1MRVA

Crystal structure of an inactive akt2 kinase domain
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
294
structure length
261
Chain Sequence
b'VTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-beta serine/threonine kinase
publication title Crystal structure of an inactive akt2 kinase domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 67
structure length 261
sequence length 294
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1mrvA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1mrvA02
4JBVA 5HTIA 1T46A 3UBDA 2QHNA 5M4CA 3HVCA 4O6EA 4NU1A 5KZ0A 2B9FA 5HORA 4YBJA 4DAWA 3ZDUA 4V0GB 5L8LA 4KSQA 5CWZA 1IEPA 4R6VA 4ANNA 2BRHA 5K0XA 4O81A 3QKKA 2BFXA 1R0PA 4YZNA 5TR6A 4AZFA 5C8KA 5KHWA 3KXXA 3O2MA 5FP6A 5I9UA 5IQFA 4Z9LA 4QT1A 4U42A 2NP8A 4FSTA 3SA0A 3GOPA 3LCDA 3TNQB 4EL9A 3QTUA 4FYOA 3QKLA 2OJFE 4KBAA 4AE6A 4TYEA 3UQGA 2OF4A 1O6LA 4P7EA 3HMOA 4QQTA 2Y7JA 3EYHA 4D55A 4WSYA 2FVDA 2HXQA 1M2RA 1W84A 4PNIA 3Q9WA 3MPAA 3QX4A 3TZ9A 5K4IA 3BE2A 4YP8A 4D9TA 4HNIA 4J7BA 4O0VA 3S2PA 2C5OA 3R2BA 2ZYBA 1ZYSA 4RWKA 1ZXEA 4EI4A 2XUUA 3CTJA 4JNWA 3C4FA 2AC5A 4IFGA 3R8VA 3KEXA 4F9WA 4W4WA 3LW0A 4U80A 3QQJA 4G3FA 4R78A 3BEAA 5L8JA 2R3QA 2BDWA 3DS6A 3LZBA 3E92A 1CKJA 2O2UA 4FT5A 4I94A 3KMUA 4BB4A 4BBMA 4Q9ZA 2WQEA 1K9AA 4E73A 3PYYA 4USFA 2NO3A 3NGAA 2ZVAA 4EH6A 4RT7A 2OIBA 5AIKA 3QUDA 3H0ZA 1F5QA 4AGCA 4EH9A 3WOWA 1SNXA 2VTJA 4O7YA 2OJGA 3FYJX 3HDMA 2XKDA 4FKVA 5AP5A 5HE3A 2XK9A 2WTDA 2PZYA 4AFEA 2J2IB 3ORMA 4CG9A 2C5YA 3EMGA 4BTMA 2QOBA 3BHHA 3FKNA 4RIXB 2XNPA 3R30A 5C01A 4B6LA 4EORA 3EQCA 4PV0A 3L9MA 5HIBA 1L3RE 4NKSA 4PMTA 3FY0A 1LR4A 1KE8A 1VR2A 5HLNA 3LMHA 1JKKA 2R5TA 4CMTA 2CCIA 4O82A 4D2WA 4MCVA 3T9IA 3G0EA 4U43A 2UZEA 2YLFA 3JYAA 3WI6A 4GKIA 2RKUA 4FI1A 4Z16A 4PX6A 2HOGA 4WKQA 1Q41A 2UW0A 4DT9A 1OL1A 1QPEA 3HMPA 4JDJA 3Q4UA 4PTCA 3R9DA 4D5KA 2R4BA 3KC3A 1OM1A 2JKOA 2X6EA 4FYNA 4HZRA 4I24A 3TUCA 2Z7QA 2GS2A 5CVFA 5KUPA 1BUHA 3K5VA 4IH8A 5HNIX 5IA1A 2OXDA 3DOGA 4ASDA 4OTGA 1OIUA 2ACXA 2HY0A 3QRKA 4MNEB 4YO4A 5HX6A 2R7BA 1PYEA 2VUWA 2ZMCA 3PVGA 4QMMA 3F9NA 3PE2A 3LOKA 4F09A 4IWQA 4DITA 3TUBA 4IX6A 3UIXA 3VW8A 3AC5A 4EYJA 3ZRKA 3RNIA 4UALA 4E4LA 3FY2A 4R1VA 2IZTA 3U54A 3QD0A 2J5EA 2Z7RA 3HUBA 1GNGA 3EOCA 3KXGA 2BKKA 3O23A 2UV2A 1IA8A 4FUYA 3ORKA 4K11A 4YUQA 1HCLA 3R7YA 2J0JA 4C02A 1KSWA 4LFIA 5KE0A 2Z2WA 5KMKA 3T9TA 4FGBA 3K54A 3RPYA 4ZSJA 4Z55A 4PWNA 4X21A 2C0IA 2E9PA 1NT2A 4A07A 2C6MA 3CBLA 4RRVA 2RFEA 4YJRA 5DA3A 3LCTA 2Y9QA 3QTIA 4IZ5A 3EFLA 2VWYA 5K5XA 2YDKA 4ARKA 2YM7A 3TM0A 4XUFA 4JT3A 3VQHA 4CEGA 3GU4A 2EXCX 3BV2A 3FZPA 4JDKA 1HOWA 3RZBA 4BKJA 3QQUA 4E8AA 4W9XA 4FZAB 2Y4IB 3JXWA 4FTCA 2Y0AA 3DBQA 3LFCA 3EQDA 4BTKA 2J9MA 4QNAA 3VUMA 4EKLA 2GQGA 2QOLA 2R3RA 3C0IA 2Y4IC 4CD0A 4EK3A 3LFNA 4R1YA 4GVJA 4LMNA 4PDSA 2IG7A 1Q24A 1Q8TA 2XMYA 4GH2A 2H6DA 4JDIA 4BGGA 1S9JA 2GPHA 3SX9A 4FE2A 2GFCA 1OVEA 4DEGA 3EFKA 2W5AA 3PZEA 3KVXA 4CV8A 4O7NA 1DI8A 5J8IA 3AMYA 3I4BA 4M97A 4NZWB 4B8LA 3ROCA 1CSNA 3W2QA 1PF8A 4NEUA 3F2AA 2X2LA 3HV6A 1XJDA 4XHKB 5A3XA 3V5TA 4HGTA 3B2WA 4JG6A 2FGIA 3I6WA 3PUPA 4PMMA 2B9JA 3B8QA 3UJGA 4DHFA 2BFYA 4L3PA 4F1OA 1FVTA 3EN6A 5AUWA 4N0SA 3M11A 5DH3A 4GT3A 1F0QA 4RX5A 4ZAUA 5A6NA 4F6SA 3PXFA 5A14A 2WTJA 4BIDA 4EEVA 1W83A 4EHZA 3F6XA 3K2LA 1MQ4A 5E4HA 3NIZA 2OXYA 2R0IA 5E9EA 2EVAA 1OIRA 3IW5A 4O7TA 5D9HA 5A4TA 2CCHA 2IVUA 3NLBA 4O7SA 2R64A 2FH9A 4DLJA 2XIKA 4N57A 3H30A 4GK2A 2PVLA 3NYOA 4QD6A 4YTFA 5AR8A 2PHKA 1U46A 2PULA 4MHAA 1APME 2VX1A 4R7HA 5LJJA 2F4JA 1PHKA 3R1SA 1XR1A 5T3QA 3NUNA 4MK0A 5I5ZA 4XG4A 2VO3A 4TWNA 5AAEA 5JZNA 3OWPA 4QPMA 4AGDA 3E3PA 3KRXA 5EW3A 1K2PA 4RVLA 5CI7A 3DZQA 4NIFB 4ALWA 4BICA 4U40A 2XIXA 4GUEA 5FG8A 3VQUA 2QG7A 5KBRA 3F3ZA 2C4GA 5JFSA 4K2RA 5DOSA 1W98A 2R3IA 2UVZA 4K33A 3TG1A 4ASZA 3IW7A 3CC6A 4FIHA 4IAZA 3CP9A 3NW7A 4I41A 1STCE 2IZUA 3EWHA 4EKKA 4FIGA 2HK5A 1OL2A 3UO6A 1KE9A 4FKPA 3IDPA 4AT4A 5I9XA 1YI4A 3HV4A 2YM3A 3LFQA 5I9VA 5DWRA 4E93A 3JR1A 3MB7A 4PPCA 2QODA 5L6PA 3CCNA 5IQGA 3IK3A 5DR6A 5CY3A 1OITA 3PJ1A 2ITVA 4A06A 4FEXA 3D5XA 5JFWA 5DG5A 2XNOA 3QXOA 4FL1A 3RAKA 4J97A 4EH3A 3DB8A 4RX8A 4AA0A 3RAIA 1ATPE 5IQBA 3EFWA 4OW8A 4CSVA 1CMKE 1PXJA 2DYLA 3PJ2A 4TYGA 3B8RA 1PMEA 2YCRA 4ZSGA 5AP2A 2X7FA 5J9ZA 3HECA 3KA0A 5IMEA 1V0BA 4EOSA 4WNMA 4QYGA 3VS6A 4ACDA 2UZTA 3AD4A 3N51A 4XBRA 4DBNA 4P2KA 3EKNA 5KMMA 4IX3A 1Y6AA 2ETKA 3ZLWA 4TW9A 4H58A 3ZM9A 4PRJA 4RWIA 3QRJA 3BYOA 3HLLA 3VW6A 3PLAE 1CM8A 2VAGA 4P90A 3TCPA 3CSVA 5J5SA 5EHLA 1J1CA 3ZMMA 3RM7A 4J95A 2QKRA 4GMYA 5HO6A 1U54A 3FL4A 3RNYA 1R3CA 3HZTA 3KK8A 3D15A 5HOAA 3VF9A 2RSVA 3ZFXA 3ORTA 3C4XA 3KL8A 3LXNA 4QP8A 5H9BA 4FV0A 5T6KA 5LMKC 4AA5A 4R8QA 2GS6A 3IDCA 5EI8A 3WF8A 4AOJA 4FKWA 3V5JA 5F94A 2WOTA 3G33A 4KABA 4ZIMA 4IBMA 4EOIA 3BRBA 2YIRA 2VWIA 4RJ7A 2Z8CA 3PSCA 4K9YA 3ZYAA 5HU9A 4KB8A 4RQKA 2ESMA 3HYHA 4TYJA 5LCKA 1JWHA 2CJMA 3WYYA 2XIZA 2WIHA 4CTCA 5CU2A 5DRBA 4QMTA 4FKLA 5L2SA 4QP6A 3IW6A 3D5WA 2PZPA 4XOYA 4KS8A 4ZZMA 5IUIA 4GKHA 4NM7A 2FSLX 4LRMA 4IXPA 2ZAZA 2QR7A 3CJGA 4P5QA 4QQ5A 4ZSEA 5JGAA 2O3PA 4QMXA 