1MRZA

Crystal structure of a flavin binding protein from thermotoga maritima, tm379
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
287
structure length
266
Chain Sequence
VVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFPGLLMTVESRVEMLSRYARTVVLDFFRIKDLTPEGFVERYLSGVSAVVVGRDFRFGKNASGNASFLRKKGVEVYEIEDVVVQGKRVSSSLIRNLVQEGRVEEIPAYLGRYFEIEGIVFPTANIDRGNEKLVDLKRGVYLVRVHLPDGKKKFGVMNVGFRRNVKYEVYILDFEGDLYGQRLKLEVLKFMRDEKKEELKAAIDQDVKSARNMIDDIINSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a flavin-binding protein from Thermotoga Maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Riboflavin kinase/FMN adenylyltransferase
total genus 76
structure length 266
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1mrzA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1mrzA01
1FYDA 1QNFA 1N08A 2IJGX 3INNA 5DB4A 4J76A 1WQ4A 1NUPA 3K9WA 5J59A 4UZEA 4DDHA 2I1LA 1YIDA 1O94C 2J5BA 1KR2A 4BWVA 3P0HA 1YIAA 4F4HA 1MRZA 1WKBA 1EFPB 2E0IA 2VTBB 3TNJA 3KT0A 4OJMX 1O6BA 2V0CA 1N3LA 4ZT5A 4EG8A 1OWLA 4PY2A 2OYNA 2AKEA 2G36A 3ZJVA 4ZCRA 5H16A 4U8HA 1M1ZA 3U1VA 5FO1A 1JHDA 1Q9SA 2J07A 3HGMA 3P0JA 4G5FA 2DETA 1X6VA 4JFAA 4PBSA 1XNGA 2PG3A 1QQTA 3CLRC 1GTRA 1JIKA 1MC1A 3L93A 3CLSC 5A89A 1PG2A 1Y42X 3LCJA 4J75A 4CT0A 1M83A 4NDAA 2CV1A 4EG1A 3CVVA 4AQ7A 1N2IA 4RUKA 3GLVA 4ZT4A 3IH5A 4PBRA 3CA8A 1N1DA 3DO8A 2YWCA 3MLAA 5DK4A 4KR9A 2X3FA 1K97A 4ZCQA 1O95C 1M8GA 4EG3A 2QJTA 2GKSA 1G8GA 1GZUA 4YBRA 1ZJWA 1G59A 1HYBA 5K0SA 4F3RA 3LOQA 1Q11A 4KR7A 3FG9A 3UK2A 2A1TS 2CV0A 1EUQA 1EFVB 1LW7A 4MW7A 3MXTA 1J09A 2QUKA 4CDNA 1WY5A 1B6TA 2WQ7A 3KFLA 3LE8A 4OUDB 5FO0A 3A2KA 1T9GS 4RPIA 4MUKA 1F7VA 2A1UA 2HZ7A 1MB9A 2QUJA 1U3DA 1PFVA 5A8AA 1M8JA 3FOCA 2A1TR 3IUBA 4Q93A 3UOWA 5KWVA 1KAQA 1DNPA 4YMIA 1I6LA 2BYTA 3L92A 4EG5A 2WSIA 4FZJA 1I6MA 1KQPA 3P0IA 3ZJTA 3M5WA 1TYCA 1O94D 2GM3A 3IVXA 1H3EA 1O95D 2JA2A 2A7XA 4R2LA 3IMGA 4K0RA 4L2IA 3CLUC 1YULA 1QTQA 4EG7A 1OWMA 1EJ2A 3MUEA 3VGJA 2VXOA 3HZRA 3OTWA 3NV7A 1GAXA 4HK4A 1QRSA 1ILEA 5IHXA 3COZA 1Q19A 4R0NA 2DLCX 4MW5A 2DEUA 1M8PA 1QRTA 3N8HA 3D6UA 4S1OA 1V8FA 4XSVA 4NX2A 1XJQA 1NB9A 4EF6A 3UMVA 2J4DA 4MUFA 1M8FA 4XFJA 2VTBA 4U7JA 5KCMA 3FETA 2IP1A 3HMQA 4MW2A 3S3TA 1ZH0A 3I05A 1TYBE 1NP7A 2TS1A 3CLRD 1WXIA 3GUZA 4ZT3A 3A4IA 4ZT7A 1PFYA 4KPUA 1P7PA 4PBTA 3COYA 4NATA 4A91A 2P3MA 3QE4A 1FFYA 1A8HA 3AFHA 1H1TA 2QTNA 5LM3A 1I6KA 2V0GA 5LFAA 3H99A 1EE1A 1NB0A 1GN8A 1N2BA 1Q77A 2XRYA 3SP1A 1GPMA 1VLHA 2C5SA 4I6EA 1SURA 1K4MA 3VU8A 4HPWA 3CVWA 1G8FA 3Q10A 2PIDA 2QJFA 4MLPA 3SDBA 1G8HA 3ZXIA 4EFKA 1V47A 2B7LA 4MUHA 2DXIA 1KH1A 2D13A 1PFUA 1N2JA 3DPIA 5TEWA 1IQRA 1IQUA 3QTTA 3RK0A 4DNXA 3IOCA 4MQ6A 1OWNA 1QJCA 2EJCA 1PG0A 4MUEA 1J21A 3CTAA 1JIJA 3JXEA 3K32A 4GRIA 4HJXA 1O97C 2VBTA 1WQ3A 3UY4A 3ELBA 4MWBA 3RBAA 3CVXA 1MOPA 3A05A 1CT9A 2X1MA 3COVA 1KAMA 3FWKA 2A84A 2QUIA 1J20A 2PFSA 1MBZA 1TQ8A 3N2YA 3HL4A 1O0CA 3ZGZA 2VBSA 1YUNA 1OD6A 2WB2A 2E18A 2CFOA 5J5AA 4UZFA 4JXZA 3UC5A 4KPUB 5EKDA 1JILA 2OV4A 3SEZA 1O0BA 1MJHA 4WNYA 1O96B 2A88A 4K03A 4QBTA 3RFFA 2R5WA 1O5TA 2PZ8A 3C8ZA 4L2IB 4MWCA 4G5YA 1BS2A 3ZIUA 1J1ZA 3H05A 4P2BA 4ZT2A 3TS1A 2BTEA 3PNVA 1KP2A 1RQGA 4G6ZA 4H3SA 3DLAA 1JECA 1NUTA 4YP5A 4MVYA 3MLBA 1KH3A 1N2HA 1NZJA 1H3FA 2E21A 1M8KA 3A04A 5TS2A 3TZEA 5DASA 3AKZA 3AL0C 2YY5A 5IJXA 4OUDA 1MAUA 5TGTA 1NYLA 3CLSD 1WOYA 4TS1A 1WXGA 1WXEA 1XNHA 3BNWA 3H97A 1NSYA 2QTRA 1NURA 3F3MA 2QJOA 3DV2A 4CDMA 3NBAA 3KT6A 2IELA 3GMIA 4EGAA 5LLTA 4DE5A 2CV2A 1QRUA 1IFXA 5KHAA 4NAHA 3TZLA 3IUEA 1NUUA 2D54A 4MW0A 5BNZA 3IOEA 1N05A 1IRXA 4NZPA 3VRHA 2O8VA 1D2RA 4I6JA 1ZH6A 2AZXA 1ZUNA 3SZ3A 2CUZA 2HGZA 1IHOA 2H29A 3X1KA 3SEQA 4KR6A 1LI7A 4MVCA 3ZXSA 1YUMA 5DEOA 1TFUA 4XFDA 4Q16A 2A1UB 2Z3VA 4MW4A 5A88A 2YXNA 1VBKA 2EL7A 3CLUD 3G59A 3ND7A 1NUQA 2E89A 4ARIA 1H3NA 3COWA 1N2EA 2JAXA 4HJRA 1WXFA 1KQOA 2CYCA 3SYTA 1PFWA 1F9AA 1OWPA 2CSXA 1Q15A 4GU5A 3IOBA 4QREA 1MB2A 3P52A 3G6KA 1JMVA 4EG4A 3CR8A 5TEVA 1GTSA 2NSYA 2PXHA 2X1LA 3AG6A 1U3CA 1NUSA 3X1JA 2CYAA 3FI0A 1JEEA 1EXDA 1KKUA 1OBHA 1OWOA 2PZBA 2PZAA 3ND5A 1EFVA 1IVSA 1T6YA 4MUJA 3X1MA 2A4MA 3KT3A 5K0TA 3TQOA 4ND7A 1KH2A 1J70A 1COZA 4ZCSA 1XNJA 5HUHA 3CVYA 4E1AA 4ND6A 1F7UA 1TEZA 2VBVA 1JZQA 4MW1A 1JGTA 3N9IA 4MWDA 5F23A 3IVCA 2JANA 4ZCTA 3ILVA 4MWEA 3CVUA 3AIIA 3RK1A 1U7DA 3Q4GA 4MUGA 2NZ2A 1N06A 1UFVA 1WJGA 3HFJA 4QRDA 4CQNA 4EG6A 4NAUA 1EFPA 2ZUFA 3IODA 3IVGA 4MUIA 1GLNA 4DDKA 1VBNA 2VBUA 5H7XA 2ZUEA 3OP1A 1TYAE 3HV0A 3TQIA 1N78A 4DJAA 2CYBA 3PNBA 5HG0A 3N05A 4DLPA 2ZP1A 1F4LA 3ISJA 1R6UA 1U0BB 4MW6A 1K92A 2OQ2A 5HUJA 1U7XA 3KT8A 1JIIA 3FY4A 3D6VA 5JBNA 4MUNA 1T9GR 4R2MA 3SZGA 1JEDA 3FIUA 3PXUA 2RD2A 1T6ZA 3CLTC 3FHJA 4ZCPA 1R6XA 2A86A 1NI5A 1O97D 2O5RA 4YP6A 2GOYA 2WQ6A 1N77A 3ZUGA 1N2OA 3E27A 2QTMA 1K4KA 2J09A 1OBCA 3G5AA 1EUYA 2CT8A 1P4MA 3PRHA 4MAFA 2X0KA 1VL2A 3IDFA 2RE8A 4AS1A 1S4MA 3MMXA 4WSOA 3NBKA 1QU2A 4ZT6A 2DERA 2AG6A 1JZSA 4X0EA 2XRZA 2J08A 3QTBA 2HMAA 2DR2A 4YP7A 4DDMA 1IH8A 2Z08A 1MAWA 4MULA 3H9CA 2YWBA 1VBMA 1T6XA 5AHWA 5J58A 3BL5A 2H2AA 1IQ0A 4MW9A 1WXHA 3PNYA 3IMCA 1KQNA 1QU3A 1N2GA 3ZJUA 2D5BA 4JXXA 3FNRA 1R6TA 3IMEA 2DPLA 2Z09A 4KKVA 1N75A 2QUHA 1J1UA 3CLTD 1O96A 3FH0A 1KP3A 1WZ2A 1X8XA 5TRDA 1TYDE 4MVWA 1KORA 3H9BA 2DUMA 3Q12A 4JZYA 4MVXA 3FDXA 3RHSA 3ND6A 4ARCA 1N07A 3AG5A 3RJZA 4I6GA 5FNZA 1LI5A 1ULHA 4JYZA 1YI8A 1I2DA 4U63A
