1MRZA

Crystal structure of a flavin binding protein from thermotoga maritima, tm379
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
287
structure length
266
Chain Sequence
b'VVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFPGLLMTVESRVEMLSRYARTVVLDFFRIKDLTPEGFVERYLSGVSAVVVGRDFRFGKNASGNASFLRKKGVEVYEIEDVVVQGKRVSSSLIRNLVQEGRVEEIPAYLGRYFEIEGIVFPTANIDRGNEKLVDLKRGVYLVRVHLPDGKKKFGVMNVGFRRNVKYEVYILDFEGDLYGQRLKLEVLKFMRDEKKEELKAAIDQDVKSARNMIDDIINSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Riboflavin kinase/FMN adenylyltransferase
molecule tags Transferase
source organism Thermotoga maritima
publication title Crystal structure of a flavin-binding protein from Thermotoga Maritima
pubmed doi rcsb
total genus 76
structure length 266
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1mrzA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1mrzA01
2ZP1A 3G5AA 4MUNA 4EG6A 4MWCA 1OWOA 3DLAA 2A4MA 3FNRA 3M5WA 1JZSA 4ZT6A 3CVUA 3CLUD 3MLBA 1PFVA 1NUTA 2B7LA 3TZEA 4MWDA 1X6VA 4DE5A 3IOEA 1JILA 4I6GA 1M8JA 2WB2A 2DETA 1BS2A 1Q9SA 3AG6A 4NDAA 1O95D 4MUKA 5TRDA 1O97C 3ND6A 2E18A 4MW9A 3IODA 2CYCA 4ZCPA 4ZCTA 5KCMA 4JYZA 2CFOA 1U7DA 2AKEA 1VBMA 3IOBA 5TGTA 1N2OA 3SEQA 1JEEA 1NP7A 1N2IA 4G5FA 2IELA 2EL7A 3CLSC 4FZJA 1PFWA 1WXHA 3BNWA 2A84A 1WXFA 5TEVA 3OTWA 4RUKA 3GUZA 2OYNA 3H05A 3A04A 4QREA 1QNFA 1I6LA 4MW2A 1QJCA 4CDNA 4OJMX 1IRXA 3ZJUA 1K97A 2PZAA 2BTEA 1N2HA 4UZEA 1NUUA 4TS1A 2D54A 5HUJA 3C8ZA 3QTTA 1QTQA 3FWKA 1MOPA 3AKZA 2A1TR 2Z09A 4NZPA 4MUIA 3SDBA 2Z08A 3SP1A 3COWA 4EG5A 4MW1A 3L93A 2RE8A 3IDFA 2QTMA 1FYDA 3FIUA 2C5SA 5J5AA 1Q19A 2ZUFA 3HMQA 4MVYA 4DDMA 1O0CA 1OWNA 3Q10A 4PBRA 1TEZA 1N2BA 1ZJWA 4MWEA 2AZXA 1JZQA 4U7JA 3FHJA 3HV0A 1EFVA 3P0IA 5TEWA 1NZJA 3ISJA 3KT0A 2XRYA 5AHWA 3AIIA 1OD6A 1XNJA 4J75A 4KR9A 1NUQA 1OWPA 2D13A 4E1AA 3UK2A 1NUPA 3H9CA 4MULA 1N1DA 4NAUA 1VLHA 2E0IA 3SZGA 1NYLA 5H16A 3COVA 3QE4A 5H7XA 4K0RA 3SYTA 1ZUNA 4MW6A 3X1KA 1NUSA 5HG0A 4Q16A 3RBAA 2QJFA 4YBRA 1CT9A 1H3FA 4I6EA 3AL0C 3P0JA 4MAFA 4ZCSA 2JAXA 1K4KA 3IH5A 3DV2A 1P4MA 1O94D 1ZH6A 1M8FA 4I6JA 1JEDA 1NB9A 2GM3A 1J1ZA 3KT6A 3IMGA 4KKVA 1ZH0A 3FETA 4ZT3A 3PNYA 4U63A 3UC5A 1KORA 2PXHA 2JA2A 2QTNA 3FOCA 3K9WA 1QRSA 2QUKA 1J20A 4KR6A 1G8GA 2HZ7A 3PNVA 1WXEA 3VGJA 5HUHA 1KP2A 3S3TA 2PFSA 1WQ4A 1XNGA 1M1ZA 1OWMA 2QJOA 3LOQA 3NBAA 1FFYA 2JANA 1KH1A 2X0KA 4UZFA 4AS1A 1N77A 1JMVA 3OP1A 3RJZA 3U1VA 3CVXA 2A88A 2CV2A 1TYBE 1M8KA 3H9BA 1COZA 3GMIA 3COZA 4MUHA 4CT0A 1OWLA 4R2MA 1N3LA 3TS1A 2XRZA 3KT3A 2IJGX 2WSIA 2WQ6A 2VTBB 3CLTC 4JXXA 2I1LA 2J07A 2CT8A 2X1MA 4ZT7A 1R6UA 3UOWA 1LI5A 1IVSA 3RFFA 1KKUA 2X3FA 3A2KA 4NATA 2IP1A 4WSOA 4ZT5A 4EG4A 2E89A 3FY4A 1QU2A 4MW0A 4ZT4A 3TNJA 1NSYA 1N06A 1EFPA 4KR7A 1O96A 1I6KA 4MWBA 5F23A 2H2AA 3ZUGA 1SURA 1JIIA 1GZUA 1TYDE 2Z3VA 1Q15A 3RK0A 2A1UA 3FI0A 3UMVA 1VL2A 1NI5A 1QRTA 1JIJA 2HGZA 2CYBA 1TQ8A 2X1LA 1H1TA 1YULA 2WQ7A 1JECA 2VXOA 1ULHA 1MBZA 1N78A 1YIDA 3CLRC 2RD2A 1N2EA 1GN8A 1O95C 3A05A 2QUJA 1IHOA 3ELBA 1O97D 3D6UA 4CDMA 3MMXA 3X1MA 1TFUA 1QU3A 1F9AA 1N75A 1T6ZA 2VBUA 5FNZA 4X0EA 5DB4A 1F7VA 4P2BA 1KQNA 3MXTA 4CQNA 1LW7A 5K0TA 1Y42X 1WZ2A 3RHSA 1O6BA 3AG5A 4DNXA 3D6VA 4GU5A 1F7UA 1M8GA 3CLSD 3ZIUA 4QBTA 1KH2A 5KWVA 1KQPA 2P3MA 3P0HA 3CVYA 2V0CA 2CYAA 1XJQA 3HZRA 4U8HA 4EGAA 3FH0A 1H3EA 3QTBA 3CA8A 1N07A 3IMEA 1N08A 3P52A 1XNHA 1F4LA 2TS1A 3N2YA 3UY4A 1MAWA 5A88A 1JIKA 5DEOA 3HL4A 4S1OA 1MB2A 2DUMA 2J5BA 3IUBA 3FG9A 1R6XA 2D5BA 1EUQA 1H3NA 1YIAA 1YUMA 4MW5A 2CV0A 1PG0A 4YP5A 4PBTA 2VBSA 3ZGZA 4NX2A 1IFXA 5A89A 3VRHA 1U0BB 1TYCA 3HGMA 3INNA 4JZYA 5EKDA 2AG6A 2YWCA 1T9GS 1Q11A 3NV7A 1U3CA 2VTBA 3N9IA 4HPWA 1IQ0A 3ILVA 1WXGA 1G8HA 1KH3A 3MUEA 4XSVA 1G59A 2HMAA 5TS2A 1R6TA 4EG1A 4J76A 4EF6A 2E21A 2DR2A 3FDXA 4HJRA 1KP3A 1M83A 1MAUA 4OUDB 4MUEA 3CLUC 1O96B 5IJXA 1NB0A 5LM3A 2O8VA 4NAHA 3GLVA 1OBCA 1GPMA 5J59A 4L2IB 1S4MA 1N2JA 5DASA 3CR8A 1EE1A 1G8FA 2NZ2A 1A8HA 4PBSA 1OBHA 3IMCA 4Q93A 1T6XA 1B6TA 4XFJA 3G6KA 3CTAA 4F3RA 1EJ2A 1PG2A 1K4MA 3H97A 4AQ7A 4KPUB 5K0SA 4ZT2A 2GKSA 3TZLA 4DJAA 4OUDA 2J4DA 4YMIA 4MVWA 1TYAE 2O5RA 2A86A 2CV1A 3ZJVA 3Q4GA 4XFDA 2CSXA 2DEUA 1NURA 2QJTA 3LCJA 4EFKA 3DPIA 2VBTA 4ND6A 4DLPA 3N05A 3AFHA 1Q77A 2GOYA 2J09A 1WKBA 2OV4A 2DERA 3PRHA 3PNBA 4L2IA 1MRZA 2YXNA 2PZBA 3IVGA 4MUGA 3CLTD 2H29A 3IOCA 4YP7A 5BNZA 1K92A 3CVVA 4JFAA 1MB9A 4R2LA 1IQRA 1KQOA 1LI7A 1T6YA 1I2DA 1WY5A 4EG3A 2CUZA 2VBVA 4MVXA 3TQOA 5LFAA 4MW7A 4HJXA 1GAXA 2A7XA 2PZ8A 1GTSA 5FO1A 1P7PA 1U3DA 1JGTA 4K03A 3X1JA 1MC1A 1QRUA 4ARCA 4G6ZA 1EFVB 2QUIA 4PY2A 4MUJA 4MVCA 2R5WA 4ZCQA 3COYA 2YY5A 1J70A 3E27A 5LLTA 3PXUA 1HYBA 3KFLA 4JXZA 3VU8A 4EG7A 1IQUA 3CLRD 2DLCX 4YP6A 1O0BA 4H3SA 4ND7A 1EUYA 4QRDA 2G36A 3F3MA 3L92A 4ZCRA 2QUHA 2V0GA 1V8FA 4BWVA 3BL5A 3TQIA 1EFPB 3SEZA 3IVCA 4DDHA 1RQGA 1DNPA 1MJHA 3A4IA 1O94C 1I6MA 1VBKA 4HK4A 2OQ2A 4G5YA 3ZXIA 3N8HA 4GRIA 3RK1A 5KHAA 1V47A 5FO0A 1N05A 5JBNA 1M8PA 3KT8A 3CVWA 1ILEA 1EXDA 1YUNA 3ND5A 1WOYA 1KAMA 4MQ6A 2PG3A 1T9GR 1GLNA 1KR2A 3DO8A 4KPUA 2BYTA 3NBKA 2EJCA 5A8AA 1WQ3A 1JHDA 3SZ3A 3G59A 1X8XA 4RPIA 1J1UA 1KAQA 5J58A 1PFYA 3Q12A 2DXIA 1IH8A 1O5TA 1J21A 2DPLA 1PFUA 4WNYA 1GTRA 4R0NA 3IVXA 4F4HA 4EG8A 3HFJA 3I05A 3ZJTA 1J09A 1UFVA 1VBNA 2NSYA 3ZXSA 2ZUEA 2A1UB 1WJGA 3IUEA 3H99A 2PIDA 3JXEA 2A1TS 1D2RA 2YWBA 4A91A 3ND7A 1QQTA 1YI8A 2J08A 4MLPA 5IHXA 4ARIA 5DK4A 4MW4A 3MLAA 4MUFA 1N2GA 3K32A 4DDKA 3LE8A 2QTRA 1WXIA 1U7XA
