1MRZA

Crystal structure of a flavin binding protein from thermotoga maritima, tm379
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
287
structure length
266
Chain Sequence
VVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYFLPDFPGLLMTVESRVEMLSRYARTVVLDFFRIKDLTPEGFVERYLSGVSAVVVGRDFRFGKNASGNASFLRKKGVEVYEIEDVVVQGKRVSSSLIRNLVQEGRVEEIPAYLGRYFEIEGIVFPTANIDRGNEKLVDLKRGVYLVRVHLPDGKKKFGVMNVGFRRNVKYEVYILDFEGDLYGQRLKLEVLKFMRDEKKEELKAAIDQDVKSARNMIDDIINSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a flavin-binding protein from Thermotoga Maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Riboflavin kinase/FMN adenylyltransferase
total genus 76
structure length 266
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
A PF06574 FAD_syn FAD synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1mrzA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1mrzA01
1JEDA 2QTNA 2E21A 1N2IA 1N2OA 1T6XA 4MVYA 1XJQA 3AL0C 4EFKA 4MW4A 3ND6A 1GZUA 5K0SA 1M8JA 1YI8A 3ELBA 1G8GA 1XNJA 3IOBA 1ZUNA 3JXEA 4KPUA 4CDNA 2PZAA 3FWKA 1N78A 4MUHA 1P7PA 2CSXA 4BWVA 4R2MA 4ZCQA 2WQ7A 2QTMA 2ZUEA 3NV7A 2O8VA 4KR9A 5J58A 1WOYA 4NX2A 5K0TA 4PY2A 2CUZA 4MWCA 4KR6A 4ARIA 1J1UA 4ZT7A 4KKVA 1N3LA 4MW7A 1OWMA 2NSYA 2R5WA 1NUQA 1KORA 5IHXA 4DJAA 1VLHA 5J59A 3CLRD 1QRSA 2DLCX 1F4LA 4HPWA 1WXGA 1TYAE 2YWBA 4I6EA 3RJZA 3AKZA 4RUKA 1KAMA 3SEZA 4MQ6A 4NZPA 3FETA 4MWEA 3X1MA 1OWLA 1R6XA 2OYNA 2NZ2A 4X0EA 1YUMA 1VBNA 1QRTA 1MBZA 2DERA 2VTBB 3ZJVA 3N05A 3L92A 3GUZA 4UZEA 1N2JA 5HUJA 1OWOA 3VRHA 5TGTA 2TS1A 4YP6A 3IVCA 3L93A 1V8FA 1PFWA 2A84A 2QJTA 2PZBA 4Q16A 2CV1A 1O96A 4NAHA 3Q10A 2J5BA 1K4MA 2QUHA 2HZ7A 1M8FA 2I1LA 1Q9SA 2EL7A 1JECA 4ND7A 1Y42X 3MLAA 1TEZA 1XNGA 1JIKA 1YIDA 4CDMA 4L2IA 2IELA 3ZUGA 4MWDA 3X1KA 2O5RA 4DDHA 1M1ZA 3H05A 1F9AA 5DASA 3DLAA 1IRXA 3RHSA 1WXEA 4L2IB 2XRZA 1EFPB 3FDXA 2A1UA 2WQ6A 1X6VA 3SZ3A 2VBUA 4YP5A 3SDBA 2A1TS 4ZT2A 1A8HA 1VL2A 2GKSA 3K32A 4Q93A 3RFFA 1NURA 1N08A 1TFUA 2P3MA 4JZYA 2QTRA 2Z3VA 1JEEA 1U3DA 4TS1A 4ZT3A 5F23A 3ND5A 4JYZA 3G6KA 2X1LA 2VBTA 1XNHA 3QTBA 3IODA 5HG0A 1M8GA 3UOWA 3ZGZA 1D2RA 1H1TA 1COZA 2V0GA 4WSOA 1IFXA 1I6MA 1FFYA 3ZJTA 1IQRA 4EG8A 4EG7A 1LI5A 5KHAA 1O5TA 1K92A 1O0CA 1ULHA 3S3TA 1NZJA 3TZEA 1GAXA 4DDKA 2PIDA 3IOCA 1PFUA 1WXIA 2J09A 4ND6A 3OP1A 4F3RA 2WSIA 4MLPA 4S1OA 5A8AA 3ZIUA 1VBKA 1GTRA 1MAWA 1QJCA 4MUNA 2WB2A 3TQOA 4G5FA 2ZUFA 4DE5A 3MXTA 1QNFA 3FIUA 4EG4A 3FI0A 1O95C 4DLPA 4XSVA 1EUQA 3D6VA 4MUKA 2JANA 1TYBE 3QTTA 4R0NA 4MULA 5KWVA 1GN8A 3DV2A 4EG3A 1JZQA 3C8ZA 1NB9A 1MOPA 1O0BA 3CLUC 3RK1A 5A89A 4HJXA 3PRHA 1PFYA 3PNVA 1Q77A 1I2DA 1G59A 3BNWA 2AG6A 2CFOA 2Z09A 1KP2A 3CTAA 1WZ2A 4ZCRA 3CLSD 1SURA 3UMVA 4U8HA 1BS2A 2QUJA 2QUIA 3I05A 4E1AA 5DB4A 4P2BA 2D54A 4ZCTA 2A4MA 2VTBA 2DR2A 1YULA 3FH0A 2OQ2A 1N05A 1KH1A 4PBRA 2QJOA 1N07A 4J76A 2QUKA 4GU5A 1IVSA 3AG5A 3CVXA 2AKEA 4R2LA 4QRDA 4ZCPA 3PNBA 1JHDA 2X3FA 1EUYA 1O96B 4GRIA 2CYBA 4EG6A 1EXDA 2A88A 4RPIA 3CVUA 2DPLA 1MAUA 3IH5A 4MW9A 4I6GA 3G59A 3BL5A 1WKBA 2HGZA 3Q4GA 1IHOA 4ZT6A 5A88A 2GOYA 4I6JA 5H7XA 4JXZA 4YMIA 3N9IA 1T6ZA 4MW6A 5J5AA 1QU2A 2J07A 1RQGA 3UC5A 1FYDA 1H3FA 1ZJWA 2BTEA 3H9BA 4CQNA 2PZ8A 3F3MA 3KFLA 2VBVA 1CT9A 1NYLA 3COZA 1B6TA 4MVCA 5LM3A 1QTQA 1ILEA 2JAXA 1JMVA 1KR2A 3NBAA 5EKDA 3GLVA 3DPIA 1TQ8A 1M8KA 1PG0A 1M83A 3IMGA 1NUPA 2C5SA 3P0JA 3CVWA 1EFPA 3VU8A 1WJGA 1F7UA 2DEUA 1OWPA 2G36A 2H29A 1NSYA 3IVXA 4HK4A 3IMEA 3IDFA 4PBSA 1QU3A 5TRDA 1T9GS 3IVGA 5LFAA 1H3NA 1NUUA 2EJCA 1ZH0A 5BNZA 1IH8A 1T9GR 1TYCA 1PFVA 2X1MA 3DO8A 4EG5A 3UY4A 4XFDA 3X1JA 3E27A 3G5AA 1F7VA 1U0BB 4MUGA 2PG3A 1N2BA 4K03A 1H3EA 1I6KA 2CV2A 4MW1A 1N06A 5FO1A 5DK4A 4F4HA 3SZGA 2A7XA 1O6BA 1KH2A 1QQTA 2OV4A 1JIJA 3PNYA 5H16A 1YIAA 1P4MA 3P0HA 1N2GA 1MRZA 5TS2A 1KKUA 1WQ3A 2D5BA 3N8HA 3FY4A 2BYTA 3CVYA 3PXUA 1OD6A 1DNPA 1N1DA 2ZP1A 3CLUD 3GMIA 4XFJA 1J1ZA 3CA8A 1UFVA 4YBRA 1X8XA 4MUIA 1U7DA 4H3SA 1O97D 3KT0A 3MUEA 3KT3A 3HL4A 1MC1A 3QE4A 3A2KA 3N2YA 1Q15A 1KP3A 1O94C 1LI7A 5AHWA 5LLTA 2H2AA 2A1UB 3LCJA 3HV0A 3HGMA 3ZXIA 2YWCA 1O94D 3A04A 1EFVB 4AQ7A 2CYAA 3MLBA 4JXXA 2IP1A 5DEOA 2YXNA 5IJXA 1TYDE 3P0IA 2CT8A 4MVXA 4ZT5A 4NATA 4QBTA 4MAFA 2CYCA 3Q12A 4PBTA 3COYA 1U3CA 3FG9A 4JFAA 1GPMA 4K0RA 4G5YA 1PG2A 2PXHA 4KPUB 3M5WA 4MW2A 1G8FA 3LE8A 1N75A 1JIIA 2QJFA 1QRUA 4MVWA 3COVA 4DNXA 3SEQA 3NBKA 4U7JA 1WQ4A 4WNYA 4MW0A 4OJMX 3A4IA 3AIIA 3TNJA 3AG6A 4FZJA 3SP1A 1MB2A 2B7LA 3H9CA 1WXHA 3OTWA 1M8PA 2DUMA 1VBMA 2VBSA 5FO0A 2RD2A 1JZSA 1KAQA 3FOCA 2A86A 2V0CA 2RE8A 3TQIA 4AS1A 1Q11A 1MJHA 3KT6A 3IUBA 3TS1A 4ZT4A 1R6TA 2J4DA 4YP7A 1IQ0A 1K4KA 1NUSA 3ND7A 2XRYA 3HFJA 2Z08A 4OUDA 3HMQA 1LW7A 3VGJA 5TEVA 5FNZA 2IJGX 2D13A 1V47A 2E0IA 1EE1A 4CT0A 4KR7A 2PFSA 4G6ZA 5TEWA 1J09A 1HYBA 1ZH6A 1KQOA 1J70A 1O97C 3IUEA 3COWA 4EGAA 2X0KA 1NB0A 3FHJA 1R6UA 2YY5A 2VXOA 1N2HA 2E89A 2A1TR 2JA2A 3KT8A 1NUTA 3IOEA 4MUJA 1KQNA 3U1VA 1O95D 3INNA 5HUHA 1OBHA 1OBCA 3H97A 3MMXA 1GTSA 3IMCA 1K97A 1KH3A 4MW5A 3SYTA 2AZXA 3CR8A 2HMAA 3UK2A 2CV0A 1EFVA 4ZCSA 4MUFA 1KQPA 3FNRA 1YUNA 3H99A 5KCMA 2GM3A 3CLTC 4MUEA 4DDMA 3K9WA 3ZJUA 1T6YA 1Q19A 4MWBA 4HJRA 3D6UA 3ZXSA 1OWNA 4ARCA 5JBNA 1WXFA 3CLSC 1J20A 1I6LA 3ILVA 1U7XA 4EF6A 1MB9A 1NP7A 4U63A 3CVVA 2E18A 3TZLA 1WY5A 3RK0A 3ISJA 1NI5A 2DXIA 3LOQA 4QREA 3CLTD 1JILA 1J21A 4EG1A 3AFHA 1G8HA 4NDAA 3HZRA 4J75A 1N77A 4NAUA 2DETA 1EJ2A 3P52A 4UZFA 4A91A 1JGTA 2J08A 1GLNA 3A05A 1N2EA 3RBAA 1S4MA 1IQUA 3CLRC 4OUDB