chains in the Genus database with same CATH superfamily
1VLOA 3ZWDA 1C2TA 3GFVA 1GGJA 4JY7A 1N08A 3SMVA 4CLRA 3TG2A 4BTVA 2IVFA 4OBEA 3VBEA 3F9RA 2GBIA 4G8CA 2OCGA 1DX4A 4J76A 1Z5NA 1H0HA 2G8LA 3AUKA 1VKHA 3PDHA 3SQDA 2BW0A 1UOPA 3ZNOA 3V7UA 5CLFA 5ILOA 3CGWA 1MMFB 1D2GA 1O8CA 1OLSB 1OPRA 1DJQA 3AJDA 3C39A 4NAVA 5FUWA 4BUCA 4G5SA 4IQ4A 3H19A 4NXNB 5E3JA 4I08A 1WA5A 1XTQA 5GPBA 2A0WA 2YUTA 2QZZA 4FC6A 4IKOA 1WKBA 2Q9AA 1R8QA 3DTVD 5IYZF 2VKQA 4H1UA 1BXGA 1H22A 1B0UA 1TXGA 2VTBB 1M5RA 2ZSJA 2Y2UA 4G4JA 3PJEA 4A5OA 1WV0A 4M8NE 5C5DA 1PR0A 4REQB 4ZVLA 1Q0LA 1ZHHA 5JZVA 3JWPA 4AG6A 3DMPA 2YBEA 2NO1A 3ZIAD 3QPCA 4FGZA 4PVCA 5JHGB 4J43A 1QHHB 1QIJA 3G05A 1TD9A 4IDBA 2QUZA 4RFSA 2OBRA 3RSZA 3T15A 4B71A 4O2AB 2GK4A 4U1RA 5FO1A 3SYRA 3UQYS 4QA9A 4G63A 5DXJA 1RM4A 1IHMA 2DETA 1Z82A 1H4TA 3V32A 5ADWA 1HR0B 1KDYA 3P5SA 3HR7A 4KAXA 1LBSA 2HQBA 2V98A 1OI3A 2HJGA 2MT9A 5BOVA 4ZI7B 2J3MA 3HRKA 4LTMA 3CLRC 3OLQA 4O2BB 3IVMA 1MH9A 3RD5A 2G9NA 1E92A 4NJOA 4V0QA 1KDPA 1I2BA 4XH9B 3GWZA 4C4XA 5AVVA 4TVBA 3HSYA 3KU1A 1QONA 1R37A 1UJBA 1SK8A 1TK9A 2QTFA 2VDOB 1I10A 2ZIAA 1XJWA 4MHTA 1Y4AE 3L7OA 1IN8A 2I3BA 1E2JA 1KA9H 221PA 3AI3A 2I0FA 2L42A 2Q41A 4U2BA 4YRPA 4AZ3B 4XM1A 2X0EA 4BP8A 2QPLA 3H6HA 3KQWA 3MLAA 3NUQA 4AP5A 3WNCA 4P2GA 3R74A 3S8EA 1BNCA 4KR9A 3WAKA 5G0WA 4DPMA 1M8GA 3ETHA 2HX1A 3UK6A 2C2GA 4I8DA 4DLYA 4PAMA 2ZU0C 2YKGA 5IS2A 3WNQA 3PQ8A 4EABA 5C7YA 1Q11A 1RTTA 2X9LA 1PX2A 5AW6A 2BGUA 2H5JA 2PN1A 3MMNA 5C53B 2Q4RA 1SA0B 7YASA 1SOVA 3SYNA 1PSZA 3K2EA 2FP3A 2RK3A 3GZNB 1ZK1A 4OOVA 3K35A 4FKMA 4HAZA 1TJ5A 2PKQP 4HH1A 5CUQA 2Z3WA 2XMDA 3U7HB 3A3NA 3SZUA 4ZAGA 3UT0A 5LUAA 2HJHA 3FHCB 3RS0A 3RHZA 1E1LA 1KRHA 1JLHA 3BG5A 4Q47A 4HWOA 3A2KA 1IIRA 4JOQA 2KVOA 1IOZA 2PR2A 3U6KA 3K1AA 3DHWC 5LB2A 5BSRA 5GV7A 4FYYA 1UXHA 3ESBA 4OH7A 3UOWA 2OCPA 1QGOA 4TV9A 1YDFA 1Q5PA 1H2YA 1LPSA 1EH5A 1ZW6A 3KXKA 1H0SA 4FE7A 2GN4A 3WGVA 3RVNA 4GR9A 4M89A 5TDHA 1PZMA 2EBFX 3SQOA 3DQPA 2VUIB 5SZHB 1KY2A 2P2CA 1E3XA 1QLWA 2F9FA 3ZZTA 4FZRA 4UCWA 1ODIA 2P91A 3FYTA 1IM2A 3GT4A 4L0QA 4Y7DA 3P2MA 5ETJA 3INRA 1X2BA 4MZDA 1Y8RA 3MUEA 4K88A 4BJ3A 2ZRQA 5KHOC 3M1AA 2CEKA 4C88A 3TRIA 4TM8A 3AERA 1N6PA 4FFBB 3CTPA 3KZ1E 1K89A 1QKIA 1GAEO 4NECA 5FIUA 5AHXA 1F6BA 3IBFA 1DAEA 2XZPA 1FU8A 2BBSA 2ZJ3A 3ACBA 2Q6OA 3CRNA 2UUCB 1F5NA 1Z2OX 2VPQA 1ODTC 4Q05A 1XK7A 1OTXA 4DCMA 1EQ2A 3WGNA 4IMRA 2OSBA 4LV6A 4XFJA 5DT2A 3AOGA 3GEGA 5IYZA 2O1XA 4PXSA 4CM5A 3HPQA 4N7MA 3UK0A 1RADA 3LK7A 4UDXX 1SBYA 3GD7A 3I4FA 3L6OO 1E9CA 1GTVA 2Z1DA 4FEGA 5E4YA 1XZJA 4BEBA 6Q21A 1XXHE 4JVNA 1WOSA 1ZCJA 1A5TA 3LY8A 4IIGA 4R1MA 4H2DA 4R3NA 3KDSE 1HXHA 1VG9B 3A2LA 2VAMA 2VUHB 4J8PA 3BE6A 1O6ZA 4NNOA 5EZQA 1YE8A 3N0XA 5AVUA 4F9FA 1Q81D 4IL5A 1NP3A 1SXJB 4FI3C 4AECA 3REQA 2G40A 3L07A 4G8BA 3ILYA 3KJZA 2OK7A 4WXPA 3V3KA 1FVXA 1G4UR 2NO9A 4DCSA 5LNK6 4U7GA 4PHFA 4P36A 1R64A 1EDEA 2X40A 2WKRA 4HDMB 2JFFA 3T7DA 1CLEA 3E4DA 3FRJA 3KSDO 2WF5A 2OG1A 5MN6A 2HI0A 2PSSA 3SQNA 2XUAA 1U9ZA 3CN7A 3ICCA 4CM8A 1RBZA 3SR0A 1J9EA 3KL9A 1WVGA 3Q9LA 3AF6A 1Y9DA 3MGKA 4MJ7A 4BKQA 2EEPA 2YN4A 3UJAA 4LECA 1N6LA 2XNCA 2FW8A 2I2XB 2YCBA 3QLVC 3ST7A 3Q5DA 1I3NA 5LJIA 1XEWX 3L43A 3P1JA 4AJPA 2AG5A 4ZDJA 4YAUA 2X6YA 4PLCA 3JQPA 1Y8QB 5DGIA 1XD2A 2WIJA 4D42A 3KFVA 4KDRA 2M5SA 3QKRA 2G4CA 4HYYA 4RLFA 2A3NA 1KWGA 4M9RA 3A1WA 3HJCA 2HU5A 4RM3A 2AJBA 1D1TA 1A8UA 1UDBA 2IF2A 2ZJAA 4DA7A 5HILA 1R0XA 2EJCA 4INPA 3OW7A 4C5CA 2Z1MA 1DELA 4JQOA 3GLGE 1N9GB 1U7HA 1NUHA 4P8RA 1IUKA 2C9ZA 5FTWA 2X8JB 1XRMA 3DUFB 1JHQA 4ZAXA 3EYAA 2P8JA 4E08A 3EH2A 4FYWA 4QOEA 2P79A 2XKJE 3QNWA 5K99A 1C3OA 5CDFE 1XK6A 2NUTA 3E9ZA 2D59A 4BMDA 4LMRA 1PJ4A 1JYEA 3ESQA 1CT9A 3COVA 4PEVA 1U7UA 2F67A 2Y6VA 3OQPA 4DWOA 2N1MA 5T4BA 2EBHX 4GKVA 2HLPA 4GMGA 1YOVA 1I3LA 4M1TA 3PIRA 3OUUA 4QPJC 4ENQA 1YUNA 2BMDA 2XGGA 4MCHA 5LP6B 1TJYA 2ZE8A 3OA0A 4WACA 1XYGA 2ODPA 3IAAA 1R3UA 1OBOA 2YJNA 4MMXB 4TZ6A 4UZUA 1C3XA 4OBBA 5TQJA 3WMRA 3I73A 4WW0A 3TJMA 4FSXA 4HL6A 1YXMA 4FIZA 1R8SA 3J81k 1I2MA 2C2MA 3PWZA 1RPAA 1S0UA 3H8VA 1EHCA 2XE8A 1MO6A 1PWYE 2VYND 2HA5A 2VA8A 4JP3A 4EUEA 2ZJ2A 1QYVA 3DOEA 5K0ZA 1WSVA 4PE5B 2OBNA 4ZHSA 5CIWA 3K70B 4X7BA 5AXBA 1E9DA 3PG5A 4B3HA 3SK0A 4ZCIA 2H5EA 3PNVA 2X86A 1Q0SA 1O08A 5KDDA 1JB9A 4TQ9A 5FF9A 3Q88A 3L40A 3A04A 2HMYB 4B47A 5TS2A 3AKZA 2AJ8A 1R0BA 2P2ZA 4JLOA 5EMNA 4JKYA 2V58A 2CXTA 2V59A 1Q6YA 3GRRA 3QUAA 5G0TA 4D3DA 4G1FA 1PGQA 3O1LA 2DSNA 3H97A 3PUIA 3PVZA 2D7CA 4B8YA 3CZ5A 3WIBA 4WY5A 5JNUA 3AR7A 3KT6A 3G3EA 2D2VA 1YS1X 5DRTA 3FAZA 4D56A 3BKXA 3BWBA 2F9MA 1JHYA 1XTTA 3KTOA 2IXBA 4FYJA 5KNDA 3EGIA 4L02A 4MHSA 1A2OA 1B6RA 1M2VA 3HO1A 3DFFA 5COAA 2GASA 5DYGA 1T1IA 3EGXB 4ZJUA 1JTVA 1KJ8A 3O7MA 4F4JA 2AZTA 1J99A 2F43B 4TWIA 4C0HA 4CN8A 3LNCA 1K73D 4GLJA 4E2WA 1FA9A 1NNSA 3KQKA 1KO8A 4G0ZA 4URWR 3SY8A 4C4PA 3SZLA 3KJGA 3VRHA 4CM9D 1WF3A 2A14A 1CUUA 