1MTCA

Glutathione transferase mutant y115f
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
217
structure length
217
Chain Sequence
PMILGYWNVRGLTHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCFNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase YB1
publication title Local protein dynamics and catalysis: detection of segmental motion associated with rate-limiting product release by a glutathione transferase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 75
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2002-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1mtcA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1mtcA01
2PMTA 1O81A 2C3QA 1WIKA 4V2MA 1XVWA 1EV9A 3IK9A 5EY6A 1A0RP 3C8EA 3CRTA 2H0IA 1SYXA 3P2AA 1ZGNA 4MH3A 1WWJA 3M8NA 11GSA 2GQLA 4G0LA 12GSA 3N5OA 1QUWA 2LUSA 3L0HA 1TDIA 3QR6A 3EU4A 4HOJA 2V1MA 3UMAA 2H66A 1I9DA 5ECPB 4AJ7A 4I2UA 4JZQA 3KP9A 2CQ9A 4OCFA 1HD2A 2HRKA 4NPBA 3DWVA 2JSZA 2DIYA 5F0GA 4KCAA 3F4TA 2CV4A 4E8HA 2DLXA 3L9SA 1ON4A 1U6TA 1PD21 5ELAA 3IE3A 4BWQA 2LV3A 4X1UA 4L0WA 1AIUA 3IDVA 4OMVA 4TKYA 4ZB6A 4KE3A 1JZDA 3GV1A 1R26A 1IYIA 4JE1A 4YQVA 5DQYA 3ZRDA 1GUHA 4PQIA 2IPAA 4EKZA 4K7OA 2KLXA 5B8AA 2CAIA 1OYJA 1YZXA 4K2DA 4IQ1A 4ZIJA 2O85A 1YJ6A 3HD5A 2RM5A 1M9BA 2LTKA 2DC5A 1GWCA 1EV4A 1YKAA 1VRSD 4KCEA 1GSEA 4K0GA 1T00A 1I5GA 2AHEA 1QFNA 2KUCA 4HEA2 3GYKA 3L9UA 2GT6A 2HZEB 3KMNA 2VCVA 4EF0A 4IHUA 1FG4A 1O73A 2VLUA 1B4PA 2VL2C 3FW2A 4HUAA 3UVHA 1HNAA 4DSQA 2JZTA 2EIQA 4PQ1A 3WD6A 4FQUA 3KEBA 4AJ8A 1X5CA 3TRXA 4HQZA 1PN9A 4JRRA 3F6DA 1DBYA 17GSA 1ML6A 3NOFA 2VD1A 3GURA 1RW1A 1XOAA 4HJMA 4TR1B 3RAZA 4GRFA 2M72A 1OKTA 5LNKe 1BG5A 2EC4A 2C0DA 3OR5A 5CAXA 4F0BA 4F03A 2PPTA 3DGQA 3GFKA 1V40A 4TXOB 2OE1A 1OC9B 4IELA 5GZZB 3VFIA 2YWNA 4TW5A 1ST9A 2H1GA 4NMUA 4TRXA 