3O8PA 3HKOA 4V0GA 3A8WA 4UYAA 2PUUA 4FSNA 2SRCA 3MFTA 3QUEA 3THBA 4D2PA 4YPSA 3FPQA 3PPZA 4IZAA 3S3IA 2KULA 5AMNA 4ZSLA 2UW5A 2VTAA 4FKOA 4J98A 1WBVA 5ANEA 4DCEA 4QP3A 3BLHA 4ZS4A 4DT8A 4J1RA 1R0EA 4C0TA 4XG7A 4G9CA 4QMZA 4UMQA 3FLSA 2VZ6A 2WMAA 3QKMA 3WZKA 1Q3WA 1JKTA 2BTRA 4II5A 4DTAA 5AP7A 2ITTA 3B2TA 3ORNA 4Q2AA 1YWRA 4O91A 4R7IA 3REPA 5B2LA 3R9HA 1RJBA 2BZJA 5M4UA 3Q5IA 4BKZA 3F5PA 3C4WA 4PUZA 4IHPA 2OWBA 4QOXA 5CYIA 3HV3A 2CGWA 3EN4A 5LVNA 5DRDA 4WG3A 3MFRA 3V01A 3PA4A 3VNTA 3C4CA 4YZ9A 3WF7A 4FT9A 2IVVA 5GIPE 5LCJA 4U44A 3VN9A 5JGDA 5KCVA 3S0OA 2ZDTA 4NWMA 3HA8A 3Q53A 2VWVA 5ETFA 4IQ6A 2OJIA 3ORLA 4HW7A 2WB8A 4BDIA 2ITWA 2C69A 5IH4A 3HV7A 1OUKA 5IA2A 5JT2A 3TACA 3I0QA 3POOA 3FDNA 4GU9A 4OR5A 2Y6OA 2C6KA 3OT3A 4DTBA 3CD8A 5LQFA 3ACKA 2G01A 4MXZA 5BUIA 2C3KA 4EWQA 4DEAA 4FSRA 4J99A 3H10A 5DMZA 2XCHA 1R78A 5HVJA 2CGVA 3NEWA 4RWJA 4KKGA 2I7QA 3EL8A 4EZ7A 4RIXA 4S31A 2O0UA 4TWPA 2QI8A 4BIEA 4CFMA 4IVBA 2YCFA 5M55A 2VWBA 2IN6A 2RG6A 5EHYA 4E5WA 3N4VA 3V6SA 3AXWA 1YDRE 3GU8A 4EQMA 4O0RA 3CE3A 3KXHA 2E9OA 4WRSA 2CGXA 3E63A 4AOTA 3MSSA 4AQCA 3ZHPC 3EYGA 1H1RA 2BIKB 3ZS5A 4UZDA 4EQUA 3QRUA 3MIYA 2X1NA 2XBAA 1YXUA 4XCUA 4I23A 3RTPA 1LEZA 3R7IA 5D41A 4CG8A 4L01A 3FQSA 2QQ7A 3A2CA 4AGUA 4BBFA 2OJ9A 4NW5A 2PPQA 2WQNA 2JITA 4P5ZA 1E1XA 4GFMA 3A7FA 4XMOA 1SYKA 4O0TA 2O5KA 3FMEA 4LYNA 3PE1A 3U6IA 2I0EA 4C4GA 2UW7A 4JAIA 1RE8A 1SVGA 4HYSA 5KHXA 5AUXA 2PY3A 2WELA 3BYSA 3BBTB 3LM0A 2ZB1A 4MNEA 3MH0A 3QX2A 3Q2JA 3OVVA 3FMDA 3FMNA 4YJTA 5AV0A 4IDTA 2PVHA 3C9WA 2JAVA 4DFBA 1Q61A 1E1VA 3DU8A 3ZEPA 5HE1A 4BGHA 5BVEA 3F7ZA 3VBWA 3GGFA 3ULIA 3M42A 3QD2B 4XG6A 4DBXA 3TL8A 3VJNA 3VUTA 4DEIA 2IVSA 2WMQA 3CPBA 3G9NA 3LCSA 4GT4A 4OBOA 3PVBA 4L00A 5K3YA 3NUYA 4DFXE 4IE9A 4U9AA 5HO8A 2LGCA 5BMMA 2WOUA 4EJNA 2VWZA 4EZ3A 2BHHA 3HP5A 3BBWA 5LVPA 4RVMA 2IZSA 4FTUA 3HL7A 3CJFA 3KY2A 3SOCA 2WTKB 3UPZA 2PUPA 5JRQA 1GZ8A 1PW2A 3LXLA 5C27A 4BCIA 3TV7A 3RPVA 3CQUA 3V04A 3DKCA 4RG0A 3CY3A 2EU9A 2PVFA 4TPTA 3FC1X 2WTKC 2C6OA 3FE3A 3ZO1A 4A9RA 3ORXA 3GQIA 3BU5A 4KBCA 4KBKA 4R3RA 4BTJA 1H1QA 4MNFA 4ANLA 1URCA 2GNGA 4F63A 4ZJVA 5AX9A 4FG8A 1BKXA 3T3UA 4G2FA 2F2CB 3HA6A 3PIYA 2W17A 3S95A 4S30A 3TN8A 4DLIA 1OL7A 4M13A 3BHYA 3G9LX 5F1ZA 4IDVA 1BMKA 2RF9A 3IPHA 1O9UA 4UEUA 5CSWA 3I5NA 4F1TA 4TKSA 4JX7A 5IQCA 2YAKA 3QA0A 3F88A 3N4TA 1EH4A 1NY3A 1YI6A 3HRFA 3MH3A 2JC6A 3C50A 3OBGA 2IJMA 3ENMA 4I5PA 5CT0A 1ZWSA 4BCHA 3PA3A 3FAAA 3GENA 2G9XA 3FZRA 4OUCA 1OBDA 2B0QA 3HEGA 1NVSA 4ZY4A 5D11A 2XM8A 4YJQA 4D58A 2RFNA 3QZFA 4FV7A 4C37A 4L52A 4UN0C 3VUKA 2QURA 3Q9ZA 3EQBA 4ZP5A 4RSSA 3A62A 2BIYA 3BEGA 2PVKA 4EHVA 2X8IA 3WF6A 4X6QC 1W0XC 2PK9A 4PDOA 4F6WA 4GSBA 5AM7A 4UZHA 5EYMA 5TKDA 2W0JA 3PXQA 4RC2A 2XRUA 2ERZE 4FX3A 4I3ZA 4A7CA 1DM2A 2H34A 4AA4A 4ZY5A 5A4CA 3FZ1A 3LFDA 3QYWA 3DNEA 2UZLA 3FL5A 3AD6A 4FT7A 2CNVA 5C1QB 2J5FA 3FBVA 5HD4A 5AV3A 3R7OA 4ENXA 4GCJA 4YJSA 1T45A 1BYGA 3ZUUA 3L8SA 3OF0A 2ETMA 2NRUA 2XK4A 4AZEA 1GIHA 4RJ4A 4O6LA 4BC6A 4O2PA 5AUVA 4D2SA 2WFYA 2XKFA 4RIYB 3I60A 3CKXA 4FK3A 3PIXA 2YIYA 3R8ZA 3MESA 3HUCA 3TDVA 3UG2A 5HG5A 1Q97A 2C5VA 3MIAA 5C26A 2YISA 3O50A 5H3QA 3OXZA 5ETIA 4RA4A 3FMHA 3KU2A 3VS3A 4BDAA 5AADA 3C5UA 4RJ3A 3RHKA 4WNKA 4C4HA 4XYFA 2DQ7X 2BCJA 2F7EE 3HAMA 1M17A 5H8GA 1BLXA 3BGZA 4ENYA 4JS8A 5ITAA 5CZIA 4NIFA 4C57A 2FA2A 3AG9A 4JL9A 4YZCA 5J5TA 2UW4A 3G6GA 1NA7A 2BDFA 3SXFA 4FV9A 3KFAA 4OTQA 4HVHA 3D4QA 4FG9A 3W2PA 4FEQA 3NAYA 5CEMA 3N9XA 1FBNA 1TQIA 4WBOA 3EFJA 3LXKA 5BQ0A 1TKIA 4RX9A 3JY0A 4HOKA 1JOWB 5CXHA 3ET7A 4GRBA 4I22A 4EOMA 4L45A 1QCFA 3BGPA 4M15A 2HYYA 2ITYA 2BZHB 5IQAA 3NPCA 5E8WA 4CT2A 5AEPA 1U54B 1ZYLA 4RFMA 4KKHA 1G5SA 2NRYA 2IVTA 4CCBA 3FLNC 3MB6A 3TI1A 4BDGA 4DGGA 3R21A 1PMUA 5M4FA 4J8MA 2YZLA 2GSFA 1Q62A 2WGJA 5FBNC 3PVWA 4H3BA 2PVNA 2JDOA 3OOGA 4MF1A 5EDPA 4D28A 4PPBA 4UWBA 5DLSA 2G1TA 3ZC5A 4EZ5A 2BAKA 2F2UA 3A7GA 4GW8A 4EC9A 4OAVB 1YW2A 4QP4A 4XG9A 4CZTA 3QF9A 4KS7A 4Y85A 3IW4A 1NXKA 3PIZA 4W4VA 4I93A 5LARA 4Z7GA 4F7LA 5IMXA 5EDQA 1YRPA 5IEYA 2JIUA 3UMXA 2JKMA 2R3KA 3BYMA 4F4PA 4FV1A 5M56A 3PP0A 2WMSA 4FTKA 3KRRA 4RVTA 2LAVA 1WMKA 4I5HA 5FEQA 3KULB 4OTWA 5IH6A 1ND4A 1Q8ZA 4JVGA 2VTNA 3AD5A 5LMKA 4FICA 4JQEA 3EZRA 3OBJA 3ETAA 5ACKA 3SW7A 4PMPA 4JOAA 2W4JA 2P33A 3VUGA 4IVDA 3WF5A 4M7IA 1SZMA 4GG7A 2E9NA 2JIVA 4GJ3A 5TE0A 1XBBA 5FQDC 4A9YA 4IC8A 2ITNA 2J4ZA 3QD4A 3SD0A 2XM9A 2WU6A 3BI6A 3ULZA 3BHUA 4NSTA 5DBXA 4YSMA 3K5UA 4ACGA 1DS5A 4IEBA 5AR7A 5FP5A 4WA9A 2A2AA 3QTXA 5AAGA 4PPAA 4O96A 4YLLA 3VS5A 5M08A 4APCA 3A7JA 4XRJA 4UY9A 4FNYA 3SQQA 1B38A 4XG3A 4FVQA 1OKWA 1S9IA 1V0PA 4YO6A 3G51A 4RLKA 3Q52A 3W55A 4YU2A 1P2AA 3C4ZA 4EHEA 3RM6A 4EOJA 2PE2A 2X4ZA 3KQ7A 2XJ1A 3G2FA 4NUSA 3U51A 3LQ3A 2WTVA 3FSFA 5L4QA 1B6CB 5ANJA 5E8TA 3BQCA 3G6HA 1KV1A 2WMRA 3GQLA 3O0GA 3TNPC 3BPRA 4OTPA 4UWYA 1GZNA 5AP4A 4PL5A 5HE2A 1JQHA 1OMWA 5A4EA 4PDYA 3NYVA 3UP7A 1XH6A 2FSMX 3WZEA 3NS9A 4Y5HA 3ZBXA 4ID7A 1BX6A 4M3QA 5A6OA 5E90A 2WEIA 4BCNA 2XNBA 5DGZA 4KRDA 3TKHA 5BVDA 2B9HA 3F5UA 3PVUA 2VTTA 1ZOEA 3FXWA 4MXYA 5FUTA 2JFLA 1VZOA 3P79A 4BWKA 1UV5A 4QP2A 