chains in the Genus database with same CATH superfamily
2WB4A 3ZC3A 1Q95A 3B1XA 3GA0A 4JOCA 4NESA 5JFGA 1XJQA 1A9SA 2C5AA 3BXOA 4TXHA 5AXAA 5H0IA 3W2FA 2GKOA 4JN6B 4KPUA 1GN9A 3TXXA 4YRBA 1G9TA 3FB4A 1DJQA 2JBHA 3OZ7A 4I9UA 1WF3A 4AZWA 1Y6FA 4OHRA 1Z74A 4TWIA 4MUHA 2FR8A 5C8DA 3FPEA 3NH6A 3DLCA 8LDHA 4S04A 4R2MA 1BZYA 2QTMA 4MGIR 3WYNA 4MCIA 4GP6A 4Q9IA 1II9A 3VGPA 3QNMA 3WGVA 1VDZA 4LOAA 4CV2A 4EITA 1J9EA 4RZXA 1YD7A 4TV9F 4TVKA 1EVQA 4CKYA 1VKOA 3AFMA 1QWOA 1A7JA 2FW6A 1P1HA 2QORA 2W2QA 3EG9A 1PJQA 2GAOA 3R3ZA 1VGRA 3QOYA 1PZFA 1C4KA 3GLHE 4BFUA 4EMTA 1YI2B 5C4IA 5IRCD 1NQOA 4WH0A 3N0WA 4CLDA 3WRXC 2C2HA 3OLQA 4YP0A 1FRVA 1VECA 3LHKA 2QYTA 3WQQA 2G5TA 1XVUA 2FOIA 1NX6A 1DJNA 4WW0A 2PUVA 4KXVA 3HN6A 4DJAA 5AW1A 1AS0A 4JSYA 3EC2A 1I8DA 4KKXB 1G4AE 2MMCA 4YLEA 5IK2A 4FFBA 1BG6A 3UHOA 3JZFA 1FY2A 3PJFA 3PFGA 3B12A 5IBRA 4DSAA 2VP3A 3SEZA 3R7WA 3OZWA 2DFTA 2C2ZA 3LDAA 4HADA 1MUUA 1WE2A 3PUXA 5JBIA 1D1QA 4ID3A 4J91A 2XIJA 2ZBGA 1Y0YA 3C98A 4FIDA 2Z8XA 3A06A 2AFHA 4NARA 2QQ0A 3H1FA 1QTNA 1C7RA 1XKXA 3CC7B 1HDRA 1ZVJA 3A6DA 3DL2A 1OX6A 4PR3A 4HDSA 4RL4A 4BECA 2E1BA 1VZ2A 4EW2A 5JNLA 4X7FA 1LPAB 3HJHA 3H2IA 4HG2A 3GPIA 4DIDA 3UMFA 1U1CA 3MMZA 1ZK3A 1T3TA 1EINA 2O7NA 4J0FA 4N7JA 3WKDA 3E1SA 3W9BA 3L93A 3AB7A 4XRGA 2C7RA 2AI2A 3FYSA 1AZWA 3NU1A 3PXBA 2EXXA 5E0KB 5L3RA 3BMNB 4NG5A 3OF2A 1U5AA 4RF5A 4Z1MD 3I09A 1CY6A 1G6HA 2C9CA 5FORA 1KYZA 2D8MA 5DI3A 4QPDA 5KNBD 4A36A 1HMPA 3HCCA 4NOMA 5AUOB 1KI4A 5G41A 5K0NA 3AVOA 4AZ3B 4U7WA 1OXBB 1RWKA 3ROXA 4QGAA 3QHPA 3WK6A 2JIZA 1MIHA 1NQWA 1RLJA 3EDRA 4MYCA 1R0XA 4L07A 2C98A 3OZIA 5CGZA 3FDFA 1RQLA 1Y42X 3RBZA 2Y6UA 1EFLA 4QX6A 1NPTO 4LDPA 2HW8A 4Z7QB 3E82A 5ICFA 1KVRA 5DRYA 2BLLA 3ZUGA 2IEBA 3R9IA 2ZM6B 4ND2A 2ZSJA 5B7QA 4KI0A 3A26A 3Q0EA 4OP1A 5ALHA 4MDHA 4A8TA 3HXQA 2LR0A 1MR3F 4S3MA 5E6SB 2BFBA 3G88A 4CIXA 3VI3B 3IEPA 3U4CA 1B2RA 1K9MD 1DUSA 3BAFA 1G0OA 1RZUA 4LCJA 4CVNA 4DBZA 1I7SB 4HAXA 2FUNB 1VLQA 3K71B 2PKEA 3NGXA 1WMDA 4EECA 1U3DA 2EW2A 1GV0A 1ZHFA 2V74B 1H2EA 1X7ZA 2OAEA 2NIPA 4ZRNA 2XD9A 5FPPA 4BQPA 3W5VA 4UHDA 1DTSA 3RREA 1DHTA 1VJCA 3P0RA 3LY9A 3Q8WA 2IS2A 5BP7A 3UH0A 3E7PA 4ACBA 1D2RA 4BASA 4F7DA 3MJ4A 3GGJA 5AIAA 1EI9A 3R24A 1U0TA 4TV9B 3CMCO 3RH0A 2H06A 1CERA 4CL8A 3B48A 4PYKA 4C5AA 1UJCA 1E9AA 2W6JA 1D3AA 2YXEA 4EG8A 1H5UA 1O54A 4K6GA 1T9ZA 2OGUA 1XLWA 2IPOA 1R8SA 4PLVA 3H1AA 4FR0A 1FVOA 2VBFA 4GGPA 5JECA 5A9SB 3TTTA 3EZGA 3WAJA 4YDSA 2PIDA 4IUCS 5JEDA 1PBTA 5C0OE 5EJIA 4LBZA 2GBLA 4U6QA 1FVFA 3U61B 5C2JB 5BYKA 5EIXA 1VL1A 3KZMA 2IVFA 1FOEB 2RIRA 3BAZA 3LQRA 1KXZA 3KG2A 4WZKA 3AHDA 2OD9A 3KJNA 2TYSB 4MLPA 1EGMB 3VTKA 1ZC3A 3VZCA 1ZVVA 1P1BA 2N46A 1Y98A 2DKFA 5DFAA 3KJEA 3ZTYA 1OSNA 4DG9A 5LNK1 1YOVA 3L7KA 4IJWA 3MQFA 3WGJA 5LOVA 1CS4C 2D74A 1KO8A 1QNFA 1PZNA 3FIUA 3AM1A 2OHOA 3ADDA 1EHYA 3LY8A 3QWAA 3A27A 2PLNA 1QOPB 3UAVA 2HF8A 1IUKA 1QCYA 1UH5A 1C81A 1GN8A 3WIVA 1X9IA 2R1UA 1LZKA 5IMSA 3WDSA 5TQJA 1CC1S 1DAHA 2R9VA 2H57A 4MP8A 1Q84A 2GJKA 2PD4A 3EHDA 4XSGA 3CCRB 1FB5A 2CUKA 4AB1A 3KQNA 3QLVA 3KZVA 4KGVA 2VFAA 4PPFA 3GLGE 2ODBA 3L8CA 3O26A 1NLFA 3BK2A 3I05A 3JAKA 5CTAA 1E7SA 1FP6A 4R9VA 3QBEA 2QL9A 1HE5A 3CCSB 1UBOS 2NX2A 4KO1S 4YT5A 4V38A 7GPBA 3AR8A 2XWBF 2Z95A 4ZCTA 3ET5A 4CIBA 5CJ2A 3LL4A 1DUVG 2N3ZA 3HZZA 1W46A 1W4RA 3K94A 3D6TB 3PC2A 2UYQA 3JV7A 4M8LA 1XYVA 2C31A 1N05A 1J0EA 1PKXA 4KTVE 2Q6OA 4PBRA 3TQFA 3VR3D 1G5QA 2XXAA 2YC4C 3HYLA 3KTAA 5AICA 3WZLA 4LGYA 1QVWA 3VC7A 4GU5A 1B3RA 4G2TA 4XOTA 3T3EA 3B1WA 3KZKA 3M4YA 4KJZA 3HJGA 5BMVF 4JEIA 4H1VA 1JHYA 3M4NA 3GHHA 4LXIA 3WR5A 4RPCA 4NYJR 3EBOA 3GJXC 4WUVA 2H2FA 1EXDA 3D2AA 3SFTA 2XNKA 3DZBA 2CKDA 1YKGA 3OE7A 2R00A 4H15A 3EVDA 1NU6A 1QAOA 4MW9A 1AUPA 1VB5A 3BL5A 1X77A 1CBUA 1G3RA 3JVVA 4S0XA 1X8LA 3L7JA 1NGSA 2P62A 1JDBB 4RDHA 2YVUA 3RBXA 2YFHA 2Z58A 1V3TA 2EX0A 3E0XA 2OG2A 4CMEC 5FAXA 1C3JA 2Q5FA 4LE1A 3LPDA 1BMTA 1H4TA 4OQEA 5JHHB 2AVDA 4U2DA 3JQ8A 2I2CA 5ALSA 4DJEC 4HUTA 4HDKA 1PHRA 3IBFA 3R6DA 1BQ4A 4GKJB 1H3FA 4MVJA 4XR4A 4BFLA 4MRVA 9GPBA 3RHFA 1E89A 1V1JA 3EGDB 3K7EA 3CYFA 1BD4A 2C03A 4ANFA 1N0VC 1JQDA 2IKQA 4AXBA 3HVRA 4JMPA 1PYOA 3Q3AA 2Q1YA 4TMVA 3IESA 4PICA 6AT1A 2O8FA 4LYEA 3GUUA 4JT2A 5JZVA 3SKBA 4AULA 1OX4A 2VPWA 4PO9A 2XKKA 5CFZA 1QYDA 4IS3A 3JAWA 4K87A 3ZW7A 1LY1A 4A82A 4CGZA 5KQLA 3HDHA 3ICCA 3AUAA 4L95C 3FROA 2H2WA 2C5SA 2ZL6A 1P0PA 4NKRA 3MWYW 1PD1A 3QUBA 1XTZA 5KTMA 1RFLA 2FFQA 1D8AA 3D2BA 1O4VA 5FTNA 1SAYA 3EBLA 5AHOA 2BGUA 5DSTA 1PL7A 1ULBA 1E1RD 4ND8A 1CUWA 4FNMA 3BH0A 4I9GA 4PBSA 4Z9FA 3G89A 4V3CA 3ZU3A 1G17A 4YAKA 3V1LA 4CRWB 4C4PA 2AVNA 2B4YA 2JI6A 2VP6A 2RHMA 3HU2A 4GXTA 5FPTA 4B2PA 3LZCA 4D9BA 4EFDA 2F6RA 5FPQA 2GZAA 4BMNA 4X1OA 2VT6A 1UZUA 1OIVA 4G25A 2C7GA 4RSHA 4EG5A 1AQNA 1R7RA 3KBBA 4I8IA 1PF7E 1UQRA 4RY0A 4NK5A 4WD3A 