1O8XA 3DYRA 4HDEA 1CQGA 3HDCA 1Q98A 2MBTA 4PX1A 2ZNMA 2IFQB 3I69A 2H70A 4PNFA 4XCSA 3Q74A 5ID2A 4LLRA 3VLNA 1TI1A 2XBQA 2JZRA 2MMAA 4Q5NA 2F51A 4KA0A 3LGCA 1SYRA 2LJRA 2TRXA 2GS3A 4V1Ag 4KW6A 1SENA 4PQHA 2DJKA 4KNDA 3C73A 3GTUA 2DBCA 1IYHA 1WRYA 1XZOA 4IJ3A 1MD4A 2PWJA 5DAKB 4ZB8A 2CVKA 5HFIA 1JZRA 1EP8A 4NXIA 5ECSA 3MAKA 2REMA 4GQFA 2LQOA 2D2ZA 1AXDA 3GMFA 2LQQA 2Z9SA 3GN3A 3D5JA 2OBIA 1FHEA 3WGEA 3H4KA 1Z9HA 2YPMA 8GSSA 3SWLA 3ZTLA 1J08A 3KCMA 3G9BA 1AQXA 5DBQA 5IM9A 1YQ1A 2F3MA 4GCIA 3TKSA 5F06A 4WXTA 3U5RE 5A4WA 5F05A 4EXJA 2L59A 1VGLA 3A2XA 2H75A 1R4WA 3C1RA 2FD3A 1BJXA 1Z6MA 1FW1A 4POBA 1GSQA 1T1VA 1T8EB 2B7JA 5H5RA 1QMVA 4KX4A 1XWCA 1X0RA 1R5AA 1WPIA 3TB2A 1PX6A 5B7CA 4JR4A 3V1WA 1GNEA 3ME8A 1H75A 3ZITA 3P90A 1FB6A 1MDIA 5G5EA 4MCUA 5J9CA 3AY8A 2FGXA 2HRFA 4ML6A 5D93A 1X5DA 5J41A 1GTUA 2X8GA 2K8VA 1SL2B 3KD0A 2N5AA 1LBKA 4JR6A 4POLA 5CO3A 2EIRA 3GX0A 3IV4A 2TRCP 2H6XA 3RHBA 1OAZA 1F6MC 3I6AA 2H1AA 3ZFLA 4K8MA 1AQWA 5G5FA 1THOA 3VWXA 2EIOA 4WF4A 3RPNA 3HVVA 1VF3A 3IOSA 3KM6A 3FEUA 9GSSA 4FIWA 3A5WA 3VPTA 5KN1A 5CRGA 1FVKA 2L57A 3EWLA 3EURA 1T4YA 2XC2A 2YWIA 18GSA 4KDUA 4HQSA 5DCHA 3HCZA 2HQTA 2L6DA 4POMA 1HYUA 4HJ2A 3GA4A 1YEXA 13GSA 2LKUA 5HFGA 3FK8A 3HJPA 2CZ3A 1SK0A 3PGTA 2P0GA 4ZILA 2C0FA 4O92A 2R6KA 1V2AA 5HFKA 4IGJA 1ABAA 1WP0A 4OFNA 1G6YA 5AISA 5GAND 5AIVA 4XRDA 2WCIA 1A24A 6GSVA 1CQHA 1G7OA 3VI7A 3G7IA 2GSQA 3FZ4A 2GZYA 1HNCA 3BCKA 2OKAA 2NPBA 5DVBA 4IQAA 4FYBA 3IRAA 3UBLA 2H8LA 2LEGA 4CDOA 1G7EA 3GKNA 1V9WA 3TJJA 2HLSA 4ML1A 2H0GA 1K3LA 3FR3A 2C4JA 4IP1A 1TKDB 2DJJA 3UIWA 1O8WA 2WULA 3HJOA 2E7PA 4MA9A 4J2FA 2JADA 1K0BA 3EVIA 1EWXA 3BJ5A 5DALB 3F63A 5COHA 5FT3A 3HYPA 2JU5A 3F4SA 2CVBA 5CP1A 1GSYA 1G0TA 4GLTA 1MDJA 3EYTA 2QSIA 3APSA 4POKA 4KB3A 4BWSA 3EMPA 3UL3A 2DJ0A 2X8HA 1Z7PA 1FVJA 1S3DA 3J7Yk 