3C14C 1RJFA 2HK6A 3MFYA 3OPVA 4KV7A 4MTLA 1H1DA 1YBVA 4FYKA 4C2TA 3L0DA 3DZIA 2B2NA 2WJYA 1SIWA 4W9RA 2H29A 2Q4DA 2FK8A 1DFIA 1TKCA 3BF7A 4RC9A 2X41A 3WVNA 3H6GA 2YTZA 1ML4A 3FNFA 3ETEA 4O4IA 2GUWA 4BBZA 1V3QE 2Q49A 1I01A 2OXIA 2P75A 5CB0A 3AL2A 1UZUA 3U9LA 1W35A 2Y8EA 3KWJA 4QU9A 1SHKA 5EJEA 4OHYA 3GJ8A 4IX1A 3F5DA 1VBKA 1V11A 2EL7A 4TS9A 3WR5A 1P77A 4X95A 4LYJA 5DHRA 1H3NA 1YV9A 4TV8F 5ALIA 4X1YB 5KI6A 1Q0HA 3HB4X 5DM60 2JGJA 2GJKA 2R7KA 4TSFA 1M9NA 2PSHA 2E5LB 1U3UA 1U8AA 1MF7A 3ZCVA 4D0SA 4A2PA 4RK4A 2ZWIA 4A8TA 1ELOA 2GXUA 4BFZA 4CKEB 3GFFA 4WV3A 3WWDA 1ZG3A 4OQQA 4OIFA 4RHTA 5B3JC 4B3FX 4XCXA 1RXYA 1UC8A 3AG6A 3MW8A 1QPBA 3D0KA 2W2NA 4L07A 2PUJA 1JHAA 4H1HA 4PR3A 5GVRA 1E99A 4Q1FA 1OF1A 3OD1A 4MKIA 3U4CA 2EJBA 1E94E 3P4XA 2EBWA 2BFMA 4B0PA 3RRFA 1D4OA 2IH5A 2PZAA 1VJSA 2V6FA 3AL3A 4H7FA 3O93A 2UZ1A 4NFHA 4RIIA 5BQ3A 2PFKA 3DYIA 1YLOA 1RXIA 3G1UA 4FDMA 4U2EA 5ALUA 2BGKA 2REBA 2WFLB 3T99A 4DGQA 2ZUVA 3KLOA 1KE2A 4BRZA 3IVRA 4RO0A 1Y7PA 2V9PA 4YV0A 1SU8A 4BGIA 2YDXA 4P82A 3F47A 2QA4B 2I66A 2ZTLA 4PSVA 3ONNA 4Y1EA 2G0TA 4RV9A 1IWBB 1RKUA 1PD1A 3ELYA 2RH8A 1PZGA 1PV4A 2IYOA 2DCMA 5DYIA 3A14A 3EWSA 3G0HA 1JDPA 2FPSA 2NUAB 4IIFA 2NZ2A 1PJAA 1GZHB 2FPGA 1G2PA 3PUHA 4YUAA 3HLTA 1M6NA 1WBDA 2R8ZA 1RQPA 2WR8A 3LWZA 5ANRB 1C7ZA 3OZTA 4G0PA 4DLBA 1HE3A 3N7TA 1M54A 3LS2A 4CLXA 3NVDA 3OSZA 4Y2XA 5AI4A 4DJAA 1NYTA 1PU2A 2NSDA 3OQJA 4HGZA 1UFRA 4PO9A 3TQSA 5JASA 1AHPA 2AOUB 1DBIA 1P18A 2HA4A 3ESRA 4LBVA 1R15A 3CMAB 1K92A 1HL7A 3Q7RA 1QVZA 3X44A 4G56A 1YCFA 1DT3A 3KOWA 4NICA 3A8IA 3F7OA 4IPTA 4POOA 2BUAA 3OZAA 4N12A 4BLOA 3PUZA 4RPBA 5DH9A 3V4OA 3LECA 4ARZB 3WQQA 4AF8A 4C20A 4UARA 2VDLB 3FLBA 1UJ2A 2GZ2A 3DR5A 3FROA 3JW8A 3KTFA 2ZIEA 4GYYA 1JEDA 4LNUB 3PXUA 4WWHA 4J6FA 1J00A 4R05A 1ZRSA 1PQYA 3R6GA 2VF8A 2XVZA 1U5BB 1R4MA 3A26A 4LXUA 5AJHA 5DSXA 4YP6A 1T0UA 1VCIA 2VJPA 4ENRA 5EPOA 3ZUGA 4ZMSA 2EZ4A 3E27A 5KNCH 1ZZGA 3C5EA 3OU2A 4LSMA 4B6OA 3F5SA 2J09A 4R1UA 4X24A 1MIHA 3UG6A 5K0JA 4MKXA 5A3VA 3UPUA 1PNQA 2OECA 5HF8A 2ZQZA 4YR7A 3FOEC 4MAFA 1L5MA 3X1WA 3BD9A 2ZZFA 4AXBA 5EJ6A 3I6MA 4BNGA 3EXG1 1W94A 1YI1A 3JWJA 4WOCA 3U81A 4NPHA 2DX7A 1VQ9B 3H5WA 3OOHA 3ZQJA 4AJNA 4YP7A 2YH2A 4P38A 5TMDA 5JLJA 5EPEA 2X13A 1H93A 4H7HA 4PZLA 1K7XB 4MULA 5D5QA 3HJHA 1NI4B 4YT2A 2ZUUA 3ZGNA 1N34B 4NH0A 4XUCA 3R3UA 3I61A 2HCRA 2LW7A 3CF4A 4C87A 3GLFE 2OFXA 1VG8A 4XCQA 1XCJA 5LL6P 4TKOB 1OZHA 4LNHA 3ZCQA 4EECA 2TMGA 5CCXA 3JQ6A 2X19A 1HDCA 3BQNB 3GPCA 1F0PA 3HNOA 1IK4A 3USCS 3O38A 4AS3A 3R5SA 4UULA 1P2FA 3P96A 3IMEA 4CTJA 4PHHA 4MRRA 1Z16A 5E2AA 2AF3C 4ZU1X 4H35A 3E7FA 1UMBB 4CKCB 2WKQA 3ZHYA 2WZBA 2ZBGA 4XTCS 1N0IA 3IQZA 1HFJA 1DRUA 4O4HA 2NQTA 1ICEA 3SSMA 3ZQ6A 5HCIA 1W4AA 4Q18A 2VJAA 4K6MA 5AFSA 3ZE8A 4FBGA 2Z98A 3DOUA 3EAGA 4LJRA 2YHUA 2J8ZA 1CUJA 4LUCA 1Y8ZA 4DOMA 3SJPA 2O50A 3HU1A 3NZEA 3AG5A 3BXEA 4ACBA 4JEHA 1T4CB 3DCNA 3PQ4A 4NBKA 1DV1A 5IYWA 1VPDA 4A3SA 4YS6A 2W2OA 3L8MA 3ICPA 1M6WA 5C8YB 2H7VA 4COKA 1QTRA 5HXAA 1W4LA 1VMAA 5ARBA 3HYNA 3OCWA 1KK0A 2P6PA 2Q8PA 5B1DA 4BFWA 3DGEC 4ZAZA 4QVKA 3OM9A 4JUCA 2NN3C 2YC4C 3N2NA 2I4TA 4ZEWA 2QD5A 2Z6BD 1GUAA 3C3AA 3UUFA 4ZYXA 3UAYA 4CM6A 2ZSHA 2CNLA 3OBIA 1O9HA 3K71B 1VRCA 1DAHA 3I9V1 1S2LA 1QCYA 1OUMA 4RXMA 2YZ7A 1FBNA 3BYZA 3RSHA 3RUFA 1N6HA 2J3IA 1JSRA 4YQYA 1B76A 2WV9A 4KQGA 5A7GA 1E69A 2HRQA 5JAIA 3EGWA 1Q3KA 3KG2A 1KXZA 2FETA 3YASA 2HCJB 4RD0A 2ZJ0A 3VHXB 3TNJA 3BMOB 1T3HA 4PLHA 4AZWA 1S4QA 3OMXA 4CR6A 3NMUF 3B8EA 1ML3A 3NTRA 3OUTA 2B1QA 4DV2B 3GXOA 1YE5A 1MPTA 3K4PA 1G3IA 4DWJA 3G71B 3H4TA 1FP7A 4HRXA 1MPXA 2V3VA 4DC1A 5JH7A 2B5OA 2C99A 3N5KA 1AQNA 4NK5A 4RPJA 3DBRB 3UO8B 2VDQB 3P0JA 1AGXA 3P71T 3TTUA 4EJ6A 1YITB 2NAPA 1J7KA 1XZMA 2W8BA 4IDEA 2GVNA 4W9NA 4CQMA 3K15A 1L4LA 1L4FA 4MPTA 2CHGA 4NE9A 4BNMA 3WYNA 3MJDA 3BY1A 1BG6A 2CVHA 4Q9JA 1Y7LA 2DBVO 2W37A 4JITA 5BR1A 1G66A 2BP7B 2IYNA 1WZIA 4OHCA 3B9BA 4XLTA 3SC2A 2CV1A 4R69A 2NTVA 3E9NA 4H1TA 5CXSA 5TPWB 3W5HA 1C7JA 3W6PA 3I8OA 3WHPA 2BGGA 1WB5A 1AF7A 1GR0A 5K6TA 3AVWA 3JAKB 4I55B 3WJ2A 5LD2C 2FN3A 3K0CC 1ZGBA 3WB9A 2CCGA 2IHNA 3T3PB 1I4DD 1X8KA 2I3DA 5CLGA 3MQ4A 3UJPA 3KYBA 4MEJA 2CFRA 5JWHA 2YWEA 3BOSA 4JI6B 3E8XA 5DW0A 4MS3A 3BQ9A 3V3TA 5B6PA 1XPRA 1AA9A 1S9DA 4DYDA 2BHNA 5E2BA 4C6HA 2A78A 1HYBA 4RMJA 1H6AA 3M5CA 1PIWA 5FBZA 1JG3A 4MUAA 5JAMA 1HV8A 1P2BA 4RVFA 3TD9A 1L6RA 4KR7A 2V9ZA 3GAAA 3E58A 2ZL5A 4DANA 2XIQA 1EB8A 2HJ9A 5E3HA 2YNMA 3T4XA 5TE9A 4TV8A 4CM3A 1C29B 2GRJA 3L0SA 4IWNA 2QNBA 4RIFA 5K05A 2AFHA 4QHSA 1D0IA 3MQFA 2WHYA 1XPUA 3DTVA 2WF7A 3T12A 3ZW9A 2J9FA 2IHUA 1MVNA 1M66A 2V96A 2XTZA 4RPLA 4S1PA 3GEPA 2NO6A 3LFHA 4HDSA 2KLHA 3CH5A 5KSOA 2YJ5A 1G21A 1UT8A 2C0PA 4N6NA 2I91A 4ITUA 1Y0RA 4O4IF 4PYMA 2BAGA 3FOBA 4ZFNA 3TSAA 5BSFA 4ZZ0A 2EXXA 4CXMA 1UQRA 1KDOA 1RYFA 1SXJE 4JL6A 1T34A 1AS3A 2E5FA 2XWBF 2V8BA 4PN3A 3DMDA 2Z9BA 3WWPA 1T8RA 3KEFA 4LGCA 5KNCD 5AM3A 2D06A 2WSIA 3V1TC 4F56A 3QVKA 3T52A 3I2GA 4AG5A 2O8BA 3R40A 5I5EA 2DGDA 4K9OA 2IUUA 3CSDA 1ULTA 2WABA 2HOQA 1P45A 3BA1A 3UGTA 5EINA 1XN4A 2HBYA 3WL8A 5LOVF 1R2QA 2A7XA 4EY7A 4HS9A 1LBEA 5AKKA 4GM1A 3FI9A 5E4TA 5HVNA 3L01A 