A 3IG7A 5DT0A 2XCHA 5TOZA 5AP4A 3C4WA 2WQBA 4M97A 4TYHA 3QCQA 2PL0A 5AR3A 4O0RA 2QHNA 3GU8A 5KHWA 3RK7A 4AU8A 2VN9A 4YP8A 3LM0A 4CLJA 5KMNA 2W4JA 4NU1A 2Y4IC 4EH6A 3G9LX 3PSBA 4UALA 4EK8A 2VUWA 2UW8A 3AQVA 4O96A 2IG7A 3QYZA 1R39A 2PVRA 4EEVA 4QTCA 5E8YA 3UNZA 4G3FA 3NDMA 3Q60A 1JKTA 4H1JA 5LWNA 1BMKA 3DBCA 3NNUA 3NUUA 2I0HA 4YLLA 3DNDA 4MTAA 1XH5A 2O64A 3D4QA 3ALNA 3R8UA 4ASZA 5LVMA 2XNBA 3IW4A 2Z7RA 4EOMA 5FGKA 3NZ0A 2E9VA 4CNHA 4JAIA 4ZY6A 2X9EA 3M11A 3VS3A 5AA8A 2A0CX 3PVGA 5EDRA 3PDTA 3FLSA 3BYUA 4PP7A 4YSMA 4GJ2A 2BKKA 3AC3A 4PDSA 4QP3A 5M4CA 3UQFA 5K4IA 3PLSA 2A1AB 1YHWA 3U6IA 1OL1A 4Q5HA 3F88A 4L7FA 3ROCA 3ZC5A 2C1AA 4U8ZA 4GIIA 1PMEA 2OKRA 3AC4A 3V5PA 3E3PA 4IACA 5K0XA 3O51A 3NCZA 3C9WA 4RC3A 3RALA 4BF2A 4FGBA 1R78A 2YLEA 3LVPA 3MH2A 4IC8A 5JT2A 4PTCA 4RBLA 5LMBA 3IDPA 4FSQA 1YXSA 4PY1A 3ROYA 3V5JA 4YNOA 4YJUA 4M3QA 3GQIA 4P5ZA 4PF4A 1OUYA 1YHSA 3U9CA 4E1ZA 2PMLX 3KGAA 4HYUA 3RPSA 5A4LA 4USFA 3RM6A 4U40A 4XNEA 4L45A 5LMAA 5BUJA 5IUHA 2QKWB 1APME 4NM7A 2QO9A 1VLRA 5F1ZA 1DI8A 2Z02A 1O9UA 3F5XA 3BPRA 3C0IA 3MTFA 5AADA 4U0IA 3SW7A 3T3VA 1Q4LA 2QU6A 3OHTA 2BTRA 2R3RA 5HE1A 4IWPA 4YGAA 3BQRA 4ZZOA 1WBNA 3JXWA 1HCLA 2QG5A 1OZ1A 2QOFA 4ALWA 4G6NA 3CY3A 4DFZE 3BX5A 3FXWA 3TIYA 5A14A 4FEQA 3K54A 4BZOA 4AGUA 1KV1A 3OVVA 4IDTA 2UVZA 2YISA 3R01A 4TTHB 4BWPA 2VTNA 5KMIA 5TR6A 2WMTA 3KK9A 3P4KA 3PE1A 3UDTA 4D58A 5I3RA 4XYFA 3AT4A 3C50A 4F9YA 3TG1A 4FKPA 4ZLZA 1O6KA 3OC1A 5IA1A 3W0QA 2OU7A 4FJVA 3UIXA 1GIIA 5L2QA 3F3TA 3WIKA 3LFBA 3PP0A 3JR1A 5EI2A 5TT7A 4PTEA 2CNQA 3DB8A 5E8SA 3ENMA 4EI4A 2QQ7A 1MRVA 4FNXA 4NIFA 4Y72A 2OG8A 4ASXA 4O27B 3P0MA 5AP5A 3QQUA 4FUXA 5AUTA 3S00A 2OLCA 2C6LA 3HUBA 3IQ7A 5IQBA 2F7ZE 1W83A 1YHVA 2ZV7A 3HMOA 4E4XA 4EWHA 2ZAZA 3NAXA 4ZEGA 5CXHA 4YURA 4A7CA 3MB7A 