2IWIA 3CD3A 3O7LB 3VBTA 4WNPA 3P0MA 3LQ8A 3JVSA 3VBXA 4CXAA 1MRVA 1M52A 4C34A 2HAKA 3PSBA 3OC1A 1UU7A 1Y8YA 2H8HA 3Q9YA 4FTLA 1WZYA 2ZV2A 3GBZA 3UDBA 4AXAA 4BDEA 4TWOA 2QOCA 4WNOA 4QMYA 1QPJA 4HCVA 3CIKA 4IACA 3R1NA 4C38A 3DGKA 3PY3A 4H1JA 2XZSA 3EJ1A 2EWAA 5I9ZA 5HQ0A 5BUJA 2YDIA 4V01A 2PZIA 2A4LA 4L3LA 3UTOA 3RK9A 3SXRA 1AD5A 3UVRA 2J7TA 4FKQA 1Q8UA 4G6LA 3RWQA 4AAAA 1QMZA 3UOLA 4C8BA 4XP3A 4CYJA 1RDQE 1PXMA 2HZ4A 2ITUA 2QU6A 2W1IA 1Y91A 3UIBA 4DGLC 3F2RA 5AUUA 3QTWA 4GV1A 5DN3A 3KREA 3ZUVA 3LM5A 3AT3A 4FL3A 4FTQA 2C6IA 4GUBA 5E8ZA 2WD1A 3KMWA 2RIOA 4JRNA 4ZTSA 4BHZA 5A4QA 1ZMVA 4FBXA 3R8LA 2JD5A 4Z7HA 5IA3A 1L8TA 2IW6A 3BGQA 4O0WA 3TJDA 1FQ1B 5BMSA 3LHJA 4N6YA 1OPJA 4FODA 4GJ2A 2GNJA 4EQCA 3U55A 4AN2A 4BZNA 4J8NA 4ACHA 4BI0A 3FI8A 2FB8A 3LFBA 3H9FA 2WMBA 3AC2A 3DJ6A 3DNDA 4FK6A 4R3PA 2GQRA 1I44A 3F69A 3U87A 3DBEA 4AW2A 4CFFA 4E6AA 1OBGA 3QHWA 4U41A 1ZYDA 3PPJA 3IO7A 3PG3A 5CU3A 4RFYA 2V55A 4AF3A 4Y72A 4LUEA 3UGCA 3DXQA 3QGWA 3P23A 2OH0E 4I5CA 2JDTA 5CF6A 5HG8A 5CANA 5CVGA 4TZRA 3QYZA 4F9YA 4LGHA 3C13A 2B53A 3QRIA 4IMYA 4PDPA 3I5ZA 2IPXA 4GS6A 3U9NA 4ASXA 2WEVA 4I5MA 4CQEA 4ZSAA 4PMSA 2PE0A 4U5JA 3PPKA 3VO3A 2VNWA 4E4NA 2J6MA 4ZTHA 4FEWA 5GIOE 1GJOA 2C0TA 3FI3A 4WIHA 5BUEA 4KIPA 2AC3A 2YZAA 4V05A 2OLCA 2X9FA 1YXSA 3BYVA 3KMMA 2Z60A 1OKVA 3GXLA 4O0SA 1FVRA 2XJ0A 3VS7A 5CASA 2UZOA 2W1HA 3G0FA 3RPOA 1ZARA 4PF4A 2ZM4A 5ANOA 5DIAA 3EQFA 2Y4PA 2CN5A 4AG8A 2UW9A 4QMNA 3NIEA 5EM5A 4BRXA 4RFZA 2VRXA 2WQOA 4JBOA 3WE8A 4UXQA 4O86A 2GTMA 5K5NA 1KWPA 4DG2E 3ROYA 2UZVA 5HIEA 3KN5A 4OTHA 5CT7A 4AZVA 3DAKA 2ERKA 3FV8A 3PRIA 3OT8A 3UP2A 4FR4A 2JKKA 4OLIA 3V51A 2OFVA 3G15A 3C1XA 5EOBA 4H3PA 3UZPA 3V5WA 5L2QA 2P2HA 3BU6A 2CLQA 3PDTA 3BV3A 1UKIA 3FKOA 4BIBA 3F3VA 4TL0A 5M4IA 3HMMA 1H0VA 1KOAA 3AT2A 4NFNA 3R0TA 4XV9A 5L2TA 2WAJA 2C1BA 4HVIA 4TTHB 4UV0A 3GCSA 5CU4A 5B2KA 1JAMA 3I7CA 2YWVA 5HVKA 5DPVA 3MW1A 3DTCA 3QLFA 1YHVA 4FTMA 4JG7A 3W8LA 2ITQA 1J1BA 1J7IA 2KTYA 1G8AA 4MXXA 5D12A 2XNNA 2C1AA 4U7ZA 5I3RA 2YIQA 2ZM3A 3H0YA 3RI1A 4R77A 4JAJA 2X2KA 5GJFA 2G2IA 2VTOA 5IUHA 4L67A 5AIRA 2J0IA 1YOMA 3CXWA 1YXVA 3GC8A 3COIA 4RVKA 3T3VA 2YM6A 3H4JA 1P14A 2VX3A 4FKIA 1IASA 1ZY4A 4DG0E 1NVRA 2QD9A 2R3OA 3QD3A 1WAKA 5DR9A 1PKDA 2OW3A 2PTKA 5D10A 4AT3A 3H9RA 4A4XA 2XK6A 4DEHA 2C3IB 3PXKA 5JFVA 1PXNA 3OHTA 4Y5QA 4ITIA 4IB3A 3V8SA 4AZWA 5FM3A 3A4PA 4RIYA 1REJA 5L6WL 5GINE 3C0GA 1WBNA 3OP5A 1SMHA 4G3GA 4E26A 4CLJA 4WHZA 3VF8A 3R8MA 2OKRA 1WBTA 4OTRA 3R8UA 3O17A 4HZSA 4FTOA 3BWJA 4FSUA 3GC9A 1OKZA 3M2WA 4MTAA 4G34A 4FV4A 4QMOA 4YNEA 2CKQA 3ORZA 2YCQA 3QC9A 3ZFMA 5ACBC 5JK3A 4LGGA 5J1WA 3Q4CA 5KKRB 3FLQA 4IAAA 4PL3A 3OCTA 3NYXA 3GT8A 1JKLA 3CLYA 2GS7A 5IQEA 3LLAA 3VAPA 3CQEA 3R63A 5AA8A 5KKRC 4FTJA 3PZHA 1AGWA 4M8TA 4TN6A 3TJCA 2UZUE 4PP9A 5IZFA 2YM8A 3LAUA 3ALNA 1TVOA 5CSXA 4YTHA 1WBWA 2WKMA 4FZDB 5FRIA 5EH0A 4AU8A 4G9RA 5AA9A 4I0SA 4HYHA 5L2WA 3DAJA 5IQIA 2BZKB 3NNWA 5CF8A 5CS6A 1OUYA 4XV2A 4CV9A 3LFAA 2CSNA 4MWHA 1YWVA 2C47A 4FKUA 4FKSA 4MD8E 3SDJA 1ZOGA 2UZBA 1UU8A 3O7LD 2UW3A 1M14A 4EHGA 3TEIA 3VUDA 2DS1A 5CTPA 4TYIA 4ZMFA 2J50A 4KUJA 2HIWA 4IVAA 2GHGA 3KXNA 4K8AA 5CI6A 2WZJA 3Q9XA 1MP8A 1MUOA 3I0OA 3KF4A 3NNUA 3O8TA 4U6RA 5AV2A 5FDPA 4M68A 5HCYA 1V0OA 3NNXA 5EI6A 4ZTLA 4O84A 4HJOA 3PP1A 2GNFA 5E1SA 4ZTMA 2C5XA 4IWPA 1G8SA 4MKCA 5CVHA 2QG5A 4ANQA 5FGKA 4NL0A 5ETAA 4EOPA 3A7HA 3RMFA 4EK5A 3KULA 1FOTA 5EG3A 3I7BA 5FTQA 2EXMA 3KKVA 4F0GA 2RGPA 4JBQA 4RZVA 3ZH8A 2CGUA 4S32A 3PFQA 3SC1A 3UC4A 3UZTA 3MDYA 2NPQA 1YHSA 4MBIA 3UE4A 4DN5A 3NDMA 5B2MA 3ZXTA 2PYWA 2C6DA 5IUGA 3RVGA 3ZLYA 3COHA 2UZWE 2VTRA 2WMXA 1MQBA 3OUNB 4BY9E 4BHNA 4BZDA 3TZ8A 3R7GA 4PNKA 3F2NA 4XBUA 1Z57A 5ANIA 4YLJA 3OOMA 3GC7A 4USEA 5IQHA 4BYJA 3V5QA 4EOKA 5EM7A 2WMTA 3W32A 4FSZA 4YC8A 4NTSA 5L3AA 3R6XA 3MFUA 4FV6A 4CMOA 4ONAA 2C6LA 4E1ZA 3TTJA 2UZDA 2ZDUA 5EOLA 4FTIA 4F9CA 3PRFA 1LUFA 2AYPA 4JIKA 2X7GA 3GUBA 3SKCA 3D5UA 4LMUA 4E4MA 4CZUA 1LPUA 5EK7A 5AR2A 3ATSA 5LMBA 3OD6X 4NM5A 3LVPA 3FLWA 4FV5A 3NX8A 4G31A 3IOKA 3F61A 3C5IA 4MF0A 2H96A 4WT6A 2W1CA 2C68A 1KOBA 4I6HA 3OXIA 3LJ0A 1H07A 3BYUA 2CKEA 3OW3A 3PXYA 2PVRA 3AQVA 4QQCA 5D1JA 2GNIA 2IO6A 1A9UA 3R73A 4IJPA 4KKEA 1J3HA 3PJCA 3E88A 4QPAA 4YJUA 1M7QA 5ANDA 5FEDA 4GG5A 5BPYA 1FPUA 1Q99A 1UKHA 4FV8A 3ZDIA 4F7JA 2XF0A 4Y46A 2QC6A 4FKGA 4G6NA 3ZU7A 4CFVA 4M12A 2QU5A 2WQBA 5CZHA 2GMXA 4C61A 3IW8A 5AV4A 4RPVA 4RA5A 3FZOA 2C3LA 2OJJA 3RINA 2W9FB 2YWPA 3AGLA 3OG7A 1YOJA 4H39A 2W06A 4YC6A 3OEZA 2F7ZE 3W1FA 4G3CA 4IJ9A 4XJ0A 3SHEA 5M57A 5AP6A 4P4CA 3F3WA 5FDXA 4J71A 2VNYA 3FMLA 4M69B 5BYZA 3VVHA 5JSMA 3QQGA 2XEYA 3EKKA 3P1AA 3GCPA 3PXRA 5B0XA 5KZIA 3FLYA 5CAOA 1ZOHA 5A54A 3MY0A 5GHVA 2WMVA 3G5DA 3UYTA 3EQPA 3L8PA 4AW5A 4BBEA 2EXEA 3A60A 3AMAA 2B54A 3BIZA 2BZIB 1IRKA 4YLKA 3BHTA 3AGMA 1FMKA 3UVQA 5ANKA 3E3BX 3RKBA 4CRLA 4MAOA 4OGRA 4FSMA 2XA4A 2G2FA 4I4FA 5HD7A 4B4LA 4CYIA 5HBJA 3SGCA 2XCKA 4LM5A 4HCTA 1A48A 4EH8A 4IW0A 4FTRA 4X7QA 3HV5A 4AX8A 4U3ZA 5E8SA 3D7TB 4CQGA 2QOOA 3OCSA 2HZIA 4BCFA 1Y6BA 2O63A 4GYIA 3R1QA 4RJ5A 5D7AA 4BL1A 1YHWA 3POZA 3HX4A 