4Q19A 1PT6A 3A6KA 1E8NA 1FZQA 1T35A 2VXOA 3AK4A 3BKWA 3BIWA 4XYBA 4EX6A 3OQNA 1CEXA 1DSSG 1RHQA 1P5ZB 1LVUA 3JQGB 2BY4A 1KI3A 3MIZA 3T5AA 4E11A 3X1ZA 2IZZA 1CZNA 2R6AA 3FW1A 2HTEA 2JJYA 2XAAA 4HH3C 3OX3A 1Q21A 3DFMA 5FEUA 2E2WA 3LCCA 5JDIA 4Q1BA 1O4VA 4K81B 5IUNC 4UM7A 3H16A 3N70A 2CXUA 2ACVA 4YMSA 4A1FA 3UMVA 2R79A 1P1HA 2VTBA 1R0ZA 4HMQA 1KOJA 1OPXA 2PKWA 1SCKA 3AY3A 1CUXA 3IIIA 1V2GA 4N6OA 2ONJA 3EE6A 5KC9A 1R9JA 3RTDA 4ZODA 2LIPA 3H1AA 1RIIA 4E7PA 4ABTA 2FQ1A 2C77A 3X2FA 2EERA 2A0UA 2BCEA 1QIHA 2FUG1 2VDKB 1NY5A 1EEHA 3PQ6A 4ZQEA 3SCZA 4A27A 3ASQA 2X0FA 4XB6B 1T4CA 1FSPA 5A9TA 2CMDA 1PJTA 1VGRA 1GCUA 3GXBA 3GZNA 4U7FA 2RKOA 3WNBA 1OTHA 1UWLA 4HWPA 1I7SB 5ELXA 3N0TA 5E3IA 1QUEA 2ORED 2PUGA 3LLVA 3R5KA 1RWQA 4UTVA 1H1TA 1BXZA 1ZVQA 4V0SA 3PI6A 3CJRA 1BEEA 5LFAA 1TJ3A 3L6UA 3WLKX 4MROA 3RS2A 4QYIB 4HFJA 1W34A 7ADHA 3I42A 5BVGB 4J16A 5HGXA 2DR0A 1UBKS 1DJNA 1FFDA 2QY6A 1UL1X 4DT1A 3HAGA 2WPNA 3Q10A 1YFLA 2I7CA 1R88A 4BFCA 1CVRA 2CLEB 1XZPA 1PQWA 3OZWA 2IYQA 3NX4A 1G8HA 4RA6B 3TIGA 4BCCA 2XLCA 2ZULA 1KZGB 2F6RA 2GJ9A 1P81A 3PFKA 1T4MA 5C1IA 2G88A 1DUVG 1UFOA 3KIPA 4DCUA 4MP3A 2D13A 3PD7A 5AI6A 1I1HA 2EDAA 4GLLA 1PFUA 3G5LA 3TNLA 1V8PA 3UQZA 5FV4A 4MJ3A 3GJTA 3RO7A 2WHPB 1XQ1A 3EIWA 5THXA 1BMDA 4WLNA 1JQLB 3Q3AA 1UK8A 2W83A 4I5FA 3CIOA 2O7RA 5A03A 5ED4A 2RCYA 5LD2B 5EJAA 3ZHXA 4NMHA 1ZSYA 3VX3A 1FJXA 4FYXA 1Q86D 3Q8KA 3I58A 4YJFB 3CSSA 3LPDA 4FNOA 5BN5B 4OGGA 4DV3B 3WKEA 3E4CA 2WJZB 2GRAA 4YUXA 4N4AA 2ZPUA 1SU7A 3ZWXA 5FBHA 2X1MA 3P2IA 1KAMA 4MO9A 2FOIA 2PA3A 2SKEA 2NPFA 3Q6IA 4IKPA 2X5NA 2X7XA 3H3XA 5AW0A 1O0CA 3P7MA 2ZZNA 1SKMA 1NBME 2AK3A 2XGOA 1DC6A 2EGGA 1QVFB 1P62B 1TUIA 2XQFA 2IOFA 3UNXA 1OAOC 1QIDA 4LA4A 1TVEA 2GPAA 4P54A 3KJHA 3A1TA 3TRJA 3CLHA 4PGGA 2DPHA 3WS7A 4BVGA 2PNFA 1DO0A 4A0QA 3BORA 3DONA 4P4UA 4UVIA 4M1YA 2R1UA 4CFSA 4A0HA 1ZMTA 1RHRA 3MCTA 4OSEA 3A7EA 3PKIA 4NENA 5B36A 5FBRB 3NNSA 2AFVA 3ORYA 3TS1A 4GRDA 1M6HA 4KU4A 4W5WA 3LY7A 2BTEA 1GUDA 4FDUA 3UAWA 1C1XA 4RYDA 2PBLA 1WD7A 2MR5A 5CT8A 3RIGA 1NUTA 4FKZA 3RLFA 1KH3A 2JD0A 4IJ6A 2GN2A 2EW2A 2P90A 3E8SA 4M6WB 1EUDB 2PRYA 3D5TA 3I92A 1HDZA 5I48A 2ZJ4A 3AVOA 3IAXA 1F60A 3LNNA 2YWJA 4FNMA 5LOVB 5TGTA 3KSRA 3AXSA 1L4KA 2OKGA 1F2DA 4FHDA 4FW9A 3O4IA 4TTPA 1OFUA 3A11A 4ERXA 4JYCA 4TMYA 1NXWA 1WCWA 1AD2A 4K3UA 4QPZA 1J0CA 4ZOCA 1NA5A 1ZQ1A 2WM9B 3NAQA 3Q0IA 4PGHA 2J32A 1SC6A 4MR7B 2PRSA 3OM8A 2I7TA 1XTKA 3VYRB 2E5WA 3LT5A 3E6AA 3U5TA 1I8TA 1N2ZA 3CPHA 2ZS8A 1FX0B 1SCBA 2GHQA 3LGXA 1U8CB 2H1IA 1X42A 3B70A 1RXEA 4D80A 3AHGA 1VRWA 2AMLA 1US8B 2OBMA 4MI3A 1C81A 2BMEA 1NUUA 2AFIA 3IUEA 5JATA 2RHRA 5HS6A 3K73O 3LHIA 2C20A 1BA3A 2W2KB 5TMBA 4I1YA 5HKKD 1EGMB 4V1CA 4BATA 3EBOA 1C3OB 5F4ZA 1KTIA 4JKOA 3VKUA 2I1QA 1I0IA 1KERA 4I6JA 1XRRA 1M1XB 3R5TA 4Z9AA 1BXRB 3JQ8B 4TV9F 1V8DA 3VZSA 4M53A 1DRJA 4FDAA 1JG1A 1R4AA 4BTLA 4ID9A 1KYVA 1HG1A 1UKCA 4OQ4A 1P9LA 4CI9A 4OQZA 5K0CA 2EF0A 5AYVA 1UPBA 3LYUA 1H8EA 1N3YA 4QGSA 3V4LA 2AN4A 1PK7A 4U4AA 4ARIA 2IHJA 1YNSA 2NV0A 2H1WA 3COWA 3GLQA 4MPDA 4BFSA 3DAPA 1CUZA 3LKZA 4MICA 4DQ0A 4E5UA 1QR2A 2A9OA 3NP7A 3T3GA 5KW9A 1NGSA 1TB4A 2Q5LA 2R6FA 3K9LA 2O0HA 5CYPA 5HFNA 4WOPA 3S70A 5BUZA 3ENNA 1EXMA 4MPRA 4C07A 4OOSA 4Y6PA 4ZZIA 1XMPA 2XDQA 1V1JA 4NQZA 3P52A 2JIPA 3HUDA 1WHSA 3HKBA 4XWYA 4DEXA 3EBPA 4P1ZA 2PUEA 3HSSA 5L7TA 3SBOA 3DLCA 4LSWA 1GPH1 5E4FA 3TI7A 3HL0A 1ZONA 4YMGA 4O29A 3GFQA 1JEEA 1XEXA 1V8BA 2ZKLA 4C06A 1Q1EA 1RJ9B 2OD2A 4DC9A 4LDJA 1JR3E 4FFVA 3IP8A 4M1QA 1EVEA 3KQMA 4NRDA 4F8JA 4BVAA 3OQIA 3RUCA 2YVLA 4WK4B 3CXRA 3QU2A 4KQIA 1Y6JA 2KBEA 4S3MA 3VYTB 4CLEA 3BAZA 1IZYA 1QAOA 1WKCA 5AK4A 1COZA 2JCVA 3SFVA 2GYWA 1MVOA 3ILHA 1SCUB 3TL2A 3L49A 4CHTA 1GRCA 2VTKA 1L7EA 2F17A 5I7UA 3JQ9C 1I18A 1M5UA 3EXEB 4HNAA 2QN8A 3MGGA 3L05A 1TT5B 4RGQA 1IJEA 4RPHA 4D99A 4O33A 4TTRA 1IZ0A 4XM0A 4FZ5A 5L46A 2ZB4A 3MSXA 5FUBA 2Y0CA 3NETA 1M6VA 4QPPA 4CQNA 1Z17A 2D00A 4DXHA 5ITZA 1Z6PA 1N1MA 2O57A 5ELMA 5IW8A 1VQ1A 4FJ0A 1T15A 2V7QA 5KYUA 5L8VA 2JA1A 4RLSA 2ZUEA 3GLFB 3MUOA 4DHEA 4GMXA 3L7CA 5G4KB 2GYVA 4BRWA 2Q5JA 3AF2A 2HY7A 3VO8A 5LA6F 1I4TD 2FOLA 2QVYX 2OQ2A 1YJQA 4PRZA 2C2XA 2NQ2C 1Y6FA 1DJPA 4TQUS 5FNVA 3L2OB 1TC2A 4YXFA 5B57C 1G55A 3ZV6A 2A5FA 4U39A 4EFLA 4G5XA 2A92A 3HR4A 3KB6A 3IQFA 3OUZA 4NE2A 4MUNA 4GXNA 1GPUA 1S2IA 4GO1A 1LLQA 4N3BA 4GICA 1E4OA 4KSCA 4R2MA 5K51A 1DEKA 3CW2A 1N8KA 3E61A 4ZO7A 4FC7A 3ZKWA 4ONEA 5KJCA 1CCWA 2RONA 5GVSA 2WQ6A 4RD4A 2A5DA 2B4TO 2I29A 4QDUA 2ZSAA 1N2SA 3RSOA 4IEFB 3VU0A 3MK31 1RABA 2WYHA 3HADA 1AK2A 4Q4DA 3HP1A 1GXSB 1YRQA 2BDUA 2PZEA 2V7EA 3V5NA 2V97A 2I4NA 4HUJA 4JV5B 1H8HD 5EUQB 2PCLA 3IALA 2XOEA 3F4KA 1OZGA 4OQMA 3NIDB 4RY8A 3HDQA 5IBPA 3A70A 4ZOQI 4I7EA 2M6KA 3GA5A 4DJ5X 1I24A 5K09A 5ER6A 1E3EA 1RZUA 4JT8A 4O4IB 5EUMA 5KOIA 2OCIA 1QC5A 4FWTA 2WFLA 2ERCA 2ZDHA 3G0IA 3HY6A 4UJ5A 3OEYA 2F1KA 3QHQA 1FY2A 5AI8A 3OURA 1Y63A 1VYVA 3EXIB 3L7IA 4IZHA 2I65A 3L7BA 2HBQA 3OIDA 4NBNA 1SG9A 1M34E 2CF6A 3A0UA 3FNRA 1Y6QA 4BP3A 2NUAA 1YQTA 1HEYA 3DYBA 1WEHA 2V55B 3MLEA 4XDHA 3R7BA 1RRFA 3EJWA 4DCPA 2XADA 5KDOA 3PX7A 1K1EA 2H2HA 1D07A 4PANA 2ZE7A 2P9CA 