3FTPA 3NWBA 4OD0A 1YJAA 5ALXA 1FJXA 1E9EA 5IM4A 4JP8A 1DXOA 3PD7A 4KXWA 5FWXB 4MB2A 2ZOSA 4Q7MB 2W2MA 4TXJA 4JBLA 5M34A 3AF5A 2HWYA 3AX6A 4JVMA 5IXSA 3LVQE 1GLVA 1KAHA 3ZWKA 3CRMA 2QAJA 4CQLB 3DA8A 4C6TA 4D5GA 2FQXA 1WP6A 2FWBA 4IDAA 4O4LF 4S2EA 3GMTA 5KNBH 2PCJA 2VCEA 2M6LA 2JI8A 3FNEA 5DE3A 2ERYA 3R0QA 3O95A 3Q41A 4R81A 5D85A 1B23P 2V9ZA 3PA8A 2OLKA 1DDIA 1N1DA 2W2KA 3D8UA 1FNDA 1TRKA 2YDYA 2ZSKA 3DAYA 3IQWA 3R0IA 4PINA 3OTHA 1OV4A 2GVNA 3L5OA 2WY2D 3U1TA 1KA9H 4NBNA 3ZCPA 1YONA 3DHVA 1GQOA 5F2KA 3KQOA 4RSRA 4ZGBA 2FEKA 4WZBB 1XN1A 4JUFA 3NPAA 3II6X 2Z30A 1ZLXA 1S1MA 2GZMA 3G2LA 3QE4A 4PGMA 4PSUA 3EXAA 3N2YA 4Q3OA 3WMFA 4I5EA 3ZI7A 1RPNA 2GEDA 3DBVO 2ZZGA 2FSPA 3HDVA 1NI4B 1SWWA 1X39A 3KR0A 5GJBA 3PX7A 4PU0A 3U56A 3QYJA 2IPLA 4PE5B 4WVFA 1V6AA 1AK2A 3K05A 4UAJA 1U6JA 1O94D 4X66B 1PQWA 3RKUA 3I5XA 2DPYA 4O1MA 3JU4A 1K9SA 1KPHA 4CUJA 3QE3A 1C4OA 1WNTA 2AEFA 2ZBRA 1T35A 5BNIA 3MLBA 3ZDZB 3Q5EA 2ORED 2AN1A 1EXMA 1X2BA 3DDNA 1VBFA 1H1LA 2GWRA 3LPNA 1M1YB 2OBMA 2QX6A 3KPJA 1AG9A 1M3SA 1XFDA 3HFSA 3QXJA 3QVTA 3R6WA 1JDBC 3IC5A 5IYNA 1WAMA 3PR1A 4FE4A 5LL6P 1MEEA 1GPMA 2B34A 3L49A 1HYQA 3OEHD 3RF6A 1V2GA 4MIEA 5AQ1A 5JV5A 1W7AA 2NU6A 3KOXA 4KACA 4KPUB 1IRIA 4NEQA 1GQYA 1KI2A 2OUIA 2QLTA 1HE2A 1KL7A 1RS0A 2X4IA 2GAAA 3D0RA 3LE8A 4WIAA 3ZX4A 4G23A 3ZHRA 1M0EA 3ZZTA 1FFSA 3O21A 1EM8B 2BEWB 3H4IA 1APBA 1WHSA 2OECA 4IMPA 4OJMX 5AK0A 2YHIB 3G85A 4UU7A 3KBOA 4IO1A 1GPKA 3DDSA 3TNJA 3T99A 2RAVA 2HSJA 2WVAA 4CR6A 4DR5B 1DAPA 1R9NA 5KCZA 4INPA 3HVUA 1QFYA 3OTWA 1CR0A 1FSGA 1RJGA 2ZRBA 5D01A 5FF9A 2DUMA 2VBSA 1M74A 3VNUA 3VHXB 4QKQA 3VNVA 1O77A 5BSGA 4TXMA 2QG4A 1ZN9A 3TQIA 1QHFA 5FI3A 4AP5A 1JKJB 4MV1A 1SUSA 1RIFA 3DOOA 3CU5A 4RVUA 4C2BA 2W00A 4WOJA 1BPLA 4ZT4A 3CRZA 3PXGA 3I45A 1V2HE 2O48X 4QEKA 5L3QB 2BF7A 4BTVA 5BQPA 2QE6A 1HTTA 2XRYA 1RKXA 1YJWB 2YX1A 4OPSA 5EZQA 1YE3A 4IQFA 1YB7A 4M4SA 1G9SA 2C3OA 2H4WA 3EEIA 4KXXA 3IMFA 1KI6A 1GP2A 4DM7A 3KUDA 4TTRA 1UPCA 5UKDA 4DLLA 2DT5A 5G3ZA 4LIPD 1VSQA 4OAOA 3W6PA 4BU0A 1BKSB 3O3OB 3N8NA 1XT6A 3K2BA 3QQ5A 1ZL2A 2IGTA 3IUEA 4J43A 5BSRA 2CHQA 3IXLA 3L0DA 4MNTA 1LRJA 2ET6A 3TBKA 4AAYA 3K92A 4E03A 1IAQA 2YY5A 4ROTA 2XWJI 2E89A 5A04A 2H2GA 2FVXA 3TZHA 1C2TA 4IAOA 4UD2A 5BVHB 5F77A 3RGWS 3URMA 3KAPA 2WIJA 1CB7A 1RXSA 2UZ1B 4RKQA 2PNJA 4YXWD 2QQFA 4C9BA 2R4TA 1LWNA 2DWCA 3PEEA 3EYWA 1UK6A 4EUNA 2PKXA 2XWSA 3DDYA 4QOHA 4R0MA 2PRJA 1AF4A 2NADA 3I0ZA 1DQPA 1AUQA 1HE4A 3DPSA 1QIHA 3FE2A 4KQHA 4L6CA 1GEEA 1N5RA 2IHBA 3AVQA 5A9TA 3KE8A 3LGAA 4ZGGA 2XF8A 1IN8A 3RABA 3I01M 4V2IA 1ISFA 4JLBA 4R8KA 3JWPA 4ZEWA 3LLUA 4KUEA 3AHGA 4M1SA 4XDGA 1U2DA 4BNWA 1G3IA 1JU4A 3C16C 4B3RB 1H05A 3AF0A 3K9WA 3MWFA 4DYDA 5HWSA 3A3OA 1EQAA 1TM3E 1JHOA 3HB9A 5AVRA 2CVZA 3UGTA 3OZSA 3CXUA 3G0OA 2L42A 2Q21A 4IH4A 2NPFA 1O94A 3AMVA 3CRW1 4ZVLA 4X44A 2VJQA 4MXDA 2GD1O 2PGOA 4RLHA 1CVRA 4NCHA 3RRYA 1Z7WA 1Z29A 4QJ5A 1BQEA 1T9BA 3BXXA 3I6IA 4WBNB 1OHHD 3ENZA 3LC2O 3TUZC 2XB4A 4LY9A 1LWOA 4RTRA 3K5HA 2PWZA 4BB5A 4TMXA 4KI7A 2Z8ZA 4OHUA 1X3SA 4FJ2A 4GBJA 2H1LA 2H3EA 3AWDA 4D0GA 2ZYIA 4NDAA 1T34A 4NRDA 2AMFA 2EWWA 4CDGA 1X7YB 3CJQA 4KLAA 1N6HA 1LK5A 2DFPA 4UUBA 1QVAA 1H6DA 2Z1MA 1LC3A 1ZZEA 5KOHA 1WUIS 2J08A 2Q5OA 2CD9A 1GLNA 2HA3A 3FVRA 3LDFA 4QJIA 5BWOA 4TYQA 3MWEA 1S4MA 1OIWA 2GCOA 2YIVX 4GOOD 1XYGA 1VJ1A 3A9VA 3CGGA 3FX2A 1QVZA 1JJVA 5E8JA 3UUFA 4F1KA 4YRNA 1EM6A 4N5MA 5DNWA 4EI2A 4F4JA 2CJXA 1N3BA 121PA 2PWPA 2G5PA 1G8GA 1XNJA 3ELBA 3EIOA 1ORVA 3OEWA 3MCZA 4FHGA 4ZAYA 5FBKA 3TNLA 1OF1A 3UGKA 5ED0A 4XSHA 2VAPA 1UBHS 3W5UA 1PZEA 3ANLA 3F1KA 3QXCA 4PAWA 1KS2A 4ZCQA 4ZYYA 1HLDA 1NI4A 4FP9A 4JYMA 3HM2A 1T3HA 4H6WA 2PLRA 3HWRA 4AY3A 2JGMA 3RIMA 5BSXA 1Y4DE 1GAJA 3D1JA 2PKCA 1RD4A 3KV1A 3MRVA 5JT1A 4P9SA 1ENYA 4GF5A 4BZPA 5K0TA 4PY2A 2JGDB 4E5KA 3PQ6A 1YVRA 3K35A 3B3FA 1LPNA 3PXXA 5IXYA 1J1UA 1QH0A 1CIVA 1W5EA 3BIFA 2ZSEA 4B4VA 4ESVA 1VP3A 1IIRA 3D3NA 2O4UX 2RJOA 3JQGA 3KWLA 3MJEA 3T7SA 1DWQA 2O57A 2AJLI 3E9ZA 3GR6A 2WSSA 1R12A 2E2WA 4FD2A 6Q21A 5FUMA 1KMQA 4ME6A 3WHPA 5JCZA 3IV6A 4UBNA 3IOYA 2BRUC 1G291 2NV4A 4EGCB 1U2PA 1AC5A 2NOAA 1OT5A 1Z56C 4IFTA 3GG9A 5J59A 4CCYB 4YUYA 5CJPA 3NOXA 4DUPA 4ITRC 3ZWNA 2IYQA 4WLVA 3SLRA 2FZWA 5FV4A 1PNRA 4JNCA 4FMCB 3SFZA 1F4LA 4M0DA 3RC1A 3SK0A 4AYWA 3QVOA 1REQB 2HHAA 3KSBC 3TM5A 4DR3B 1KEZA 2LPMA 1NYQA 4TVSA 3VSBA 2WYVA 1I1NA 3AQIA 4J0GA 5K3BA 2O8CA 1E9BA 1RXWA 1RWQA 3GLSA 4CKBB 4MA4A 5I48A 2AJDA 1V8PA 2QXYA 4RAOA 3LHIA 5AM4A 5D7NA 2YXLA 5E3IA 4DSNA 3SN6A 3ZDYB 4ZAXA 4CG3A 2FPLA 3TG2A 1W5TA 1G5HA 3TW6A 1V7PC 1C7ZA 3BHIA 3E5MA 5BV8A 1L7XA 1QF6A 4H27A 4ZO9A 1DWPA 5B57C 3R5TA 2PUDA 3V3TA 1J07A 2FF5A 5LZ4A 3QVLA 2JLXA 1V8FA 1U2QA 2QM7A 3IUNA 1NR7A 2WYHA 3EF0A 4M9SA 1WCV1 4LMAA 3IL2A 4BLPA 2PLWA 3W2GA 2Z43A 4HNUA 1C3EA 4LYAA 3MYRA 5DVZA 5FTKA 3BFXA 2QMZA 3HDQA 3U3RA 3E8SA 3QU5A 2J41A 3G2JA 4IJMA 2QVGA 2ZVQX 3STUA 4JUAA 4KVAA 1EVYA 3O0TA 1XDWA 5LLDA 1VQOB 5D3QA 4LRSB 3W5IA 2E55A 5DP2A 2EF1A 1RXYA 3GLRA 2OHIA 3LP5A 1MLDA 5GINE 5DEIA 3BWDD 4J2HA 4ND7A 3K0KA 4I08A 1QYIA 1SD1A 4X1KA 1VGQA 4F6CA 3PLAE 3RFXA 3TW8B 4E2ZA 3GLFE 3E3MA 3KP1A 2WIDA 3BH4A 1SIWA 1GVHA 