4GK4A 5CLPA 3W2CA 4E4XA 5IH5A 3O8UA 2XH5A 3PLSA 5G6VA 5J79A 4ERWA 1ERKA 4BZOA 3FYKX 1GZOA 4BCMA 3EHAA 2WHBA 5KX8A 4IVCA 4BF2A 4QRCA 4G6OA 3HGKA 3MPMA 5DFPA 3DY7A 4EH5A 5HG7A 2P2IA 1A06A 3V5PA 4CMUA 3JY9A 5EQPA 3WIKA 4DC2A 2XEZA 3FMMA 3VULA 4C4IA 5GZ9A 3OW4A 5A9UA 5AWMA 1OL6A 4ZJJA 4CFWA 4ZLZA 3ZSIA 3VRZA 3DA6A 3QTQA 2GNLA 3VHKA 4CRSA 4F64A 3LPBA 3DAEA 3WIGA 4ALVA 4QYYA 4E6DA 5LVOA 3PG1A 3PXZA 2PU8A 4MD7E 3P78A 4ANBA 5E91A 2C30A 2YAAA 4TXCA 5I9YA 3VBQA 4A9TA 4MVFA 4D1ZA 1ZMUA 2X0GA 5AV1A 4JDHA 3DFCB 2P0CA 2XIYA 4QMUA 4U0IA 3ZBFA 4BWXA 4EYMA 2VTIA 3P08A 4ZLOA 4S34A 4FIIA 5AUYA 5E8YA 4C3FA 4FZ6A 3U6JA 1Q5KA 1UA2A 2HZNA 2XVDA 2XNMA 4FOBA 3ZXZA 5K9IA 4XG2A 2RFDA 3RBWA 1GAGA 4XOZA 1ZLTA 4WUAA 4C2VA 5HCZA 4K6ZA 4B8MA 5CEIA 4YHFA 3ID6C 4YC3A 3MYGA 2WO6A 2CPKE 4LRKA 3IQ7A 2XS0A 4U97A 4ANSA 2QONA 4Q5EA 3GC0A 4I92A 4RWLA 5CEKA 3DT1A 4UMRA 4RIWA 4QP1A 4O7VA 2VTMA 3OTUA 3EQGA 4X3JA 3LIJA 4D4YA 4HCUA 1ZY5A 3QQFA 4WG4A 4EK4A 2RFSA 1DAWA 3H3CA 3BWFA 4BDFA 4FTTA 3RJCA 3WF9A 3CR0A 1H28A 4C58A 4L44A 4KSPA 4O0YA 3SG9A 2E9VA 3OFMA 3DQXA 4XLIA 2DUVA 4BDHA 4BCKA 4EOLA 1MRYA 2GU8A 5IF1A 3IONA 2VTHA 4WO5A 4DFYA 3OY3A 3ELJA 4L43A 3R28A 4HGLA 4QYEA 3ZONA 5EYCA 3V8WA 4DYMA 2V0DA 5JMSA 1MRUA 3FZTA 3N4UA 3KVWA 1KUTA 4DE4A 4MQ2A 4MXCA 2VO7A 5HTBA 1LEWA 5HZNA 5TF9A 2R3NA 3II5A 4H36A 4H3QA 4BI2A 4AT5A 4FSQA 4O27B 1K3AA 3IS5A 3Q4TA 5CAVA 1ZYCA 5IDPA 3R71A 3JS2A 5EKOA 4EOQA 3KRWA 3E8EA 4ZTNA 3TDWA 4BWPA 2CHLA 4O38A 4O7WA 3BELA 2WTIA 1Q8YA 5TOZA 5IA0A 3OXTA 2GTNA 3Q32A 3VS4A 4KRCA 2W9ZB 2XB7A 4W8EA 1W82A 3DDQA 3D83A 1PKGA 2W5BA 4ACMA 3LKMA 1GIIA 4AFJA 1WBPA 2W1ZA 4FC0A 5EKNA 5M51A 2W1EA 4E6CA 5EM6A 4C2WA 1CKPA 2JEDA 3PWYA 4DH1A 4FTAA 4LV8A 4D1SA 2OG8A 1U5QA 2JFMA 3SRVB 1JVPP 3QTRA 5JEBA 3VJOA 2NNWB 4IM3A 2CDZA 5GZ8A 4V04A 4QP7A 4FA2A 4W8DA 5K0KA 2V22A 3LMGA 3Q60A 4E6QA 3AT4A 4EH4A 3L1SA 4X6RA 5CQWA 3IKAA 1ZRZA 5HHWA 3QFVA 4JQ7A 4RMZA 4K77A 4DEEA 4ZEGA 4CVAA 2BROA 4BCQA 3R01A 3CGFA 3NRMA 5T68A 3PSDA 1YOLA 4G5JA 4L9IA 3BKBA 1B39A 1UU3A 2W99B 3NCGA 4BDKA 1IR3A 3DQWA 3FI4A 5C8NA 5KMLA 5IA4A 4S2ZA 2XYNA 4Y73A 5HESA 3FPMA 2Z7LA 1OPKA 3F82A 3COKA 2OSCA 1URWA 1UWHA 1LP4A 5L6OA 2F57A 2QKWB 3QCXA 3OTVA 4AS0A 5KMOA 3DK7A 2C6EA 4H1MA 5JFXA 4IANA 3UOHA 5B7VA 3MH2A 2Z02A 4FZFB 4DG3E 3C7QA 1QL6A 3QTZA 3UODA 2BTSA 3GCUA 3Q96A 3K3JA 4DGOA 1OGUA 4XV1A 2OK1A 3LE6A 3KXZA 2FSTX 3IOPA 3QXPA 3D0EA 4CTBA 4NYEA 4CCUA 4NCTC 4RLLA 3SAYA 4C4JA 4YGAA 2YCSA 2X81A 3OCGA 4QNYA 3UNZA 2W1GA 4EUTA 1PXKA 5CALA 5GZAA 1CDKA 1WVXA 3D2KA 4FZ7A 4NM3A 3TUDA 3MY5A 3OMVA 3GU6A 4HYUA 4KINA 4WUNA 4C59A 4D2RA 4F0FA 3ZLSA 1VJYA 4BDCA 4IFCA 3GU5A 4O2ZA 4UMPA 3IG7A 4QTAA 5LVLA 5ETCA 3D2IA 4FNWA 1H26A 3ZOSA 3QLGA 1H1WA 3FHIA 5CEOA 4DF3A 4RBLA 5FXQA 5HI2A 4D4VA 1CTPE 3QCQA 4MXAA 3QZGA 4L46A 5HNBA 4A9UA 4F9AA 4OTIA 3HAVA 3QZHA 4QYFA 5AX3A 4FSWA 1J91A 3UO4A 5HCXA 4WBBB 1WBOA 4UYNA 5CENA 3MGYA 3DPKA 3O96A 3S4QA 5C03A 4YJVA 1BI8A 2GHMA 3M1SA 2R9SA 2RG5A 3R02A 5FXSA 3GI3A 3VIDA 4A4LA 4X2FA 5D7VA 4DTKA 1JPAA 3BLRA 1P5EA 4FEVA 4X3FB 2IW8A 3KGAA 1H00A 5EW9A 5IEXA 2C0OA 3ZM4A 2ETRA 2UVXA 3Q6WA 4M66A 4QQJA 1PXIA 4X3FC 2BKZA 3L9NA 4X2GA 5H8BA 4O7ZA 5BX0A 2J0LA 2YM4A 3HNGA 2ZB0A 4GK3A 3DXNA 3E7OA 5J7BA 3LCKA 4I4EA 4R5YA 4RC4A 4PTEA 1XBCA 3PWDA 3FMKA 4LOPA 4BVUA 1FGKA 4LRJA 4CFUA 3MVLA 4HPUE 4HYIA 4NH1A 4AW0A 3EL7A 3WE4A 4O83A 4E3CA 1BL6A 1Q4LA 3NUUA 4IZ7A 4BCGA 5J9LA 4BFMA 2CMWA 3CS9A 1M7NA 5TT7A 4EUUA 3H9OA 4LUDA 5LWNA 5IG1A 3FEGA 1XH9A 2ZV9A 3FJQE 3TNIA 4BCJA 4X2NA 2GCDA 2I40A 4ZY6A 5JZJA 1O6YA 2VTPA 5BVWA 4XEYA 4IX5A 2PUIA 2XK7A 4WG5A 5M09A 3ATTA 5LWMA 2FUMA 1XQZA 3UC3A 4YR8A 5J7HA 1J7UA 3RWPA 3RPSA 3R2YA 1H8FA 2YIXA 3R04A 3R8PA 3SXSA 3L9PA 3LJ2A 4I6FA 4IB0A 5FBOA 3LJ1A 3DDPA 2GHLA 5KMNA 2ZOQA 1XH5A 2O8YA 3FKLA 3ZZWA 4WOVA 4YHJA 3CTHA 3TKIA 2ZV8A 3R9RA 4U45A 1GOLA 2UZNA 3E62A 3RP9A 4CKIA 5AP3A 1YKRA 3KF7A 5DVRA 3VUIA 4IAYA 4KIKB 4D4SA 4F65A 3RZFA 3SOAA 2HWOA 4U81A 2R3GA 4F6UA 5E1EA 2XBJA 4FEUA 1R39A 2X6DA 3KB7A 4Y8DA 2OH4A 2OBJA 3WILA 3W8QA 1YXTA 4IADA 1O6KA 4O0UA 3C4EA 4W4YA 3RK5A 4M69A 4CT1A 1Z5MA 3F3TA 5BVKA 4M0ZA 1UU9A 5I3OA 1XBAA 3KCFA 5I4NA 4EK6A 2OI4X 3LFEA 3I81A 2OZAB 3Q3BA 4A9SA 2PZ5A 4QO9A 3BHVA 4CKJA 3DKGA 1Q8WA 5LVMA 3BU3A 3ZC6A 5CQUA 1Z9XA 2F7XE 1OIYA 4IAIA 4LOQA 4NT4A 2Y8OA 4AACA 2YABA 4FL2A 4HGEA 4B9DA 4GIHA 2HENA 2YLEA 3EN7A 3KK9A 2GDOA 3MH1A 5DR2A 5HNGA 4EH2A 3IDBA 4YTCA 3Q2MA 2XRWA 2R7IA 2W4OA 2XIRA 4DINA 3EQRA 2A27A 3D7TA 3R7UA 2VO6A 4ZLYA 1P4OA 2F9GA 3ANRA 4I6QA 4F7NA 1P4FA 1XKKA 3E64A 5HEZA 3RCDA 4UB7A 4F99A 2YDJA 3BX5A 3E8CA 2J0KA 1RQQA 1Y57A 5EYKA 4OTDA 2VWWA 4XLVA 4EONA 3DKOA 1IAJA 2X39A 1XHAA 3E8DA 3Q6UA 4TNBA 5J87A 4I6BA 5DEWA 3BLQA 4Q5HA 2I0VA 3ORIA 1VYWA 3T8OA 5HX8A 3DTWA 5FTGA 5IISA 3QRTA 3QWKA 5BVNA 3UZRA 4KIQA 3C0HA 4G16A 3AC4A 1WVYA 3QALE 5CU6A 2X9EA 3BE9A 4QMQA 3QU0A 2WXVA 5FXRA 5AP0A 5EHOA 3ZCLA 4RIWB 2R0UA 4TY1A 3VC4A 3OS3A 3UOJA 5AR3A 2WTCA 4QMVA 5J95A 5EM8A 4IZYA 2JGZA 2YACA 4A4OA 5L2IA 3OUKA 5K4JA 2QCSA 4FT0A 4RIOA 3TIZA 2XNGA 3E7VA 3UIMA 1U59A 3AC8A 3Q4ZA 2PVYA 4QPSA 4R5SA 