3L5OA 4DCTA 5BOSA 1WV1A 1X19A 3HVJA 1Y8QA 4B3IA 4CMIA 1YL5A 3RYHB 1WP4A 1PUIA 3IV6A 5AOCA 2YZMA 4X1IB 4K6OA 1F48A 1T4DA 1RYHA 3IPRA 1QR6A 1UBJS 1ZXBA 3QPWA 2WTXA 4HBGA 5ERXA 1RAFA 1RHUA 4DWWA 2PSDA 1ZGHA 2WJ3A 3FA2A 1QORA 4LYEA 4LE1A 4RIEA 4Q37A 5TT0A 4BYGA 2QN3A 5D6NA 1THZA 2PUHA 1A7AA 3C5VA 1PHRA 1VJGA 3HM9A 4P92A 4LQDA 1U4NA 1WDLA 1M1YE 3KWMA 2Q5QA 5CA0F 1NUPA 1X80B 3CY6A 1UJ4A 1E1CA 1Q2XA 2JAUA 4FHGA 5BYAA 2HMWA 1KKMA 2HCTA 4I9NA 4DKXA 1FDRA 2VBIA 4YRQA 4TYMA 1CHNA 4G2NA 1L4GA 5KBYA 4XJSA 2J5BA 4X92A 2A9RA 4UFNA 1BE0A 1QDEA 4BWVA 1E1QD 2BM9A 3I6IA 5I5GA 3UAOA 3QFTA 5F52A 2UYYA 1EJ6A 3L1VA 1EFPB 1VSQA 3HLYA 3ADCA 2NVOA 3IX7A 5IYNA 1JJ2B 4GFDA 3BJRA 4OX9Y 1RI4A 1T25A 5JPIA 4JP2A 4X64B 4Q7JB 3TIIA 3ABQB 4JB8A 5JZSA 4IXNA 3HI4A 2ENWA 4JL5A 1ZOLA 2AE1A 2YXDA 2IZOA 4UQPA 2JS7A 1NLUA 2IDMA 3NHAA 3ZX5A 5JD4A 1Q9SA 1WU8A 1RTKA 1RXCA 2BI7A 4O2BF 5AJXA 2GJ8A 4CCYB 2OK8A 3NHRA 3GJ6A 3QPVA 1VECA 4C6RA 3GEIA 1PR9A 1E9RA 1TA0A 4HFRA 3IS3A 2ZUTA 4MV8A 1J8MF 1GTRA 2AOTB 1YUBA 3NPAA 2GVZC 1JEQA 5B2FA 3U44B 3SSAA 1LVGA 4UFPA 1IOVA 3VR0A 1KYZA 2DPMA 3LCJA 4PONA 2O5EA 4NDAA 4KRFA 3TZHA 1NDQA 1NW6A 2H07A 1U0RA 5HE8A 3PLAE 3IL2A 4CIBA 4LHSA 3IH5A 3T0GA 2E9SA 3GT3A 4ZVKA 5JXIA 1A9ZA 4XX0A 5ALGA 3U4DA 2J6BA 4PPGA 4D0NA 3DPSA 3CO0S 4TVKA 4DM7A 2CXQA 4R1OA 1Y5RA 2PT5A 3A31A 1WCV1 1XD9A 4I50A 4F9GA 2P5TB 1YO6A 2C54A 1MN6A 1ZMXA 1OJLA 2GERA 5NLLA 4DN6A 3B60A 2KPOA 4RPDA 3LWBA 2OD7A 2J48A 1V6SA 4DIFA 2GZHA 4NZNA 2QMYA 2W58A 2IW1A 3LTEA 5G1PA 3DCIA 3EIUA 2I7XA 3IV9A 3N39C 1KQGA 3L7YA 5EIBD 1J09A 2VL7A 2XEDA 3FZEA 4G1EB 4HLCA 2J6IA 1TLTA 4HZGA 1TK2A 4B2PA 3ICOA 4UOEA 1UMCA 3D1VA 2NU9A 4H6PA 1Z2DA 2O2GA 4LWQA 5DLPA 1ZX1A 1GM5A 2G17A 4U5QA 4LF5B 3HJFA 9GPBA 3SQWA 1JEYB 1EAYA 1L9XA 3KB2A 4MVJI 2ZVQX 2FMXA 4HGPA 4LOHA 1P7YA 2PAFA 2AW5A 4OKSA 4YYEA 5FCDA 1K5HA 4YXWA 2A0YA 4JEMA 5JNVA 2CVFA 3FPKA 1PJ8A 5LQRA 2AC7A 2QUJA 1XDDA 1OYOA 2VT2A 2VYVA 5IVPA 4R54A 3DSRA 4W8HA 2ZTNA 4LX8A 2Y1XA 3QOFA 1N9ZA 2IX3A 1CRQA 1DC3A 4OXKA 3TSWA 1JEJA 3NM5A 2EARA 3HU3A 3UXMA 4KO3S 4KE9A 1V1MB 3E9QA 4MSUA 4YYZA 3IURA 2IYEA 3E84A 3ET4A 3F8SA 5AR1A 4TKUB 3RRYA 3SPXA 3FYUA 1NIPA 4BEWA 3DOIA 4PZAA 4QUBA 4XOIA 5CJ2A 4MEAA 1BHO1 4QYWA 4D25A 5F77A 3NALA 2XMZA 3DAYA 1G4HA 2O4UX 3IYLW 4P6VF 2E37A 2XQVA 3KSUA 3ZYZA 1YB2A 2OCKA 1HQKA 3O9VA 3OTWA 3PB3A 5GM2A 4RNCA 1PQUA 5FFFA 3UZUA 2C4TA 1ECFA 1I4OA 3DEFA 1O89A 4NY1A 4Z0NA 5LZ5A 3WB0A 4EHNA 5JY6A 5CIYA 3QFSA 1XLUA 1KO5A 2UZ1B 3KP1A 4MW5A 4EHIA 5ALPA 3ZVNA 1JJFA 1SUEA 3FYSA 4Z4IA 1QRRA 3NHKA 5HS4A 4HI0E 3H5IA 5IT9A 4MQEA 3CRZA 5BW6B 2HXSA 1J22A 1U8UA 3MNFA 3ZPXA 1CF2O 4YIHA 1K8XB 1IDN1 3LQFA 2K2WA 1DZ3A 3AF0A 3QLUC 2A30A 3OOYA 4X71A 1RPNA 3P4UA 4QDZA 2QP9X 4CMIB 3CRW1 3ADBA 1FRFS 2PH7A 1JHMA 3NATA 1IATA 1VLMA 2I6QA 3HDVA 4V0RA 5LZ4A 4JC8A 1KDVA 3WAJA 5FPTA 4KPUA 3EQ6A 1VHWA 4C6TB 4I4IA 4H16A 4YRJA 2VF5X 4JI2B 4QDJA 3LT0A 1FJHA 1V37A 4OFBA 5AJYA 5L3ZA 4DL9A 721PA 4RTSA 4X8HA 5HIIA 4YMTA 1A8HA 4KH0A 1B0PA 1TRKA 4JT9A 3FAKA 3H9JA 1GQ2A 4DUPA 5LM3A 2CXRA 1T36A 3ZDQA 1DWUA 1N2BA 3UV7A 3FMVA 1QQ6A 4PYKA 4WN9B 3W5DA 4BO4A 1VLHA 1FP4B 2DRIA 3SC2B 2C9CA 3OVMA 1GNLA 1EWTA 1TECE 2QX7A 1VSBA 1K9SA 2ODNA 2WOOA 4AJJA 2R1ZA 3N7AA 4QOGA 5LC1A 5BORA 3CW8X 4DR3B 5L9AA 4I55A 2KX7A 4BLUA 3K6KA 3UT5B 3FCUB 4NFSA 3KZVA 3G8BA 3WISA 1WABA 3GI1A 5EP3A 1TT5A 3L4BC 4QOJA 2H16A 3UVEA 4RULA 1K88A 3QU7A 3BFJA 2BH2A 3AJAA 2DBZA 2QLFA 4KLCA 1YB6A 1USUA 1IQUA 2VJBA 2WLTA 2X53S 1Q7EA 1NE7A 3LRPA 1J42A 3OZ7A 4MINA 1W1UA 3BXOA 5G3YA 1XZHA 2E4WA 1D2NA 2GAOA 3RI3A 2OVFA 1A96A 1J0EA 3RANA 2R1TA 1UIMA 3TG8A 5BUCA 1HK7A 1K0UA 1Z06A 4PG5A 5FD8A 1O97C 1ZJ4A 2CLLB 3DHYA 3MILA 2X2FA 5JBIA 2HA6A 3KHSA 1HTBA 2WTNA 2GF9A 4UTXA 4BGEA 5I7VA 3LOPA 4KFUA 4DLTA 2RMKA 3F3YA 2FPIA 3UCXA 5HZGA 2A59A 1WB6A 4QQNA 3SLRA 4BBAA 2EX4A 1MRNA 1NI4A 3RT9A 2CDAA 1DXHA 1W0CA 2WF8A 4CNBA 2Q0HA 4XB2A 3S29A 3IBTA 1PEDA 2C9DA 2C2WA 2GA9A 2R7NA 3QELB 1ZXXA 2VBSA 2GEFA 2LKDA 2FOXA 4M7OA 4XWAA 3IRVA 3QLJA 5EHZA 1EUCB 1JMYA 2BZ1A 1RM5A 1S7CA 2C7PA 3FSJX 5J5AA 2QN9A 4ZRDA 3H0EA 4K6KA 4XMYA 1E9AA 5B5SA 2OCLA 4BE7B 4XQFA 3RARA 1OBVA 1E2FA 2I6XA 3SEZA 1D1SA 4BVLA 4REMA 3ZDAA 5H3HA 2B1JA 3RFFA 1JJIA 3IHWA 3PQCA 3B1WA 3K0EA 4IWYA 3S99A 1KJNA 1RHJA 2GYYA 2P9YA 2FPOA 4KXYA 3V2IA 3QUCA 2QYOA 2B4RO 5C1DA 3M6MD 1E6WA 1GHTA 2PGXA 2VPTA 4ZT2A 1QYRA 4HUTA 1ZN9A 4ZOLA 1P3Y1 2F1IA 2YICA 2R8PA 3JQGA 5A6SB 4EPRA 1KRWA 3WE7A 2E4UA 2ZAYA 2HYIC 3JAWA 3ER9A 4NMMA 3AEUA 1PNVA 1ACLA 2GI4A 3QG5A 1LFAA 4LRQA 3TPZA 4FQ8A 1O0SA 2V4ZA 1A2BA 1N3BA 3KQTA 3U7GA 1PR5A 3PVDA 4YMLA 3BWXA 2WZNA 4L9AA 2B21A 4KSBA 1CUGA 2VP2A 3CLSD 1VQKB 3GR6A 4TLCA 3EQ7A 2RHWA 5TVKA 4PLZA 3UJCA 1RCTE 2QYTA 3K8QA 4F5WA 4U9IS 2QJWA 4GM0A 4BX2A 1F9EA 3EDMA 1QH0A 1TM3E 5C3MA 3MTGA 2AI2A 3UPDA 3WQSB 3WB1A 3GLFA 1QRUA 2UV8A 1FF9A 3KYDA 4HGYA 4RV5A 4E1VA 2FPLA 5D5PA 1M72A 4P3OA 3L6EA 3VV3A 1G8SA 3JR3A 3M83A 2ZUWA 2OHHA 3JD4A 1V5WA 3NOOA 2CKDA 1L5WA 3LO8A 3Q3EA 4NBTA 2ZSUA 4L5YA 4Y2HA 2FPGB 3IOEA 1YVPA 5DEIA 4F4FA 3HBLA 3SQXA 2AE2A 3I6QA 1J0DA 2R47A 2J5KA 1ZD5A 3H3JA 3OQVA 3NAGA 4JJKA 2Q7XA 3M89A 3ZE2B 5LP6F 