4H2DA 4LHXA 3U7FB 1UDXA 4D92A 4TL9A 5HYVA 2UUPA 5F1KA 4EDHA 4DMRA 4JUCA 1KTIA 3F0TA 1KQFA 1ADFA 1SVUA 1OAOA 2YJ4A 3A9CA 2IV7A 3RYFA 3LUFA 5E6UB 4NZMA 1AO0A 4L8JA 3D4OA 4C5BA 3HBFA 5TMDA 5J40A 3NATA 4M55A 2Q6TA 1H9AA 3RFFA 3TL2A 5CD1A 4RPBA 2BFBB 2DTDA 4XCQA 5HKLA 4BTLA 5GP1A 2X7XA 3IJEB 1X8KA 1SQSA 1ONOA 2X15A 3D0QA 1JVSA 4WKOA 4MQ5A 2QGZA 2YQ4A 1GUZA 2YZGA 3FYDA 1U2TA 3GEDA 2FZVA 1RYMA 3IODA 3MB5A 2PIAA 2E48A 3M3HA 1F8UA 4UCWA 2KBFA 1QK5A 4HAUA 3TIFA 1LDNA 2BE7A 2FPGA 4LVUA 1P81A 5FYQA 3GJSA 4NY1A 2PMKA 5CM2Z 1ARZA 4ENVA 1I10A 4LAFA 1M6HA 3F8TA 1ZGCA 3LBNA 1OLSA 1C14A 4EG7A 5KHAA 1GPUA 3ZBQA 2ZCUA 3A37A 3LW8A 3KQMA 4DNFA 1I94B 2XDYA 4UMVA 3QPWA 2X8KA 2A9KA 2NNLD 1A5BB 3GBVA 3TZEA 1DHRA 5CDGA 3E3NA 3H1EA 3HU5A 3IEXA 1ZM2A 1BKDR 1NXSA 3QKTA 1FLAA 4PLPA 2YWFA 5D51S 1IXSB 3AUTA 4OSPA 3RI3A 3TIVA 4DIEA 4CT5A 5FR2A 3CP8A 2E5FA 2WSIA 3FRHA 5AW7A 2PANA 3ESCA 5K6AA 1AMNA 1C4WA 4B73A 1NR5A 4WZTA 5DTRA 1V26A 2QBYB 5LQNA 2GNPA 2HWXA 3IR6A 3VNSA 4EYGA 3A6ZA 2PTGA 3NI2A 2FHSA 4DZZA 2OBFA 2GWHA 4HQFA 4TPKA 5E2AA 2FR0A 5G0VA 5H3LA 1BVYF 4UMFA 1Z37A 3NKVA 2R8ZA 3R7BA 1EUQA 3HDJA 5L46A 1RU3A 2Q1WA 3I3SR 4YJGA 3NUGA 4MULA 5HQJA 1L8QA 2EWMA 2EYUA 4E51A 1PR0A 1QX3A 1Z8DA 5CEEA 4GP7A 1NW3A 4HN4B 2DU8A 4TRNA 3NT5A 5CT4A 1TVCA 1A7KA 3BSYA 4P08A 1JQLB 4PGAA 3M70A 2FR1A 2PUHA 5TLSA 2EU8A 3U7QA 3K6RA 3NEAA 3L79A 4K26A 3VO8A 2Z09A 3WGLA 1W48A 3EQ7A 4B6FA 4BKMA 2WK1A 2HLPA 1SURA 3KJQA 1HH4A 1G8SA 1CUCA 1SUPA 3TTUA 1S4QA 2WKWA 1CUVA 1P19A 1W6RA 2NAFA 2UYGA 2NV0A 4BS9A 3IDAA 1IN5A 4P2BA 5BPHA 3EDMA 4O2AA 3UC9A 3GXOA 3ROMA 5E0OA 5JDIA 4OFWA 4DM4A 3HP7A 1OXXK 3ASQA 1M0TA 1SEPA 5FUBA 2JFUA 2FQQA 4QTXA 2FEMA 3DHNA 4J0CA 3ZQ6A 3EJWA 3ONYA 4JBHA 3T34A 4FGJA 5IVDA 3V7FA 1CUJA 3SS7X 4UQLA 1MFZA 2BISA 2J30A 1XZAA 4N8SA 5CVUA 5KJEA 1IVSA 1ZVMA 2FSVC 1ZITA 2I71A 4YRTA 3O1LA 1G8MA 1XD8A 1EUYA 3CXCB 3DOJA 4M49A 4GRIA 4CCSA 4RS3A 1ZD3A 4XLZA 3S70A 4QEDA 5JJKA 4D9GA 2BKLA 1MAUA 2FUEA 3ID6C 1II0A 2Q3LA 4WN3A 3OEHA 4JVSB 3WGIA 2IBSA 3LXUX 4PTLA 4DG8A 5C8VA 2ZKIA 1ZJJA 1IHPA 1DV1A 4PRLA 1U98A 3LUPA 1F8YA 4GMFA 2DFVA 2Q1SA 3WISA 3B8EA 3W8NA 1NC3A 1E61A 1C0KA 4GPZA 2J07A 2QS9A 4DJ5X 4ZOLB 1NWHA 4OH1A 3OCCA 5KOJA 4JR2A 4E12A 3JZDA 3ZXUB 1Z8HA 5C7OO 1JHAA 1AB5A 1GILA 1D7AA 2WHYA 1MDBA 4QU9A 3U09A 2JIBA 3BF8A 2GT1A 4XX0A 1SCBA 1GL7A 2JL1A 1T4BA 1XVIA 2BKUA 2G08A 4G0OA 5AKJA 1RXUA 4DANA 4E31A 5FAKA 2A7QA 4FONA 1O9HA 1MOSA 5JANA 3HEBA 2IYSA 3R3HA 1CY4A 1Q3TA 3VDMA 1FQOA 3ZWDA 4N3GA 3K20A 1TUGA 4OREX 1NYRA 2BMDA 5A1TA 4U5XA 2JAHA 1V4VA 1FFXB 3FM9A 3WIBA 5KPJA 5ADHA 4UDYX 3D02A 3K9GA 3JD2A 1Z7BA 4HQOA 7REQA 4C0HA 3O4HA 1IWOA 1IBRA 4IIXA 5K51A 5FA6A 2O8DA 3A6FA 4DQXA 4TWJA 1NSYA 4M1YA 2HYDA 3H6GA 5ALYA 1RJDA 1PDVA 2AG5A 4D4HA 4HAIA 4IH1A 4ENUA 1QYCA 4XL9A 3KO8A 1PS8A 5B6PA 3IVGA 1MVOA 4CKCB 1PJCA 4P9NA 3LYAA 1NUUA 3OQ6A 1I33A 4NF2A 2M5SA 3QMWA 4DQKA 3W5SA 4AUNA 4ZFNA 2QU7A 1XZDA 2WF7A 1IH8A 3G1WA 1KSHA 1WDKA 1F6BA 1YL7A 1QTRA 2J0UB 2BJWA 5TR9A 1I2MA 1RM5A 2DF8A 2DPHA 3QKRB 1D09A 5KDLA 1WPXA 3ZU6A 3ZLVA 4KQ1A 4AN4A 4E2YA 1U0BB 4AY5A 1RQXA 2YJZA 2H4YA 2B4QA 3FKSA 1TNDA 1VFPA 3HB0A 4CUZA 3TG8A 4B84A 3DLBA 3OJLA 1TYEB 2OBBA 3NWOA 1TM2A 3LCRA 4HNQA 3TR6A 1MRSA 3FPSA 4QBHA 4ZTBA 3T5TA 1ADYA 1TCAA 2GM4A 4IIJF 2XUDA 4FCCA 3VKWA 5A4KA 5JR3A 1NRXA 1W0JA 4K6KA 2R1ZA 2YWEA 1U8CB 1I9CA 4IG4A 4WZAE 2HXGA 5TS2A 2IS6A 2R6JA 4PCAA 1LZLA 1I5RA 1UKCA 2FKAA 2WT9A 2ZAGA 5K3SA 4Z4CA 3Q85A 3GFGA 1VA5A 4KBGA 1Z4LA 2CLSA 1XMSA 1DDGA 1QUFA 1GDDA 2DBZA 3IV7A 1Q2UA 3CXRA 3GMIA 3MWLA 1WEKA 3UMRA 5TQVA 4B8ZA 4PO8A 3J7AC 4RS4A 2OXIA 3AI2A 2AZTA 1T8UA 4OA8A 3UYKA 5IPFA 2AEEA 4TWBA 2PCLA 2PYIA 3HXTA 3JATA 3K09C 3PDCA 3JRWA 3ICOA 1N9ZA 2EATA 3Q72A 1CDZA 1J2YA 1DLIA 4GE3A 1QC5A 4IIJB 4JY7A 2CLLB 1BMFD 5LQJA 1M34A 1CKEA 1TKAA 2PEZA 1LXCA 1CR6A 3G2PA 2HZBA 1TM5E 1XWIA 2RSLA 3LPMA 4IIEA 5DMHA 5BMOA 4RPDA 1JXOA 1IJKA 1O87A 1OJ7A 1P9NA 2YCBA 3H1TA 3LPLA 4C30A 3SC2A 3FSJX 4R05A 1BU5A 4YJDA 3ZJYA 1WWKA 3MJDA 2O6HA 4IXDA 1XRSB 2DYIA 2HD4A 3AKEA 4QYMA 5DP1A 1UBJS 2BFFA 4Y2XA 1Y5NA 2VPPA 5KYVA 3GDGA 1MU0A 1C0IA 2H1RA 3LT4A 1J97A 1M66A 2IP1A 4P53A 3HAGA 3RT7A 2GEKA 1PS0A 4L27A 5JDCA 2ZSDA 2WP0A 4QBTA 1G42A 4DDUA 1JJ7A 4G24A 4XH9B 3H4VA 1FTSA 4X95A 4FU0A 1ORTA 2OC4A 3N6RA 5J1SB 3NE5B 2JLCA 3AW9A 1UKEA 2B7BA 2FSUA 5JH7A 1S7CA 4W5NA 3CCMB 4GLFA 3O31A 2IS1A 2YHBA 1N1MA 4EFLA 1A2BA 4EKGA 3FFAA 1J33A 4WNYA 2Z3WA 2JIOA 2WBLC 3A4IA 1UANA 5TY0A 1N25A 4TSRA 2AEMA 4WBNA 3WJAA 5DNUA 4GL2A 2RIPA 2QPOA 2ZUTA 2JZCA 2HT6A 2MTBA 2VWHA 5IVIA 5KTOA 2Z98A 4HDRB 1N8RD 3ZQUA 2C8KA 1EP9A 2I2BA 1NXPA 3A1NA 4MK4A 2QW8A 1HDIA 2X8BA 4HQNA 1XL1A 1TZMA 1FRQA 2IOQA 3AEXA 2X77A 3OPXA 4AK9A 1XZFA 4NE9A 1Z4MA 3QX7A 4HXGA 4NFHA 3V9AA 3T1HB 2NXEA 4PWZA 3CKLA 2GZHA 3UXMA 5ALJA 3LX8A 3ME5A 2B99A 4Y2YA 2C2WA 1UDCA 2C2BA 4F4IA 1FRFS 3REQB 1BDIA 5HKBA 4I14A 1V4NA 2Z08A 1DEXA 3OO1A 4H7IA 1GUFA 2J6CA 1PL6A 3BDAA 4FBMA 1F1BA 4MVJF 4OKIA 2JAWA 3OZXA 1LW7A 4Z8YA 1LJUA 4AVZA 4ZI5A 3FCYA 2PUWA 4ZOLF 1VG1A 1RM3A 5FNZA 5K2OA 1E3XA 4CMKA 4MYHA 1GPAA 3WG9A 1HEYA 1LVUA 1SVNA 2ATXA 1WSVA 3Q6NA 3A6LA 3D4BA 4K3VA 3BL8A 