1WMJA 2I4AA 1BX9A 3TRPA 2WFCA 1ILOA 2WRTA 3W8JA 3KIJA 2VUPA 4EDZA 3LQ7A 4CW9A 1YF0A 1KBNA 4ZBDA 1KNGA 4WBJA 3LYPA 4I2TA 1GUKA 2AB6A 3FZAA 1PX7A 1YY7A 3GRXA 3ZVJA 1UC7A 1A2LA 2MMNA 1GSDA 1N8JA 3EINA 3HXSA 4DSRA 4ZL8A 2UZ8A 3LXTA 2XPEA 3F3QA 1TW9A 3L4NA 3I9V2 1XBSA 1YEPA 2H73A 1EP7A 1BQ7A 2R3XA 4FO5A 4FYUA 3BBYA 1S3AA 2JZSA 1O6JA 5LD0A 4AF2A 2LRNA 2O7KA 2TIRA 3TKPA 4ULXA 3E9JB 3QOUA 3A3TA 3P7XA 2H30A 2G2QA 5G31A 4BVYB 2VL3A 2WZ9A 3WYWA 4H86A 5CRDA 2VO4A 4G9HA 2HNLA 3G7YA 2J23A 5EVOA 4MLYA 1EGOA 1A2JA 2WGRA 2LRTA 1K0DA 3G7JA 3M3MA 1EEJA 3UEMA 2I81A 2P31A 2PBJA 4PURA 1HQOA 1EGRA 3ISOA 2HSNB 5D9XA 2HZEA 3M9JA 1X9MB 2YWOA 1Z5YE 4RQXA 1SL0B 3ME7A 2BJXA 2PU9C 2VCZA 2QKEA 4MF6A 3KJYA 2HRKB 4BL7B 4YAPA 4GWRA 4WKWA 3K8NA 1W4VA 4KSOA 4F9ZA 1XPVA 1M2BA 3APQA 1LJRA 5D9TA 3FR6A 1XIYA 1G6WA 2BTOT 3TJFA 2VIMA 1A23A 4G19A 2GQKA 2YANA 3APOA 5CREA 5ECLB 4YQMA 4OCEA 3KH7A 1DUGA 2DJ2A 2V6KA 4TR1A 4EUYA 1EEMA 2YOIA 5DCGA 2QGVA 1PL1A 4AJ6A 1K0CA 1SD9A 5IIZA 4J57E 2KOKA 3BOAA 2OJLA 4IVFA 3IBHA 4TXOA 1OC9A 3DVXA 2HSMA 1M2AA 3F0IA 2GGTA 5IMZA 4RQRA 2RLIA 1Z3EA 4PGTA 2LS5A 4NV2A 3BD2A 1UN2A 1EOGA 5J3RA 3FZ5A 3ZMLA 3PR8A 3HHVA 4ISDA 2IFQA 3C71A 4GQCA 3LJRA 5ECOB 2YP6A 2NTOA 3TUEA 1GNWA 3KZQA 2R4VA 2ES7A 4MJBA 1NM3A 3EC3A 2X64A 1ERWA 2YWMA 2GDRA 3QPMA 5AN1A 3MSZA 1A8YA 3ZL5A 3CYNA 3TKQA 1K3YA 2FNOA 1XCCA 2J9HA 4PTSA 22GSA 4PUAA 3TCOA 2HRAA 1GSUA 5DAKA 4ZL9A 4FH8A 5IMAA 5D9WA 3FRCA 2L5LA 5G1LA 3F3RA 1M0UA 4N0ZA 1KEBA 2FCHA 4GSNA 2V32A 2B1LA 4YH2A 2AJQB 3NIVA 1J9BA 5HR0A 2H1BA 4QL9A 3RDWA 1SK1A 1R7HA 1JLWA 5J4UA 3GH9A 1V98A 3TOTA 5A4UA 3LG6A 3LWAA 3ZZXA 5ECNB 2VLTA 1BAYA 3H93A 3QCPA 3A2WA 3ZIJA 4MJCA 2KP2A 5INYA 1TRVA 4BVXB 2YJHA 3GKXA 1GSFA 3M1GA 2F8AA 3IHQA 2B3SA 4LMWA 2YV9A 4TR4A 1K0MA 1M99A 1AUCA 10GSA 1C72A 2CT6A 2MMOA 1JHBA 3S9FA 2FA8A 