2QG7A 5A4QA 1WBVA 2CNUA 3WF7A 3GENA 4J98A 4QMLA 1YDTE 2PVKA 5AV3A 5A4EA 2GHGA 2WMQA 2X8IA 4XH6A 1XJDA 2GNGA 2J0KA 3F5PA 3Q4TA 5AV1A 3ZZEA 3BKBA 5IEYA 3FL5A 3HX4A 2YM4A 4LFIA 4RZVA 5TKDA 1OGYA 5JSMA 4FL3A 3OWPA 3SG8A 3F5UA 4U41A 2YEXA 4HPTE 4AE6A 5I4NA 3CE3A 3PJCA 4KBAA 4PPBA 1PKGA 2W06A 4FKTA 5BQ0A 1SVEA 4HCUA 3SAYA 3NNVA 5GZ9A 5FTQA 2VGPA 3W16A 4YC3A 5IH5A 3ZDIA 3FC2A 4KSPA 3ETAA 3MY5A 3QD3A 4U6RA 5AWMA 4C36A 2WTJA 5LQFA 4CCBA 4BDBA 2E9PA 4NYEA 3QZGA 3MVLA 3K3IA 2GDOA 1FGIA 1KE9A 1Q3DA 3GI3A 3IK3A 3W0NA 2ITTA 5AV0A 1UA2A 1H0VA 3AT2A 4ANMA 4O81A 3QAME 2AUHA 3UO4A 4JG7A 4TXCA 2JC6A 5EM8A 4MD7E 4NM5A 4GRBA 4DEEA 3LQ8A 4MXYA 4U43A 5LARA 3GFEA 4C2VA 2KULA 2ZB1A 4DDGA 2W5AA 3PRIA 4JIKA 3QFVA 4AUAA 3R63A 3KMMA 3AMAA 3WZKA 2WTWA 5EI8A 5AP1A 5IA5A 2GNJA 1Y91A 4YZ9A 3ZS5A 3FBVA 4FBXA 3SRVB 4YZCA 1NW1A 5CEMA 2OFUA 2V62A 2PTKA 3QD4A 4YZMA 2CCIA 2A4LA 3COHA 3QZFA 4CQGA 4GL9A 5AR4A 4RX7A 1IA8A 1V0OA 4JR3A 1Z5MA 3GC9A 4X6RA 4XP3A 5LJJA 2R3HA 4MNEB 5L2WA 4U97A 1CKPA 3Q52A 1H08A 3ORKA 3NYVA 5AP6A 3ZFXA 1U5QA 3TNQB 4QD6A 2C5XA 1PW2A 4FKUA 4FSNA 4G3CA 4QP6A 4U81A 5EHYA 5LCKA 5C4LA 3AC5A 4FZDB 3WOWA 4EJ7A 4FYOA 4BDCA 4HYSA 2VO6A 3OS3A 4CFVA 2JIVA 3D7TB 4EOKA 4IAZA 1W7HA 3VW6A 2PZRA 2VTLA 5IUGA 3KCFA 3FMEA 4YJQA 3FXZA 3FJQE 2YM3A 4FKOA 1XH9A 3ORMA 5F9EA 3LQ5A 3R7EA 3A7GA 5FD2A 2WXVA 4XRJA 5HOAA 4D4VA 3Q53A 2BFYA 3NUXA 4BKJA 5JMSA 4N6ZA 3VN9A 3BYMA 2R3QA 4L8MA 4KS8A 4G9RA 3UP2A 1OPJA 4RJ3A 3UC4A 2CGWA 4U79A 5D11A 1KE8A 4O83A 1OMWA 3IOKA 3V01A 5L2IA 2JIUA 4AXEA 4DGNA 1W82A 2BIKB 2XH5A 4EHGA 2C5OA 2VZ6A 2J2IB 3NAYA 1IEPA 4L43A 5I9XA 2EB2A 5HBEA 4AQCA 1FVTA 4MXZA 2J9MA 4WNKA 2EXCX 3QLFA 4I3ZA 3O7LB 4OBOA 1XQZA 4S34A 5E8XA 5HD4A 2OIQA 3HGKA 3VS0A 4ANSA 3OG7A 1UVRA 3P7BA 3DXPA 4RJ6A 4JVGA 5GHVA 1M14A 2OF4A 