3CT6A 5C1IA 4BL5A 2PQMA 4HAWA 1DIHA 3DE2X 4H08A 5AVSA 1YDMA 4F2GA 5JZ9A 3Q2IA 1GA4A 4P6YA 4QASA 4EHKA 2JA2A 4FFMA 3U1VA 5AI6A 1C0LA 2B4AA 4LSWA 1OH5A 1OBHA 4XM2A 3TIGA 3TNYA 2VYVD 3HADA 1M73E 1GTSA 2XQGA 4MPPA 1N6IA 4XN3A 3EIWA 2VJBA 4TN5A 3S99A 4DKJA 1TLLA 4BGUA 1P1RA 3GLGB 1YL6A 4LFAB 5CVCA 2IY8A 4V0MA 3QFCA 1UK8A 3MGBA 4R16A 4LQLA 5AQEA 4X05A 3UATA 2JCVA 3O73A 3V1NA 3PFHA 2A1IA 1JQ5A 1OKKD 1RNLA 3TRJA 2IOFK 2DBQA 4QXMA 2JKZA 4NPAA 3OQBA 5IEBA 2YYSA 5KCMA 4C3VA 1H9CA 3OPMA 4YR7A 4EH1A 5T4BA 3HY6A 3ZJUA 1RDFA 1AB6A 3FLMA 2ABWA 5BR8B 5EYPA 2VPXA 1CFJA 1D5WA 2MSDB 4H9GA 3GMSA 4WZZA 3ZG6A 4HB4A 4ZREA 3TW4A 3DOUA 1SC9A 1BDJA 2OHVA 4U7HA 4WACA 2L69A 2ZRAA 1K89A 4BEJA 1ZQ9A 2C7OA 4QV2A 1COWD 1MG0A 4LDNA 3INYA 2WJZB 3EA0A 2YS7A 3MNFA 1KOFA 1TGYA 3FNBA 1QV9A 4U63A 4BO8A 4BTEA 5CG1A 2FRXA 5C1BA 3U2QA 1A7AA 2PEYA 3EFOA 3KAQA 5H3HA 2IYUA 1Z2EA 3DJYA 4QREA 4D4KA 3T3NA 1I3NA 4MPRA 3JYQA 4MV0A 2IUYA 2WP8J 5KYUA 3B1KA 1J4AA 2BEUA 3HZRA 4DNQA 2DH6A 4E11A 4L28A 3DMDA 1A9XB 2IVZA 2NTNA 3FZEA 3QY9A 3C5HA 2GJPA 2I7CA 1N7HA 3VZBA 4XR9A 3UK6A 4CF5A 1EBBA 3T1YB 1QHXA 1QOZA 3LTNC 2O3UA 2QOEA 2ZR0A 2GZ2A 1CTQA 2LV8A 3DHYA 5H81A 3CISA 3IQHX 4GLJA 4RVSA 2GRUA 4RPHA 1U3GA 4RHCA 2VTKA 3E22B 5FHRA 3OX3A 3F9IA 1U3FA 4J4BA 1ZGHA 4Y2RA 2E85A 3FD8A 1FJ2A 2D0OB 3L7BA 2CNWD 4ETMA 1Z0SA 4GOKA 1DX6A 1T8RA 4MAMA 2DQKA 2FZKA 3PI7A 4KW7A 4MQBA 1BN7A 4V1CA 1T2VA 4MWCA 3QEKA 1ESZA 5L40A 3BDIA 1K3TA 4DL9A 3OQIA 1Y3BE 4ERNA 1K8QA 3AR9A 3ESYA 1UDRA 2BKXA 1J90A 3OU6A 4GUAA 1Z75A 2G0AA 1FU4A 5GIOE 4QUGA 2Y67A 2XUZA 1F17A 3SEAA 2V7BA 3HJAA 1E6WA 2FZ5A 1BX1A 3OTIA 4MWTA 1Z6GA 2GK7A 1QCZA 3KJFA 1U7HA 4QO8A 2KWIA 5JSKA 4YRAA 2VLIA 1TU0A 2YIJA 3QUTA 4WKNA 5EQTA 4CL2A 3K16A 3T38A 1YS9A 4H3VA 2WJHA 5DRTA 3SE0A 3MTIA 4CL3A 1Z9BA 3U19A 3HCRA 1OAAA 1T2DA 3NFYA 4JT4A 3MS4A 3VH4A 1K27A 2GF0A 2QTCA 3BEOA 1THMA 2CVQA 4NZPA 4DA7A 2PSSA 1Z6XA 5LD2B 2I7DA 2Y1XA 1SHLA 2HDWA 1QPGA 2OCYC 2Z9DA 3R20A 4IIFA 3TOCA 2ZJ5A 5C80A 3CCBA 2RJNA 1E2NA 1WOPA 1FFDA 1GNSA 2DERA 4R7ZA 5CLHA 3DT6A 1G6Q1 3SJUA 3VU9A 2JGRA 1WIWA 1X7HA 2ZATA 3ABOB 3H2JA 4A92A 2Q46A 3P27A 1XAJA 3NOOA 4N82A 4I4LA 4RF3A 3PIRA 4CEHB 4YP6A 3LAWA 4GZ6A 4X9XA 2F9FA 3OCVA 5JADA 4KTTE 1A77A 1VKJA 2JIQA 2A5YB 2LWIA 3ZOKA 2AW5A 4HH1A 2ECOA 2P90A 3ELDA 4BCCA 4OB6A 2WIAA 5HZBA 4CM9D 4NAHA 3DR5A 3DTVD 3W4IA 1YVUA 5CNJA 4YWHA 5JSYA 3LCVB 3BM5A 1UMDA 5ALTA 1TVKA 2IHJA 2J45A 1KEKA 2DWPA 1C3OA 5EUQB 3LZ6A 4S12A 3SQNA 3MA0A 4MJLA 1OA1A 3QYAA 4OBBA 2C5BA 3W0LB 1U63A 4YYEA 1R9MA 5JNTA 3AF1A 3DDCA 3WJ2A 1FFHA 4RV5A 4FN4A 1XC7A 3B53X 4RQAA 3WGGA 4J0JA 4DRYA 1HDEA 4WCFA 2V7EA 1PGPA 3A6GA 3IIJA 4MWDA 4YQYA 4DDHA 2CMKA 4KYUA 1HGXA 1F9AA 1RZVA 2WE8A 3KC2A 1KJ9A 3DDOA 2RH5A 3K4PA 1WXEA 4L2IB 1UXJA 3UQYS 2WQ6A 2C1ZA 3ASUA 4II2A 2PS9A 1GNLA 3PQEA 4LHWA 1F8XA 1J99A 3BG5A 4P3NA 1ZSVA 1LNSA 2ZIAA 2P41A 3CR3C 3HJTA 5FADA 1A8HA 4ZT2A 5JXGA 4M2LA 1E9VA 3DO5A 3K32A 4XQEA 3ZK9A 5J3JA 4EUSA 4EQ6A 5LSAA 1MT0A 3FTNA 1W87A 3UO8B 2W2PA 3VPBA 2QA4B 1RVDA 2X1VA 2Z3VA 5HF5A 421PA 4PLWA 5AVUA 4D56A 1EGQA 1U28C 1CUSA 2J9RA 3KM0A 4HNTA 1VHJA 2UUCB 3R9XA 2E3JA 1MNQA 1U0NA 1I13A 1YZ3A 2HLDA 3EFOB 1GYPA 4PZZA 4U7FA 4ZVNA 3P9SA 1M8GA 3N2GB 4MUBA 5JSUA 1P9WA 4IGIA 3PEYA 8AT1A 1PUXA 5CXXA 1G3MA 2V5VA 1R0WA 1E1QD 2Z8YM 3W3AA 1P1KA 4H6VA 5JH7F 2YWJA 2CXNA 3DNPA 4GL4A 4RJLA 2BFDA 1II8A 2WSYB 3L6CA 4FLMA 1ULHA 4PGHA 1E66A 2H1FA 2J31A 3EXFA 5CX1B 5FV7A 1UZAA 1SBIA 1HKUA 1T8YA 2NVOA 2RHDA 4YO8A 3A3GA 1I5OA 1W5AA 1ZGZA 4KYIB 2PZGA 3ANXA 4D25A 4OGLA 1VE1A 2W0SA 4E70A 2VWPA 2D1TA 2UZ0A 4I5GA 1RYNA 1VPLA 1P7WA 3H42B 1QXSA 3ICVA 3OP1A 4G41A 4N3AA 3RLIA 2PPLA 4HGOA 3MN1A 2H7YA 2RGGA 3AHFA 4J1NA 5AOAA 4A9AA 3KKKA 2QF7A 3V4PB 2HU5A 2AMLA 3R9KA 2YH2A 2CXQA 3HNPA 1K8ZB 2BZSA 5EJ4A 1XKLA 1Y0BA 3TSAA 1F8GA 4GO1A 3I9LA 5AW4A 1NVVR 4JA0A 3F8SA 4YWJA 4N03A 1EK6A 1OZFA 5LP6F 3H2ZA 4I81A 5KNDH 2JANA 3T3DA 1NAIA 1L7EA 1VCOA 5KWVA 2FOLA 4WHMA 4JWKA 3KQSA 2PKQO 1NB9A 4OJYA 2IQIA 1VB3A 1L5GB 2IHVA 2DLNA 2ZCVA 5ITSA 2Q4TA 3V00A 1JH9A 2RK6A 3L8MA 1KDRA 1O03A 1FSSA 3SQDA 2AG6A 5JXHA 1IY2A 2PMEA 5ICSA 3AIOA 4GM4A 4H0FA 3CLSD 1WTHD 3UMVA 4ABYA 2ZE6A 4EGJA 1Z6YA 4H1UA 1D4ZA 1NN1A 2Z1NA 1JF8A 4M83A 3HLTA 3NHWA 4UUQA 4Z3DA 1G1AA 1HOXA 3G49A 1QP4A 1EZZA 1T2EA 2HMUA 2Y68A 5LXTF 3L06A 4WFIA 2IH5A 2HMWA 5BQFA 1DADA 1BEEA 2RHTA 3LCCA 4L73A 1KH1A 4A26A 1UKYA 3HP4A 3MJTA 2QAGC 1EVLA 1XD2B 2SKDA 3C43A 3FUUA 4IVNA 1HT3A 1PO7A 2Y76A 4YJ3A 4Z9AA 2D6FA 4MJXA 4UM5A 1XOIA 1EWRA 1NDQA 1NZFA 3ZD8A 4IRMA 1P18A 2GKGA 4U9UA 5L6MB 1MQAA 1G8AA 2R8EA 3DT8A 5KHOC 3DH0A 1NW9B 3WADA 4HUQA 2OILA 3NO4A 2MSCB 4P34A 4YT4A 3GA7A 5A4MS 2GN4A 3WLMA 4LX0A 4WKBA 4B74A 4NK4A 1JB1A 1RRVA 1Y81A 4PLFA 4ZYWA 3N8KA 3OFKA 5JD5A 2P4HX 3W2HA 4URFA 3I2HA 1DAGA 4GD3Q 4QT4A 1X1AA 3RODA 2GUWA 2X42A 4LZNA 1IM2A 1T6ZA 3AJEA 3J7TA 2HQSA 5LR6A 1MGPA 1SZJG 1U8YA 4NU6A 1CF9A 1NJ5A 2NNWB 4PZUA 5EXTA 4AQYB 3WV5A 3PVZA 5E1BA 1P74A 1AM4D 2D2EA 2C95A 3UC5A 1JEQB 3WLTA 2F1HA 1PI3A 1SOUA 2IOYA 1P0QA 1EXVA 521PA 1KZLA 3RO7A 3LQQA 3V9PA 1ISIA 3IOMA 4AECA 3VKHA 2O4CA 2RGUA 2W2LD 3D6MA 3Q3HA 4TKVB 3P5BA 4EO4A 1ONBA 1U2EA 