2NBSA 3H8QA 3UBKA 2XPDA 4DSSB 3QAWA 4I8BA 5ECQB 1HNBA 4TXVA 4G0IA 4WETA 1GH2A 3TJKA 4NWYA 2DMMA 1Y25A 2E2GA 6GSXA 5ID2B 3KTBA 5EPFA 2NDOA 3DEXA 4Q5RA 4BA7A 4ZL7A 2IMFA 1DE1A 3DXBA 4IKHA 3GTUB 4ACSA 3ERWA 1NSWA 4PUFC 5DJMA 1QGVA 3F8UA 2AUVA 2VOCA 1SJ6A 3I43A 2OA7A 5IQYA 5F8BA 1GTBA 3LEFA 3D0ZA 4NHWA 2JSYA 3LORA 3KP8A 5GAPD 2NVLA 2VAFA 2YCDA 2K6VA 3H1NA 3MNGA 5AGYA 1TK0B 4ID0A 5H5QA 2N5BA 2LJAA 3CMIA 1DSBA 1TK8B 1AAZA 4WBRD 4KF9A 4KH7A 1F3AA 3ZMKA 3US3A 1X5EA 1SJZA 4TN8A 1N2AA 2GSSA 5IPHA 2FA4A 5GSSA 4EE0A 1Y6EA 4K6XA 1A0FA 3EU3A 4XRAA 1PMTA 2B5YA 2K18A 3GL5A 3KTLA 1PQNA 5ENUA 3VK9A 3SBCA 1SJIA 5LCZA 2FWFA 3D4TA 2DJ3A 3QMXA 4N0VA 1VF2A 3D21A 1O7UA 1MDKA 1TRWA 3GKKA 4N10A 4TVEA 4XS4A 4XHMA 4V1Ap 3RPPA 2LSTA 2M46A 3HY2A 4OO5A 2B5EA 5ECKB 1O85A 1GLPA 1TRSA 5IOWA 4HZ2A 4D73A 5D73A 4YAVA 5DQSA 2PVOC 3CSJA 1VF4A 4N30A 4YQUA 5IMFA 1J0FA 3H79A 3E3EA 3IR4A 1EOHA 1XWGA 3FKFA 2X8CA 1URMA 5IMCA 1XW6A 2FWGA 1T4ZA 1ZYQB 2OE3A 5CRWA 2PN8A 3A2VA 2VM2A 3CTFA 3HZ8A 2DMLA 3FYGA 4Z7XA 3WT2A 4IJIA 3FY7A 5J5NA 2A2RA 1AC1A 2IWTA 3L9VA 5DJLA 3GX8A 2A2SA 3VWWA 2LNTA 1MTCA 4F82A 5DALA 3ED3A 1PKZA 2C0GA 2FY6A 2IN3A 4IBPA 3C1SA 5ECHB 2VCTA 2GVPA 1ZOFA 1X9SB 1THXA 2G0FA 1B8XA 3DIEA 1TRUA 2I1UA 3MWHA 1QQ2A 1JZWA 3DMLA 2RIIA 1UVZA 2ALBA 2VM1A 1K0NA 4KGIA 2CX3A 3TGZA 1QK8A 3WT1A 4K7IA 5ECRB 1USBA 1WJKA 3PINA 5H5SA 3IC8A 1V57A 2QC7A 1ZCPA 5IPGA 5JCGA 2PERA 2DSAA 4AGSA 1GTAA 5A4VA 5B6NA 2HXKA 1PL2A 1FB0A 2VL2A 4EDYA 1F3BA 4HU9A 2YJ7A 3TRQA 4L8EA 4X43A 4MJAA 1T3BA 4HS1A 4KSMA 2H76A 4WR4A 4X0XA 2B6MA 4RI6A 3IC4A 4MMMA 1U87A 2L4CA 2MBSA 3TKSC 1V58A 3R3EA 2FWEA 2O8VB 3PPUA 2RUEA 4K1FA 3TJGA 2H01A 5FHIA 2L4QA 2C3TA 4GSTA 2E0QA 1JFUA 7GSSA 2MMZA 3UOMA 1TK5B 2GTUA 2CA8A 1ZMAA 3CRUA 4KDXA 1BYEA 4OFTA 2PGTA 1TXXA 1Q4JA 4MZWA 4LA1A 3JCML 1TJDA 2H72A 3QFAC 4BVYA 