3C3MA 4TWRA 4AKSA 2IZ5A 4B6EA 1GAWA 3ZHOA 2GGSA 5FPPA 2DU8A 5I9BA 5BV0A 1Z6XA 4O8ZA 1MR3F 3GP3A 5TQ0A 5F1OA 4FX5A 2C84A 1JE0A 2YC2C 3DC2A 3RV4A 3CRQA 3DH0A 1LNZA 3WSTA 1Y3CE 2A1UB 2YOGA 4OB6A 1NVMB 1N8RD 4WUVA 1GYPA 1VFNA 2ON6A 3PVSA 4LZJA 4CTNA 5I7OA 4DUZB 4IH1A 4Y1RB 4P0QB 3KOOA 1DBWA 3BSWA 4KDFA 1N2EA 3PWTA 3OAAA 5DHSA 2WTEA 5A5FA 1KQOA 1PTKA 1WLSA 4GI2A 4LDZA 4NBWA 1MJGA 1AMOA 1NW7A 1TVKB 1W49A 4TS4A 3T7KA 1Z08A 3ZV5A 3MJ4A 2H5IA 4M83A 1C3EA 5GOZA 5T67A 2I4RA 3AJEA 3RIMA 4YALA 5JZBA 4DIDA 2COKA 5CG2A 4ON9A 2FX3A 1M1UA 1SUDA 3K0FA 5BN4A 1U3CA 1FXSA 4OF4A 3B78A 2CYAA 3QA9A 2C7RA 5H1YA 4ZGBA 2WD7A 3KQVA 3MG9A 1VFPA 2YJZA 3ME5A 2PSJA 3HCCA 1SZCA 5J1SB 2BEKA 1SXQA 1WBJB 2F3SA 3BMXA 1ZGJA 2G4LA 2LR0A 4BNJA 4D8UA 3BIJA 3DZGA 4AMYA 1BWRA 1G98A 2UUBB 3R7DA 2V3WA 2NPIA 3P0EA 5GZ1A 4TMZA 2BONA 1WY7A 3EWIA 1HETA 2HREA 3I0MA 3EZ2A 2B20A 3UMYA 1O54A 1QIGA 4I2NA 4WXEA 1HDEA 4HYEA 1W75A 3JZMA 4R3UC 2FSFA 2R4QA 4L78A 1AKVA 1BH2A 2YYYA 4QO7A 5CBPA 1QGDA 3I2JA 1JZQA 3OT1B 4KGXA 1M0EA 5CVCA 4F6CA 2B61A 5L95A 3ICEA 2PUWA 4IKEA 3T5BA 1FXWF 1FDVA 2GZ3A 4LKOA 4Q7QA 1MNQA 3HFJA 1U2ZA 2OILA 5EHXA 1PQ4A 4JI0B 1H2FA 4LF6B 3I4LA 3GLHB 3IVGA 4MUIA 4XPIB 4FQ7A 4D9IA 2GM5A 4J2HA 5EN4A 3B3JA 4E5SA 1JHUA 3I2FA 1LPMA 2YXEA 4MI1A 3T61A 5A6SA 1GQSA 3OP1A 2Q3HA 3H1BA 3PHCA 4NHOA 3IOYA 3HTXA 1OXBB 3A4YA 1U0JA 3H4MA 5G53C 4Z0HO 2IUYA 3MUFA 5K3DA 1QJ4A 1R0SA 3IE1A 1AUOA 1TYEB 2W4MA 4ZHQF 3I5UA 4N5DA 2CXOA 4Q9AA 2IUFA 3V80A 2AK2A 2IL1A 3FY4A 5HMLA 4DJFC 3HXMA 4PAWA 1Z18A 3IE0A 2QG9A 5H8WA 5DTIA 3FYDA 4M21A 1TEHA 4B6PA 4HZUB 1WNTA 2UAGA 1W52X 2YRFA 2ZBFA 1H5NA 4GX2A 4L5CA 5EXTA 5C7LO 2F3QA 2EDCA 1DP4A 3KEQA 3JZFA 5IFLA 2Z4SA 3DEIA 3C3XA 4KUGA 1EIZA 1Q1QA 3MIIA 5KVQA 3BH6A 3EYWA 3JWHA 3PPYA 3HWRA 2XJ9A 3G89A 3QXGA 5HIJA 5K5EA 3MFQA 3QUBA 1KGDA 2O0KA 4L4XA 4X0CA 1YASA 3JZAA 2C00A 2QTTA 4NS4A 5JI3E 1YFJA 1E2MA 5K3FA 2UZAA 3GJ5A 4B3BA 2IBSA 1ZSVA 2XBMA 1BDJA 3P9ZA 5DLEA 3QNUA 4YDSA 5B30A 1SKAA 3OOCA 3PRHA 2BLLA 5DYNA 2OUIA 4J9VA 2R6HA 2UXDB 1UP7A 1PRYA 1Z2NX 3H2BA 3EGEA 3QEKA 5K3BA 3RYTC 4I5EA 1HLGA 3WJAA 4CIVA 1KEEA 3DEKA 3GPBA 5F1YA 1AA6A 5A71A 1TJPB 4Q1VA 3I5XA 2VJDA 1JZSA 3IULA 3MWEA 7ABPA 1E98A 1RWKA 3A28A 1LQTA 1S2DA 1V26A 1Q7BA 1T2VA 2HWUA 4OFZA 5DW3A 1H2BA 3RS9A 4B8WA 4BLSA 4YUYA 3BH4A 3WWOA 3U49A 1A1SA 2X3UA 2W6QA 3DW1X 4RZXA 1CK4A 3GRAA 4ZAYA 4XWWA 1S89A 1O77A 1Y6RA 2P4QA 3GFSA 4J0DA 3AJ8A 5FWAA 3JWIA 1CUSA 1HMYA 1DBVO 3K8YA 3KK0A 5K8CA 3BE5A 1ZH2A 3R0JA 2ECFA 3SDSA 1W0KA 2D5BA 2VPXA 1JA1A 1R6TA 1VQOB 3LT4A 2N0SA 1HZJA 2PT7A 4RELA 3G82C 5ALNA 4OQEA 3UK7A 5AOBA 3MHTA 2OESA 2I6FA 1DV2A 1Y4ZA 1KP3A 3F97A 1ESMA 3FDJA 1X7WB 4B9AA 4A0RA 1VA5A 1RFLA 5FV7A 2JD2A 4FE4A 4DQXA 3BXXA 1G3RA 1VZ3A 4NWIA 2CLSA 4AB1A 1DOAA 3R41A 2QQGA 4RSRA 4Y2PA 4BMNA 5JD3A 2LIVA 5IF3A 2BRUC 5T64A 1T1SA 2WT4A 1U80A 1CB7A 4XZ3A 5C32A 3TTXA 1SOWA 3GVJA 1GNTA 1UFKA 2HW8A 2HQOA 3K6RA 1QOPB 2VVTA 3RBVA 1ZVKA 3RLIA 1JDSA 1UF9A 4MIKA 3KXIA 5EHNA 2OYCA 2V1XA 1DX9A 1WPRA 3A6EA 1ZH4A 2W6ID 3E82A 4IINA 5FR2A 4WWVA 3TVTA 1Z4KA 3INNA 1B3BA 1NBMD 2J0UB 5BPFA 4UBLA 3ECSA 5J63A 3JPYA 1S72B 2C4HA 2F55A 3LLMA 1ACMA 3W9UA 1Q44A 4ZOEA 3IV7A 2I1LA 3O3MB 1DWQA 3TLAA 1UBRS 2F3PA 2GJSA 3JRNA 3AUJB 3W9BA 1SHJA 1YACA 1AKQA 8GPBA 3WL6A 4IUYA 4LF7B 4HNQA 4UU1A 1N36B 2VR1A 3P0HA 3VPDA 2ZITA 3R8CA 3WL5A 5DJ5A 1UBTS 3S0JA 4F2GA 4P3KA 4KVFA 3R8FA 3E9EA 3PLNA 2H4JA 2C61A 4YRKA 2AEMA 5CEJA 2VK2A 1VQ4B 1KFKB 4P3IA 3G85A 3EZNA 1W59A 3NRBA 5HQTA 5FPHA 2NO5A 1HA3A 3CW9A 1G60A 2P69A 1OWLA 1CS0A 4PY2A 3ZJVA 2PE3A 4FXPA 4P3PA 4URZR 5I8ZA 2X5XA 3ZIAA 4BO8A 2CJXA 1EX1A 1YB7A 4ND4A 4BMCA 3D0RA 5JCOC 3EAQA 4EITA 3LKDA 4M9UA 5DF1A 2PKYX 1UK9A 1DQYA 4BNXA 4WLOA 1K7CA 1R9GA 4W1PA 2GYUA 4HLUC 3GELA 4JOCA 2PG3A 4NHEA 4R84A 3RWOA 4Q3BA 3AESB 3O4HA 2C4NA 4M1WA 5AKLA 1PZNA 5F5LA 2WZCA 4HAOA 5T6MA 4LRUA 4TLDA 3V4SA 3GVXA 3L93A 2EFGA 1NT4A 1CUEA 5IYRA 3AYZB 3LSTA 4CT0A 4IJVA 3SHVA 3IHLA 3HE3A 1KK1A 4KUEA 5JMWA 2DPXA 1WOPA 3W4IA 2ZRJA 5LMUB 1TU4A 1I9GA 3TSOA 3ZY2A 3A2MA 3G6EB 2XUZA 3CKYA 4F3NA 3EWAA 4F6LA 4HWGA 3NKLA 4ZCQA 1NQWA 2WAAA 2YVQA 1ODJA 2F1RA 1FE8A 1IEQA 3L0BA 4JR1A 2GM9A 1KSJA 4D79A 1BKDR 1ZK2A 3ZY6A 1RM3A 1TUBA 4KHZA 2GNAA 4YCAA 4GWGA 1P0PA 3SC4A 4F71A 1KY3A 1QAQA 1VQ7B 1CZOA 2ZS9A 1GTG1 3FG9A 3OOEA 2YHBA 5LP6C 3SXUA 2OCYC 2Y66A 1C3VA 3K0AA 4JEUA 3K8ZA 4ZOLB 4NH4A 4FJ1A 2B30A 4FHEA 3CH6A 4GX1A 5LXTB 4I3GA 3MHPA 1QP0A 4ME6A 3AZOA 2L17A 1MABA 4Z7NB 4RTLA 8ABPA 4CDNA 1II8A 2O8CB 2L0XA 1TEVA 3FNEA 5IAJA 3VO1A 4OUDB 1I5EA 3D3WA 5H3LA 5J2TF 3Q7TA 4YQEA 4O0MA 3JQFA 1YGPA 1S2OA 2A1UA 4F12A 2XGJA 4GNRA 4YAKA 3K70C 3D6MA 3JYQA 3FOCA 4LXQA 1DEAA 3CG4A 4NQRA 3KEWA 4KFSA 4IRXA 1TGYA 1TRHA 2B1GA 4OB8A 3KX2A 3VR5H 4CF6A 3HH8A 4BO6A 1BE1A 3HYCA 2BR5A 2OFFA 3SAJA 4I46A 2IY9A 3QY9A 4PO8A 3PCTA 3FKJA 4D5GA 4CF7A 3OF3A 1PT8A 1K5GA 4CCSA 1BX1A 2V74B 1CIPA 3E5MA 4H60A 2GBLA 5JVDB 5A06A 2ZVDA 4QOSA 3IBGA 4JIMA 5JVDF 3WKAA 3H2IA 1J9GA 1NFRA 1RHKA 1IY8A 5CDFA 2C7BA 2YV5A 4MS4A 4Q4CA 1P39A 3JZDA 3CEHA 1UMDB 4R1PA 3F7NA 5JSYA 2VF2A 4PVDA 1JAHA 1Z4IA 1CFZA 2JFQA 3GAMA 3K3PA 3D7LA 4XIJA 