chains in the Genus database with same CATH superfamily
3RR2A 1U0NA 1PR2A 1PK8A 2OK8A 1CK4A 2VAMA 3G5AA 3K0HA 3KWMA 3LK7A 4RK5A 4JI3B 2BCEA 4D4MA 3RVRA 3ZS8A 1O8CA 2ZYAA 1WZIA 1XTZA 5HKLA 1UK6A 1YQUA 3G1WA 3ILXA 3J7TA 3Q5EA 2BGTA 1QKIA 2ENWA 3IAM6 4X7FA 3KKNA 3KKQA 2FMIA 4Z0NA 4F8YA 2X0FA 3UK1A 2HK8A 1JG4A 4BGDA 1YZTA 3GVXA 1J0BA 4DADA 2WLSA 3ROFA 1Z9BA 1ML3A 2FW8A 3HHPA 4L7QA 5HEKA 1YRLA 2J45A 3QZUA 1KU6A 3SGLA 2QN7A 4HH3C 3AJ9A 3EJWA 4JVMA 4DA7A 4NEQA 5KHOC 3LUHA 2WB2A 2EJTA 1CUSA 4TKMA 1MX1A 2AZ4A 2JGJA 1MN6A 2IIVA 4UEWA 4A8JC 1U8CB 1HV8A 2J6IA 2PKEA 1PL8A 1QGDA 5TX7A 2G88A 4OI1A 2VPIA 3S40A 5I6DA 4OLBA 4KNVA 1IWPB 4KN6A 5TGTA 3WGHA 1N2OA 1KWKA 4JMPA 2VNAA 2OV3A 4YRNA 1HY3A 4E32A 5JCXA 1YK1A 4I19A 4INAA 2J3QA 3SZUA 3F5SA 4IIHA 4YRGA 4N8SA 2KLBA 1JKXA 4NCJA 5E7QA 1UL1X 2GNOA 3OZBA 2BFPA 2DR0A 5JXIA 4BNDB 1XXHB 1MORA 3T1QA 4TMWA 3H5TA 1QNFA 2XE8A 1Z34A 4IXDA 1A1VA 1JJVA 2ORVA 3EFOA 3FLEA 1IRXA 2D3NA 1P0PA 2HF2A 3A1WA 2IYTA 2WBLC 3PDUA 1N5OX 3SICE 1DEHA 3EWAA 1IM2A 3KSUA 4X93A 1U2TA 2R3SA 1N2HA 3CCMB 3A9VA 2V3CC 5M29A 5FJJA 3R7AA 5JRDS 2JFBA 3V4ZA 3CUWA 2RHWA 5JPIA 1GUAA 3A6LA 3TVDA 3QUBA 1PWHA 2RK4A 2XQIA 2UYHA 1ZM2A 4C0AC 1EAYA 3COWA 3MCUA 5FB3A 1U2GA 5A4FS 3HO1A 1VB5A 4OI4A 1FYDA 2B0JA 1PHRA 2NACA 2QAIA 3NT2A 2ID8A 2AZTA 2BGWA 3N28A 1H42A 2CLFB 2OHHA 1EVQA 1Q7TA 2POQX 4X8LA 3R7LA 3OW2B 2QX4A 3EZXA 4TS3A 3INYA 4X1KB 2K2WA 5K7SA 3L46A 3SXPA 2Y1XA 4H27A 2N47A 4WWVA 4YQZA 5LIRA 4BVKA 1E99A 9ABPA 4J1TA 3A9WA 3OIGA 4COKA 1NUQA 4MR7B 4UD2A 4Z0HO 2ECOA 2GM4A 5IT4A 3G8DA 4L8JA 5DF1A 3F8SA 3CPSA 5T4HA 4TTVA 4B8WA 4N03A 4U6SA 3F7TA 2CL7X 3LV8A 1ZGJA 4TMXA 4JEMA 4JSYA 5JWHA 4CG0A 4I5GA 3QLUC 2FOLA 3PUWA 3JAMA 4OMCA 3GLGA 3J7AC 4WE3A 2WU1A 4K0RA 4D74A 4OQLA 5F4BA 2ZB8A 3TOVA 4BNNA 2C5EA 2VHJA 4QBFA 4QEKA 4J0IA 1HSOA 4TPKA 5AVOA 4P9NA 2FSGA 1P81A 2WHRA 4BNXA 4MAFA 3WLEA 3OSZA 3GLGE 1ZC3A 1PWZA 2AZMA 3V1KA 4XGRA 2BJVA 5JXGA 1A8IA 1W4RA 4PABA 3GQVA 3OETA 4I99A 4RK0A 4A0RA 2P0AA 4LJAA 1AKYA 1PYDA 2AJCA 2SECE 2YIJA 1D3AA 1T91A 4KYTA 4O4IA 1R27A 5DLYA 4LF9B 1OV4A 4JJ4A 4ZKDA 3VC2A 3O9MA 5FLEX 3ED5A 2AHRA 3W9BA 1TF2A 2C0CA 1M6YA 2C5LA 3FSJX 1NMZA 3D8HA 3CKYA 4GH5A 2J9GA 1OC2A 2OM6A 3R7DA 4RTNA 4G07A 5F21A 5L40A 2I6TA 3CRRA 3L8EA 2O8CA 1ZEMA 4Q3CA 1EGAA 1G66A 1T2CA 1PO7A 3SXUA 4UVGA 2ZBVA 3FOCA 4PAWA 4HD8A 4GI2A 1YJ8A 3IR7A 3WL5A 5KSZA 1KZGB 3DPSA 1AGRA 1G6KA 3C6ZA 3CTPA 3DE2X 3G5TA 2ZZEA 3IKMB 4OKIA 2XUKA 3AKYA 1CV2A 4Y1FA 4ZOEA 3S3TA 2A5YB 3IP8A 4NJMA 2PFSA 5D5HA 1E2JA 3UJ6A 5CDFE 1MCZA 4MR9B 5FUMA 5TSDA 4TVSA 2JLYA 5BSKA 1KI3A 1XU7A 2JANA 4R1QA 4LY6A 3MAJA 3PC4A 4EG0A 1NYTA 1KH1A 2FEPA 2XUIA 1C9YA 2AD1A 3D8BA 2VUSA 3ZH9B 3UT5A 4TYMA 1YZQA 5B7PA 1W48A 3C3MA 4I1YA 1U8FO 2BOVA 1PJQA 3MQ2A 1U8AA 1N77A 2R4TA 1YS6A 3QXSA 1M8KA 4QPZA 5ALVA 3HXTA 3QKTA 3RFVA 3GUVA 5J2UA 1HE2A 3QPCA 4LE2A 2NUBA 4TXLA 4GPBA 5K3FB 3HFSA 1JQJC 4F92B 2CNWD 3H9UA 2ZVQX 3CT4A 2EGUA 3SZMA 3H1TA 4BUZA 2QROA 4M1EA 4JC8A 2IA5A 2X1HA 5KO2A 2B78A 3JQBA 3FTCA 1LI5A 3LHSA 3KQOA 3VSAA 2OPBA 4QTYA 1KKUA 3QENA 1EVIA 1ZK4A 1SXJD 2H92A 2WYRA 4EG4A 4NOJA 2QSZA 3ZD6A 4X06A 3CH7A 4X3CA 3CUEF 3E9ZA 3UGTA 2XCQA 3IB3A 4KR7A 5F3WB 2CDCA 3S81A 4GRDA 4IV0A 4RY8A 2DBRA 4JGIA 2ZG6A 4CF6A 1GSOA 4ID3A 4KQGA 2IVFA 5B1HA 2RGYA 4IDEA 1KERA 1PT9A 4EY6A 4PZCA 1T1EA 4YT8A 4QRIA 2Q2WA 5ITZA 3IKLA 1TCVA 3CW9A 1GNVA 1DPGA 1LY1A 1QQ5A 1RKVA 1LSOA 4JNCA 1W73A 3I8OA 4JSTA 1ULTA 1VE9A 2PS9A 3RC9A 1MBZA 3DBHB 1N78A 4QOEA 4PANA 2PGLA 4YCJA 4J4TA 4BKUA 1ZEJA 4A36A 3E58A 1M34E 2O8NA 1L3IA 5KWJA 1QHHB 2PWPA 2W37A 3AYXB 3IBTA 5AUQA 2BTQA 2JI4A 3SQOA 4O1HA 2RGNC 2V4DA 3K0BA 4F60A 5CCEA 1R6VA 2AYYA 5LC1A 2NU8B 1TZCA 1ZMRA 5DHAA 3RRMA 4P4GA 4HLDA 2WOJA 4TLLB 5IXJA 4PPGA 3WDSA 3CH5A 1WP9A 4XKWA 3GD5A 1MRSA 1EJBA 2XMCA 2QPAA 3UQZA 4DZZA 1PR5A 2VJYA 3HWWA 3PRYA 1KH2A 3IELA 3JYOA 1LBQA 4JX9A 1SD1A 4OKSA 4RQTA 5E8RA 1CF4A 1OIWA 3D3KA 1P4HA 1SQ0A 1KMCA 1EK0A 4IVPA 4CL0A 4KKUA 1VMEA 4U39A 4HIZA 5EPEA 3UUWA 1IZ9A 1V95A 3O0DA 2W2TA 4JFRA 4U8HA 3ZWKA 2IDMA 2EYQA 2OBNA 4RDKA 2QW0X 5CAEB 4MR9A 2CJFA 4TLBA 1DC4A 1N7GA 1RAIA 1G5QA 5GVSA 2HU2A 3NEJA 4RXMA 1U1DA 4ALKA 1Z63A 4POAA 4D92A 1OZ0A 2W6NA 5BN5B 4XVCA 2BMEA 4UMDA 2KWIA 2P5TB 1GA6A 1N8TA 1H4QA 4Y2VA 5CT5A 1KEUA 1AN0A 2PT5A 3E0QA 2ZYDA 5D1HA 1GUBA 1DLJA 4P38A 4PHCA 1AA6A 3OQ1A 1QIEA 4UVDA 2VHYA 5F1OA 3OQHA 1VE7A 4RZXA 4PBTA 5DWDA 2BONA 1YQWA 3ABQB 1C4KA 1Q0UA 2BUCA 4N41A 4L8FA 3HGMA 2YN4A 4IDBA 4IHQA 5EMJA 5ICEA 3FTPA 5BSRA 2WP8J 3OTHA 3JQ9A 4KODA 1WCIA 4TTRA 4X92A 3AJRA 2C0PA 2H1CA 4XI9A 3TFOA 4XN3A 4QSMA 2PZLA 4RPGA 1II8A 3AY6A 3Q5GA 4WBSA 1BKYA 3KU4A 4YRJA 3U3KA 3BTOA 5D5PA 3ZTWA 4OVKA 2D74A 3FPGA 4KWEA 4Z4QA 1U3TA 2GK6A 1KJNA 3PC8A 4FWIB 5FWAA 1YRQA 3W8DA 4GXNA 1M6HA 1EH5A 4MKHA 3W2GA 1GXSB 4XSVA 2LD4A 4B6SA 1Z3CA 