2XK4A 3MTLA 3AC8A 3EYHA 4DTKA 4EQCA 4J1RA 1MUOA 1PXOA 3F61A 3PPJA 4ONAA 3WYXA 4I93A 4FV2A 4D4YA 5KMOA 2ITYA 1PXKA 3H10A 3OCTA 3UDZA 3TM0A 4AN3A 4CXAA 1OI9A 2WMBA 3HAVA 4NEUA 1U54B 1P14A 2NNWB 1B6CB 2OJGA 3VULA 5EM6A 1NA7A 4FICA 2WTDA 3QZHA 4QRCA 3UG1A 4QQ5A 4W4VA 4WBOA 2ZMCA 4ORKA 2BZIB 5E8UA 5AR2A 5HVKA 5HZNA 4C8BA 5CALA 4QDVA 3VRZA 4DT9A 2IEWA 2ZMDA 3R2BA 1WCCA 3D5VA 4XLVA 3FYKX 1FVVA 2Y7JA 2QLUA 1FMOE 3NRMA 4IZAA 4F7JA 4UN0C 5EQYA 2W7XA 3C7QA 5HG8A 3NGAA 3P7CA 3BELA 4N70A 1Q5KA 4FTNA 4I5MA 5CSXA 3SW4A 3V6SA 4EQUA 4XBRA 4ZMFA 5BVOA 5FTGA 4O84A 3SRVA 5F20A 4FKRA 2R3OA 3GVUA 4D4RA 3HV4A 4IJ9A 2YIXA 2BAKA 3EFKA 3QQGA 4QYEA 4F70A 1BI7A 2Q0NA 3FZSA 4EK5A 3TYKA 3I0QA 4IHPA 3DGKA 4GK2A 2NP8A 3HNGA 1H25A 3RK5A 2OFVA 2ZB0A 4FNWA 3OMVA 5AX3A 4C0TA 4DAWA 4K0YA 4BCMA 1FBNA 3A7IA 5DGZA 4F9AA 3VS1A 4DEBA 4IIRA 1YWVA 2GFCA 3IW8A 3QLGA 2JKKA 2CN5A 2OWBA 4JQ8A 2QOOA 3DQXA 3TV7A 4BI0A 3HZTA 4CT2A 2O65A 4JRNA 5LOHA 3MDYA 4PQNA 2B0QA 1ZYSA 4WG3A 4G3GA 4FA2A 4C59A 2XYUA 1L3RE 3DK6A 2OIBA 4W4WA 5TE0A 3SDJA 3SX9A 4ITIA 2RL5A 4EL9A 3MESA 5FUTA 3UOJA 4USDA 3D0EA 4W4XA 4OTFA 4BFMA 3D5UA 3I0OA 4OGRA 5E8ZA 2YERA 3NUSA 2XNMA 3GEQA 2IZRA 2FSOX 4RFZA 4AA5A 5KZIA 3PUPA 3EQGA 4EKKA 3U8WA 3F3WA 3W2SA 4OBPA 4USEA 3RVGA 4XG7A 1SYKA 4KAOA 4H36A 5CEPA 2IVTA 3MA3A 5BUIA 4QQTA 4PWNA 5EYCA 2IZTA 4Y83A 4FV8A 3ZLWA 1H8FA 4AG8A 4E6CA 4Z7HA 5EM7A 5GZ8A 2XA4A 5E7RA 5H8GA 2UW9A 3R83A 2GNFA 5HLPA 4I5PA 5M56A 4CFMA 5AP7A 1S9IA 1JKKA 5M06A 3E87A 3PZHA 3ORIA 3DFAA 3ZEPA 4BKYA 3FZTA 3PXRA 4H39A 3Q9YA 5HO7A 5IF1A 3Q9WA 4PMMA 3TXOA 3GXLA 5A4TA 4E20A 3AD5A 4AW5A 3LIJA 3ZDUA 1OPKA 3TJCA 4BHZA 1Q3WA 2PUNA 1UV5A 3BHYA 3DV3A 5HORA 4HNIA 3GFWA 1R0EA 2XKEA 4FV9A 3QYWA 4GFGA 5CZIA 2Y6MA 3T9IA 4RA4A 3OP5A 4MYGA 4RIXA 3KREA 4LDTA 4RX9A 3FSKA 