3FXZA 3VBYA 3UQCA 4FSYA 1H25A 4FV3A 1JSUA 3FZSA 3GOKA 3EQIA 4GFOA 3IGOA 5AR5A 5F20A 3F7WA 3LFFA 1YXXA 3UIUA 4U8ZA 1OKYA 1REKA 3NUSA 5JH6A 4I0RA 2ITOA 1PY5A 4XRLA 5GJDA 4NJ3A 4UXLA 4FOCA 1XH4A 2HCKA 5GJGA 3DK3A 3QCYA 4B0GA 4D1XA 4FVRA 4NFMA 5L8KA 2VWXA 1OI9A 1M2PA 4YHTA 4ZXTA 1V1KA 1ZYJA 2JDSA 1XH8A 1XO2B 3FMJA 3QZIA 4FT3A 4GIIA 2Q0NA 3KXMA 4J96A 1BL7A 2P3GX 3TNHA 3E93A 3MA6A 4JBPA 2HXLA 5CAUA 4CGAA 3VWAA 5AUZA 4O1OA 1TQPA 3GEQA 4WD5A 4XX9A 4DCAA 4ZS0A 3QQKA 3OEFX 4HNFA 4BDJA 1CKIA 4OT5A 4YBKA 3VS0A 4EWHA 2A1AB 5EFQA 3TIYA 4MEDA 1H24A 2PVJA 1VEBA 4ACCA 1PMNA 2OFUA 3MS9A 3OY1A 4QYHA 4U3YA 4XP2A 4DEDA 4J53A 3D14A 3ZLXA 5J1VA 1G3NA 2OU7A 3OWKA 5IDNA 3R22A 3D5VA 4MD9E 5BYYA 4DH5A 3I79A 3ODYX 3QBNA 4PTGA 5HBEA 2WNTA 4LOOA 2Y6MA 4FUXA 4M14A 4DEBA 2X7OA 4C33A 2ONLA 3ODZX 5BNJA 5CXZA 1Q3DA 3CGOA 3LMIA 4RZWA 3MVHA 4M67A 4K0YA 4GL9A 2EB3A 3MN3A 2BMCA 3LLTA 1QPDA 4NKAA 3DK6A 5CNNA 2JIIA 4MWIA 2VTQA 4FV2A 2W05A 4YNOA 3WYXA 5CNOA 4DFLA 3ZRLA 4DH8A 4B99A 4RQVA 4Z3VA 4LV5A 2OGVA 4XG8A 2JBPA 4WSQA 4AZSA 4C62A 4CZYB 3QQLA 5CF4A 3QCSA 4AUAA 1SNUA 4D2VA 2QOFA 3QGYA 4FVPA 5JN2A 4GVAA 2Q0BA 1SVEA 2ZM1A 4YURA 2P4IA 3W16A 2OF2A 5HU3A 4ITJA 2C3JA 4R3CA 2I1MA 3SRVA 2A19B 3E8NA 2B7AA 2HZ0A 4M0YA 4OTFA 3NR9A 3D7ZA 4RJ6A 5A4LA 5JQ8A 2XK8A 2YIWA 1R1WA 4YJOA 1PXLA 2REIA 3QUPA 3K3IA 3WARA 3NUPA 4FKTA 4PP7A 2R3LA 4GEOA 3TZMA 1ZZLA 4JXFA 5CAQA 3FXXA 4G3EA 4F70A 4BCPA 2W4KA 1DAYA 1DI9A 4YMJA 4EH7A 2H9VA 3NYNA 4AGWA 4TYHB 5H2UA 4IWOA 4X2KA 3AC3A 3UYSA 4JI9A 2UW6A 4B7TA 1XWSA 4AN9A 3RHXA 3L9LA 4R7BA 4BYIA 3F66A 4N6ZA 4HVSA 4LG4A 1OIQA 4BCOA 5A46A 4YTIA 4H05A 5LXMA 3NUAA 4X0MA 2P55A 3MA3A 4YJNA 4UX9A 3MY1A 2X4FA 1YI3A 2ZV7A 4JR3A 4LL5A 4C4FA 3FUPA 3SV0A 5CSHA 1X8BA 2CN8A 3NW5A 4YPDA 3TTIA 4IIRA 2XP2A 2F49A 2XKCA 3W33A 4G17A 2QR8A 2YJRA 2I6LA 4KNBA 4E20A 2R2PA 3DXPA 3DLSA 3MTFA 2PVMA 4ZTRA 3ZO4A 3ZRMA 4LQMA 2QO9A 2BRGA 3TXOA 4D4RA 1TQMA 5LOHA 4USDA 3UNKA 2AUHA 3P7CA 1UNGA 2XNEA 4AP7A 4MYGA 4NCTA 5KMJA 2CLXA 3A7IA 3COMA 5FM2A 4PL4A 3I1AA 3MWUA 2IW9A 4MBLA 1IAHA 5CX9A 2QOIA 5CEQA 2VTSA 2BHEA 5HKMA 3IGGA 3JPVA 3NVKI 1OL5A 3NAXA 3A4OX 3EH9A 3QA8A 4CNHA 4JQ8A 3TZ7A 3W2RA 2VX0A 3RAHA 2OIDA 4HVDA 3NMUF 3CTQA 4JRVA 2YITA 2UVYA 4QP9A 4XP0A 2V5QA 5DT4A 3TWJA 4ORKA 3P7AA 4CKRA 2BUJA 4FIEA 5CAPA 3PJ8A 4LL0A 5FLFA 3UG1A 4NM0A 4OBQA 5HG9A 3LCOA 2EB2A 3A61A 5DEYA 5E7RA 3CKWA 3VUHA 4AWIA 4QTEA 2B55A 4RGJA 3EZVA 5EI2A 4YZBA 3UO5A 2QOKA 1NW1A 3R9NA 4I1ZA 4NTTA 1UVRA 5HO7A 3NSZA 3HMNA 3CQWA 5AP1A 5HLPA 4AOIA 1WCCA 2PE1A 1PYXA 1FINA 1U4DA 5EW8A 4EC8A 4FKJA 2YN8A 1NVQA 3TT0A 1BI7A 1Y8GA 2JDRA 2BDJA 4DGMA 4IB5A 4MBJA 4EOOA 4X3FA 1FVVA 3KRLA 3NNVA 3QHRA 5IU2A 3L8XA 2VWUA 1JSTA 3DJ7A 5IPJA 3DV3A 3ZO2A 4EBWA 3UQFA 4FNZA 4KAOA 4BDBA 4G1WA 4DGNA 2R3HA 4ZMEA 3L8VA 4XV3A 1E9HA 2UW8A 2XK3A 3FLZA 4O1PA 2C5NA 4APPA 2B9IA 2FSOX 5G1XA 2WQMA 4IAFA 2R3JA 4ZOGA 4S33A 5JKGA 3OCBA 3RALA 2QO2A 3UVPA 3ZSGA 4M84A 1SVHA 1H01A 3V8TA 3W2OA 5HIDA 1M2QA 2PWLA 3SLSA 2V7OA 1H1PA 5DNRA 1PXOA 2Z7SA 4EJ7A 4IB1A 3JVRA 1ZMWA 3VRYA 4CFNA 1YDSE 3CEKA 5E8XA 5EDRA 2ITPA 1WVWA 1UNHA 2BVAA 2PMOX 3ACJA 4YZMA 4N70A 4FKRA 1OB3A 4W4XA 3ZO3A 2YFXA 5M07A 3ANQA 4KA3A 5DI1A 4RC3A 2I0YA 3NW6A 2W7XA 3VHEA 3NWWA 4KIOA 3S00A 4GT5A 4ALUA 2BR1A 1PRYA 3GU7A 4RX7A 4XS2A 3A8XA 4K18A 2BAQA 2VGOA 3GB2A 5M53A 2R3PA 3HMIA 5CSVA 3ZUTA 1GIJA 3R83A 2ITXA 5I0BA 4Q9SA 2BALA 4MXOA 2VD5A 2VGPA 4JR7A 3ZFYA 5C4LA 3HRBA 2JLDA 2YHVA 3BQRA 4JLCA 5FWKK 4F7SA 4E5AX 3FQHA 4QMLA 4Y95A 1VYZA 2A0CX 5F4NA 2BRMA 5ICPA 3PTGA 4FIJA 2YJSA 4KIKA 4L7FA 3SVVA 2WIPA 4ZK5A 3HP2A 4O22A 4I20A 4FF8A 5JQ5A 2CKPA 4TNDA 3V5LA 3PJ3A 2WPAA 3P4KA 2OIQA 4GU6A 4FG7A 2J51A 3O71A 4L53A 4BDDA 2PZRA 1I09A 4OAUC 3VBVA 2FYSA 3P86A 3DJ5A 3MVMA 2R3MA 4MH7A 1W8CA 2JAMA 3KCKA 4UMTA 4UWCA 3EN9A 4YJPA 5FEEA 3OWJA 2OZAA 4HGSA 2VU3A 4IAKA 4C4EA 5IA5A 4K1BA 5GNKA 5DE2A 4CFXA 3Q04A 1QPCA 5AM6A 5HVYA 3VS1A 1IA9A 4F0IA 5HE0A 3UOKA 5CSPA 2XYUA 2IZRA 2V62A 1RW8A 3GNIB 5TO8A 2YM5A 2B1PA 3QAME 4BGQA 2BRBA 4I0TA 4D2TA 4DFNA 1AQ1A 4FIFA 4TWCA 1PMVA 2ZJWA 3MPTA 5IKWA 2OICA 3F3UA 4IWDA 5C9CA 2HY81 3GP0A 3ZTXA 5HLWA 4KD1A 2G15A 1FGIA 2UUEA 2B4SB 4JIAA 4JX3A 4O7RA 3R1YA 4E7WA 5J9YA 4U79A 2GFSA 1JNKA 3VS2A 4EBVA 3WZJA 4DFUA 3LFSA 2HWPA 3FQEA 3OWLA 3GCQA 4PY1A 2QOHA 2R3FA 3Q5ZA 4ZZOA 2W1DA 5E92A 5EYDA 4YZDA 1J7LA 5HICA 3G90X 4TT7A 3V6RA 4C7TA 4D5HA 5F9EA 5JGBA 5I9WA 5E8VA 3AC1A 3UMWA 1W7HA 4F08A 1KE5A 2YERA 3E87A 2E2BA 4KWPA 3R7VA 1KV2A 2QVSE 4XH6A 3P9JA 1YQJA 4MQ1A 3ZZEA 3TNWA 2BPMA 2BRNA 4GYGA 5EQEA 1UNLA 1H27A 1OZ1A 4WRGA 2ITZA 3W10A 2HW6A 2PMLX 4JJRA 3EIDA 4IX4A 4QTDA 2QLQA 3U4WA 2J90A 4NW6A 4Y83A 4BKYA 3NCZA 3GFWA 3FHRA 2ZMDA 1XH7A 5LMAA 4F1MA 5E8UA 2HW7A 3OROA 4TRLA 4C36A 2VO0A 4D0WA 4ITHA 2V7AA 3ERKA 4QTBA 4FGRA 3U4UA 2E9UA 2RL5A 4ZJIA 3CY2A 4QMWA 2HELA 3DZOA 5C4KA 3DBCA 3WZUA 3MBLA 3R9OA 3DLZA 3GVUA 2CNQA 3A99A 4O0XA 3TKUA 3ENHA 3F5XA 3TV4A 4D0XA 4OBPA 5ANGA 2DWBA 5DT0A 3WBLA 1SM2A 5DYJA 2JBOA 4JG8A 5KMIA 4C35A 2EUFB 3IECA 1H08A 3D94A 4OT6A 1IG1A 3P5KA 3RK7A 3DFAA 5H8EA 3DKFA 3QTSA 3FI2A 1OPLA 3EB0A 