1EZ4A 3OZDA 1AN9A 1HRKA 3RKRA 1FDTA 1BE6A 4DC0A 3AJAA 3OA0A 2XBMA 1YHNA 1BCSA 1FDRA 3FKQA 2HDNB 3M2TA 5KDOA 4KC0A 4KXQA 5FBRB 3CSDA 3F7MA 4G1MB 1NM5C 2BR3A 3EVBA 2LCQA 3DF7A 1U5CA 3K70C 5IJ9B 4MRMB 2O8EA 3DL0A 2SCUB 1FS6A 1SH7A 3MMSA 2AQHA 3FHCB 4HOYA 2EBWA 2ZSFA 4ALJA 4FB4A 1NJGA 1X1BA 1Y5LA 3ROEA 5AJZA 1U99A 2VHEA 3M6FA 5A7GA 4BJHB 5JCJD 3JAKB 1Q1EA 1NKTA 2G0NA 3WLFA 5JOQA 1U9IA 4HK4A 2JLYA 4KFCA 3M5CA 4AIIA 4CKWB 1VKRA 5I4BA 2JGIA 1AZSC 5TRDA 1NW7A 3MSCA 2KPOA 5J3OA 3ECAA 5FWAA 4G5XA 1QGED 2Q1UA 1IY0A 1WV0A 5HIMA 1QQ7A 2GN8A 4C0QC 4KDFA 5ALKA 1XCGB 4PPQA 2I1QA 4WNCA 3AP1A 4DIMA 3NVAA 3L0OA 4DRZA 4XGRA 4HRYA 1SQGA 1UOEA 4A10A 2RC6A 5U1PA 1XA0A 3UY4A 1EDEA 4F2PA 5T5QA 4FWIB 1DEKA 1L5ZA 4X1IB 3L0ZA 1M2KA 5AVQA 5JWOA 1RAHA 4JJKA 3T1OA 1DARA 4DUZB 3K73O 4ZOQI 3TQTA 5C8YB 2C8VA 1C7QA 2O05A 4V0KA 4K9OA 2P68A 5DOVA 3TMYA 2Y1LA 3NM4A 3O2NA 4WCDA 1FUKA 1Z63A 2OB1A 3LF2A 3RW9A 5H16A 1PJ8A 3ZWXA 5A3JA 2FFHA 2HIHA 2ZT6A 5KQRA 5HZGA 4REQA 2C29D 4D8YA 3H7IA 3PXUA 3UTDA 3G82C 4MP3A 5DYGA 1RWWA 1S5PA 2CEKA 3AR7A 3NBXX 2DFDA 3X44A 4YCLA 2HHHB 3BWXA 3KKZA 3PGMA 3WX0A 1VL6A 1J1ZA 2A2ZA 3H8WA 1DZ3A 3GVKA 4GHWA 2GERA 3ZH2A 2WNIA 1NVXQ 3WWYA 4KGZA 2P2ZA 3RC8A 3AETA 2VJDA 4FGLA 1Z13A 3HUTA 3BWEA 4KWIA 4O4LB 4TLDA 4WKGA 4N65A 3F6EX 2VPTA 3PUIA 3HXOA 5E4JA 4H59A 2NU9B 3BDVA 3TCNA 5JD3A 5AHWA 3NZEA 1V11A 5LLTA 1LPPA 4BBJA 4MSUA 3LKVA 4WINA 4ARZB 2HGSA 2X7JA 2QI9F 3E9MA 3NOQA 3M6UA 3A04A 5K0JA 1CUFA 2XUJA 3C5EA 4J4TA 4JU9A 5F4BA 3RARA 5BXQC 4CIYA 2FLWA 4XB1A 2FCAA 3E81A 4U4AA 3O8DA 3ZWYA 4G5QA 4XW2A 5LN1A 5JMPA 5K6RA 2HEGA 2EQ5A 3B38A 4LBYA 3CJTA 5D1HA 5CDHA 5KREA 3L8HA 4MVXA 4PLYA 4NATA 4JJ4A 5IYQA 2CJWB 1YS6A 3FG9A 2Y1DA 3I6ZA 3PDUA 1CE8B 1XE3A 3PRJA 4L8LA 5IAAA 1N0IA 3B3GA 1VJSA 1PTJA 3F3YA 1Y1TA 4OGKA 1GSOA 1YHYA 2J48A 4MPJA 1JIIA 1MXHA 2HRCA 2P5UA 1HVXA 2B21A 3H87A 2XJ9A 4PZYA 2OB2A 4Y1FA 3TVTA 5EIHA 3JQQA 1M2WA 1LS6A 2BI7A 2XZTA 2GH1A 4L8FA 3PTZA 5C4MA 1BRTA 4AWBA 1R15A 1UEXC 4YMGA 3EF1A 1YRYE 1Z4JA 4ER6A 1GRQA 1QHSA 1Z45A 3HKBB 2FPMA 4MX8A 2VUTA 1WBDA 1YH3A 2F00A 2EEPA 1YCFA 2PKYX 1YA6A 2VJCA 3GK3A 5LCXA 3U3DA 1CJVC 3DMHA 2DC1A 3DW3X 4CL0A 4Z4ZA 4XYGA 1Q21A 2AOUB 2PN1A 4IX9A 3Q39A 4MRPA 3UICA 3CMMA 2QM0A 4JYBA 1JQAA 4EUFA 3QPCA 3LO5A 1BS1A 3MLEA 4KQ6A 2DG2A 3OX2A 1DP4A 3QE0A 4PLGA 2J5RA 3BA1A 3HMQA 2W6CX 2D3TA 4Q6WA 2CFCA 2QYOA 1WABA 1V9CA 4L5JA 2X2FA 3DVLA 1S0UA 4M7RA 1SPXA 2PLAA 5J4HA 1IMOA 2O7VA 4HI0E 1V47A 1GL3A 4KYVA 4EEZA 2BDEA 1J09A 3W7BA 1Q0QA 1HYBA 2Z4RA 3DVSX 1HL3A 4ALMA 3T4EA 1MRNA 3NONA 3I61A 2IXEA 4GOLD 4LZJA 2R8OA 4RHFA 3V8NA 1PYDA 5DBGA 3OIUA 2VXBA 3AEQA 3RTAA 3TE6A 1LFAA 4UFPA 3INNA 2PBFA 5IVKA 1NVMB 1QRAA 1GR1A 1LX6A 4ZVUA 1YMQA 1SUBA 2OV1A 3ETNA 4BDTA 1DL5A 1T0JB 2EG9A 2AZXA 5LBTA 2QYHA 1RKUA 4BE4A 1ODCA 4TRJA 2YXDA 1NMQA 2VNIA 4X60A 1G7TA 2PL3A 3T9AA 5JS8A 3EGXB 1DBVO 3WOHA 1QZZA 2H4ZA 2XUKA 1YXMA 1TIKA 4YA6A 4PZEA 2EJWA 2R60A 4MV4A 3FOEC 4KQXA 4UC0A 1P29A 1M1UA 1P7CA 4KKUA 2X0RA 1XQ1A 3DOCA 4I9NA 1SCKA 1YE8A 3SX0A 3I2FA 1QP8A 4HPJB 2ZIUB 2HRRA 1XK7A 2XR1A 5KQGA 1G8PA 1XV5A 2ATIA 4JLPA 4B6RA 1I01A 3F3KA 5F5LA 4ZDKA 4MGHA 4GDFA 3W78A 3UFXA 3C41J 3ZY4A 5AW6A 1JI0A 2AFRA 3K15A 3ASPA 1NQ5A 3CF4A 3OZGA 3USZA 1CQJA 3IERA 4L76A 5AKZA 3ZCTA 4HB0A 1PR9A 2QX4A 3DL4A 3F71A 3HNOA 1J2EA 4NC9A 1YAJA 3WK8A 5TE9A 4L78A 3TL3A 1RWVA 4DIFA 3WDKA 3WV4A 1H22A 3TZLA 1DXQA 5MN6A 3HHPA 1ECLA 1PW5A 5ENZA 2GDZA 5A71A 1UWLA 2YASA 1T1SA 2I8LA 1DXYA 2OO5A 3I30X 4LI0A 4RNCA 4WOBA 2BH9A 2P9ZA 5CP8A 3G2QA 5IW8A 4WVLA 4BQOA 1EB9A 1RQRA 3WGTA 2OV3A 4P92A 4NAUA 1G21E 5B4VA 3VUEA 1V7QA 1UMKA 2X41A 4RKYA 4YELA 1L4YA 5ECWA 2P0AA 2QSUA 4P4UA 1GU0A 1TU4A 1VJDA 1CD5A 1M9NA 5JFOA 2NXNA 2W2OA 1FP2A 4EZIA 5CCBA 4G36A 1VL5A 4BPRA 2RGXA 2AJBA 2QRLA 4M3NA 3KZCA 2QDKA 2LW7A 3VYSB 4M89A 1UD4A 3WNVA 5JVDA 2JAOA 1R4AA 1ZH4A 2ZULA 5EPUA 3UWSA 4YRMA 4TWAA 4Q4AA 1NRKA 1TM7E 4AWAA 1K5GA 3WRYA 1C3LA 4QNNA 2KBEA 3NV7A 5EMLA 4LY0A 4CF7A 5J58A 3AUFA 3PR3A 1A69A 4DIUA 2X9GA 3IR7A 1TTTA 1WLSA 2I7TA 3DCIA 3ETGA 4ZQBA 5C5CA 1L4UA 2AXNA 4BO1A 1R3DA 1OI2A 5BN5B 3V4RA 4JNKA 2JGEA 1J9ZA 2BEVB 2XGOA 1N3LA 2JATA 1EIZA 4N39A 4EGQA 1QYRA 5JAUA 1FSPA 3DONA 1LBEA 3UHPA 5JTUA 2NSYA 1RXCA 1SXJE 2MJLA 3PUHA 1QKIA 3KSUA 4G4SO 4I1SA 1NUQA 4REQB 5AKHA 4UHKA 3JQPA 1IDN1 2CDRA 5JCOA 3TO5A 1VLHA 3N0TA 1HEIA 3PR2B 4KX5A 1ZCFA 5BW5A 3K8ZA 1LQTA 2FRVA 3OX1A 5DLEA 2PTHA 5BW6B 4BLOA 1QRSA 2AMYA 3WNBA 1CXZA 2C58A 2R65A 4GPD1 2CN1A 2HMTA 4TQ9A 1VCIA 4FYHA 4LX8A 4CI0B 1TYAE 4DVGA 2ZI6A 2X40A 2BI8A 3DEYX 1ZISA 2O2GA 2PO5A 3PTLA 3ZPNA 5LP6C 3PQ2A 4XVRA 2ZAIA 1NLZA 4I2VA 3WI7A 2VDQB 2QB5A 3EAGA 2J67A 4V0RA 2NO1A 5I9SA 4GMDA 3PFFA 1S2MA 1GZ5A 1S3GA 3FVQA 4G0YA 3CCQB 1U1IA 2WMYA 1XKQA 4ARZA 2G77B 1LLQA 4PN3A 1FTYA 2IIVA 4URXR 3TZBA 2CWWA 2Q28A 2VDVE 2R5NA 3E7FA 1DBIA 1W9MA 3OLXA 4FDVA 5FDFA 4BP9A 3FNHA 2I4LA 3R75A 4IJKA 1PN3A 1CP2A 5D2CA 5LDHA 3ERCA 4HS4A 3UUWA 2ONJA 4CM7A 3OJWA 1JFRA 3CUTA 4KKSA 4ILKA 4D45A 1U2GC 1ZNZA 3R6LA 2RHCA 3PD1A 5JS6A 3QWHA 3M33A 1EWKA 2QK4A 4IUBS 2XVYA 3VR3A 1T5BA 1L8LA 1PKEA 2A3NA 5EPEA 4U2KA 4B6GA 2ODAA 5KC8A 1Y33E 2I1LA 3HGQA 