2BIYA 3S95A 3QTXA 1RJBA 4C58A 2B9JA 5M51A 4C3FA 4RX5A 3O5AA 2C6TA 2Y8OA 4BJJA 2HOGA 2IWIA 3CPBA 4ALUA 3HV3A 3K2LA 5EK7A 1YOJA 3LFCA 3C1XA 4ERKA 5I9YA 4YJPA 1TZDA 4GFMA 3BLQA 1CM8A 2R3MA 2YCRA 3COKA 3AG9A 4FTUA 4O4BB 5HIBA 3T3UA 5JQ8A 1G8AA 3A8WA 3C4CA 4TYGA 5DOSA 2IVVA 1Q97A 2QURA 5C8KA 4OTGA 4HVIA 3CCNA 3Q32A 4HGLA 1CMKE 2NPQA 4DH1A 4YTFA 2Y6OA 3G15A 3MH1A 1H28A 2QCSA 2VD5A 1YXTA 2OSCA 3OWJA 5ANEA 4PMTA 1F5QA 4B6LA 4UEUA 2YJSA 2ZYBA 3NEWA 4QTAA 3TKHA 1JSVA 2WQNA 3CIKA 4FZ7A 1YDSE 1ZY5A 2HXLA 2QONA 3PXYA 2HZIA 3QCYA 5AM7A 4D5KA 3R9HA 1XH6A 4U5JA 4FR4A 3TL8A 2YCQA 4FSZA 4FSMA 4NM0A 1J7IA 5AUZA 4RFYA 3WYYA 2X6EA 5DNRA 3OY1A 4AW1A 3BHVA 4YTIA 3ULZA 5ITAA 5J95A 3FPQA 1ST0A 2E9UA 3O8TA 3PJ1A 4AZFA 2QOLA 1FINA 2JLDA 2RG6A 4FV3A 5CSWA 2B7AA 2VWWA 3RTPA 4ANNA 1JPAA 2UUEA 2WB8A 4RC4A 3UP7A 3QRIA 4FUYA 4EYJA 2R7IA 4F78A 1Q8UA 5KMJA 2C6MA 4DHZA 3PIZA 2GPHA 4ACDA 4ACGA 4CYIA 4M13A 4TYIA 5L8JA 3R73A 4HZRA 4YNEA 3W0PA 2ZV2A 5AAGA 4AACA 3COMA 3Q4ZA 4O91A 3HV5A 3U87A 3B8RA 2HZNA 3DOGA 2I1MA 3I5NA 3MFTA 4BBFA 4L53A 3GC0A 5FBNC 3NYXA 4I23A 3SXSA 3FLZA 1H24A 2GHLA 4DN5A 2FO0A 2WQEA 3SOCA 3LJ2A 3ZLYA 5BYYA 3OWLA 5J5TA 4O6EA 5JRQA 3ZSGA 2GTNA 3BHHA 4RT7A 3VVHA 2WTKB 4WNMA 2XRWA 3FZOA 3W2CA 3MH0A 4KS7A 1CKIA 2JITA 4ZXTA 2P2HA 3DBDA 3OXZA 3Q04A 2Q83A 3C0GA 4LUDA 4ZSAA 5DMZA 3UVRA 1OBDA 1YI4A 3LFFA 3ODYX 3NVMB 2XIZA 5E90A 5HIDA 3OBGA 5CEIA 3VW8A 3GCSA 4O0UA 4ZK5A 3HMPA 4FEWA 3ATSA 5HNIX 3UO6A 1J1BA 3ACKA 3R9OA 2OH4A 3R7IA 4R77A 3RCJA 1IAHA 1YXUA 4L46A 4DH8A 4DHIB 2WMXA 2CGUA 3ALOA 1YXVA 2QOHA 4KKHA 4CV9A 5IQIA 3RJCA 3LMHA 3JS2A 4CZTA 4FZAB 1GZNA 3VUHA 3BYVA 3GC8A 4G17A 4BKZA 4A4XA 4Z16A 4IM2A 4NZWB 3DZOA 5CAOA 3FSFA 4D2PA 4ERWA 4JAJA 3WZEA 4DINA 5CENA 3VS4A 1XMLA 4TYEA 2RFNA 2VTOA 2W4KA 5CU2A 3EWHA 4ENXA