4QMPA 4BN1A 4G3DA 2OZOA 3QC4A 2OXXA 3PY1A 3MV5A 4F9BA 4O7LA 3OZ6A 4YSJA 3RCJA 5IEVA 3V3VA 3ALOA 4ZTQA 3DBFA 3EN5A 2YA9A 3CPCA 3JUHA 1H4LA 4L3JA 2ONLC 4ANMA 4L8MA 4XNEA 2PMNX 3E5AA 4QMSA 4ANOA 5IQDA 2W1FA 4MX9A 2X8EA 2XKEA 4FMQA 3NUXA 2XJ2A 3MVJA 2QHMA 4X2JA 3QL8A 4L68A 5AJQA 3KRJA 1PXPA 2PSQA 5BVOA 2JDVA 1OECA 3D9VA 4L6QA 5KBQA 3DCVA 2O65A 2O64A 4HPTE 5DHJA 1UWJA 1HCKA 5JRSA 4D9UA 3W2SA 3C51A 4GFGA 4IM0A 2JKQA 3QWJA 2WTWA 2W96B 3PY0A 4DFZE 5BVFA 4C3RA 3ITZA 4L7SA 2BILB 3S1HA 4AZTA 2I0HA 3F5GA 4NJDA 5AUTA 2GQSA 4L42A 2CKOA 2PUNA 5AAFA 1JSVA 4N4SA 3SW4A 3AOXA 5KNJA 3ORPA 4UBAA 4FTNA 4G5PA 4DH7A 2QO7A 3QQHA 4IC7A 3EQHA 1JKSA 1PJKA 5BYLA 4HVGA 5AFVA 3P7BA 3RPRA 3ZSHA 5KO1A 4DA5A 4CLIA 3U9CA 3RAWA 5DT3A 4PQNA 3AMBA 2X8DA 3W18A 2PL0A 4UMUA 3I6UA 4E5BA 2GNHA 3DB6A 4BR3A 4W9WA 2QNJA 5EQYA 2VTLA 5FTOA 2B52A 1FMOE 1ZZ2A 3SG8A 3WZDA 2FO0A 4AN3A 3U8WA 2CNUA 5M06A 3LXPA 3BZ3A 4RJ8A 4DH3A 4ERKA 1WFCA 1KE7A 2WMUA 3FC2A 5AR4A 3MFSA 4LI5A 2WU7A 4TYHA 4O21A 2VN9A 5CEPA 4AE9A 3FSKA 5F95A 3GFEA 5CF5A 3BCEA 2BAJA 2Q83A 1ZAOA 3R7EA 3KN6A 4QTCA 5HBHA 2X2MA 1U5RA 3DBDA 3RGFA 4AW1A 2WMWA 1F3MC 4EK8A 4J52A 2QLUA 3PA5A 1H1SA 2W5HA 1WBSA 1YDTE 1KE6A 2QOQA 3FWQA 4LGDA 3NVMB 4C3PA 4FNXA 4ZZNA 3LQ5A 2OO8X 3HRCA 4BI1A 5M44A 5C8MA 4BTFA 3HDNA 3MI9A 5HGIA 3U6HA 1H0WA 2PMIA 2J0MB 3GCVA 3MJ1A 5HTCA 2G2HA 3MTLA 3NZ0A 1YVJA 1JLUE 2VV9A 1YWNA 1GZKA 3R00A 3TV6A 4ASEA 2YEXA 4I21A 3UNJA 4NK9A 4IM2A 5FD2A 3O51A 3ZEWA 1JBPE 3UPXA 1GY3A 5CU0A 3MJ2A 2C6TA
chains in the Genus database with same CATH superfamily
4JBVA 5HTIA 1T46A 3UBDA 2QHNA 2NYAA 5M4CA 3HVCA 4O6EA 4NU1A 5KZ0A 2B9FA 5HORA 4YBJA 4DAWA 3ZDUA 4V0GB 5L8LA 4KSQA 5CWZA 1IEPA 4R6VA 4ANNA 2BRHA 5K0XA 4O81A 3QKKA 2BFXA 1R0PA 4YZNA 5TR6A 4AZFA 5C8KA 5KHWA 3KXXA 3O2MA 5FP6A 5I9UA 5IQFA 4Z9LA 4QT1A 1W2FA 4U42A 2NP8A 4FSTA 3SA0A 3GOPA 3LCDA 3TNQB 4EL9A 3QTUA 4FYOA 3QKLA 2OJFE 4KBAA 4AE6A 4TYEA 3UQGA 2OF4A 1O6LA 4P7EA 3HMOA 4QQTA 2Y7JA 3EYHA 4D55A 4WSYA 2FVDA 2HXQA 1M2RA 1W84A 4PNIA 3Q9WA 3MPAA 3QX4A 3TZ9A 5K4IA 3BE2A 4YP8A 4D9TA 4HNIA 4J7BA 4O0VA 3S2PA 2C5OA 3R2BA 2ZYBA 1ZYSA 4RWKA 1ZXEA 4EI4A 4DHZA 2XUUA 3CTJA 4JNWA 3C4FA 2AC5A 4IFGA 3R8VA 3KEXA 4F9WA 4W4WA 3LW0A 4U80A 3QQJA 4G3FA 4R78A 3BEAA 5L8JA 2R3QA 2BDWA 3DS6A 3LZBA 3E92A 1CKJA 2O2UA 4FT5A 4DDIA 4I94A 3KMUA 4BB4A 4BBMA 4Q9ZA 2WQEA 1K9AA 4E73A 3PYYA 4USFA 2NO3A 3NGAA 2ZVAA 4EH6A 4RT7A 2OIBA 5AIKA 3QUDA 3H0ZA 1F5QA 4AGCA 4EH9A 3WOWA 1SNXA 2VTJA 4O7YA 2OJGA 3FYJX 3HDMA 2XKDA 4FKVA 5AP5A 5HE3A 2XK9A 2WTDA 4DHJA 2PZYA 4AFEA 2J2IB 3ORMA 4CG9A 2C5YA 3EMGA 4BTMA 2QOBA 3BHHA 3FKNA 4RIXB 2XNPA 3R30A 5C01A 4B6LA 4EORA 3EQCA 4PV0A 3L9MA 5HIBA 1L3RE 4NKSA 4PMTA 3FY0A 1LR4A 1KE8A 1VR2A 5HLNA 3LMHA 1JKKA 2R5TA 4CMTA 2CCIA 4O82A 4D2WA 4MCVA 3T9IA 3G0EA 4U43A 2UZEA 2YLFA 3JYAA 3WI6A 4GKIA 2RKUA 4FI1A 4Z16A 4PX6A 2HOGA 4WKQA 1Q41A 2UW0A 4DT9A 1OL1A 1QPEA 3HMPA 4JDJA 3Q4UA 4PTCA 3R9DA 5BV3A 4D5KA 2R4BA 3KC3A 1OM1A 2JKOA 2X6EA 4FYNA 4HZRA 4I24A 3TUCA 2Z7QA 2GS2A 5CVFA 5KUPA 1BUHA 3K5VA 4IH8A 5HNIX 5IA1A 2OXDA 3DOGA 4ASDA 4OTGA 1OIUA 2ACXA 2HY0A 3QRKA 4MNEB 4YO4A 5HX6A 2R7BA 4JMQA 2XAOA 1PYEA 2VUWA 2ZMCA 3PVGA 4O4DA 4QMMA 3F9NA 3PE2A 3LOKA 4F09A 4IWQA 4DITA 3TUBA 4IX6A 3UIXA 3VW8A 3AC5A 4EYJA 3ZRKA 3RNIA 4UALA 4E4LA 3FY2A 4R1VA 2IZTA 3U54A 3QD0A 2J5EA 2Z7RA 3W0OA 3HUBA 1GNGA 3EOCA 3KXGA 2BKKA 3O23A 2UV2A 1IA8A 4FUYA 3ORKA 4K11A 4YUQA 1HCLA 3R7YA 2J0JA 4C02A 1KSWA 4LFIA 1VLRA 5KE0A 2Z2WA 5KMKA 3T9TA 4FGBA 3K54A 3RPYA 4ZSJA 4Z55A 4PWNA 4X21A 2C0IA 2E9PA 1NT2A 4A07A 2C6MA 3CBLA 4RRVA 2RFEA 4YJRA 5DA3A 3LCTA 2Y9QA 3QTIA 4IZ5A 3EFLA 2VWYA 5K5XA 2YDKA 4ARKA 2YM7A 3TM0A 4XUFA 4JT3A 3VQHA 4CEGA 3GU4A 2EXCX 3BV2A 3FZPA 4JDKA 1HOWA 3RZBA 4BKJA 3QQUA 4E8AA 4W9XA 4FZAB 2Y4IB 3JXWA 4FTCA 2Y0AA 3DBQA 3LFCA 4BJJB 3EQDA 4BTKA 2J9MA 4QNAA 3VUMA 4EKLA 2GQGA 2QOLA 3PFYA 2R3RA 3C0IA 2Y4IC 4CD0A 4EK3A 3LFNA 4R1YA 4GVJA 4LMNA 4PDSA 2IG7A 1Q24A 1Q8TA 2XMYA 4GH2A 2H6DA 4JDIA 4BGGA 1S9JA 2GPHA 3SX9A 4FE2A 2GFCA 1OVEA 4DEGA 3EFKA 2W5AA 3PZEA 3KVXA 4CV8A 4O7NA 1DI8A 5J8IA 3AMYA 3I4BA 4M97A 4NZWB 4B8LA 3ROCA 1CSNA 3W2QA 1PF8A 4NEUA 3F2AA 2X2LA 3HV6A 1XJDA 4XHKB 5A3XA 3V5TA 4HGTA 3B2WA 4JG6A 2FGIA 3I6WA 3PUPA 4PMMA 2B9JA 3B8QA 3UJGA 4DHFA 2BFYA 4L3PA 4F1OA 1FVTA 3EN6A 5AUWA 4N0SA 3M11A 5DH3A 4GT3A 1F0QA 4RX5A 4ZAUA 5A6NA 4F6SA 3PXFA 5A14A 2WTJA 4BIDA 4EEVA 1W83A 4EHZA 3F6XA 3K2LA 1MQ4A 5E4HA 3NIZA 2OXYA 2R0IA 5E9EA 2EVAA 1OIRA 3IW5A 4O7TA 5D9HA 5A4TA 2CCHA 2IVUA 3NLBA 4O7SA 2R64A 2FH9A 4DLJA 2XIKA 4N57A 3H30A 4GK2A 2PVLA 3NYOA 4QD6A 4YTFA 5AR8A 2PHKA 1U46A 2PULA 4MHAA 1APME 2VX1A 4R7HA 5LJJA 2F4JA 1PHKA 3R1SA 1XR1A 5T3QA 3NUNA 4MK0A 5I5ZA 4XG4A 2VO3A 4TWNA 5AAEA 5JZNA 3OWPA 4QPMA 4AGDA 3E3PA 3KRXA 5EW3A 1K2PA 4RVLA 5CI7A 3DZQA 4NIFB 4ALWA 4BICA 4U40A 2XIXA 4GUEA 5FG8A 3VQUA 2QG7A 5KBRA 3F3ZA 2C4GA 5JFSA 4K2RA 5DOSA 1W98A 2R3IA 2UVZA 4K33A 3TG1A 4ASZA 3IW7A 3CC6A 4FIHA 4IAZA 3CP9A 3NW7A 4I41A 1STCE 2IZUA 3EWHA 4EKKA 4FIGA 2HK5A 1OL2A 3UO6A 1KE9A 4FKPA 3IDPA 4AT4A 5I9XA 1YI4A 3HV4A 2YM3A 3LFQA 5I9VA 5DWRA 4E93A 