2A4VA 4L5OA 3D22A 4I6XA 1PKWA 1ZZYA 5IO2A 1F9MA 4EL1A 1UA5A 2B5XA 1GP1A 2HI7A 5HR3A 2CZ2A 3TOUA 3GSSA 2YZUA 3F6FA 1RK4A 6GSTA 3IAM2 4OO4A 1GL8A 3FZ9A 3TKRA 2CVDA 4K9ZA 1OKDA 4WEYA 3R2QA 4HZ4A 2GSTA 2FHEA 2L6CA 5BMUA 4MJEA 4TOPA 1B4QA 4WF5A 4GSSA 3HVXA 1SL1B 4BL7A 1MD3A 1XXUA 2OE0A 3GHAA 4OD7A 2CAQA 1QXHA 1XWAA 6GSYA 2VCWA 19GSA 2H19A 4PXOA 4ECBA 2KP1A 4G2EA 2R5GA 2IMDA 2GQMA 4XIHA 4L0UA 1Z6NA 2ZUPA 5ECIB 2C0EA 1M9AA 4CHSA 2R37A 1ERTA 4DEJA 14GSA 2XBIA 3O76A 3TKSE 3BCIA 4JEDA 1SU9A 1TU7A 4JBBA 1OE8A 2XHFA 3CBUA 3N9JA 4USSA 2RM6A 1SKWB 1OE7A 5HR1A 1F2EA 2IJYA 4EVMA 3QAGA 1GRXA 1PRXA 2H71A 4JU5A 4XS6A 4TR0A 5E4WA 3ZYWA 16GSA 1B9YC 4MPFA 3ZFBA 1U3IA 4OWYA 2YZHA 1WE0A 5KN3A 2WB9A 1XFLA 5F07A 5D96A 6GSUA 5HR2A 4ECIA 3KGKA 2HFDA 5ELGA 2FUG2 2RUFA 5A5KA 3KMOA 1Z7RA 4QL7A 4Q5FA 4MF5A 2LJKA 5DDLA 2P5QA 1DE2A 4ECJA 4NAXA 1K0OA 3J7Yb 2C1YA 2FLSA 3ERFA 2MYGA 20GSA 5J9BA 1GLQA 2GLRA 4TR3A 1XOBA 2HYXA 5JWQB 1GULA 1U3AA 1XW9A 1SKSB 3EMXA 1GTIA 3GKMA 1FAAA 2DIZA 3CXGA 3NZNA 2PUKC 1YKCA 4P3YB 3FHKA 1MEKA 6GSSA 2OACA 1T7PB 2HSMB 4BVXA 5G2ZA 4EO3A 1TU8A 2OADA 3DKSA 1XWBA 2HSHA 4ZB9A 1NHYA 4RI7A 4G10A 1TTZA 2C3NA 2LNSA 3U6VA 1NHOA 2YNXA 3ZVJD 4DSSA 2H6YA 2HT9A 1K0AA 2LRCA 5C04A 1YDKA 3RHCA 3UVTA 5JWRB 1ERVA 2WJUA 2K9FA 2WDUA 2K8SA 5EL8A 3GSTA 1NW2A 2H0HA 5CYYA 3VURA 4MDCA 3Q19A 2B7KA 3D6IA 3GIXA 1PSQA 4IP6A 2H74A 4ECCA 4F2IA 1JLVA 5D8IA 1F37A 2B1KA 4GXZA 1BEDA 5CRHA 1ZYEA 5HQPA 4MF7A 3ZREA 3CSHA 4O32A 2GZPA 3ERGA 3Q6OA 2VCQA 2ON5A 2IMEA 1TI3A 2WS2A 2AYTA 3CSIA 3IAS2 5JWOB 2VL9A 3QD9A 1SD8A 3QDNA 3HZ4A 2AV4A 4NHZA 2KHPA 1E6BA 4G0KA 4ZXGA 4ILFA 3O6TA 2F9SA 3QAVA 3LFLA 4V2NA 1PA3A 5FWGA 1H4OA 1VF1A 3VI5A 1JZOA 1XW5A 5ECMB 5D9VA 2YV7A 4N11A 1B48A 2IIYA 4NV5A 2ZCTA 4DVCA 5AIXA 1B9XC 3P8WA 4HI7A 1YF1A 4BPYA 1KTEA 4K7NA 3TJBA 1E2YA 4EC0A 