5GJCA 3Q38A 1T3ZA 1JLLA 1BU8A 3V4ZA 4M8SA 5IHXA 5MGNA 4AX8A 1T1EA 3DUFA 4R0NA 4BMSA 1U5CA 4IQ0A 1JVNA 4TUYB 3ACCA 4CCWA 4CT4B 5HJ5A 2CD7A 2XX3A 1W19A 3MAGA 3W05A 3LVBA 4BNDA 1TVMA 4E33A 3Q6RA 5FL7D 4EGFA 1R0KA 1SBNE 4JLDA 4R7ZA 1ZZEA 4U00A 3STHA 4UHDA 4M98A 2DFVA 2FB9A 3RAJA 5HM8A 4HBZA 3DKVA 4L4ZA 4QTUB 4M0MA 2IX9A 3C7CB 3TOXA 3LQQA 3UKDA 3CG0A 2F8LA 1TYBE 3GUZA 3K8OE 3TM4A 3TF5A 3OE4A 3D8UA 4EB0A 4MLZA 2HA2A 4Y0VA 1K8RA 1QO0A 3U7JA 3JPWA 2FRVA 3I8XA 2V1UA 4C2BA 2WAMA 2P3MA 1TCUA 4MYDA 2BFCB 2HJVA 4AG3A 2RGBA 3O9MA 4BFTA 2Q07A 4ZJZA 5FKJA 1GGKA 2XDWA 2X0NA 4YACA 4BL5A 5FBVB 1D9XA 2A1IA 1SELA 2CXPA 3PNQA 5B1HA 4YCSA 5JZ9A 1ZVMA 2AOTA 2QTBA 5JS2A 1NNEA 1ISIA 3E0QA 4JLAA 1P6UA 1YS6A 4BQFA 2FMKA 3ORHA 3K2IA 1UMKA 1K4MA 3LZCA 3NDIA 3DVRX 4O25A 1VJTA 3T06B 4D9MA 1ECPA 5DDIP 4ODIA 1WPGA 1VP3A 2DQKA 3NYIA 2HC9A 1XTIA 4M9QA 4FXUA 1DCMA 2DT8A 3SJAA 5B3AA 4N18A 1PSWA 1ENZA 4E3WA 2AHRA 1QCDA 1ODFA 4MUHA 1CRWG 1JQJC 1KH1A 2Y71A 5ALHA 4JDPA 3PFCA 3U3KA 1DO2A 1ATIA 3KJNA 2PRKA 1NXVA 1VQ8B 3NYRA 5J23A 2Z43A 3QKWA 3H2ZA 4YJGA 3WBKA 3W8EA 1PR3A 1I36A 2EHDA 2G83A 4ID3A 2ABWA 1FQJA 4YFVA 2VYCA 5K8UA 4HQNA 1C1HA 1US8A 4U0JA 4ASUA 2WAXA 3DTYA 4ZQGA 4HJXA 1VQPB 1XRSB 4F96A 4Z0PA 2P9TA 1Y0YA 2OXCA 1Q7YD 4JR2A 1DQRA 1XZQA 2FWBA 3G2NA 2AV6A 1QDLB 3D8SA 3D3WB 1JG6A 1O4WA 3N8IA 3Q3CA 4HUQA 4B79A 4GKJB 1ZA2A 4BMZA 2WY2D 3O2JA 4EMBA 4E5MA 5KYVA 4YAIA 5JT1A 2E87A 4HQRA 4QYSA 2ZYGA 3ZHBA 1CX9B 4RDKA 4QQ8A 2FGJA 3STVA 4QG7A 3C5HA 1CRLA 4G0YA 1CUBA 3L1UA 2BSXA 1QYWA 1MBZA 4XOPA 3L6DA 2OXTA 1I2ZA 1KO7A 3QYFA 5A7FA 1GDTA 3ABZA 2AYYA 2G80A 3FKSA 4KQCA 4B3CA 4LJ7A 1P2SA 3RSFA 2COEA 1NZFA 4WCFB 2BGJA 3QPUA 3CC7B 4FIDA 1W36B 3W5AA 2P4EA 3EEBA 1AXGA 2QNIA 5CTJA 5HRUA 4KIJA 1F3LA 3DT6A 1C9DB 4Q9LA 5IJWA 2CNDA 2R87A 1TF5A 1G0NA 4R71A 2OP1A 3B2NA 2NU7B 4L2IB 4R68A 1RI3A 4E31A 1XZKA 2JN9A 2GZAA 2JK0A 3H9UA 3O4FA 3BGWA 3ZIUA 3M81A 4J0JA 1J9ZA 1NBIA 1YS4A 5JS8A 1MQ8B 1RXUA 4WK0B 3BMNA 4IZOA 4PX9A 4YWJA 3CUTA 3CKLA 4UMDA 4MVYA 2P11A 3OPYI 4P08A 4NIMA 4A0SA 1J56A 1AUXA 2PGNA 4J1SA 4BECA 5KINB 2XHZA 4ZC8A 4ML3A 2WFZA 4IDHA 2X22A 4RKFA 4KN8A 2XTMA 3H5AA 4M87A 4JS0A 3W1EA 3C6QA 5C46F 5MF6A 1U8YA 1ONBA 4TS1A 5J9FA 2GILA 3ONUA 2BP7A 3V1MA 1XNHA 3RW9A 1C0IA 3D7KA 3M5PA 4HDNB 2RHGB 4ZU3A 1NU6A 4CMHA 2HIMA 2R11A 3KKKA 3RSQA 5ICCA 2NW6A 3W0LB 1YF3A 3NUGA 1IHXA 3W2FA 4EJSA 2VTDA 3R7AA 5LLTA 1UXGA 2IUTA 2XUOA 2YDYA 3EGDA 1Y37A 3K1TA 3QI2A 4MOWA 3LDGA 4ZVUA 1R74A 1THMA 1V7QA 5IAOA 4OU4A 1ZCBA 4G86A 4W1QA 2Q0XA 4CDGA 5KOYA 2I76A 1XUOA 1N5LA 2NVUA 5AVZA 2BEUB 4K6FA 4P33A 2BZSA 5DX1A 4X7MA 2XXAB 4MW0A 4ZXFA 2Y27A 5GGXA 4UU7A 2G1PA 2PS0A 4U7HA 3VVBA 1IRXA 1FS4A 1LLFA 2GPWA 4JLPA 4R1NA 1URPA 1TTHA 1D2RA 3DMYA 1YKSA 3TEJA 2Z0MA 5GTDA 2OY0A 5EKSA 3SC3A 4C0XA 4RCVA 1R0CA 1GFZA 3D2CA 2ZRLA 3PQ2A 4JIGA 3UAVA 1W36D 1WHTA 1WL8A 2CNNA 3AEKA 4Z54A 4Q3AA 4KTTE 3ZLUA 4IIJA 1E79D 2OFPA 4YAEA 5C34B 1M2GA 1UWVA 1IONA 3E35A 3BJIC 3IEPA 4LSGA 4ECAA 2H4HA 5CXUA 3DBIA 1AQLA 1KZ1A 2C7VA 3G9UA 4XSGA 3ZGOA 4NV0A 4UKDA 2QRKA 5F1KA 2ACKA 1WETA 1QBGA 3Q3HA 1GRNA 1X7YB 3C1OA 1Z0SA 3KJIA 1JR4A 3AR5A 4C9BA 3PI7A 2EZ9A 2PS9A 4JMQA 3GRPA 4GOMD 1YHZA 5A2QA 1A5SB 3C6ZA 4P32A 4XR4A 5FA5A 5JANA 2HLDA 1AKRA 5JMTA 1F9AA 1C9EA 1KQ3A 1HNXB 2B36A 4TROA 3D0OA 2VT6A 4O8CA 5C8YF 1UMBA 2ZJZA 3OEED 1VA4A 1SQ0A 2ZWOA 4FZ3A 4DMGA 1Y5LA 1E3LA 1AKUA 2AB0A 1FJ2A 3GMTA 3R23A 3R0XA 2OHGA 2ZR7A 3X1JA 5MFZA 1Y34E 1GV1A 3OSUA 4YGXB 3RABA 1JDUA 4IDQA 1W88B 4Z8YA 2ARKA 2WWXA 2C4WA 3IT3A 2D3TA 1MD9A 5EJIA 5KDLA 1T6YA 4HEA6 2OGSA 3DEJA 3X2SA 5B4VA 2A4MA 5EXEA 1QH9A 1L4NA 4GAEA 1KH2A 3O83A 4PYRA 1EFHA 5FEMA 2D0IA 3MN1A 1XNJA 1JEYA 1PGOA 1UQTA 2ZIZA 5M34A 1KETA 2QQ0A 4N1AA 4FFDA 1KSGA 3WP0A 2WWIA 2DQYA 5IANA 1MQAA 2IHVA 1JGTA 1ZNZA 4Y2JA 2OV6A 4KDEA 1ZPDA 2AD1A 4XVCA 5KYXB 1PJQA 3FE2A 2NXEA 3LIPA 3VR5A 5B1IA 3DOJA 4QRDA 3ROPA 1CUHA 2B5WA 3S6JA 4EG6A 3IODA 3NIFB 2BF4A 3JU4A 3OZEA 3VZCA 3OQMA 3WNVA 3T1YB 4ZGNB 1QHGA 3CMMA 1OGYA 3Q5EA 1SRRA 3A6ZA 1TYAE 2QL5A 5DNDA 5LA6B 2A0KA 1OB5A 2CYBA 2B0CA 4G25A 2PQMA 5IJ0B 4KLZA 2V7WA 1KGSA 1VPLA 1F4LA 3SFTA 3HDYA 1RACA 3BDAA 4U6NA 3W8NA 4QBFA 3S68A 4LC0A 2YWRA 4OAOA 4ENUA 3RAEC 5TT1A 3FLEA 4II7A 4UE3S 1I1OA 1Q92A 4HWRA 1RWBA 5HE9A 4GRAA 3URKA 5D3MB 5IH3A 1NU8A 2EG5A 4XIFA 1MABB 5EWJB 4MDYA 1E5XA 1T9GR 2PX3A 3DMHA 2O7QA 3RG2A 4FT4A 3PYLA 4D6YA 4DQUA 3H2JA 1WMDA 4O1IA 5ARDA 3GYGA 5CG1A 3CZAA 3SGLA 2AEFA 5BQOA 3A1FA 2A86A 3GNSA 3C5CA 4LE0A 4ZQCB 1YZQA 3DZCA 4B6SA 4H1VA 4AYXA 1O03A 3RJ9A 5EJ9A 3TTSA 2IK8A 1VI5A 3LOUA 3NBZC 5ISMA 3ABOB 2PMFA 4D4JA 3UMGA 4OX9B 4OHVA 1SBTA 4ABYA 2FP4B 2QL7A 5TMPA 5TPZD 4EATA 5DV9A 3UB4A 2WU3A 3LHDA 4X1KA 3DF9A 4D5EA 3ICQB 3AZQA 1Z8NA 1X38A 4FEYA 3ZWCA 1JWLA 3NVAA 5IM4A 4LF4B 2P0YA 5IKEA 5CXQA 4LBZA 1EUZA 2D4AA 4NCHA 4R0MA 2J4FA 2VDVE 5C7IO 2NZJA 5IARA 1LGYA 3KVRA 4J4HA 3WIVA 5LVAA 3WG9A 4D0RA 3DZHA 1Y8RB 1HE5A 3ZS9A 4FCVA 3FDIA 4GMHA 3VZQA 5SZJA 3TOCA 4BCDA 2P2LA 2QQFA 3F9IA 4Y1GA 3RBZA 1ZEMA 2LDBA 5C0OE 3WMXA 3BX1A 2EEZA 4WN9A 1OOEA 1C2YA 1NUAA 1L7DA 1WXHA 2E4VA 2WG0A 4YRNA 1DXQA 1Z3CA 4KMRA 3G79A 1V3UA 1TCBA 5KJ1A 