4DB4A 1ORDA 4KFSA 2MWMA 3OZDA 2EJWA 1B93A 1JDBC 1E9DA 3OAAA 3E8MA 1TVMA 3FVWA 3EJ6A 3FWHA 5JSHA 3MWJA 4KO1S 3CY6A 3H2BA 3ICVA 3Q7IA 3TO5A 1ZGBA 4R9VA 2X58A 4IZIA 5FI0B 1HE8B 1V2GA 1UKBA 3MWLA 2BFEB 3Q40A 1N36B 1HQYE 1QBKC 4H7DA 1EE1A 3U6KA 2GBIA 2G1KA 2ZRQA 2PUJA 9GPBA 5DP1A 3FFBA 4JDUA 4CKEA 2UZAA 3EEBA 4G84A 1T4CA 3N74A 2XI4A 1HGXA 4KRXA 4Q9AA 2JCSA 2P6MA 2VSQA 1P7VA 3LUAA 2Q4OA 5SY4A 2BFWA 1N8SA 3D4OA 5HJ5A 1ATIA 3HTXA 1QZUA 1ZM3A 1JG7A 4BQRA 3H42B 4CODB 2Q3EA 3SK0A 2B98A 2ZZKA 4K40A 2HIMA 3QLVC 2ORYA 1RMYA 3S2ZA 1VI6A 1SC1A 1IIBA 2D62A 2I66A 3P2JA 4KX5A 2OCGA 3V8PA 1L4FA 2J4DA 2PX4A 3P2IA 1MGOA 3SJBA 3RLFA 3T4XA 4LE1A 4R1TA 2DEUA 2B8TA 4V1CI 3EEIA 3KZXA 3T1OA 3DPIA 2VBTA 3VUEA 3ES9A 2C98A 4BC0A 1TU0A 3TRJA 3HA7A 3PKZA 3QJYA 3H2HA 1U1FA 1WKBA 4KH1A 3SC3A 5IBCA 4CMEC 2FXIA 4EH1A 3LNCA 4K2AA 2NPFA 2WJWA 4R6WA 4D02A 5BW8A 2UXCB 3IUQA 3FDIA 1PGJA 1G18A 3OY2A 1R66A 1OUMA 2QVZX 3QH4A 1B42A 5IAOA 1LV8A 2WKPA 3DUFA 4M1OA 2H29A 3GJSA 1E7SA 1GVNB 2XQJA 3UVEA 5BNZA 4JFAA 4LJRA 4QXPA 3HUTA 3OKXA 3OLCX 3QXHA 4H4EA 2ZXEA 4MGYR 1E7YA 2X4DA 5EHZA 1R9GA 2DFTA 3LVRE 1E5TA 4KQIA 2G77B 4ZZ3A 1ORTA 4L9WA 4U3JB 2C4UA 2W5UA 3CNEA 4Y6QA 5I9TA 1HG1A 2F8MA 2ZZFA 1T24A 2CDAA 1DGQA 4JU9A 4FFOA 1GNPA 3X1JA 1M2OA 3UANA 2FHSA 4ZGQB 5HS6A 3IP5A 3QW4B 4DQXA 2R86A 3AFIA 2YUIA 2QUIA 3P9PA 2IIBA 4B4UA 1PS0A 1ZFNA 2V5UA 2RHHA 1HDGO 3VKHA 1M2FA 4F9FA 1P1FA 3PXUA 3O95A 5EI5A 2P9EA 1D1NA 4ZKEA 3UIEA 4NCHA 5FI3A 4FW8A 5ALWA 2BEKA 1KAEA 5DN9A 1AQLA 2JH3A 1L2TA 1YBVA 5IBRA 4YREA 1LSUA 1V45E 4KCGA 1N5MA 4EELA 2QN6A 3E18A 3H1PA 4PX3A 1KZ9A 1IB0A 4U2EA 1CY8A 3O3CA 8GPBA 4WHMA 1QYXA 1DELA 4Q3DA 3DVAB 2XZLA 1TC2A 4RQAA 1UBOS 5EVCA 4XLCA 1Y9EA 4MYDA 4OV6B 3MCZA 5FFNA 4RIGA 3HFGA 4HVAA 4EHDA 1P19A 3EB9A 1THMA 2OQ2A 5EWMB 1LRKA 1SRQA 2JFVA 4PGMA 3U09A 2QP9X 3ZCXA 4V3CA 2XYVA 4QXAA 3CCCA 2JBAB 5BN3A 4MMZB 2XTMA 3QE9Y 1M1NB 1MNAA 5DM70 1M8PA 1MRNA 2VZ9A 4BGEA 4PLGA 2EJVA 2H5IA 4R2IA 3R7NA 4NMWA 2NUAB 2OHOA 4O08A 2ZJ6A 5DM4A 4ZU3A 1Y3BE 4W5WA 3WP0A 3BY2A 1VDMA 2F7SA 1P3JA 2WHXA 1RHQA 1WBDA 1J1UA 3ZVLA 1ZITA 3T3DA 4WESA 4RK1A 4MCJA 1J2YA 1CEQA 1VDZA 4B83A 3E2PA 3FDZB 3S2IA 4YYZA 6Q21A 4V0MA 1YB4A 3CJRA 2NO0A 4QVKA 3H3FA 1QMGA 4Q48A 5JXJA 5LDGA 4GOLD 1YMUA 2ODAA 2VDWB 4IIBA 4NXMB 1A9SA 2ZYGA 4LYDA 2DBVO 1OBOA 2P9ZA 2VPZA 2PSDA 3NYIA 5JJ5A 4MI3A 5L3QA 4MVJA 3WLOA 1WJGA 3ITDA 3EE6A 1NVXQ 4BQNA 3LVFO 1ZXBA 2D4HA 3GROA 4OHOA 2AFHE 4KQ2A 3G85A 5L53A 1F8FA 2CHQA 4XSGA 3M7IA 2Y67A 4CCSA 4LW8A 3H86A 2FGJA 4DRXA 4I9FA 4ZAWA 4RJTA 4B79A 2VQEB 2CCGA 3WQZA 4B6EA 1PJ7A 5JQWA 1JYSA 1SU4A 1NP6A 4GF5A 1NG1A 3EXFA 3NUGA 4URVR 5KYNA 3QEMB 2JZOA 4RHYA 4AKIA 1UDRA 4U3JA 4LNAA 1D6NA 4YIKA 4Y2SA 5ESDA 3L41A 1G8YA 1OZFA 2GCOB 2R8EA 2YJNA 4KMSA 3P2OA 4YT2A 1NZFA 1NYRA 4BV8A 4WKOA 2GSWA 2BMAA 2VP9A 2B4YA 1F20A 1Y7PA 3G1TA 3P5BA 5CH8A 2X0JA 4LMBA 4UPDA 2DZDA 4D9HA 2CLHB 2CLCX 2H59A 2FMUA 2GYWA 2P41A 1WNFA 3BYZA 2O4UX 3I2YX 3QVUA 1GLVA 1ZNYA 3G0GA 3SZRA 1JVSA 2V7WA 4RM3A 1IAQA 3B9BA 3D2BA 1ZJJA 3PUXA 3LQEA 3EGIA 4HP8A 1CZUA 1RZVA 4J6FA 1QIGA 4P22A 1HE5A 1E3LA 1MAAA 1VG0B 1VJCA 2A0FA 4OHMA 1Z7YA 9LDTA 3OHPA 5EE0A 4ZCPA 2QU7A 4ZOQI 5HKKD 2CFOA 5AQ1A 1U7DA 1I33A 3ONWA 2Z98A 5L4NA 1NF3A 4HEQA 2J67A 4FJ2A 1K2VN 4WZEA 1CDOA 3W78A 4PYKA 2EL7A 1G0NA 1YV9A 4GZ5A 1Z2PX 1N5DA 1ZN2A 1KFCB 4FCWA 4IIJB 4JJAA 1IN5A 2CKDA 3MTQA 3Q2IA 4MR8A 1AY0A 3I9KA 1LTKA 1GAJA 1HE1C 1Z0IA 4OQ4A 2XUAA 4D79A 1NATA 2AFIB 4L0QA 3G8AA 1QJCA 3AEQB 2WR8A 1CCWA 1S8AA 2VHXA 4MHTA 3I5MA 3BRSA 1E0AA 1OTYA 1WV0A 5ADHA 3RNOA 1C8KA 4LGMA 3SYNA 4UZEA 4UE2A 3UGJA 2RGNA 1CVLA 2N1MA 5L46A 1XLVA 4X6XA 5ECWA 3KPUA 2FN3A 2JI8A 5AI5A 4MUIA 1HLFA 2VLBA 3WGJA 1SHLA 4FYKA 4MX8A 5IMBA 3ZCRA 3STVA 5BVGB 4RPHA 4RETA 2Y4OA 3A3YA 3OZFA 1GGNA 2ZBGA 4LMRA 1ADJA 2UZIR 3W4JA 1B0ZA 1GVHA 1PE0A 2IU3A 1WVIA 4WASA 1P2FA 3ZU2A 4LZLA 4BQSA 3FOFC 1UADA 4QU5A 4DDMA 2R00A 1T26A 3DCIA 1U11A 3P9QA 4G8DA 5EQJB 2ZDHA 2E2WA 2ZB7A 3UT5B 3I4FA 4NMMA 4RY9A 1AQUA 1RWQA 5GV8A 1V9SA 2ZAMA 5M5BA 3DOFA 3AIIA 1OD6A 5CVUA 3ZIDA 3TQQA 4BNDA 2QLBA 4UTVA 5FWNA 1L4BA 2ARKA 1Z62A 2OSBA 4L72A 2D8MA 3SC6A 4PHFA 4XJTA 3LYHA 4ZVSA 2AG1A 1Q0QA 5FHQA 1WR8A 2KVOA 2E0IA 3OBBA 5I8WA 3GGCA 3RVDA 4YRSA 1NYLA 1OQAA 1QH1B 2O6LA 3M6XA 3W77A 3NHSA 4CCAA 1EVKA 1VQKB 3DFMA 1JNXX 2WNIA 5AK5A 2GHIA 2VNJA 2CMHA 3AU8A 1NUSA 1EVJA 3SN6A 2AEJA 5JANA 2J3IA 1A97A 4LYHA 2H4XA 5EG5A 3OKPA 4ZCSA 4B74A 1AZLA 1P1HA 2PX6A 4RF5A 4EGJA 6AT1A 4XPIB 2YC2C 2YW2A 3V97A 4C6HA 1J0EA 1B4DA 3O3OB 2AW5A 4QGAA 5LQNA 3AO0B 2RHCA 3GRPA 1X42A 2PMFA 4Y3UA 4HN2A 4ZD6A 3RIYA 1WSDA 2PZMA 1JBQA 1NBWB 3NORA 3OX1A 4TMFA 2UU9B 1U0TA 3ER6A 1XKQA 2IS1A 1RD4A 3WLNA 4YUVA 4Y9TA 1VHOA 3CE9A 3WK8A 2CXXA 1GCUA 4OOEA 4DDWA 1JWAB 3AR9A 5DBFA 2IHBA 4ZT3A 1JIUA 4QOFA 5F3RA 4ZAYA 3F96A 3M4YA 3A6FA 3C6MA 2XKKA 5TMEA 3DQZA 2WAOA 4Y67A 5IVPA 3IQZA 4IMIB 5DX0A 3HDGA 4GUDA 3PICA 4YONB 1LRJA 4JWKA 5J4YA 3I9LA 4F71A 4LNUB 3PQ3A 3BQ9A 4KWIA 3QEMA 4RH0A 4X45A 5ALRA 3RSSA 4FR2A 2OXCA 4C2BA 5CB4A 3ANSA 3F4BA 1RFGE 3LUCA 3VZDA 4CF5A 3KYJB 1XNRB 3JWJA 1M7GA 2XB9A 2XBMA 2BL4A 2IWHA 5F51A 2PWYA 1XQ9A 2ISQA 5KX5F 