1M2DA 1A8LA 3KH9A 3QFBC 1FOVA 4KUNA 2HZFA 2V2GA 3VWUA 3M9KA 5E59A 4J56E 2BMXA 1WOUA 5JCWA 2O87A 3O3TA 2VD0A 3Q18A 2N5FA 4PNGA 3GH6A 4MK3A 3UARA 3FR9A 4LL1B 1ACVA 5IO0A 5IMDA 2R2JA 4O7HA 4Q5QA 2F8FA 1A2MA 5L71A 3GNJA 3D4MA 2HE3A 3F4RA 2IL3A 2IMKA 3W6GA 5IMVA 4O5RA 3MDKA 1U88A 1XVQA 1AW9A 3E0UA 2I3YA 2DJ1A 2I9HA 5B8BA 4MZCA 3UJ1A 3ZLPA 1TP9A 3LXZA 4IW9A 1RQMA 3HVSA 2YN1A 2MZCA 3WGXA 3GL3A 4MZBA 2L5OA 4IN0A 2O89A 2GZZA 2P5RA 4ZBAA 1ERUA 2FWHA 3HJMA 4L5LA 4XS4B 3M0FA 2JL4A 1GUMA 5IOXA 4MPGA 3DD3A 4I5QA 3HA9A 4V2LA 1OC8A 3TDGA 4IS0A 1OVNA 3WGDA 2ON7A 1S3CA 4D73B 2HRNA 1K3OA 1ZL9A 2CX4A 3ZIVA 4RUVA 3CTGA 2C80A 2X99A 3W8SA 5G1KA 2AAWA 2E2MA 3F9UA 5KN0A 3DVWA 4MP4A 3UAPA 1OC3A 5C00A 2OBKA 2GSRA 1XWKA 3PH9A 5KEJA 3VWVA 3LSZA 4MABA 5G30A 4K0NA 2V6OA 1EZKA 4LMVA 2H6ZA 3L78A 4FYCA 4MH2A 5GSTA 3LYKA 3IA1A 3IXRA 5CNWA 4I97A 4KDYA 3VPQA 3HKRA 5B6MA 1TOFA 1AQVA 2VCXA 5JCUA 6GSWA 1PGTA 4WR5A 2HSYA 1LU4A 2IMIA 4HU7A 1R5PA 5KN2A 3EE2A 4KAEA 1M7TA 3IPZA 3C7MA 4E8EA 5ABRA 3GUSA 3KXOA 2GT5A 1X9WB 4QQ7A 4GF0A 3RBTA 2JACA 2H1DA 1FO5A 4ZBBA 1SKRB 4OFMA 3DRNA 1SK2A 4GTUA 3IK7A 4LL4B 2PVQA 4XTSA 2M80A 2VLVA 4XS1A 4F0CA 1W89A 2C8UA 2V41A 1GSSA
chains in the Genus database with same CATH superfamily
2PMTA 1O81A 2C3QA 1WIKA 4V2MA 1XVWA 1EV9A 3IK9A 5EY6A 1A0RP 3C8EA 3CRTA 2H0IA 2A2PA 1SYXA 3P2AA 1ZGNA 4MH3A 1WWJA 3M8NA 11GSA 2GQLA 4G0LA 12GSA 3N5OA 1QUWA 2LUSA 3L0HA 1TDIA 3QR6A 3EU4A 4HOJA 2V1MA 3UMAA 2H66A 1I9DA 5ECPB 4AJ7A 4I2UA 4JZQA 3KP9A 2CQ9A 4OCFA 1HD2A 2HRKA 4NPBA 3DWVA 2JSZA 2DIYA 5F0GA 4KCAA 3F4TA 2CV4A 4E8HA 2A4HA 2DLXA 3L9SA 1ON4A 1U6TA 1PD21 5ELAA 3IE3A 4BWQA 2LV3A 4X1UA 4L0WA 1AIUA 1FOHA 3IDVA 4OMVA 4TKYA 1PN0A 5A5HA 4ZB6A 4KE3A 1JZDA 3GV1A 1R26A 1IYIA 4JE1A 4YQVA 5DQYA 2WW2A 3ZRDA 1GUHA 4PQIA 2IPAA 4EKZA 4K7OA 2KLXA 5B8AA 2CAIA 