1UJMA 1JA0A 2HHLA 5IBPA 1Q9SA 5BWBA 2IF2A 4O4IA 3EASA 4K86A 2GVZC 3BK7A 3KVNA 2QW0X 4CDMA 2BWJA 1OILA 3R76A 3KL9A 1EX9A 3FSEA 2VKQA 1ZLYA 4M0KA 2PSHA 1ZUNB 3G7NA 4PXAA 1HETA 2ZVDA 4AT1A 2OGTA 3RWBA 4PGGA 4QAQA 3A0UA 5J63A 8ATCA 2VRNA 5FXMA 1FP4B 1EFPB 3D0KA 2L19A 1WP9A 5DWQA 1HYHA 4Y7DA 1WRBA 5H83A 5K8IA 4UFNA 3ZE8A 3HJUA 1E9DA 3DV9A 2WWRA 3NYQA 6REQB 3STVA 1PWZA 2OTCA 2YOGA 2QTRA 2XKBA 2A67A 1VQ5B 2XOEA 2N0SA 2QRGA 1S2GA 1YZUA 5HK8A 3ICEA 2ZBUA 1TMOA 1OMOA 1ZP6A 4J0EA 1E62A 4C3UA 1FNCA 5EWLB 2LIVA 3RUPA 1L7PA 4NCAA 5HEKA 4DCJA 4U6SA 2ZROA 3Q15C 1U2RA 2ZIFA 4QGHA 1B15A 4FSHA 1R8XA 4DLUA 4EM6A 4F11A 4HVLA 3C5CA 2XDAA 3R4VA 2GK6A 2GR9A 3QEMA 4HYTA 2OYCA 2H08A 2A58A 1IWBB 1MIOA 4OATA 5AKLA 3UJAA 1Y37A 1K92A 4G4JA 3O4FA 4JKIA 4BN4A 1O0CA 1AQ6A 2FXVA 4MR9A 1T8WA 4BUZA 4YJ2F 5DTIA 5FPKA 3LDUA 3ZVKA 3R40A 2BD0A 5C18A 4BKRA 3ONUA 2E4ZA 1Y1QA 5DI9A 3ZWBA 3TR5A 1JWBB 5EJ7A 3N2ZB 1SHZA 5COBA 3IQEA 4OO3A 2AL7A 4B3CA 4B4UA 4TUYA 4X1YB 1M1NA 4BNDA 4IPTA 1Z88A 4EY4A 5H9WA 2I2DA 4RIGA 2VLBA 5GIPE 4EZEA 1TD1A 1VMKA 4YJFA 4GR9A 5EWMB 1CW2B 3BBLA 5F4ZA 3VDRA 3TQOA 2VWGA 3NDRA 2DMRA 2CWDA 4RKRA 3ROFA 2NUTB 2ZIXB 3G7SA 1LBHA 3EFHA 5FLEX 2R8PA 2X0DA 3FI0A 4JQSA 4MUMA 4ALIA 3DZDA 5B3JC 2JVJA 4PXSA 3CG0A 4FS3A 4RTLA 1U0LA 2V3VA 4Y2SA 3VPFA 3NC0C 1ENZA 2K7FA 1S9HA 2P65A 2M2IA 3DE1X 4GR5A 2G9RA 4EVRA 3ZLJA 4AY6A 3RK1A 3H9JA 4YN3A 3RANA 1YR6A 1AH2A 1XTKA 4PG7A 3UXEA 3D43A 3PNVA 5G40A 3CC2B 1QHIA 1K6XA 3BTUA 3RIHA 1QGZA 2P3SA 1Q7BA 1ZOOA 1KP2A 4N54A 4RY2A 3KCNA 3TQHA 3CF4G 1GVNB 5I9TA 3UJ9A 5JATA 1D1NA 1P1IA 3R09A 5GGXA 4TRRA 3LC0A 3UAOA 3BGSA 2EBUA 4A1OA 2VRWA 2ISSD 2PRIA 3D8NA 3G2HA 1JIUA 3BSWA 5EHNA 3T3PB 4DSOA 1QOQB 4HX5A 3T7KA 3KHKA 4BXOB 2BHNA 4BB9A 4FUQA 4C22A 3V55A 1Z7EA 2SNIE 4GGMX 4PQGA 1V5VA 2AOXA 1VG8A 4LJ5A 1DCTA 1BHO1 1N07A 1RYDA 2XT0A 2I7VA 2G40A 4Q1EA 2PVSA 1K66A 3AG5A 4BE7B 3BJMA 2DYKA 2IEZA 2DY0A 4R9RA 4KEAA 2YRWA 3A2NA 4JROA 3SXUA 4BMPB 1O96B 3FUVA 4M9QA 4RULA 2JLQA 4UE2A 4UTOA 1UD8A 2B20A 2CXXA 4RPIA 1XLVA 1ZRMA 1RLTA 3AT1A 1DQZA 4FFBB 4N8DA 1IXZA 4O29A 5HBRA 4ETIA 3L18A 4KMSA 4LZPA 3M9XA 2WVHA 1E6EA 1MJ5A 3PZRA 5CCEA 1XBTA 2P6MA 3C4QA 3LT2A 4L9RA 4MKIA 1Q7RA 4YP1A 4QM7A 2BL4A 2WD9A 4IRUB 5JCOC 3ZW9A 4N76A 2O3JA 4CM5A 2IHYA 2V98A 3HXLA 5HGJA 3CRVA 3RHTA 4R4JA 3R6KA 4YCDA 3FVVA 4I19A 1KI7A 4M86A 4L5IA 5BSVA 4JLDA 4UQPA 1A88A 3DE4X 721PA 3H17A 5U4XA 4Q4LA 4YRQA 3ROTA 3RG2A 3MTJA 4HH3C 5IYPA 3I9OA 1EE9A 2UVPA 5CLQA 3QXGA 4LHZA 4MQEB 4A6PA 2C9DA 2R8BA 1JYEA 1QZXA 1SU6A 2EHDA 3WLJA 2Y1KA 3E5NA 4Y1RA 1OXKB 1M1XB 2OLJA 4NYIR 2QUZA 3OPNA 3QIVA 3IKJA 4N0MA 4URUR 5FIUA 2WUDA 1XYYA 3ZY2A 1ECFA 5ECDA 1G7SA 1XJ0A 4QUEA 4WMLA 2XXAB 4JT8A 3OLWA 2Q99A 3H6KA 4BBAA 4EB8A 3IMGA 4IQ8A 5JZOA 2QTVB 4TYMA 1USVA 4R0VA 3FR7A 5KBYA 1G2IA 3Q88A 1OE0A 5K4AA 4CLRB 2FYTA 3PC3A 1PJBA 1M5UA 3SIWA 4KNYA 4LG1A 5DU2A 3PA1A 3KDAA 5CM8B 2AF4C 1GPNA 3IVXA 4QXOA 5ELMA 4AJEA 3SBXA 3ONNA 1ODKA 1TM1E 1DOHA 1TADA 3R6TA 1OX5A 1FU7A 3FRJA 1RC0A 2PVPA 3EYAA 3F5SA 2AKYA 2WJGA 4MV9A 3C6BA 3VM6A 621PA 4QPJC 4ZQIA 3H18A 1ZRHA 1F2DA 4U39A 1P1CA 3R0JA 2OK8A 2WYRA 5A02A 3I83A 4MKHA 3SX2A 1WG8A 1R5OA 1DKRA 4IHAA 4UXHA 5CFRA 3KXKA 5KX5B 4P3KA 3I04A 4LKOA 4R2KA 2IW3A 4GX2A 1YI0A 4Z4YA 1FFXA 2TMYA 4JL5A 3E27A 4TTSA 5HIJA 1F7VA 2C96A 3IAHA 3F6SA 1P4SA 1YR2A 2ZJ7A 3HDTA 5EE3A 3ZWQA 4Z0NA 2IUSA 3SOPA 3G9TA 4V1CI 1MHPA 3KQWA 4O2LA 3QU9A 1CZNA 1Y5MA 2A8YA 4MAAA 3X1YA 3P9CA 4V0NA 3CUUA 4MS3A 4C03A 2IQ5A 3OOHA 3SC3A 2R1TA 3AUUA 3TLKA 1PWEA 1AVTA 2Q8PA 4TRMA 1YTLA 3MCVA 1KKUA 3ADCA 2QEQA 5IDWA 4R2XA 4UBMA 5KTTA 3DZKA 3GZJA 4L85A 5BUQA 5KQSA 3NCTA 2EVWX 4LDRA 4B5KA 3QF7A 4N9WA 1GWNA 1T1RA 2W2XA 1QE3A 3KYBA 4HFRA 2OPHA 3BREA 1ZMRA 4KVFA 2Y6VA 1E2LA 3CSSA 3NC4A 2NACA 3OP4A 4HGNA 1IATA 4PG6A 3C1TA 1Q0PA 3NGMA 4EX7A 4WOPA 1W25A 2ON6A 2BSAA 8GPBA 4JJFA 2ASEA 1JDPA 1KP3A 3K0FB 3CESA 1NJFA 1NXQA 1KQ3A 1NF3A 3RNOA 2ISQA 2EV9A 4CG2A 4JUDX 2C07A 1P0FA 2OCGA 3L40A 1JE0A 1KO4A 2E37A 4IEIA 4ZV7A 2F2TA 3QFFA 3KQTA 5KJ6A 3N1UA 5EJ6A 1XTTA 3OCJA 1X19A 2ZI9A 3U4HA 5AUNB 1G8YA 1OR8A 2G71A 4B32A 2JEOA 1WY7A 4HKTA 1B7GO 1D9XA 2WKQA 3H3XA 4J3NA 1MV5A 3GJZA 2GHQA 4RD4A 2R00C 3Q12A 4OHXA 4JFAA 2OXTA 4DT1A 3OCYA 5HM8A 3ZQKA 3QEOA 3A6PC 5CT8A 1JXAA 4B7XA 1NNUA 1M33A 1YQDA 1G21A 5FQOA 4Z4RA 2ZR7A 5LBUA 4LWQA 2D1QA 2FQ1A 5A9SA 1N92A 3COVA 3SLKA 5JS1A 4MB6A 3VR6D 5EIBD 5T4FA 1V0EA 1WHTA 4HDNB 2JASA 4J0IA 4OFZA 4RXMA 3P2EA 3CX7A 5B1HA 2YRFA 3E7XA 2TSYB 1ORHA 1CHNA 3MXOA 4J94A 5A6VA 1FFWA 2VAWA 3JD3A 4KVZA 4HY3A 4BJ6A 3NG1A 2ZBFA 4Y67A 1I14A 1JR4A 4XIYA 2AE2A 3BYZA 2P6UA 1G5TA 4X06A 3G9QA 4KGDA 4RABA 3SC4A 1ZR2A 3PT5A 4ZAWA 4HV4A 2J4CA 2WKSA 2NVWA 3FR8A 3IBTA 4LPSA 1C9KA 3DE5X 4G8JA 2X9VA 5KZMB 2VJAA 3C85A 3DP9A 1MNAA 1UFQA 1M2OB 2Q0HA 3M49A 3LQEA 1P4HA 4U1RA 3TLAA 3KVYA 5H8WA 5B6IA 4EAQA 1W581 2HOQA 4KXYA 3L4EA 2RHLA 2BBWA 5BR1A 5T64A 3NW9A 4YC7A 2JLZA 3SKVA 2MSNA 1Z82A 4BN0A 4UHEA 4DCMA 3QV2A 5F4JA 2VAVA 3TIXB 4CIWA 1ZJ6A 2EFDB 3AIMA 1W85B 2AG8A 3NDBB 2VIIA 1QIKA 3PHLA 3KK0A 2UVPB 3JYLA 1RJ9A 3C7TA 1KOLA 4N6NA 3VBCA 2EX4A 3WGHA 3T5MA 4W7HA 3L5KA 2YTZA 2C3UA 3JQ8B 