3BHNA 1K1EA 1Q3TA 3TCXB 4D4IA 5JWOA 2Q3BA 4HX9A 1BQEA 5DOVA 1M5TA 3AU9A 1TYBE 4NARA 1WETA 2IBMA 5HRUA 2XR1A 5HZGA 1OFTA 3THOA 5I3ZA 3UKDA 1HWYA 1L5MA 1PX0A 4ZRMA 1B0AA 3GFQA 3HVKA 2P35A 4R8MA 3VSBA 5BUCA 3EISA 1RRMA 3PE4A 3D6HA 2CFTA 1DC5A 1U3UA 3RUDA 4JXXA 4HBZA 4RJLA 1EUDB 1YNOA 1VJSA 3ENWA 4M0DA 4XLZA 4AJJA 3EPJA 4XQCA 1A3CA 1MPXA 1YR3A 4F3NA 2CLIB 1CYDA 3PEUA 1WHTB 2OVBA 3RUPA 4YAGA 1IVSA 1FVXA 2J1LA 3H2JA 3P9KA 4DQLA 2ILVA 3G23A 3I92A 3DMNA 4D81A 3TNJA 3S1AA 2GNAA 3CSSA 3K2IA 4NRDA 3SS9X 4MA0A 1E1RD 3OMLA 3N70A 1YJQA 4G37A 1MQSA 1MF7A 4TT8A 3R6JA 2HU8A 1RQPA 2JCYA 4XONA 5JSQA 5FTLA 2AOXA 3DWFA 5BSUA 3NOOA 4ODIA 2FWBA 1U8XX 1GTZA 1KO5A 1ZBDA 1D07A 2WKRA 1ORRA 1A2OA 2WD9A 2Z3VA 3DM5A 2YW9A 3I52A 1VL2A 4DCJA 4ER3A 5LP6A 4R54A 3F71A 4HDSB 2WJAA 4ND3A 1K7FB 3V7WA 2GO7A 3CUUA 4AW9A 3BK7A 4RAOA 5H3HA 1VE1A 3RIEA 3O4RA 2LP4Y 3OO1A 4K46A 3T3IA 4G36A 5ARDA 1WDWB 3LCRA 3C1UA 1Y1TA 2FPUA 3BXEA 1VI5A 3ETHA 3VTZA 3W8RA 1D03A 1T9BA 1NT4A 1VPTA 1HM5A 1YR8A 4A16A 1E4EB 1YRHA 5ES3A 1U0GA 1J90A 1M73E 1Q83A 5E95A 1W8IA 1EWYA 2ACKA 4JLBA 4TKLA 4YI5A 4M7PA 3W06A 3VO1A 4JY7A 4E3ZA 5CFNA 3AM4A 2PO5A 2H5LA 3JYHA 4W7IA 5DXFA 4KXLA 3L8MA 3W9SA 2PKWA 3FW1A 4FN4A 3H7AA 1SK8A 5LZ5A 5LQMA 3IR5A 2HLPA 4ZXFA 3R0ZA 3TLEA 4I50B 2V65A 2FRDC 5FD8A 5FWXA 2XE6A 2DWCA 4CL3A 1IBKB 1F38A 2XRMA 4DIDA 4EGQA 2ZT8A 4JXJA 2V58A 2GK3A 4EEXA 2VK1A 5JIBA 3D8UA 3ASPA 3CN7A 4RIFA 3ZHTA 4QJ3A 3ASTA 2WG2A 1PQYA 2PUHA 3U60B 4EHKA 4CMJA 1UD5A 1XZCA 4DR5B 4UUBA 2XHZA 3CJTA 3WMFA 2EWMA 2E4WA 4LHYA 4TQGA 1FQWA 4P0TA 4WH0A 2FQYA 3KJNA 4AMUA 1XDUA 5CG2A 3QRWA 1TM7E 2ZVPX 5T3UA 1XLTC 2DTXA 4C0BA 3U7HB 1UZLA 4RFVA 4R3NA 4A0QA 3ZW9A 1IOWA 1U99A 1W5AA 1DQNA 3PVCA 2YIDA 1KYQA 2R62A 2FE1A 4FFDA 4HRVA 5SY6A 3V1LA 4C3UA 4LXXA 1TLTA 3H4MA 2XMGA 1GN9A 3HS3A 2ZE6A 1E2HA 3K1ZA 3LUPA 4JUAA 4GSKA 4YP1A 3UYKA 3IIKA 1LUAA 2HHJA 4IMPA 1NF2A 4G4SO 3VH3A 4PPYA 2G06A 3GOHA 2RJNA 4LYJA 4OO3A 3OCYA 4XDHA 2ODEA 2RC6A 1H2EA 2EFHB 4Y1EA 3U7JA 5JC8A 1UH5A 2P4HX 1XZBA 4HQLA 4YV2A 1CDZA 1GGVA 1JWLA 3HM2A 3PWKA 1BPLA 2XNDA 3RSQA 3G2MA 5F4OA 1UOEA 4WCDA 1UPAA 2R6HA 3CX4A 3KBOA 4GDFA 2PUEA 2NQ2C 2AN3A 2O3TA 4ME6A 4KXFB 4TV8A 3CNBA 5KQPA 2C7PA 3JQ7B 1XJ5A 4GW3A 1S9HA 2PD3A 3HWRA 2VUTA 1P31A 2YCLA 3KB8A 1MTOA 3LQ2A 4JYMA 3DE4X 1R88A 3ENZA 4IG9A 3U9SA 5LQSA 3OOYA 2H52A 4LFCB 4DT1B 3VGPA 3TIGA 1LVUA 6REQA 4F85A 4JLVA 1VG9B 2DWOA 2CEKA 3AOGA 3NGMA 3H4VA 3PQ7A 3R3XA 4NYIQ 4UUMA 5AOBA 3RHZA 4NZNA 3TZKA 4EF5A 4ZK2A 3GSIA 3W6OA 3HSKA 3VPCA 3CXCB 4XWTA 3IEMA 4ZV4A 1JN0A 5IARA 3PQDA 1P3DA 4LV8B 3HBLA 1K9VF 3TVTA 4EHLA 1I13A 3C7KA 3V1TC 4FEAA 1IK6A 2WU4A 4Q93A 5KBYA 3KJXA 4ZCLA 1R50A 2BKAA 4R0VA 4PGAA 3D1LA 4LWOA 1QFJA 3UV6A 2HWKA 4KBGA 2QN3A 4IXWA 3B6KA 3MTDA 3RYTC 1KO8A 3AZQA 4AJ2A 1E6UA 4B3MB 4BFZA 3JQGB 4LN1A 2J0SA 1SXJE 2O2ZA 4AZSA 2ZI3A 1R4NB 3D8TA 2GBLA 2O5RA 1I1NA 2AEMA 3WGMA 3Q4GA 1VIMA 2H4YA 1NURA 4RF2A 3MJHA 3NBYC 4N5DA 4ADSG 4AICA 4EB6B 2Y0BA 3MMSA 2ZJ4A 3DO6A 4DCCA 3LX8A 4JJEA 3TINA 4X84A 4I3GA 2HXGA 1LVGA 2QRMA 3CZRA 5KYXB 1UBTS 2FF5A 3D6TB 1M2EA 4R7TA 4AP9A 4EKYA 5IWCA 3ZQUA 2PJDA 4F06A 5K0JA 1KI9A 3DZHA 3PNBA 3LRTA 3AUKA 3NQ41 3VR2A 3WIDA 4PAGA 3VTAA 1NN5A 3BWCA 4OL0A 2B82A 1DJNA 2C3OA 3F74A 1ECLA 2WYIA 3SJPA 4XWYA 5LNK6 3PDWA 5LP6C 5EXXA 1SKQA 4JC5A 4EQ6A 3HKDA 2HA6A 1IQRA 2OXEA 5P8WA 4NPAA 4J0HA 4JLPA 3L01A 3RTBA 1XPUA 3CMAB 3JALB 3LS2A 1PR0A 2VEOA 4KHZA 1LBIA 1NDHA 3NBZC 1OIXA 2NU7A 4EAAA 1FW6A 4J2OA 2YJGA 4W6ZA 4G0UA 3A3PA 2VYQA 5D3MB 1A72A 2EZTA 2P2DA 2Q6TA 2QI9C 3FWNA 3IP1A 2XH8A 3N0WA 2WMNB 1VIAA 3W8FA 3I6QA 5AW2A 4C4AA 3N0VA 4ZAXA 3HYNA 3AJAA 4ZN6A 2VHUA 2ZIUB 1BMTA 2ZUTA 4NTZA 2P7HA 1VHTA 5D3QA 4ILEA 3FOZA 4ARCA 1WOMA 3CRZA 3ZZ0A 3A11A 3GFVA 3JAWA 3OIWA 3V80A 3BVPA 4CM3A 1UP4A 5CLQA 5K0ZA 5CYGA 3D5QA 3L8YA 1W4AA 3EG9B 3SX4A 2AFHA 3O8OA 1EDZA 1ZD8A 3E23A 3VVLA 4CMIA 1XHEA 1HYBA 5AKEA 1QH8B 4FHGA 5F77A 1WU7A 2DJ5A 4LAFA 3MSCA 4TKUA 2HSGA 5KAMA 5CA0F 5KPDA 4X60A 4JEHA 1SBIA 2YZMA 5D2CA 4QRDA 2FN4A 5I45A 3UNXA 3LTEA 1QYDA 3UN1A 1EUCB 3OIVA 1JFFB 2C9MA 4NHOA 4BWVA 4PPFA 4DXHA 1FE8A 3TQIA 1ZHOA 1WOPA 4DR4B 3B6ZA 1G5IA 5H02A 2I65A 1VQ1A 3OE4A 4DV2B 3V5NA 4M53A 3ONEA 2X0RA 3A4IA 2X9QA 3F1KA 2ZPUA 4X24A 1ZYUA 4QXOA 1BXRB 1BN7A 3FFXA 1M5UA 5IXYA 1PJAA 3E8SA 4PN7A 1D1TA 2FRVA 4TT3D 3RK1A 3OPYI 1Z82A 2DYIA 1IK4A 5DRTA 2V7QA 1QZZA 4JASB 2I2FA 5L3SA 3QIVA 1ILEA 5F4JA 2O1WA 4R16A 1AUPA 4B7XA 2FSUA 3A4VA 3PIRA 2C29D 2NUTA 5EMLA 1G2IA 1UBLS 1AKNA 2ZR9A 3MTEA 1GLNA 3PFHA 4FBGA 2FW1A 4XLEA 3QHAA 2B2NA 3DO8A 4LF8B 4YAEA 1NXWA 4TTAA 4EZEA 1AKWA 1X19A 3OQJA 1JHDA 2O4CA 1QNLA 3KZ1E 3OBIA 1H93A 1R5JA 2I3ZA 3FOBA 3KPYA 3KOOA 4C2AA 5A5VA 3B60A 3GFGA 1HL3A 1O5TA 3IUPA 4XB2A 1SZCA 2J3LA 1GSIA 4O2BB 3HC7A 4OP2A 1G38A 1OF1A 2EYUA 5F12A 2O2DA 2G71A 1L4UA 1OT5A 3STTA 2ZJFA 4E88A 3HFJA 4E33A 3I05A 4MQEA 1NBOA 3W7VA 4P2NA 3LXUX 1RJ9A 4IHKA 2ZIGA 4S1PA 1LLCA 1NXQA 3OZVA 2E87A 3KOZA 3QWIA 3IAXA 3KAKA 1R64A 4FMDB 3P96A 4Y6RA 4BJHB 1SXGA 4QTXA 3ZCQA 2P9TA 4XVQA 4OBEA 2JRCA 1FBNA 1R3UA 1RYMA 4CEHA 2DC1A 3C74A 4MS4B 1MABB 4X63A 3RAJA 4MW4A 1XG5A 5CLGA 5E6UB 1Z4PX 1UAYA 3N07A 