4DDGA 3JR1A 3MB7A 4PPCA 2QODA 5L6PA 3CCNA 5IQGA 3IK3A 5DR6A 5CY3A 1OITA 3PJ1A 2ITVA 4A06A 4FEXA 3D5XA 5JFWA 5DG5A 2XNOA 3QXOA 4FL1A 3RAKA 4J97A 4EH3A 3DB8A 3UDZA 4RX8A 4AA0A 3RAIA 1ATPE 5IQBA 3EFWA 4OW8A 4CSVA 1CMKE 1PXJA 2DYLA 3PJ2A 4TYGA 3B8RA 1PMEA 2YCRA 4ZSGA 5AP2A 2X7FA 5J9ZA 3HECA 3KA0A 5IMEA 1V0BA 4EOSA 4WNMA 4QYGA 3VS6A 3PUFC 4ACDA 2UZTA 3AD4A 3N51A 4XBRA 4DBNA 4P2KA 3EKNA 5KMMA 4IX3A 1Y6AA 2ETKA 3ZLWA 4TW9A 4H58A 3ZM9A 4PRJA 4RWIA 3QRJA 3BYOA 3HLLA 3VW6A 3PLAE 1CM8A 2VAGA 4P90A 3TCPA 3CSVA 5J5SA 5EHLA 1J1CA 3ZMMA 3RM7A 4J95A 2QKRA 4GMYA 5HO6A 1U54A 3FL4A 3RNYA 1R3CA 3HZTA 3KK8A 3D15A 5HOAA 3VF9A 2RSVA 3ZFXA 3ORTA 3C4XA 3KL8A 3LXNA 4QP8A 5H9BA 4FV0A 5T6KA 5LMKC 4AA5A 4R8QA 2GS6A 3IDCA 5EI8A 3WF8A 4AOJA 4FKWA 3V5JA 5F94A 2WOTA 3G33A 4KABA 4ZIMA 4IBMA 4EOIA 3BRBA 2YIRA 2VWIA 4RJ7A 2Z8CA 3PSCA 4K9YA 3ZYAA 5HU9A 4KB8A 4RQKA 2ESMA 3HYHA 4TYJA 1XMMA 5LCKA 1JWHA 2CJMA 3WYYA 2XIZA 2WIHA 4CTCA 5CU2A 5DRBA 4QMTA 4FKLA 5L2SA 4QP6A 3IW6A 3D5WA 2PZPA 4XOYA 4KS8A 4ZZMA 5IUIA 4GKHA 4NM7A 2FSLX 4LRMA 4IXPA 2ZAZA 2QR7A 3CJGA 4P5QA 4QQ5A 4ZSEA 5JGAA 2O3PA 4QMXA 3O8PA 3HKOA 4V0GA 3A8WA 4UYAA 2PUUA 4FSNA 2SRCA 3MFTA 3QUEA 3THBA 4D2PA 4YPSA 3FPQA 3PPZA 4IZAA 3S3IA 2KULA 5AMNA 4ZSLA 2UW5A 2VTAA 4FKOA 4J98A 1WBVA 5ANEA 4DCEA 4QP3A 3BLHA 4ZS4A 4DT8A 4J1RA 1R0EA 4C0TA 4XG7A 4G9CA 4QMZA 4UMQA 3FLSA 2VZ6A 2WMAA 3QKMA 3WZKA 1Q3WA 1JKTA 2BTRA 4II5A 4DTAA 5AP7A 2ITTA 3B2TA 3ORNA 4Q2AA 1YWRA 4O91A 4R7IA 3REPA 5B2LA 3R9HA 1RJBA 2BZJA 5M4UA 3Q5IA 4BKZA 3F5PA 3C4WA 4PUZA 4IHPA 2OWBA 4QOXA 5CYIA 3HV3A 2CGWA 3EN4A 5LVNA 5DRDA 4WG3A 3MFRA 3V01A 3PA4A 3VNTA 3C4CA 4YZ9A 3WF7A 4FT9A 2IVVA 5GIPE 5LCJA 4U44A 3VN9A 5JGDA 5KCVA 3S0OA 2ZDTA 4NWMA 3HA8A 3Q53A 2VWVA 5ETFA 4IQ6A 2OJIA 3ORLA 4HW7A 2WB8A 4BDIA 2ITWA 2C69A 5IH4A 3HV7A 1OUKA 5IA2A 5JT2A 3TACA 3I0QA 3POOA 3FDNA 4GU9A 4OR5A 2Y6OA 2C6KA 3OT3A 4DTBA 3CD8A 5LQFA 3ACKA 2G01A 4MXZA 5BUIA 2C3KA 4EWQA 4DEAA 4FSRA 4J99A 3H10A 5DMZA 2XCHA 1R78A 5HVJA 2CGVA 3NEWA 4RWJA 4KKGA 2I7QA 3EL8A 4EZ7A 4RIXA 4S31A 2O0UA 4TWPA 2QI8A 4BIEA 4CFMA 4IVBA 2YCFA 5M55A 2VWBA 2IN6A 2RG6A 5EHYA 4E5WA 3N4VA 3V6SA 3AXWA 1YDRE 3GU8A 4EQMA 4O0RA 3CE3A 3KXHA 2E9OA 4WRSA 2CGXA 3E63A 4AOTA 3MSSA 4AQCA 3ZHPC 1W2DA 3EYGA 1H1RA 2BIKB 3ZS5A 4UZDA 4EQUA 3QRUA 3MIYA 2X1NA 2XBAA 1YXUA 4XCUA 4I23A 3RTPA 1LEZA 3R7IA 5D41A 4CG8A 4L01A 3FQSA 2QQ7A 3A2CA 4AGUA 4BBFA 2OJ9A 4NW5A 2PPQA 2WQNA 2JITA 4P5ZA 1E1XA 4GFMA 3A7FA 4XMOA 1SYKA 4O0TA 2O5KA 3FMEA 4LYNA 3PE1A 3U6IA 2I0EA 4C4GA 2UW7A 4JAIA 1RE8A 1SVGA 4HYSA 5KHXA 5AUXA 2PY3A 2WELA 3BYSA 3BBTB 3LM0A 2ZB1A 4MNEA 3MH0A 3QX2A 3Q2JA 3OVVA 3FMDA 3FMNA 4YJTA 5AV0A 4IDTA 2PVHA 3C9WA 2JAVA 4DFBA 1Q61A 1E1VA 3DU8A 3ZEPA 3UDTA 5HE1A 4BGHA 5BVEA 3F7ZA 3VBWA 3GGFA 3ULIA 3M42A 3QD2B 4XG6A 4DBXA 3TL8A 3VJNA 3VUTA 4DEIA 2IVSA 2WMQA 3CPBA 3G9NA 3LCSA 4GT4A 1XMLA 4OBOA 3PVBA 4L00A 5K3YA 3NUYA 4DFXE 4IE9A 4U9AA 5HO8A 2LGCA 5BMMA 2WOUA 2X0QA 4EJNA 2VWZA 4EZ3A 2BHHA 3HP5A 3BBWA 5LVPA 4RVMA 2IZSA 4FTUA 3HL7A 3CJFA 3KY2A 3SOCA 2WTKB 3UPZA 2PUPA 5JRQA 1GZ8A 1PW2A 3LXLA 5C27A 4BCIA 3TV7A 3RPVA 3CQUA 3V04A 3DKCA 4RG0A 3CY3A 2EU9A 2PVFA 4TPTA 3FC1X 2WTKC 2C6OA 3FE3A 3ZO1A 4A9RA 3ORXA 3GQIA 3BU5A 4KBCA 4KBKA 4R3RA 4BTJA 1H1QA 4MNFA 4ANLA 1URCA 2GNGA 4F63A 4ZJVA 5AX9A 4FG8A 1BKXA 3T3UA 4G2FA 2F2CB 3HA6A 3PIYA 2W17A 3S95A 4S30A 3TN8A 4DLIA 1OL7A 4M13A 3BHYA 3G9LX 5F1ZA 4IDVA 1BMKA 2RF9A 3IPHA 1O9UA 4UEUA 5CSWA 3I5NA 4F1TA 4TKSA 4JX7A 5IQCA 2YAKA 3QA0A 3F88A 3N4TA 1EH4A 1NY3A 1YI6A 3HRFA 3MH3A 2JC6A 3C50A 3OBGA 2IJMA 3ENMA 4I5PA 5CT0A 1ZWSA 4BCHA 4BJJA 3PA3A 3FAAA 3GENA 2G9XA 3FZRA 4OUCA 1OBDA 2B0QA 3HEGA 1NVSA 4ZY4A 5D11A 2XM8A 4YJQA 4D58A 2RFNA 3QZFA 3W0QA 4FV7A 4C37A 4L52A 4UN0C 3VUKA 2QURA 3Q9ZA 3EQBA 4ZP5A 4RSSA 3A62A 2BIYA 3BEGA 2PVKA 4EHVA 2X8IA 3WF6A 4X6QC 1W0XC 2PK9A 4PDOA 4F6WA 4GSBA 5AM7A 4UZHA 5EYMA 5TKDA 2W0JA 3PXQA 4RC2A 2XRUA 2ERZE 4FX3A 4I3ZA 4A7CA 1DM2A 2H34A 4AA4A 4ZY5A 5A4CA 3FZ1A 3LFDA 3QYWA 3DNEA 2UZLA 3FL5A 3AD6A 4FT7A 2CNVA 5C1QB 2J5FA 3FBVA 5HD4A 5AV3A 2XARA 3R7OA 4ENXA 4GCJA 4YJSA 1T45A 1BYGA 3ZUUA 3L8SA 3OF0A 2ETMA 2NRUA 2XK4A 4AZEA 1GIHA 4RJ4A 4O6LA 4BC6A 3VONA 4O2PA 5AUVA 4D2SA 2WFYA 2XKFA 4RIYB 3I60A 3CKXA 4FK3A 3PIXA 2YIYA 3R8ZA 3MESA 3HUCA 2XALA 3TDVA 3UG2A 5HG5A 1Q97A 2C5VA 3MIAA 5C26A 2YISA 3O50A 5H3QA 3OXZA 5ETIA 4RA4A 3FMHA 3KU2A 3VS3A 4BDAA 5AADA 3C5UA 4RJ3A 3RHKA 4WNKA 4C4HA 4XYFA 2DQ7X 2BCJA 2F7EE 3HAMA 1M17A 5H8GA 1BLXA 3BGZA 4ENYA 4JS8A 5ITAA 5CZIA 4NIFA 4C57A 2FA2A 3AG9A 4JL9A 4YZCA 5J5TA 2UW4A 3G6GA 1NA7A 2BDFA 3SXFA 4FV9A 3KFAA 4OTQA 4HVHA 3D4QA 4FG9A 3W2PA 4FEQA 3NAYA 5CEMA 3N9XA 1FBNA 1TQIA 4WBOA 3EFJA 3LXKA 5BQ0A 1TKIA 4RX9A 3JY0A 4HOKA 1JOWB 5CXHA 3ET7A 4GRBA 4I22A 4EOMA 4L45A 1QCFA 3BGPA 4M15A 2HYYA 2ITYA 2BZHB 5IQAA 3W0RA 3NPCA 5E8WA 4CT2A 5AEPA 1U54B 1ZYLA 4RFMA 4KKHA 1G5SA 2NRYA 2IVTA 4CCBA 3FLNC 3MB6A 3TI1A 4BDGA 4DGGA 3R21A 1PMUA 5M4FA 4J8MA 2YZLA 2GSFA 1Q62A 2WGJA 5FBNC 3PVWA 4H3BA 2PVNA 2JDOA 3OOGA 4MF1A 5EDPA 4D28A 4PPBA 4UWBA 5DLSA 2G1TA 3ZC5A 4EZ5A 2BAKA 2F2UA 3A7GA 4GW8A 