1OYJA 1SVMA 1YZXA 4K2DA 4IQ1A 4ZIJA 2O85A 2EFHA 1YJ6A 3HD5A 5BMUB 2RM5A 1M9BA 2LTKA 4K5SA 2DC5A 1GWCA 1EV4A 1YKAA 1VRSD 4KCEA 1GSEA 4K0GA 1T00A 2O3EA 1I5GA 2AHEA 1QFNA 2KUCA 4G01A 3GYKA 3L9UA 4HEA2 4QMKA 2GT6A 2HZEB 2DKIA 4BIKA 3KMNA 4K5RA 2VCVA 1BG1A 4EF0A 4IHUA 1FG4A 1O73A 2VLUA 1B4PA 2VL2C 3FW2A 4HUAA 3UVHA 1HNAA 4DSQA 2JZTA 2EIQA 4PQ1A 3WD6A 4FQUA 4MNNA 3KEBA 4AJ8A 1X5CA 3TRXA 4HQZA 1PN9A 4JRRA 3F6DA 1DBYA 5KOWA 17GSA 1ML6A 2VD1A 3GURA 1RW1A 1XOAA 3NOFA 4HJMA 4TR1B 3RAZA 4GRFA 2M72A 3CQFA 1OKTA 5LNKe 1BG5A 2EC4A 2C0DA 3OR5A 5CAXA 4F0BA 4F03A 2PPTA 4A5PA 3DGQA 3GFKA 1V40A 4TXOB 2OE1A 1OC9B 4IELA 5GZZB 3VFIA 4AKGA 1ZYPA 5A34B 2YWNA 4TW5A 1ST9A 2H1GA 4NMUA 4TRXA 1O8XA 3DYRA 4HDEA 4E68A 1CQGA 3HDCA 1Q98A 2MBTA 4PX1A 2ZNMA 2IFQB 3I69A 2H70A 4PNFA 4XCSA 3Q74A 5ID2A 2WVXA 4LLRA 3VLNA 1TI1A 2XBQA 2JZRA 2MMAA 4Q5NA 2F51A 4KA0A 3LGCA 1SYRA 2LJRA 2TRXA 2GS3A 4V1Ag 4KW6A 1SENA 4PQHA 2DJKA 4KNDA 3C73A 4CY6A 3GTUA 2DBCA 1IYHA 1WRYA 1XZOA 4IJ3A 1MD4A 2PWJA 5DAKB 4ZB8A 2CVKA 5HFIA 1JZRA 1EP8A 4NXIA 4X4JA 5ECSA 3MAKA 2REMA 4GQFA 2LQOA 2D2ZA 1AXDA 3GMFA 2LQQA 2Z9SA 3GN3A 3D5JA 2OBIA 1FHEA 3WGEA 3H4KA 1Z9HA 2YPMA 8GSSA 3SWLA 3ZTLA 1J08A 3KCMA 3G9BA 1AQXA 4ZB7A 5DBQA 2WVYA 5IM9A 1YQ1A 2F3MA 4GCIA 3TKSA 5F06A 4WXTA 3U5RE 5A4WA 5F05A 4EXJA 2L59A 1VGLA 3A2XA 1TXUA 2H75A 1R4WA 3C1RA 2FD3A 1BJXA 1Z6MA 1FW1A 4POBA 1GSQA 1T1VA 1T8EB 2B7JA 5H5RA 1M3IA 1QMVA 4KX4A 1XWCA 3RFRC 1X0RA 1R5AA 1WPIA 3TB2A 1PX6A 5B7CA 4JR4A 3V1WA 1GNEA 3ME8A 1H75A 3ZITA 3P90A 1FB6A 1MDIA 5G5EA 4W66A 4MCUA 5J9CA 3AY8A 2FGXA 2HRFA 4ML6A 5D93A 1X5DA 5J41A 1GTUA 2X8GA 2K8VA 1SL2B 3KD0A 2N5AA 1LBKA 4JR6A 4POLA 5CO3A 2EIRA 3GX0A 3IV4A 2TRCP 2H6XA 3RHBA 1OAZA 1F6MC 3I6AA 2H1AA 3ZFLA 4K8MA 1AQWA 5G5FA 1THOA 3VWXA 2EIOA 4WF4A 2X4AA 3RPNA 3HVVA 1VF3A 4PI0C 3IOSA 3KM6A 