4YGYA 1XMOB 3B3AA 4Y9UA 4NONA 2FX3A 4RD4A 3JALA 3M5PA 1PL0A 4HSEA 1ZGZA 4HWKA 4QUAA 4HQRA 4YJFA 4ZOCA 4MWCA 4YRPA 3W2FA 4Q0MA 2DULA 2QQEA 3JQ6A 1EHCA 3HADA 1H2HA 1R4AA 2C95A 4GPIB 4LV6A 4ZT6A 1TLLA 3U37A 4A6PA 5IT0A 3CVUA 3JR7A 5DN6D 4H7JA 4PNHA 1UPTA 1GGEA 2P2CA 4DV3B 3TLXA 5FBZA 3MJTA 1RPNA 3BQMB 5EE5B 3K2BA 3S7TA 3TZEA 2W6MA 1P9LA 4DRZA 3THYB 4HN4B 1XRQA 5D00A 1T4GA 3F6RA 3IULA 3BXFA 3CYFA 4DY6A 2CFCA 4G01B 3RADC 2IBTA 4DG5A 4RTRA 3F9RA 1M72A 1UP7A 3GLIB 1QF6A 3N76A 2NSLA 4R8LA 4KFTA 3TYXA 4NBSA 3G2HA 3SF0A 3PNMA 1IG0A 2GZMA 3E4CA 2OHIA 2D1YA 1E2LA 5EHGA 5LMCA 5AKIA 1NOJA 4YUAA 3ITEA 4HYEA 3RYFA 1XF1A 3TNDA 1GAQA 5LQKA 2PL9A 2WW8A 1PFQA 3ND6A 4R84A 5IAGA 1FSPA 1EHIA 2F1KA 4M8SA 1SELA 2C8JA 2DCMA 3BXXA 4XSHA 4ZCTA 4DWJA 1W5TA 3ZHXA 2BD0A 5D3MA 4H17A 3CGWA 4LISA 4WK4B 1OKKD 1V7CA 4QLBA 1AKVA 5DGHA 4YAOA 3THWB 2ODPA 3A1TA 3AVQA 5HF6A 1NVEA 4DJFC 1CJTC 1N2IA 1I8DA 1NQVA 1XP5A 1IY2A 2V54A 3OTIA 2BZSA 2M1XA 4YRKA 4XZ3A 2DP4E 1GNLA 3GBVA 1WXHA 4GVLA 3RVKA 4NZZA 3GJ3A 1P3Y1 4K1XA 1ZD5A 2OYNA 2R6DA 3EASA 3FYUA 3OVMA 1E2EA 1EIZA 4MYHA 4YI3A 3WGTA 3S55A 1WTAA 1G2QA 2Y66A 4ZAGA 3VAYA 5M34A 1PNRA 1YZKA 3Q9LA 1Z7BA 2P62A 1MW9X 4PNPA 3CH6A 1X80A 2FPPB 3R5KA 2Y05A 4HAOA 3PR1A 2CMFA 3EVFA 3GRYA 1WMFA 2F48A 1VRVA 5DGDA 1NIPA 1MOPA 4OLAA 4ZVOA 3WB0A 5C52B 3O90A 4U9UA 4EBBA 3PL5A 3WRVA 5C0OE 2KLHA 4N5NA 2H08A 1CWUA 4HZGA 3RIHA 4I5FA 5KOYA 1RAFA 4X3OA 1RKXA 1W1WA 2ID7A 1Q19A 5IF9A 1NW3A 3H4TA 2JGDA 3HYLA 2CLSA 2VH5R 2BSAA 4CM7A 1JDSA 3BK2A 2DQYA 3IEIA 1W7AA 1H65A 3H8VA 1U9IA 3ZH2A 2WWVD 5H8WA 4ENSA 2Q6OA 1P2DA 4A92A 1E79A 3I9NA 4OQFA 1YU9A 3VNVA 3IAEA 1O94A 2Y9PB 3HYSA 3Q5DA 1K9SA 2AFIE 4IMRA 4UNPA 1SOWA 4NESA 4URFA 2H17A 1LKZA 2FPPA 3D3QA 3K5IA 1QGUA 1PZGA 4FI3C 4LDZA 5DHRA 1FFAA 1L7DA 3FZNA 4P3NA 3V33A 3Q8KA 5JFTA 1KMIY 2IYAA 4G0VA 4QQFA 5CT6A 1T2EA 1MZPA 4NYMQ 1YB7A 3RS3A 4L8WB 4ZHQA 3TTTA 4CUJA 1P4AA 1NQOA 4QUGA 4PEVA 1W36C 1IHMA 1RABA 3JQAD 4G1CA 1WNTA 2GBPA 4CETA 2QNBA 1CFZA 2OECA 4GZ3A 4WNIA 5HS4A 2JGAA 1B0PA 3KC2A 3RS4A 2JAXA 4MJXA 5BQFA 3DVAA 2C5AA 4JP8A 1PK7A 3RI3A 1RXYA 2BZGA 4QT0A 4UOEA 5L3ZA 4YT5A 2KW5A 1U90A 2QHXA 2WAAA 3E81A 1OBFO 1QXSA 4KWCA 4D6YA 3SX2A 1TJPB 3O8NA 2J7KA 1X1SA 3RT9A 5C35A 3IPXA 4XGQA 2OO7A 2LRHA 3FETA 3LP5A 4UUAA 5AK6A 4C6SA 2H3HA 3C5CA 5JZOA 1LPBB 3AB7A 3EXEA 1BX1A 3HRHA 3OHSX 3EULA 4O4LB 5DX1A 3UC5A 4ID9A 1RI3A 4B7CA 2IEBA 2ID9A 2Y0DA 3ZVNA 4S12A 5DTJA 3VR5A 4YJGA 2GYUA 1FDSA 2CNWA 4FHDA 4JDPA 4BWGA 4RTLA 4KR6A 1N25A 4YCSA 1WXEA 3D2CA 3ICCA 2FPIB 5C8YA 4RA6A 1GFZA 1EEXB 2C3UA 5FOXA 4LF6B 2AE2A 3B36A 4A5SA 4ACBA 1PT8A 5LQDA 3UMYA 4BCCA 4AC9A 1EVZA 4HWTA 1QP0A 4XLFA 1E9AA 2F17A 2VAVA 2H06A 3VPHA 1ZA2A 3N39C 1SVOA 3JW8A 1TAHA 3ABZA 3L4EA 4OHWA 1QQ6A 3UMFA 3OCVA 2J59A 2RBEA 3KT3A 3NHMA 3G9ZA 3EIOA 3PUZA 3D7KA 3STHA 2DPYA 1YA4A 5CH3A 2WTEA 1GG9A 4PZDA 4CV0A 4DYHA 5LYJF 4XCVA 3O8QB 1OX4B 4L8LA 4A5OA 2C96A 10MHA 4R81A 2PFKA 5FAKA 2Q3DA 1UC4B 1UD6A 4Y9DA 1A5AB 4PRKA 3CWZA 4L74A 1KYXA 2G5PA 4I2NA 4A2QA 3A2KA 2E89A 1A5SB 2DJIA 4K6FA 4MW0A 4E31A 1X9IA 4NDZA 4EVRA 1UK8A 2I0FA 3GVCA 1OW3B 1MO5A 1PJ4A 3AQIA 4P81A 4D57A 5BWCA 2GGSA 3O0TA 3T3EA 3HA2A 3PXBA 1JTFA 2JCVA 2XMSA 3M9XA 1TK2A 2WTBA 1JE0A 4DNFA 1ODCA 2JHPA 4DWOA 2F9MA 2Y1FA 3CCRB 3R44A 2M9MA 3H9GA 4PXAA 2Q5LA 4M7RA 1P8AA 3C45A 3T38A 2CYBA 4LDNA 3KR1A 4HBGA 5I5GA 2ZSDA 5IEJA 4EW3A 2WQ7A 1ZHFA 4LZJA 4DRYA 2R7NA 4CQLB 1NU6A 3CLRC 5ITSA 4OAOA 4GSYA 1KMHB 2E1RA 3UMGA 2E82A 2CXOA 4UHJA 4BDTA 4OXXA 2D1SA 2YYZA 2P9HA 1JSCA 3ZWMA 3H6KA 1YE8A 4REOA 1F9AA 5BUQA 1T3GA 2J41A 2PD6A 1VYUA 3PG5A 3PR2B 4N7BA 4RYDA 3SU8A 1TKAA 3NH6A 2VSOA 1EBBA 2WAYA 3G0OA 1IXZA 3VPAA 4ARBA 4WEQA 1UT8A 4ND8B 4EJSC 2ZTSA 2FR0A 3D6VA 3WA6A 4D9IA 2WU0A 1NMXA 4MXDA 2P6PA 1T8RA 3FPBA 4XQ0A 1J8MF 1KAHA 4ZDJA 2POCA 5I01A 4YDSA 4CM9A 1KJ9A 1W87A 3C8HA 4MTCA 1WZEA 1TQ6A 2Z6BD 1OYYA 2Z8YM 4WXYB 4AYXA 3FNEA 3Q2KA 4K88A 2AFRA 1UMDA 3QTBA 1CQJA 2QVXX 1Y5IA 4Q9DA 4DK0A 1G5TA 5BT9A 1ESNA 3X2FA 5TV2A 3QVWA 4WBNA 5IC6A 2PRYA 5C3MA 4TV8B 2Z6AA 2DG2A 3L84A 2NXJA 1XZIA 3KTOA 3EH2A 1SJ9A 4PHTA 3W6ZA 2PVPA 3Q15C 4ESHA 5CB4B 1FLNA 1L4HA 3HA5A 4MUXA 3RF6A 3QELB 1CZNA 4BCDA 4IIVA 1ZIDA 4X1OA 1S3SA 1KC1A 3VJMA 1QR2A 2D5BA 2Q5HA 3G82C 5I4CA 2CBXA 4RFLA 3EAGA 1X94A 2HJHA 3VYSB 5A9SA 5C4IA 4MW5A 2ONYA 3UUEA 2ZM5A 2CV0A 1UFKA 2X6YA 2C4HA 2ZXFA 4NX2A 1N0UA 4C22A 3PPXA 5KYXA 1XZHA 1H8EA 1RHMA 2OFOA 2REQA 2OK7A 5CLIA 4GM0A 1UBGA 4R98A 5HJ2A 5SYNA 2QTCA 3O93A 3E70C 5CLHA 1Q11A 2EGHA 2ZE5A 2W6JA 1NUHA 4OX9B 4NJEB 1QVAA 5BW5A 5TPWB 3U4GA 3SOPA 4C9BA 2DSTA 4CEJB 3O94A 4Q24A 4DNQA 1G8HA 4QXQA 5ENZA 1OX4A 3WK6A 2OFWA 4CIAA 1WUTA 5IKPA 2EDCA 3ZK8A 2FP4A 3MJEA 2BM9A 3THXB 1K0UA 2C7QA 1WD7A 2R60A 2Q28A 1T5LA 2WRZA 3G8BA 4OHPA 2VDKB 1DO8A 2P75A 2AS0A 1SKYB 1E60A 5F9MA 3C4VA 1Y80A 1AKMA 4OUDB 3TXAA 9ATCA 1CVRA 1XPJA 2CXSA 3TIIA 3ADKA 4DR3B 1KZLA 3KELA 2JAQA 2G4VA 1UZUA 1GRCA 1H22A 1E98A 5CDSA 2PVCA 2HB6A 5I9LA 5TF4A 4LHWA 4CG1A 5FF9A 1DVRA 4UHEA 2HH9A 4W5TA 3H94A 3GJ6A 4F1JA 1CS0B 1FA9A 1T6XA 4QUZA 4G86A 5EXEA 5JI2E 4A0GA 2ZM6B 1N2SA 3CX8A 4CEJA 4ZJUA 5TPZA 1HTTA 1E0DA 2JGEA 2FPXA 