1OYVA 4G81A 5J40A 3N6RA 5IJ9A 1RCUA 2ZJOA 2FZ5A 1IPHA 4MK4A 1L5VA 1N75A 2BM1A 1KDZA 3RG8A 3VKFA 2IH2A 1V1RA 3ML1A 3U62A 3R5JA 1AUQA 1LBTA 3PKZA 4D4MA 4KLRA 1TYDE 4QELA 3V1NA 4NK4A 5EPUA 2DUMA 4YUWA 3G8DA 2B0JA 1Z6AA 1J90A 3QUSA 4ZU6X 3CWQA 3R6WA 4ARAA 7REQA 3Q7EA 3NS7A 4EZEA 5DWDA 5K20A 3PC8A 3H5RA 2VNHA 5KQGA 2FY8A 2VSNA 3OFND 3RJZA 1USIA 4I6GA 2AFHE 4ZHQB 4JYZA 2AOWA 4L95C 4ZCMA 3S2EA 4ZQIA 1C14A 1QX3A 1TM4E 1MX9A 3OETA 4GR5A 3MTJA 3HKEB 1XDBA 2YINC 1P31A 1BX0A 5HK8A 4R2HA 5IC4A 2HXGA 2X0JA 4K9KA 2G4VA 1X0XA 4I1PA 1AU9A 1V11B 1QFJA 2OBBA 1XX6A 1YCDA 1DE0A 1UJNA 3QVGB 2J9YB 4XB1A 1KR2A 4L9RA 2DFKB 4GPD1 3GLIA 2VSYA 4AIRA 2CK3D 2X0RA 4P4SB 3CF2A 5CM2Z 2ZR8A 3D4PA 1Z37A 2D1SA 4UTNA 3N5CA 4LYDA 1QZZA 4NMLA 1M2VB 1RW4A 3GRZA 5CVDA 4D6XA 1R0WA 3IUQA 5DN9A 4F45A 3K6JA 4PLWA 2VLBA 3ILXA 4X8MA 3ERCA 1Z5WA 2J6HA 3GN1A 5FFNA 3OX1A 2IOFK 1EFUA 1JV2B 1NNLA 2VPIA 3MF4A 2W0MA 3FPCA 3KTAB 3D1LA 1OV4A 4PNHA 4U2FA 4UNPA 4WERA 4QL3A 3EDYA 3ZLTA 4B3RB 4LZZA 1O5OA 3N7UA 2QX6A 5IJ0A 1P6QA 1U8XX 1G16A 4IGFA 1U0NA 3BFVA 2BMFA 4B8ZA 2ODWA 3NRJA 3HJGA 2AUMA 2GN1A 3REQB 4B3DA 2NV4A 1HL3A 1HORA 5JNLA 1XCLA 2ETXA 3KR0A 2IVZA 1GUFA 1OC2A 1SCNE 2JIZA 4GM4A 4HNGA 1ZGCA 3NIWA 5E7IA 3O1JC 5HHTA 1D5CA 2JCSA 3A4TA 5A89A 4PFSA 3T56B 1E62A 3FFTA 4MP8A 3NV9A 3IMFA 4C7BA 2ROQA 4LRYA 3L6RA 4K1LA 2V4UA 4JHLA 3DMRA 1ECBA 1H2EA 2W4QA 5KTSA 5I8PA 4OP7A 3C8MA 1KY4A 1V96A 4LN1A 1B3RA 4HLQB 2YWCA 2I99A 1MQ9A 2V5UA 1C3LA 3EFHA 4LOAA 3MWJA 1NNI1 4PCVA 2X8WA 2ZIXA 1PDOA 5D3KA 4F3YA 4YJ2A 3EIXA 3N2GA 1A4UA 1XCBA 3NNDA 4JJ7A 2J1LA 4Y2VA 1UAAA 1NE2A 1PEYA 5CPBA 1FPMA 2ZXHA 5AKYA 2R3SA 3NBUA 1X1TA 4GI3A 3UHFA 2FKNA 1Z9BA 2LDXA 3CH4B 2HSEA 4Y9DA 3GCZA 3GHYA 4P5PA 4M8KA 2HSDA 2VF4X 2YFYA 1ZNQO 1EUQA 4DMKA 4UNQA 4XQCA 5EXPA 1TQ2A 4PLYA 1LW7A 2G8NA 3O0TA 5CLHA 4CF3A 2G76A 3P8ZA 4FCTA 3ZWNA 5JRJA 3ORRA 1DHTA 1MA0A 2VT3A 3CPEA 4G7XA 2VP4A 3PDJA 3FTQA 5EJ8A 3UM9A 1I7DA 1EA5A 1N0HA 1JA9A 4EJ2A 2RGCA 3LE8A 5FO0A 3KJFA 5CT6A 2AA3A 4YJ3B 4B7CA 3UN1A 2X76A 1H4VB 1YC5A 3FGNA 4H7JA 4P3NA 4RPIA 1D8AA 4GSKA 1UD3A 3ZZNA 4D3YA 3E9RA 5J4VA 1UD5A 2CZQA 3FUWA 3I3SR 5I01A 2JGRA 2V7QD 3PA6A 5GGYA 2R4TA 4RKWA 4X5OA 2AUTA 3FMFA 2G9RA 3RAPR 1TOAA 1ZAKA 1CU1A 3DEZA 1QHYA 3VISA 1IM5A 2NVBA 3EZFA 3ZXUB 5IVIA 1LSOA 3IP1A 3W5CA 5IVHA 4BP1A 5LPNA 5ICMA 4PIVA 2J5XA 5HF5A 3SDZA 4MVJM 1C4WA 2JA2A 4DMRA 1X39A 4FYIA 1LWNA 4CCYA 3HKEA 4RHCA 3L9WA 5EA2A 1YZHA 2G06A 4GZLA 4KXNA 4AMBA 3ZLVA 1E0SA 4LZWA 4UBNA 5HNKA 4Z99A 4HK4A 3NGXA 5J4LA 4CVNA 3CUKA 2WVJA 1RBYA 2FWAA 4OCZA 3AEYA 2CMGA 1J39A 2SECE 1FQKA 5IBRA 4NCNA 4BC0A 1NBMA 5CFZA 3V6MA 5C37A 1CJBA 3L7LA 4TQGA 3ICWA 4HO1X 4CKBB 1DIOB 1KEPA 5FORA 3AB8A 1NB9A 2EWWA 2Q46A 1RLOA 2P6UA 3EZYA 1OZAA 1LU9A 5FJJA 4W7SA 1JJAA 4MUFA 2XQIA 3R5HA 1F2VA 3OE5A 4LK3A 3GOHA 2JH8A 1X7YA 1N3IA 3KEGA 3MB5A 1CJUC 5B37A 3B6KA 3R0VA 2OPHA 1RBMA 2H4YA 1Z4PX 4ALMA 3MCUA 1KIMA 3KBOA 3LLCA 3KQLA 1EU1A 1OI7A 2UYQA 1INLA 1FMJA 4DDUA 2CBXA 2EV9A 1I1NA 1TX4B 2HA0A 1H42A 1ZJ5A 3BE8A 3OWXA 3W04A 1EYZA 1M76A 1R6VA 2VUUA 3OJFA 4TTAA 4W4TA 2ZK7A 4WESA 1I7PA 2R97A 4MKHA 1UMCB 3FJ1A 3KB1A 1PK9A 4NZ9A 5DM2A 3PA8A 3LG2A 1KI2A 1G6OA 2YFQA 5FBWB 2CZGA 4TMWA 3QITA 2YRWA 2WU0A 1BWQA 2XRYA 1P9NA 4YEDA 3CPXA 3KQPA 5F33A 4G0UA 3E7XA 4HPWA 5J47A 4AI6A 3SBXA 1YMVA 5B2EA 4RD1A 2WIAA 1D5WA 3UWDA 3R3JA 1T29A 4WOBA 4CMGA 2QJFA 1LY1A 5AVWA 4NR0A 4B80A 5LYJF 3ZXIA 3E8MA 3A4LA 2DWOA 3ONYA 2IHZA 3KPWA 2OAQ1 5AM0A 1UZMA 1G6HA 2DXIA 4F72A 1MO3A 2ZI9A 1RQRA 3B3QA 3BC9A 3KNZA 4TL9A 3C5WP 3DS8A 3E48A 3FDZB 4NMWA 2BI4A 1SXHA 1SVUA 2ZI6A 1XQYA 1G18A 3DMTC 3GX1A 4GMKA 1NBEA 3G2HA 2AIRA 5F3DA 2O7NA 3DBRA 2O0LA 1TAGA 3KHKA 3MOSA 3KXDA 2I54A 4GE3A 3PEFA 1I3KA 3PNSA 5AI5A 4I3HA 2D1QA 4WDQA 3VFDA 4BFYA 4LVUA 4L8FA 5ELLA 1L7PA 2ZIGA 3TZKA 3OOWA 5K03A 3RRBA 4OJQA 4S24A 1AC5A 4HB3A 3ZDEA 2O5CA 3ZHSA 2X9GA 1B2LA 3AUUA 3P0FA 1Y89A 3QVUA 3ID6C 1XRPA 1PYOA 2WWWA 1NVTA 1EHYA 2XSZD 4FYVA 4Z1MD 1V3VA 2BM8A 1XTRA 2YOHA 3NRCA 4JNCA 1FU7A 2NT3A 1H4QA 4OXRA 1L7OA 2C1EA 1QGED 2P27A 3L7KA 4CUKA 4MDFA 3L18A 4PNPA 4ZI2A 4JN6B 3HL4A 2BGTA 5CRIA 5AJVB 5FB3A 3L9XA 2I33A 2F48A 2XAUA 2KE5A 4AD8A 2C5EA 3FF4A 1P44A 4B83A 2YV1A 1TF2A 2BHSA 2OKCA 3HB0A 4MGEA 3OPNA 2ZBQA 4F46A 3D54D 3N2GB 1DAIA 1DFHA 2DZDA 1G8JA 2JARA 4OOEA 2PMEA 4HNVA 3KKOA 1O5TA 3ENKA 1RQXA 3KALA 4EGCB 2UXBB 1P7VA 3EUEA 3HBFA 1JU3A 1ZC3A 2IZ0A 5JXHA 4ILEA 2WFMA 1VMDA 4RZ2A 3WLFA 2WYOA 4YRTA 4ZJPA 1JWAB 2ZPAA 1WUJS 5KOJB 4G84A 2AFRA 5JE8A 1BIFA 4X9XA 4YCBA 1AGNA 4X93A 1E6CA 1NZJA 4L8GA 1ABEA 1M73E 3CXUA 4KVGA 5DGXA 3RIYA 2O8EA 1PWZA 5HJEA 1AT1A 1PZFA 2GFIA 2XB8A 2BIFA 3CQ9A 3LP6A 4YRFA 1N92A 5DASA 3QP9A 1U9IA 4L76A 1MB0A 4JCOA 3OPYB 5F12A 2H00A 4BNDB 4D2IA 5KNDH 3NJRA 3HXQA 3L4JA 4LFCB 1OVGA 1TZCA 3RVSA 3FGPA 1BKSB 4A8JA 1JLMA 1M7BA 1PX0A 4EFNA 5G0UA 3B6ZA 1X77A 2IYXA 2PKRA 4OLHA 1Z34A 1OFGA 2BD0A 3QVGA 1OAKA 4IDAA 3I1JA 1B16A 1WBBA 1ZQ9A 3TLEA 1P4GA 3O90A 3W3ZB 2JLAA 4XUDA 4B85A 2BGLA 3NT5A 4F9EA 2R68A 1PCXA 2HK8A 4WX2B 3DT9A 5BWNA 5JUWA 4AYWA 2C9YA 4DEYA 5AK0A 5CEFA 2UZ3A 1XMSA 4FHFA 4LIPD 3T9DA 5BR7A 1A72A 4F2HA 5B1SA 2P67