2I4RA 3LUHA 3S68A 4HTFA 1KPIA 2BGGA 4Y9SA 3FHJA 4GQNA 4D82A 2WT8A 1U04A 2ZUUA 3KJHA 4BNLA 2CRVA 3DEKA 2V03A 1T15A 1NUTA 3OT1A 4YXWA 4Z4HA 4B3TB 1GGVA 1YQXA 1EA5A 3G23A 2ZJFA 1QHYA 3H97A 3LRPA 2OQRA 1RPAA 2QD4A 1CZLA 3LNCA 1SRRA 3O9VA 2FRDA 3OZBA 4KK3A 1HC7A 3GRPA 4MWZA 2WIKA 1HLPA 5ALLA 2EAUA 1XXHA 1PDOA 3PPIA 2HMAA 1DKMA 3WYEA 3DKKA 4A0HA 1Z5ZA 3LH5A 1AKEA 4MUFA 4FHZA 3HVJA 1RHKA 1ESEA 1UXKA 1LFDB 3CEMA 3D2LA 4RXTA 4EELA 2ACEA 1ZI9A 5EP4A 5CDSA 4PX3A 2FK8A 3CZ9A 1GTZA 1ZGJA 1FYWA 1TK3A 3L6RA 1SC3A 1O0SA 2NO6A 3I62A 4HXYA 5B5SA 3P9RA 5ALZA 3SYNA 2NSLA 5BYBA 1UP4A 3CUWA 2GO7A 2B1QA 2A9OA 1MAHA 2ONZA 2GLXA 3OOYA 4I5DA 3OW2B 2OZLA 2SBTA 3QZUA 4V02A 5FTJA 2QR2A 2C57A 5JVDB 1ZN7A 3DLPX 3H04A 5LKRA 4RMJA 3B6KA 3HA3A 1X7DA 2GESA 1SHKA 5DSZA 1NDUA 2V4MA 2XCOA 3AH8A 1FA9A 1GG2A 3G1UA 3IMKA 4KQEA 4PYIA 5E1OA 2WZPP 3T4XA 1QLWA 1Y5RA 1Z08A 1VIAA 1T4MA 2XDWA 4GLLA 4HQ0A 1CEXA 2ODWA 4JC4A 1JTFA 4D80A 2ZITA 1N8TA 2OAQ1 3HHEA 1M7GA 5JCXA 5FKJA 1BDMA 1ZMOA 3TPFA 4OU5A 1E0JA 1NI5A 3D81A 3JWEA 2PXCA 4WBNF 1J8YF 1JILA 2NVUA 1AV7A 2O0HA 3GFTA 1J21A 2OPBA 2ERCA 3O8LA 1GO2A 1Z5OA 3O8QB 4IMJB 3PYXA 5F2EA 1OJLA 2QD5A 1CZHA 3W4KA 1KJZA 4R84A 3W2IA 3AL3A 4GR4A 3WIEA 2H4JA 5FP0A 4F3CA 1MQSA 5EHZA 5J4LA 5JJ5A 1P6UA 5CA1A 3E4CA 1SIBE 2J3LA 2I22A 3M3DA 4QDJA 2F3QA 4OK5A 2CXTA 2B7CA 1LBIA 1JEDA 3VOTA 2O1EA 3L82B 3ILHA 1Q7TA 4IDBA 4MKZA 5AW8A 4MW4A 1Y6JA 4F6RB 3NALA 4AJNA 1NJ6A 3L6UA 5BURA 2N47A 2BFEA 2JH8A 2PKWA 2X6TA 2C5LA 3CONA 2CSXA 1JYSA 2GQ0A 2R84A 1B0UA 2BCJQ 2G8LA 1Q7YD 3T9EA 4RD6A 2AB0A 4PZ0A 5BUCA 3Q9NA 1AA6A 5B1EA 1JPJA 1RE0A 2OD7A 2AFIB 4ZXFA 2VI5A 1WOYA 1E79A 5YASA 2Z6UA 3S6JA 1GAQA 3CW8X 5CNMA 4XYBA 4JZKA 1N2CE 2Q6LA 4UEKA 5EZSA 5I45A 5REQB 2WZNA 1PNVA 4HLNA 2GJRA 1J0DA 3BD7A 2BDTA 4KCGA 3SVLA 3OQIB 3G68A 4F56A 4EBFA 4Q1BA 1H2XA 3UWPA 4RHXA 4D4GA 2JFNA 3FCEA 1NG1A 3P96A 1EFAA 4N5LA 4A4DA 2VT3A 1RYZA 4BWFB 3KVOA 2R8RA 2WZDA 1DJLA 1VCMA 3GPDG 4ESEA 4ZGQB 1RBYA 3HU3A 3LY7A 4ZDWA 2QMQA 4BFXA 4C07A 4O5AA 1BEUB 3WWEA 4DCGA 5KTRA 1OFGA 2PZMA 2Q3MA 3D6NB 1OI7A 2Q6KA 1JE1A 3OJ0A 3PDIA 1RJ9B 1V5FA 5D5PA 5CA0A 4DHWA 1FTGA 2OP1A 3L9WA 2COEA 1UZMA 2W70A 2Q0QA 1HE1C 3DBRB 4NONA 4RD1A 5JYCA 1FP1D 4HYEA 1VSVA 4JBGA 4B3FX 2F43B 2Q3DA 3AJDA 4WZLA 1FTWA 3ZDCA 3NOVA 1T9KA 4YECA 1K06A 4A6XA 3PNQA 3FVWA 4EHAA 1KF0A 2BMJA 1L7DA 3IVCA 3VISA 4FHFA 2HNBA 4HEHA 4D8UA 1E4OA 1US8B 4DG5A 2BEUB 2PGLA 4IGAA 4L8GA 4QICA 5K8JB 2C4WA 4ZVPA 5FBVB 1KIAA 2FXIA 2ZJAA 4B6JA 1DOAA 4WFQA 3BSSA 1S8AA 2OGWA 2K2WA 1DAMA 1VCHA 3KZNA 3MJCA 3AOEA 2EFHB 5BORA 2FMUA 5LQAA 1GU1A 4FMPA 5H68A 1XAIA 5ER6A 1IOZA 1RZRA 4H0NA 1IHDA 2O3QA 3JVDA 3OWHA 1JPUA 2CLOB 5CRIA 5DBIA 4RK4A 3C2QA 5C4GB 3LD9A 4E2FA 1TEZA 1RC8A 2RCNA 2VDRB 2YINC 1HFKA 3RM3A 3T5AA 3AL2A 1ZA2A 4J2OA 2ZIXA 4WCFC 1M1ZA 2JD0A 2ZYVX 4XLTA 5J43A 3ZUPA 1X9HA 1E2IA 2P79A 1GNTA 3DQPA 3LBYA 4NPCA 5AR1A 2GETA 2G63A 2OKCA 2XSZA 1J8FA 1JBKA 4HAYA 3EZNA 1S8NA 2GHIA 5EEGA 1M1NB 2D7JA 2PD6A 4MKFA 4P7JA 5EJ2A 2B6NA 5K9ZA 1VL2A 1K3UB 2GKSA 1XXLA 3M9LA 4IIDA 4WY5A 3S2GA 3L77A 3H5TA 3NQ41 4HO1X 4NZ9A 4IIYA 4F4DA 4I1UA 2QX8A 4EO7A 3Q7RA 5FCDA 1QP0A 3BH7A 2FWNA 2QRNA 3CNQS 3NBMA 4IDEA 4ZT3A 4OHZA 3TB6A 3UMCA 1WEHA 4HH4A 4I36A 4A6DA 5JSZA 1K98A 1SBHA 2EOAA 2B2NA 3EAQA 1RYEA 4TS4A 3BA6A 1FK8A 1FZTA 3C45A 3PZBA 1S8OA 3ZGZA 3LIPA 3ZU2A 3K0FA 3P45A 2R6FA 1ZDMA 1FCJA 4I3GA 2HA6A 4J07A 4MKRA 4GEGA 4RX1A 1I6MA 3VC1A 5CW1A 3T5PA 1GM5A 3PCXA 4IOJA 2AS0A 4MTCA 5IDQA 1WBBA 4B85A 1R16A 1TQ6A 5G0SA 4YK7A 1DIAA 3NJRA 2NZVG 1G4HA 4KN9S 4OCZA 2ONCA 1VG0B 2PX5A 4QPZA 1K88A 4EATA 4IHJF 5BVGA 3IXMA 3UT5A 1JR6A 3QJ5A 4E22A 1WXIA 1AGXA 5H3CA 4EMBA 2J09A 5E6TA 3AUSA 4BOYA 1WD7A 5K0EA 4NZOA 1NP6A 1HQKA 1P72A 1XQ9A 1IXKA 2QPLA 1W9XA 1O89A 1WUKS 3E61A 3H13A 3KQYA 4WASA 4BGDA 4BJ5A 4MUNA 3GJTA 1HORA 2HJSA 5IASA 3BMCA 3WYBA 1OFUX 2B0CA 1IZYA 3UAXA 1W4BA 1XZNA 5J4KA 5A05A 2ZTVA 3LWNA 3LWDA 4LV5B 5T3YA 3TDMA 4JI7B 4EYSA 3HXKA 2BKVA 5F5XA 3CLVA 3R44A 2IITA 1RQNA 3TZQA 4MHOA 3TEJA 1JUDA 4ENTA 1I2ZA 1M2VA 3HWSA 3PA2A 3WB9A 4YPOA 1E63A 3RD5A 4UKDA 3VZRA 4CIDA 2ZBEA 3ZHZA 3J80A 1ZU5A 4RIEA 3WY9A 4B2IA 4NEHB 3L6EA 3ZBTA 4WWVA 1SZDA 2QTWB 1P44A 2RH8A 1POXA 1Y1RA 4FFRA 3HA2A 4GWKA 3AEYA 4OP3A 5CPFA 3RSHA 2Z57A 1RHRA 2I5PO 3H11B 4MV8A 1ETHA 4G1FA 4GC5A 3SVTA 3QKUA 3NHJA 2OCLA 4F5DA 4DBLC 2FH5B 5T3UA 3GARA 3FOWA 2IH4A 4P81A 1TO1E 3D4LA 5KYYB 3FH0A 4F4CA 3EZLA 3BVPA 1Q74A 3RWOA 2N9UA 4Z4QA 1AZTA 1USWA 2P2SA 3G8AA 3GU3A 3EGWA 1L8XA 4J76A 3OLYA 5FUXA 1V43A 2G1AA 4E13A 3CVXA 1Z39A 4ZCPA 4JBIA 1ZD8A 1ZIDA 5DLPA 3SE7A 5HJ5A 4KHZA 4RVDA 3SHTA 1PTJC 1GZ7A 2JIZD 5M2QA 1TE2A 1Y3HA 2DT8A 3BKXA 3PQ4A 4DMMA 1ZH2A 1WOMA 2MSEB 1T4CA 3HZOA 2AYXA 4K9NA 1YB1A 1Q81D 3DVQX 4P1VA 1YFLA 1IHOA 3EMBA 3R3JA 4U00A 3NAMA 3RVKA 2M6RA 1JFTA 1Z35A 3M2PA 3MGKA 1GPYA 1T6NA 4MW6A 3UJDA 1QPBA 2CFSA 3RADC 4I66A 3RJ9A 1G21B 1OGIA 1OV6A 2QRKA 3CWCA 5J5AA 3V7AA 1PX0A 3QU7A 3SMQA 3VOAA 4TVOA 1O5IA 2Q6IA 2O3TA 4HPXB 1QZ3A 3VVLA 3WLQA 3R74A 4CQNA 1WXWA 2JZNA 3A11A 5B7NA 2QBYA 2V4DA 4Z7OB 2WFAA 3CNEA 5JU6A 1Y0RA 3HCDA 1ILEA 1QHGA 4IZHA 1P2GA 2EDCA 3DAFA 1G8KA 3GV0A 2XODA 4PLC