4D97A 3OJEA 2BHRA 2HYIC 1LC3A 3A4NA 1NJSA 4HB2A 3AHHA 3JWIA 4L75A 4D46A 5I4IA 5JBIA 4DIMA 3B51X 3OCZA 4R1SA 3R9XA 3EGDA 4IFBA 5CCXA 4M22A 1TECE 3ZDYB 4IFEA 4OUDA 5AP9A 4GNKA 3TPCA 3ZWVA 3JYLA 5L7TA 2IU4A 3JASA 4R1LA 1VZ3A 3G8YA 2WF8A 3VC1A 5CB6A 4JAVC 1FF9A 2DLDA 2OWDA 2P77A 1XB2A 3KJIA 4XIYA 5CM9C 3PC3A 1G21B 3CM0A 3UK0A 2OV8A 4DLPA 3WLSA 1B8UA 1YFZA 3GQBA 3WMXA 2XIQA 3FBTA 3FMVA 3LK6A 2E9SA 1UFQA 4KXYA 4DBLC 2WIFA 3KD3A 3KL4A 3G6WA 1U7PA 3KX2A 4HSGA 1JA9A 5L3VA 1XZ8A 3FMGA 3IVMA 3HZOA 1T0JB 2QTFA 4JOBA 2WG1A 5H3LA 5HRCA 5IYZA 3ZCSA 3HK2A 5DTIA 4TXJA 1TD1A 3M4ZA 2Q5QA 3ML1A 4N6NA 3A7EA 4JNKA 5ALNA 1PS8A 4OHVA 1MB9A 1U0OC 1YJBA 1CZLA 2QTTA 4GOJA 4EUHA 2Y4NA 1MIOB 2NT4A 4P31A 5M3BA 1IBLB 4TWRA 1ZQ1A 1S4QA 3QKRA 4EABA 1E1LA 1HDRA 4R7ZA 1O57A 2YMMA 5EY5B 4IO1A 4TLMB 3WSWA 1SRRA 4YFYA 1HL7A 4EY3A 2EBFX 4GLLA 5BY2A 4NIMA 4IIUA 1CNEA 2VHCA 4GRAA 3HJAA 3OU7A 4TV9B 3O4GA 3LDFA 3B8EA 1ZM7A 2UZ3A 1XF9A 5ERXA 2YZGA 1ZN7A 1G9TA 1UINA 1UPFA 3SVLA 3V76A 2KX7A 2EATA 1JAYA 3EGEA 2VEDA 1LF0A 3R20A 1Z6QA 4Z1MA 2R5WA 1P9RA 3OUUA 4GWGA 2XGSA 3NC1C 2O2CA 2IPOA 2W8BA 2GETA 4HFNA 4IDAA 4RF4A 1YASA 2BAGA 3EZNA 2GD6A 4FYPA 4G1EB 2OB1A 1CYEA 2P3SA 5KS2A 5KNDA 3BH6A 2C5BA 5B37A 4BMCA 1F6DA 1J9ZA 5T4BA 4KWTA 3HGTA 1TM2A 2OP0A 4F6RB 4C2UA 5KYUA 1P1CA 5GOTA 1PR6A 2KBFA 1WY7A 1XHLA 2BKXA 2BFBA 3RTGA 3F2VA 2IOYA 5HKAA 2FR8A 1PGPA 5IVHA 1ZU4A 3RC8A 2BV3A 1GZ4A 3BDAA 3DP9A 3GP3A 5HOQA 2X0EA 5HSGA 3ZXIA 1MH1A 2JI7A 4RGVA 5FV7A 4D6PA 4ZO9A 4GRIA 2SKDA 4EUKA 4OJKA 2DHEA 5KHAA 7REQB 3GUYA 1WZUA 1Y3IA 3HB0A 2H1RA 1JEJA 2ZXHA 3ASVA 4HB3A 3F90A 4RKRA 2N1BA 1I4EB 1YVRA 2YFQA 3GIDA 1MENA 4IQ0A 1JRLA 4KUGA 1JR3A 4B3FX 1VPDA 5I7EA 1LQTA 2NO9A 1R18A 2PH5A 3IA2A 4JBIA 1N32B 2HXSA 4MQ5A 3EOZA 1GD1O 4DV7B 4HYQA 4Z7JA 2PX3A 5IAAA 5DISB 2Y0EA 2YR0A 2NXCA 2UYGA 4J1SA 3HJUA 5GONB 1XBTA 2PTGA 1EUCA 2V5AA 1E3QA 3Q3JB 2NU6A 4WJKB 2BGIA 4GLFA 4UM9D 3ZY2A 2DKOA 3BG5A 1I01A 4AX4A 5JNUA 4NYJQ 5EWMA 1J7JA 4UHCA 2F62A 3TVYA 1I14A 2WAMA 4PS0A 1L8OA 2Q6LA 1XTPA 2BCGY 2VL7A 3A3KA 3Q9NA 4RVHA 4W82A 4CQJA 1I1OA 3M83A 1TGYA 3NOXA 4XYBA 5HF5A 4EHIA 3LL7A 2AEFA 3VYTB 4Z4FA 1N2CE 4E5VA 2BFDB 5CNKA 3M3DA 1JQ3A 3MT8A 4XX0A 3TXXA 5A1TA 4L5BA 1T8WA 2BF7A 1UKVY 2ZBQA 1PUXA 3GPDG 4GP7A 3M6IA 4MLPA 3RYFB 3VR6H 2RGRA 1Y5NA 2VT6A 2UZ1B 3VU3A 4ZFNA 3KSZO 3JZAA 1HMYA 4S2EA 2BM0A 3A1PA 1NULA 2C84A 4OPSA 2FVXA 3U6BA 3CZQA 1DRUA 1V9CA 4MUNA 4NQRA 1BKDR 2HNAA 2X8JA 4LUCA 1Z29A 4H08A 5AJZA 1RI4A 1HEYA 1JQ5A 3D1JA 3SYKA 2J9XB 4FFLA 2R11A 1TCBA 1UCFA 3U7RA 5EIBD 4EATA 1G5HA 1GQFA 1UIRA 1P2UA 2JIMA 2BGJA 3GGJA 2C7GA 4IR7A 3SAJA 1ENYA 2XUDA 3RYHB 5AW7A 1KO1A 2HA7A 4I6GA 4F45A 4PQGA 4IJWA 4RVUA 3BF7A 4KR3A 1MJGM 4A7PA 2F3TA 1U8UA 3QV2A 2G9NA 3VJRA 3CC7B 4ZEOA 4JX8A 3O84A 4PZLA 2WY2D 2OCKA 5J4LA 2K2QB 4OK3A 3D3WA 2NV6A 4PCUA 4ZXPA 1JDVA 2Y68A 1Z73A 4OLFA 2AMJA 4UQPA 4RTMA 5CDYA 3D43A 3U7GA 3BA6A 1M0EA 3M3PA 5DGTA 4ALLA 1I2BA 1NR5A 1EDBA 4I4CA 1H9AA 4H2DA 3EC7A 5D51S 4IPTA 1DC8A 4JUFA 3C70A 4UAVA 3FKJA 3G05A 1C0KA 1UR5A 2ZETA 3FFWA 3M81A 2CJXA 3L7IA 4MEBA 4Y18A 4GPZA 2I7CA 5J47A 4YMHA 1IN7A 1T8UA 2HM7A 1K2WA 4A03A 4TRRA 2BR4A 1IZYA 1ZNQO 3DDHA 3DT6A 4IIJF 3C43A 3G89A 5G1OA 3V46A 3QMVA 5JAHA 1PCXA 3ANTA 3JD2A 5AKYA 4HQ6A 2ZWIA 1WXFA 4LX8A 1STOA 3OTOB 3E5NA 1PG5A 1SIUA 3REQB 1JT9A 1JPUA 1RBZA 4BO8A 2ZJ1A 1R0XA 2R6GA 1TT7A 4AMGA 3U13A 2QD3A 5HUJA 4XW2A 1N7JA 4UDNA 1KSGA 1ULUA 4ZALA 1C7EA 3NUZA 3MRVA 3IKVA 4RD1A 3OKFA 4Q21A 3PFWO 5BUZA 5C1OA 5LWQA 3B7PA 1Z5PA 2Q5FA 2VT7A 4H35A 3AVTA 1SZDA 2Z08A 4QTTB 3TAUA 2QPTA 1F8GA 4GBJA 4LHSA 4AZ3A 2RE8A 2O07A 1R9MA 1LFDB 2PWZA 4P7JA 1E2KA 7MHTA 2I4OA 1C2YA 3NO4A 2JLRA 1T1SA 3H75A 1EFLA 2G76A 3WWEA 4IINA 2B6NA 4FZVA 4RPKA 5AXDA 1YUBA 3WKDA 2PRSA 4FOTA 4AZTA 5K2OA 2MIIA 4RACA 3RHFA 4K3VA 1W0CA 5JTTA 5B2ZA 4HFJA 2DY0A 4GR5A 1UZMA 5KTYA 2REXB 3UB2A 3UJPA 2J4FA 4CFZA 4XM1A 4O4HB 1KK2A 3F3KA 3QE3A 3WZ2A 4QGSA 1XYYA 2A58A 4F5YA 3L6DA 3GBSA 4Z7QB 3J81k 1R4ZA 2MDTA 2VKTA 1XCLA 3IE0A 5EINA 1RC1A 1N1DA 3GZ4A 4EJFA 4WCVA 5EQFA 5LU9A 1NW6A 1ZVKA 3RPEA 3FLAA 5DYTA 5H83A 4XGNA 1X38A 3IQFA 4C76A 4LWPA 3SYTA 3IQEA 4GICA 1RCUA 4U2FA 3RARA 3MS4A 1MO3A 4TRNA 3LQKA 1GUZA 1Z6YA 5JZ9A 4R1MA 2UUOA 1YR6A 4I6EA 3TMKA 3D59A 1E66A 1VLVA 2YIMA 5KTTA 1E3SA 1JPNA 4XQFA 3DTVB 4I9UA 1V6CA 2QRVB 4NP6A 4E30A 2A92A 3RYCA 4KUHA 1CR4A 5EXSA 4FTWA 4A6EA 2P6NA 3ZHCA 4DLVA 4HPXB 1AGPA 3T7IA 1NB9A 4JK3A 4TL6A 3U49A 4KIWA 2A5DA 4X54A 4CW7A 1QGAA 3PPIA 2IYFA 2WUFA 3ZHSA 5J43A 5HIKA 2IXEA 1ODJA 1KORA 2BFMA 5JG7A 1QH1A 3L4BA 3H11B 4R1UA 1SCUB 2Z43A 3BE6A 2IRWA 4XIFA 4XE5A 1QRSA 2FJ0A 2RI6A 2D2EA 3BAZA 3R7WB 4BEWA 2WUEA 4MWSA 3QBEA 2VYCA 1SNYA 4OIMA 4OHZA 2LKDA 4OFWA 3WDMA 2WWHA 5T67A 3W1VA 1VE6A 2P4EA 3GLTA 1DRVA 1KI1A 4XPIA 4MKXA 1AB6A 3BGDA 2D7DA 1ZIPA 5E3IA 4B3XA 4WINA 3A4LA 2CV2A 2V7TA 1QHYA 5EKTA 4DN6A 4G85A 4RSMA 1G5FA 4JLOA 4Q7EA 1FTSA 3SQWA 2DRIA 4FBLA 2KPOA 3WYNA 2FWMX 2WMOB 1KZ7B 1E5LA 4Q03A 5IFKA 3PC6A 1R7RA 4EI8A 1ISPA 1JIXA 1MXHA 1QYIA 1U04A 1ZWLA 2OZKA 5SYMA 4N48A 2FPGB 1N5KA 2SHKA 3NHUA 1ODLA 1EFAA 4HGRA 3T53B 1ZIXA 1F3LA 3LZCA 3FNHA 3R0VA 4PW0A 2WYVA 