4EC9A 4OAVB 1YW2A 4QP4A 4XG9A 4CZTA 3QF9A 4KS7A 4Y85A 3IW4A 1NXKA 3PIZA 4W4VA 4I93A 5LARA 4Z7GA 4F7LA 5IMXA 5EDQA 1YRPA 5IEYA 2JIUA 3UMXA 2JKMA 2R3KA 3BYMA 4F4PA 4FV1A 5M56A 3PP0A 2WMSA 4FTKA 3KRRA 4RVTA 2LAVA 1WMKA 4I5HA 5FEQA 3KULB 4OTWA 5IH6A 1ND4A 1Q8ZA 4JVGA 2VTNA 3AD5A 5LMKA 4FICA 4JQEA 3EZRA 3OBJA 3ETAA 5ACKA 3SW7A 4PMPA 4JOAA 2W4JA 2P33A 3VUGA 4IVDA 4O4CA 3WF5A 4M7IA 1SZMA 4GG7A 2E9NA 2JIVA 4GJ3A 5TE0A 1XBBA 5FQDC 4A9YA 4IC8A 2ITNA 2J4ZA 3QD4A 3SD0A 2XM9A 2WU6A 3BI6A 3ULZA 3BHUA 4NSTA 5DBXA 4YSMA 3K5UA 4ACGA 1DS5A 4IEBA 5AR7A 5FP5A 4WA9A 2A2AA 3QTXA 5AAGA 4PPAA 4O96A 4YLLA 3VS5A 5M08A 4APCA 3A7JA 4XRJA 4UY9A 4FNYA 3SQQA 1B38A 4XG3A 4FVQA 1OKWA 1S9IA 1V0PA 4YO6A 3G51A 4RLKA 3Q52A 3W55A 4YU2A 1P2AA 3C4ZA 4EHEA 3RM6A 4EOJA 2PE2A 2X4ZA 3KQ7A 2XJ1A 3G2FA 4NUSA 3U51A 3LQ3A 2WTVA 3FSFA 5L4QA 4FJVA 1B6CB 5ANJA 5E8TA 3BQCA 3G6HA 1KV1A 2WMRA 3GQLA 3O0GA 3TNPC 3BPRA 4OTPA 4UWYA 1GZNA 5AP4A 4PL5A 5HE2A 1JQHA 1OMWA 5A4EA 4PDYA 3NYVA 3UP7A 1XH6A 2FSMX 3WZEA 3NS9A 4Y5HA 3ZBXA 4ID7A 1BX6A 4M3QA 3W0PA 5A6OA 5E90A 2WEIA 4BCNA 2XNBA 5DGZA 4KRDA 3TKHA 5BVDA 2B9HA 3F5UA 3PVUA 2VTTA 1ZOEA 3FXWA 4MXYA 5FUTA 2JFLA 1VZOA 3P79A 4BWKA 1UV5A 4QP2A 2IWIA 3CD3A 3O7LB 3VBTA 4WNPA 3P0MA 3LQ8A 3JVSA 3VBXA 4CXAA 1MRVA 1M52A 4C34A 2HAKA 3PSBA 3OC1A 1UU7A 1Y8YA 2H8HA 3Q9YA 4FTLA 1WZYA 2ZV2A 3GBZA 3UDBA 4AXAA 4BDEA 4TWOA 2QOCA 4WNOA 4QMYA 1QPJA 4HCVA 3CIKA 4IACA 3R1NA 4C38A 3DGKA 3PY3A 4H1JA 2XZSA 3EJ1A 2EWAA 5I9ZA 5HQ0A 5BUJA 2YDIA 4V01A 2PZIA 2A4LA 4L3LA 3UTOA 3RK9A 3SXRA 1AD5A 3UVRA 2J7TA 4FKQA 1Q8UA 4G6LA 3RWQA 4AAAA 1QMZA 3UOLA 4C8BA 4XP3A 4CYJA 1RDQE 1PXMA 2HZ4A 2ITUA 2QU6A 2W1IA 1Y91A 3UIBA 4DGLC 3F2RA 5AUUA 3QTWA 4GV1A 5DN3A 3KREA 3ZUVA 3LM5A 3AT3A 4FL3A 4FTQA 2C6IA 4GUBA 5E8ZA 2WD1A 3KMWA 2RIOA 4JRNA 4ZTSA 4BHZA 5A4QA 1ZMVA 4FBXA 3R8LA 2JD5A 4Z7HA 5IA3A 1L8TA 2IW6A 3BGQA 4O0WA 3TJDA 1FQ1B 5BMSA 3LHJA 4N6YA 1OPJA 4FODA 4GJ2A 2GNJA 4EQCA 3U55A 4AN2A 4BZNA 4J8NA 4ACHA 4BI0A 3FI8A 2FB8A 3LFBA 3H9FA 2WMBA 3AC2A 3DJ6A 3DNDA 4FK6A 4R3PA 2GQRA 1I44A 3BLAA 3F69A 3U87A 3DBEA 4AW2A 4CFFA 4E6AA 1OBGA 3QHWA 4U41A 1ZYDA 3PPJA 3IO7A 3PG3A 4MUQA 5CU3A 4RFYA 2V55A 4AF3A 4Y72A 4LUEA 3UGCA 3DXQA 3QGWA 3P23A 2OH0E 3W0SA 4I5CA 2JDTA 5CF6A 5HG8A 5CANA 5CVGA 4TZRA 3QYZA 4F9YA 4LGHA 3C13A 2B53A 3QRIA 4IMYA 4PDPA 3I5ZA 2IPXA 4GS6A 3U9NA 4ASXA 2WEVA 4I5MA 4CQEA 4ZSAA 1ST0A 4PMSA 2PE0A 4U5JA 3PPKA 3VO3A 2VNWA 4E4NA 2J6MA 4ZTHA 4FEWA 5GIOE 1GJOA 2C0TA 3FI3A 4WIHA 5BUEA 4KIPA 2AC3A 2YZAA 4V05A 2OLCA 2IEWA 2X9FA 1YXSA 4F78A 3BYVA 3KMMA 2Z60A 1OKVA 3GXLA 4O0SA 1FVRA 2XJ0A 3VS7A 5CASA 2UZOA 2W1HA 3G0FA 3RPOA 1ZARA 4PF4A 2ZM4A 5ANOA 5DIAA 3EQFA 2Y4PA 2CN5A 4AG8A 2UW9A 4QMNA 3NIEA 5EM5A 4BRXA 4RFZA 2VRXA 2WQOA 4JBOA 3WE8A 4UXQA 4O86A 2GTMA 5K5NA 1KWPA 4DG2E 3ROYA 2UZVA 5HIEA 3KN5A 4OTHA 5CT7A 4AZVA 3DAKA 2ERKA 3FV8A 3PRIA 3OT8A 3UP2A 4FR4A 2JKKA 4OLIA 3V51A 2OFVA 3G15A 3C1XA 5EOBA 4H3PA 3UZPA 3V5WA 5L2QA 2P2HA 3BU6A 2CLQA 3PDTA 3BV3A 1UKIA 3FKOA 4BIBA 3F3VA 4TL0A 5M4IA 2XANA 3HMMA 1H0VA 1KOAA 3AT2A 4NFNA 3R0TA 4XV9A 5L2TA 2WAJA 2C1BA 4HVIA 4TTHB 4UV0A 3GCSA 5CU4A 5B2KA 1JAMA 3I7CA 2YWVA 5HVKA 5DPVA 3MW1A 3DTCA 3QLFA 1YHVA 4FTMA 4JG7A 3W8LA 2ITQA 1J1BA 1J7IA 2KTYA 1G8AA 4MXXA 5D12A 2XNNA 2C1AA 4U7ZA 5I3RA 2YIQA 2ZM3A 3H0YA 3RI1A 4R77A 4JAJA 2X2KA 5GJFA 2G2IA 2VTOA 5IUHA 4L67A 5AIRA 2J0IA 1YOMA 3CXWA 1YXVA 3GC8A 3COIA 4RVKA 3T3VA 2XAMA 2YM6A 3H4JA 1P14A 2VX3A 4FKIA 1IASA 1ZY4A 4DG0E 1NVRA 2QD9A 2R3OA 3QD3A 1WAKA 5DR9A 1PKDA 2OW3A 2PTKA 5D10A 4AT3A 3H9RA 4A4XA 2XK6A 4DEHA 2C3IB 3PXKA 5JFVA 1PXNA 3OHTA 4Y5QA 4ITIA 4IB3A 3V8SA 4AZWA 5FM3A 1TFFA 3A4PA 4RIYA 1REJA 5L6WL 5GINE 3C0GA 1WBNA 3OP5A 1SMHA 4G3GA 4E26A 4CLJA 4WHZA 3VF8A 3R8MA 2OKRA 1WBTA 4OTRA 3R8UA 3O17A 4HZSA 4FTOA 3BWJA 4FSUA 3GC9A 1OKZA 3M2WA 4MTAA 4G34A 4FV4A 4QMOA 4YNEA 2CKQA 3ORZA 2YCQA 3QC9A 3ZFMA 5ACBC 5JK3A 4LGGA 5J1WA 3Q4CA 1OGYA 5KKRB 3FLQA 4IAAA 4PL3A 3OCTA 3NYXA 3GT8A 1JKLA 3CLYA 2GS7A 5IQEA 3LLAA 3VAPA 3CQEA 3R63A 5AA8A 5KKRC 4FTJA 3PZHA 1AGWA 4M8TA 4TN6A 3TJCA 4QDVA 2UZUE 4PP9A 5IZFA 2YM8A 3LAUA 3ALNA 1TVOA 5CSXA 4YTHA 1WBWA 2WKMA 4FZDB 5FRIA 5EH0A 4AU8A 4G9RA 5AA9A 4I0SA 4HYHA 5L2WA 3DAJA 5IQIA 2BZKB 3NNWA 5CF8A 5CS6A 1OUYA 4XV2A 4CV9A 3LFAA 2CSNA 4MWHA 1YWVA 2C47A 4FKUA 4FKSA 4MD8E 3SDJA 1ZOGA 2UZBA 1UU8A 3O7LD 2UW3A 1M14A 4EHGA 3KIOC 3TEIA 3VUDA 2DS1A 5CTPA 4TYIA 4ZMFA 2J50A 4KUJA 2HIWA 4IVAA 2GHGA 3KXNA 4K8AA 5CI6A 2WZJA 3Q9XA 1MP8A 1MUOA 3I0OA 3KF4A 3NNUA 3O8TA 4U6RA 5AV2A 5FDPA 4M68A 5HCYA 1V0OA 3NNXA 5EI6A 4ZTLA 4O84A 4HJOA 3PP1A 2GNFA 5E1SA 4ZTMA 2C5XA 4IWPA 1G8SA 4MKCA 5CVHA 2QG5A 4ANQA 5FGKA 4NL0A 5ETAA 4EOPA 3A7HA 3RMFA 4EK5A 3KULA 1FOTA 5EG3A 3I7BA 5FTQA 2EXMA 3KKVA 4F0GA 2RGPA 4JBQA 4RZVA 3ZH8A 2CGUA 4S32A 3PFQA 3SC1A 3UC4A 3UZTA 3MDYA 2NPQA 1YHSA 4MBIA 3UE4A 4DN5A 3NDMA 5B2MA 3ZXTA 3W0NA 2PYWA 2C6DA 5IUGA 3RVGA 3ZLYA 3COHA 2UZWE 2VTRA 2WMXA 1MQBA 3OUNB 4BY9E 4BHNA 4BZDA 3TZ8A 3R7GA 4PNKA 3F2NA 4XBUA 1Z57A 5ANIA 4YLJA 3OOMA 3GC7A 4USEA 5IQHA 4BYJA 3V5QA 4EOKA 5EM7A 2WMTA 3W32A 4FSZA 4YC8A 4NTSA