4J2HA 3PQ2A 3ZHZA 4ZO8A 1ZI8A 1VCOA 4ETMA 5CXUA 3LSYA 5ALJA 2DECA 4NAVA 2UDPA 3YASA 1H2FA 1CR1A 1EFPA 1N8NA 2KQUA 3E22A 3KG2A 4YCLA 3LCVB 4QVIA 4I4LA 3ER9A 4W4TA 4BVEA 1JU3A 4TN5A 3IESA 1DJOA 3MS2A 1DARA 1BC5A 1O6GA 4TLAA 3TR5A 4B3CA 1TYDE 1GZUA 2C3YA 1GUFA 3AW8A 3BD9A 5IK2A 5I7FA 3C5HA 4W5OA 4JA0A 3WK9A 4LYFA 5LZ7A 4ZJZA 1C3XA 2XD9A 2QX9A 5FFFA 2PS0A 2VXCA 4QFDA 4F9GA 1UMBA 2H6EA 3AEUB 2OCPA 2V7UA 3FSGD 3DDOA 3O6VA 1L5HA 3URMA 1WS6A 2M5SA 3FYUC 1SQ5A 3WNCA 1ECPA 1X86B 3DAFA 2VAXA 1N2EA 1YZFA 5IU6A 2X2PA 3RSZA 3T9DA 2QUJA 4NCNA 2HRBA 3ODPA 4RY0A 4X62B 1L9XA 4JR0A 2QT9A 4CDMA 3W5BA 5U4XA 1EGMB 2VJIA 1AK9A 4UDYX 1K4YA 1KYVA 1NVKA 1QKKA 2SCUB 4BFUA 1VIDA 4L0DA 2D3TA 3HB4X 2FW9A 5HVNA 2UUBB 2NZXA 2CHUA 4ZA2A 3KYDA 3EZ2A 1CRZA 3O4FA 4GMDA 4MJLA 1DO2A 2CGEA 4IQFA 1CPYA 1COWD 4QGBA 1KXZA 2PSHA 4GU5A 1QVFB 3AHJA 3IR6A 4BNVA 2QRVA 3PWZA 1EHYA 1V5IA 2ATXA 2ZSIA 4G2NA 3FPEA 3GL9A 5DM2A 2FK8A 2P2NA 4KX3A 3Q7PA 5H81A 2H48A 5EYPB 4IDCA 2OD2A 3G2IA 4L5IA 4BL5A 2WD7B 1OY1A 5EC8A 3RAEC 2OFFA 3VSDA 1S89A 3LO5A 3KUKA 4D8WA 3UY4A 2QX7A 3A9SA 3OZIA 5JVDA 1SOMA 4OP7A 3RFUA 3PX7A 2H1VA 3E53A 1CNMA 2FR8C 4BX2A 4QYTA 1GT91 3HB7A 4K6CA 3KSAC 1YHNA 3TBHA 3Q38A 4FX5A 4MV0A 1PR1A 3SJUA 5B3LA 3IHLA 5BOSB 5ES4B 2ZRPA 1K8RA 4M1ZA 1NN3A 1JHOA 2PV0A 5JTUA 3OW7A 4W5NA 2FZ4A 1NF8A 2V7BA 4ZQIA 2E55A 4D45A 3TSYA 1LPSA 3E61A 4L7VA 2BY4A 3FAZA 2W43A 4ZI3A 2VDWA 1ZKMA 4CZ2A 3VYRB 5F4ZA 1S1CA 1TCCA 2AOTA 1HI9A 2I29A 3H0EA 4EB0A 3W3AD 4KXXA 4FYVA 4PZUA 3B1XA 1ZD4A 4R8VA 2XDAA 3T9CA 3IBSA 3TTVA 2O8FA 1JXOA 1LDMA 4LI3X 4HNHA 2C7VA 3RWMB 2RAFA 1CEYA 1XAJA 3GGGA 1V39A 3LGSA 2P90A 4CBVA 2Q99A 2VUUA 3NX4A 3R5SA 2PU7A 1GPDG 4I08A 3A4MA 5K3SA 3SVZA 3H6GA 2GAOA 1Y48E 3SLGA 4EF6A 1C14A 3KEQA 4DQ0A 3DDYA 2I6GA 2NVUA 2O1XA 3VFDA 3CLUC 3SBEA 4D9JA 4P26A 4AKHA 4TWBA 1USGA 4CI9A 3UJNA 4U7DA 1ZLXA 3NTLA 3VI4B 1BU8A 2W9XA 4WKGA 5H68A 1CY0A 1GPMA 4QULA 3UAYA 4N5IX 4M60A 1N7IA 2QE7D 1IQPA 3D6FA 3HJNA 1M6WA 4JOSA 4EWLA 2DX7A 1ZVJA 5TGZA 5BSFA 2W4MA 2IDJA 4ZEXA 1O6ZA 4TMTA 2H57A 4H6WA 3DLIA 3CTAA 4CQLA 4PN3A 5D1NA 2AIRA 2ZI7A 3HB5X 5JNLA 5ALKA 1TA9A 1EFRD 3K8OE 5EMNA 1CUEA 4AROA 1Q0LA 1A9QA 3AR7A 1P0MA 1JNYA 3NU1A 4ZT2A 4BVJA 1XTRA 3EWSA 1KARA 1SA0A 3ZWWA 2I4MA 4MKFA 5CUQA 1JX6A 1WUYA 5EIXA 4UFPA 1DWOA 1JMKC 1NZDA 1P75A 3D0OA 2C54A 3RV3A 1G5PA 1TI7A 1IDOA 4RORA 3FCSB 4QIHA 1MH9A 4PSCA 1OILA 1W30A 1XC7A 2BBSA 3UM9A 2VH2A 4Y7DA 2OV6A 4DSNA 3I5XA 2UXBB 4CUKA 2XSZA 5DT2A 4CM8B 4RVOA 1E5XA 1V3QE 1OGJA 2D5LA 1CJSA 1BQ4A 3AM3A 3FTNA 2IYZA 1FU7A 3NVAA 4H7PA 3W4KA 4KJZA 3L7MA 3UOGA 4AECA 2J0QA 3A3NA 1IPFA 2A9JA 1Z2EA 2WD8A 1U0SY 5ALXA 4M88A 4M1YA 2A8YA 2B37A 1YXMA 4QNMA 2PZBA 2Q5IA 2PSJA 1SU6A 1LC0A 2RBGA 1N33B 1X7GA 1LDYA 3MERA 4LJSA 5FA5A 4G24A 2HIAA 4IOLA 3FVRA 4MVJM 1XQWA 2ECPA 2JFFA 3VSEA 3RC1A 2VCHA 1EP3B 3OLWA 1RZ3A 3I37X 3L04A 4ZYXA 4MDHA 3B1YA 1PT7A 2SCUA 1IL0A 1MAVA 1WY5A 1E9FA 3VNUA 1HZEA 1OVGA 1VJ5A 1C3EA 2GEFA 3CNLA 3GG2A 5DBGA 1EQUA 3WLMA 2OAP1 2BJWA 4Q34A 1FLDA 1AA9A 2YIVX 3KLBA 4XH9B 4CTJA 3CNHA 4MW7A 5UKDA 2X9VA 3H04A 1NRJB 1KVQA 2DQ4A 2AWNA 2WKWA 3GRKA 5CYOA 4K03A 3SJCA 1J56A 2A67A 3H6HA 2O23A 4I1OA 5DNCA 5DHTA 2P1RA 5DLPA 1I80A 1U63A 2N9UA 2FW6A 3FRJA 1HX7A 2ZB3A 5LZ8A 2VVTA 4X1YB 1IVYA 2V6GA 4AN4A 5FX2A 3LPAA 1AK1A 2OYSA 5BSXA 1BXKA 5GZ1A 1QQAA 4OP1A 3QNMA 1TTTA 4HPJB 2AN4A 5TS3A 3WSVA 3RG2A 4GKBA 2JH8A 4I5EA 4M37A 4JL6A 2A0KA 2DE0X 3PPVA 1O0BA 3QOFA 1A9RA 1CJMA 2DOGA 3B7WA 3L92A 3O4VA 1QHHA 1V8DA 1DQYA 2C58A 3HR8A 4V0RA 2FETA 4TM8A 1Y5LA 4F91B 2FPOA 1XJCA 4WA7A 1W2BB 3NHJA 4N3BA 4RVNA 4QU8A 5EZYA 4B73A 2HF7A 4DCPA 5K6RA 3CE6A 3FOWA 1KRHA 1ZZEA 4QELA 4Z0TA 3NATA 4NVRA 2XWJI 2JEOA 3ICQB 1U5BB 1ZUWA 1O94C 3DULA 3HV2A 3TKLA 1QTRA 4J8PA 1I32A 1KO4A 1OASA 3SSOA 4MPRA 5BQPA 4O8CA 1XTKA 3NC4A 4OB6A 1FDWA 3NHZA 3QNUA 4ML3A 1L5FA 1TT5B 2H00A 4DMFA 3NETA 3NEAA 5KC8A 1CS0A 3RTCA 3NG1A 3RHTA 1JLSA 2X8KA 4G09A 2CBGA 1T3ZA 3RK4A 1IVNA 4EY5A 4JQCA 4M7WA 1Q0TA 1QH8A 4PR3A 1S2DA 4PVCA 4X41A 4F04A 1QYCA 2P2SA 1V37A 1WD5A 1GCGA 1GKKA 1NU8A 1RXEA 2H3EA 4B84A 1RXUA 1T9GR 2NP6A 1ZS9A 1UZNA 8ADHA 4B43A 3HU2A 5KYKA 4JLDA 4CLDA 3E8XA 2Q4DA 2IS4A 3KEMA 3QPDA 4OSEA 5A4MS 4D96A 1NXXA 3EF3A 1C80A 1IOZA 3VNRA 1QVGB 4GPD1 1TK9A 1FNCA 2JFUA 5A6VA 2IYQA 1UXKA 5B55A 2QMUA 1K89A 3HCWA 1CZHA 5KDLA 1AS2A 1NBHA 1U7OA 3ZBUA 4EG8A 4ZIRB 4BO3A 3ZXYA 3PLAE 3E7DA 4AUKA 5EL0A 1CR6A 1QGYA 4HUJA 2ZI6A 3SHTA 4IJQA 5ARBA 2REBA 4GKKB 3OF5A 1RJWA 2XNHA 3OIYA 3WDLA 5L7YA 4A91A 5DYYA 3L6BA 4P6VF 4URUR 4W9MC 1DCTA 4WLEA 4UARA 4YAFA 1XKLA 3TE6A 2V03A 4ITRC 3T5GA 3H1AA 4RSHA 4Q7QA 1Z6TA 2EKZA 4B4OA 3DQQA 5MN4A 3U4MA 4HH4A 1V4NA 2WFLA 1ZCBA 4DDKA 2ZJOA 4E3WA 1L4MA 2XT9A 5C5CA 3E48A 1IOLA 3HXLA 2RONA 5KSYA 1XNQB 2RFLA 4E7PA 2C92A 1E77A 2ZIFA 4MQLA 2OD9A 4P93A 3DWEX 4GC5A 5IYZF 5KNCH 3DXYA 3WHPA 1Y4ZA 3BCHA 1JJAA 1WB4A 4MUMA 2HJVA 1DBWA 4CF7A 4JU8A 3QX3A 2QAGA 1NUTA 2EQBA 5JLAA 1EPUA 3RTDA 3ROTA 4MH0R 3GGDA 3B52X 4IQGA 1TCAA 1C3VA 1SEPA 1CUGA 4TTSA 5BYBA 1TM3E 1UBKS 5A4JA 4ZVNA 3S5UA 1M8JA 4UHBA 2I7DA 4OLJA 2W6IA 3ECCA 1S8NA 1JPVA 3WLAA 3VMMA 1BD4A 1DCKA 2CC2A 1NE7A 3AG6A 3CEMA 2PR7A 2BP7A 2RHOA 3M6WA 3OO0A 4Q12A 1JKJA 5BWBA 5T7BA 2PMEA 1RM3A 1YTUA 1QBGA 3MJVA 4MW9A 3AKDA 5KVVA 1V7QA 1A8SA 4GXQA 2RB4A 2IYPA 1P91A 1Z7GA 2GREA 1NSTA 3AB3A 4P82A 1QS0A 3HKBB 4LHVA 1XEAA 2QRUA 2XMPA 3JASB 1WP4A 1NP7A 1NJ6A 2JBWA 2XBUA 1P73A 5CVVA 4I1SA 2OCAA 4DDTA 5AR1A 3HN2A 4C4RA 4I7EA 5EXDA 3TKAA 1GZ6A 2WUDA 5DGXA 1Z5UA 3OLXA 1XQVA 4C7VA 2L69A 5IYRA 4FE4A 2A84A 3OTWA 5TF0A 1O5IA 4EL0A 3K0CC 3WK4A 2Z2IA 1Z8FA 4FOPA 4KE9A 4JUDX 2B5VA 3B85A 4D3SA 4XKJA 3ZJUA 2OUIA 3HBJA 3R1IA 1Y81A 4Z2AA 1B6RA 1DAKA 1OU4A 2ZJZA 4DC1A 1QTQA 3CMMA 2YWJA 1W4LA 2W90A 2R1TB 3CS3A 3I2FA 1P60A 3KM0A 3MWDA 4QHYA 1E3WA 2FSFA 3CNNA 4EHBA 3BFJA 3IAM1 2QA4B 4B47A 2WHPA 3C3PA 5A3VA 1B23P 1T2UA 2CNBA 4ZTZB 5CB8A 4KAAA 3H9EO 3LMKA 3EMBA 3DHWC 1T2DA 3QU4A 1GU0A 1K3TA 3K94A 4OF4A 1O03A 5KOIA 1E6WA 1KYWA 1Y3AA 4TUYF 4NMXB 5IC5A 1VGQA 2B4RO 2RI1A 2RGWA 2V9PA 4QC2A 3P0IA 4QL3A 3K2QA 1L1EA 3ZTTA 3S2EA 1LLQA 1XNJA 4E7OA 5JZMA 1S9DA 1YGYA 5DRYA 4HDSA 3I5YA 1CVIA 4RDXA 3UK2A 2AMLA 3C7AA 4MUBA 1UQUA 3AV0B 4KDFA 2INGX 4QJIA 4PYMA 5A0FA 1YQDA 1EFCA 7YASA 5DTRA 3EUEA 3A2LA 1E9RA 2BTQB 1X1EA 3OPVA 1UBJS 3JQ7A 3ZV3A 4EM6A 2FUG1 2HRRA 3BREA 3CX3A 3DJFA 3NRCA 3ZHYA 1BJKA 1A50B 1ZOLA 3OMXA 2M6LA 5AVRA 1A96A 5BXQC 4E5SA 4TRJA 5LYJA 3EAFA 2QRHA 4W1QA 1EMDA 4G26A 1UXHA 3ORSA 1B6GA 1BX0A 3PK0A 5FOQA 1T36B 3VPXA 3P0JA 3IPYA 3P45A 2X0NA 3DV2A 1V71A 5FOWA 1ISJA 4HDAA 4V3BA 4BV9A 3EIUA 4MO9A 3LOUA 3DWGA 3D0KA 3IEVA 2CUTA 5GGYA 2ZKIA 2QG9A 2DUWA 2LZJA 1LXCA 2FWPA 3IHTA 1CSEE 4MV5A 1KKLA 5ERYA 1U8YA 1XRLA 4FOLA 4Q19A 1B7GO 3KT6A 3M1AA 1WB9A 4DEYA 1P2VA 1P45A 1OXVA 1VTKA 1NNUA 3DLCA 3N8DA 3ZYCA 3CURA 3PHBE 4BFLA 3EEOA 2BPOA 1WEHA 3PGJA 4QODA 4YRIA 2J0EA 3TX2A 4KITB 2EZ9A 4LXTA 3EGCA 1EX6A 2IFTA 1BGWA 4XMYA 2ZQYA 3K0AA 1YGPA 4D9NA 2HW8A 4BVBA 1MX3A 1GPKA 2PT9A 2MYNA 1G8GA 1KNXA 1IUNA 1VKJA 3OX2A 3VTFA 2F55A 2WE7A 5CD9A 3CW2A 3HXPA 3OM0A 2PVSA 5KJEA 1W1UA 4RANA 2XDQA 3LL4A 3O83A 1VXOA 2ZWAA 3AVPA 5LDDC 5BXYA 2QAGB 4O59O 2YQ4A 4UNQA 1ARZA 1JA0A 2X0KA 2HDHA 3BWVA 4BNGA 4BQOA 5CIQA 2XUGA 4UZFA 3TLCA 3AQ4A 2VYFA 4KXQA 2EIXA 1JMVA 2JCBA 3HCEA 1ETUA 5DLQC 4DCOA 2QJRA 4ZOLA 1JV2B 4CLRB 2HA5A 4Z4VA 3RO7A 4MUHA 3EW9A 5AI9A 2H4JA 1KFKB 4RPLA 1HDEA 3HEMA 4WZAA 1YDGA 4HLQB 4RD3A 4MNTA 3Q3GE 1ZK2A 4DA9A 3KJQA 1PQWA 3NHFA 1H1LA 1HFJA 2QVGA 1QIHA 2ZDGA 1DG9A 1GNTA 3FFAA 5B3AA 1R0RE 4RYLA 2WZCA 4J90A 2OBTA 4K6OA 2I1VB 2IZ1A 4MVJG 4DMLA 3U5TA 5AXCA 3C8UA 3NVMB 4DJTA 1XA3A 4WZLA 4R68A 4IH4A 5E9WA 4RS4A 1VQLB 1ICEA 2C2MA 4WSOA 2CKMA 4CKZA 5KTKA 4ZAVA 2GHQA 3BTVA 3P9YA 4OXYA 2VBFA 4C0SA 1U3WA 3EBOA 4B32A 4B9EA 4A23A 2GN6A 2QEXB 1N6RA 3KLMX 2P9CA 3N8GA 2HCTA 5KWIA 4LQLA 5JJKA 1GCIA 3LC0A 1UUFA 2J4CA 2MR5A 2BFAA 2IHKA 1NI5A 2RH9B 5C18A 1J2RA 3K3PA 4GLJA 4D6XA 2PA0A 2A33A 3PGA1 3Q3HA 4LJ8A 1YI1A 1YULA 2H1HA 6YASA 2IZZA 4PZ0A 1WCV1 2P8JA 4A2CA 5A62A 5H4GA 1X2BA 5H80A 2BEUA 1NASA 3LHFA 3D3WB 4PX9A 3U40A 2RD2A 4EYQA 2NIPA 2Z57A 4MLCA 1FFSA 2Y1DA 3LBAA 1B76A 5ALYA 4HEA1 3HDTA 4KE7A 1RHKA 5BPFA 1K5DA 3DR3A 4H7KA 1CLEA 1PSDA 3TFQA 1MU0A 5F2EA 4CXMA 4Z4EA 2WUGA 3AHEA 4C6TA 2YUTA 1UF9A 1NW5A 3OQIA 1MC4A 1QRRA 3RUEA 2I6XA 5B7GA 3ASSA 1FYFA 4EFLA 1SBQA 1VLMA 1XD9A 2HSWA 3A0RB 3F97A 1CETA 1Z4OA 3O7MA 5DCYA 5LQCA 2ODBA 4CTNA 1F9EA 1G3QA 2V0CA 2XXAB 3LKVA 4KZKA 1EM8B 4UTXA 5ALUA 4BRWA 3R3JA 3VDRA 2XTZA 1SU8A 3DUFB 4NCKA 3B70A 2DWUA 3H5LA 3AEQA 1CY7A 4ZRNA 5EWLA 1JSLA 1ZRMA 1ABFA 3IMEA 3P52A 4RHTA 4XM2A 2A9PA 5K5EA 1ZD2P 3HKCB 2PS1A 3K96A 3I53A 2E6UX 4K2HA 4EY7A 1AV6A 1CB7A 2FWJA 3VV3A 4Y98A 4AMZA 3T1TA 2VHEA 2HO5A 3DTTA 4RDLA 1MB2A 4MQMA 4PYOA 2J3HA 3H5AA 3H1FA 2WPNA 3DEAA 2RC5A 5BNFA 4A8JB 2FPIA 5G1NA 5GP1A 4G1VA 2Z8XA 4F9EA 2GAAA 4ASUA 3TQTA 5B58C 4JQOA 1PTJA 3Q3EA 1BWPA 1DKUA 5F7JA 5EA2A 1FP4B 5C31A 3V8MA 1IFXA 3ZJYA 2OYRA 3RVLA 3V8VA 4H7IA 1E7MA 3WXMA 4UUOA 5F35A 1TYCA 2Q8QA 3D31A 3JWEA 2LBPA 1DAFA 3U62A 1E2IA 2R751 1NC1A 4M3NA 4QDXA 2ZBFA 3JZIA 1LCIA 3ZY3A 1IHXA 1JA1A 2BKLA 2ODQA 3E9QA 2Z3ZA 1IMOA 1DUSA 5JS6A 2W58A 4FFBA 1IQ0A 1UJBA 4KLCA 1KZ1A 1WLSA 1SUFA 1TF7A 1XZEA 3KU1A 1GUYA 3MUEA 2XCLA 4UTOA 4HV4A 3E3NA 1AZWA 1ID8A 4FDAA 3LFTA 2X4LA 3T06B 4AZ3B 2V7VA 1XZGA 4LY0A 3PHCA 1QTNA 2VJQA 4RZIA 4NL4H 4M4SA 3O8LA 4KOEC 5KWSA 5IRCD 3SSNA 5EJ2A 3DD1A 3MOGA 1DBSA 1RC0A 1NB0A 3KTDA 3TOXA 1I4LD 1XXHE 3HCNA 3KQHA 1QIJA 3QOYA 1XTBA 2WJGA 4QE3A 4KAFA 4NEHB 4FYXA 4E46A 1MG0A 4PQEA 1JFRA 1JG2A 2C9BA 3QOXA 1Y9AA 3U3XA 3HGQA 1I7QB 4QJ5A 2FVGA 4LTNA 1QP4A 3Q6IA 5A4IS 5DASA 5DEIA 4BMSA 1G8FA 1XXHA 2PKYX 2YH2A 4M86A 5CMLA 3F0TA 3UHOA 3IMCA 1CHNA 1NVAA 1U7TA 3F8WA 5IFLA 4MWZA 4W6QA 1ZOOA 1N6NA 4Q4DA 2WT8A 1J25A 4Q7MB 1W52X 3HBMA 4R83A 4P7GA 1N92A 1QOQB 3AEXA 3R5FA 4XDGA 2P0EA 3BD6A 4KPFC 1FDTA 3TE7A 4KPUB 5M04A 4YMGA 1R8JA 2CVHA 4DK1A 3ZI0A 5B58T 1YFJA 1GQYA 2CMGA 3GFSA 3MBKA 3NVDA 4RD6A 3UK6A 4Z7NB 2XD4A 3EHEA 4E6EA 1C3OA 4ARZB 1C3LA 2A59A 3BCRA 2A86A 5MN5A 2HNBA 3A1NA 1Y8RB 3AT1A 3SC2A 4LJYA 4B7UA 2OLEA 4AD8A 2I3AA 1Q77A 2CLDX 3C3KA 3GZJA 4GL2A 1RRVA 4P5PA 3QI7A 2WJIA 5A2GA 3OCXA 3P2MA 4WXPA 2Z56A 3WL6A 4BB0A 5F1PA 1JYFA 2C2XA 3ASQA 2GRAA 2W83A 3H2YA 3ISTA 4QUDA