3FEUA 9GSSA 4FIWA 3A5WA 3VPTA 5KN1A 5CRGA 1FVKA 2L57A 3EWLA 3EURA 1T4YA 2XC2A 2YWIA 18GSA 4KDUA 4HQSA 5DCHA 3HCZA 2HQTA 2L6DA 4POMA 1HYUA 4HJ2A 3GA4A 1YEXA 13GSA 2LKUA 5HFGA 3FK8A 3HJPA 2CZ3A 1SK0A 3PGTA 2P0GA 4ZILA 4AKHA 2C0FA 4O92A 2R6KA 1V2AA 5HFKA 4IGJA 1ABAA 1WP0A 4YKGA 4OFNA 1G6YA 5AISA 5GAND 5AIVA 4XRDA 2WCIA 1A24A 6GSVA 1CQHA 1G7OA 3VI7A 3G7IA 2GSQA 3FZ4A 2GZYA 1HNCA 4ICYA 3BCKA 2OKAA 2NPBA 5DVBA 4IQAA 4FYBA 3IRAA 3UBLA 2H8LA 2LEGA 4CDOA 1G7EA 3GKNA 1V9WA 3TJJA 2HLSA 4ML1A 2H0GA 1K3LA 3FR3A 2C4JA 4IP1A 1TKDB 2DJJA 3UIWA 1O8WA 4YKFA 2WULA 3HJOA 2E7PA 4MA9A 4J2FA 2JADA 1K0BA 3EVIA 1EWXA 3HVNA 3BJ5A 5DALB 3F63A 5COHA 5FT3A 3HYPA 2JU5A 3F4SA 2CVBA 5CP1A 1GSYA 1G0TA 4GLTA 1MDJA 3EYTA 2QSIA 3APSA 2QA1A 4POKA 4KB3A 4BWSA 3EMPA 3UL3A 2DJ0A 2X8HA 1Z7PA 1FVJA 2UV8G 1S3DA 3J7Yk 1WMJA 2I4AA 1BX9A 3TRPA 2WFCA 1ILOA 2WRTA 3W8JA 3KIJA 2VUPA 4EDZA 3LQ7A 4CW9A 1YF0A 1KBNA 4ZBDA 1KNGA 4WBJA 3LYPA 4I2TA 1GUKA 2AB6A 3FZAA 1PX7A 1YY7A 5BRTA 3GRXA 3ZVJA 1UC7A 1XG8A 1A2LA 2MMNA 1GSDA 1N8JA 3EINA 3HXSA 4O5UA 4DSRA 4ZL8A 2UZ8A 3LXTA 2XPEA 3F3QA 1TW9A 3L4NA 3I9V2 1XBSA 1YEPA 2H73A 1EP7A 1BQ7A 2R3XA 4FO5A 4FYUA 3BBYA 1S3AA 2JZSA 1O6JA 5LD0A 4AF2A 2LRNA 2O7KA 2TIRA 3TKPA 4ULXA 3E9JB 3QOUA 3A3TA 3P7XA 2H30A 2G2QA 5G31A 4BVYB 2VL3A 2WZ9A 3WYWA 2R0GA 4H86A 5CRDA 2VO4A 4G9HA 2HNLA 3G7YA 2J23A 5EVOA 4MLYA 1EGOA 1A2JA 2WGRA 2LRTA 1K0DA 3G7JA 3M3MA 1EEJA 3UEMA 2I81A 2P31A 2PBJA 4PURA 1HQOA 1EGRA 4EIPA 3ISOA 2HSNB 5D9XA 2HZEA 3M9JA 1X9MB 2YWOA 1Z5YE 4RQXA 1SL0B 3ME7A 2BJXA 2PU9C 2VCZA 2QKEA 4MF6A 3KJYA 2HRKB 4BL7B 4YAPA 4GWRA 4WKWA 3K8NA 1W4VA 4KSOA 4F9ZA 1XPVA 1M2BA 3APQA 1LJRA 1PFOA 5D9TA 3FR6A 1XIYA 1G6WA 2BTOT 3TJFA 2VIMA 1A23A 4G19A 2GQKA 2YANA 3APOA 5CREA 5ECLB 4YQMA 4OCEA 3KH7A 1DUGA 2DJ2A 3MIXA 2V6KA 4TR1A 4EUYA 1EEMA 2YOIA 5DCGA 2QGVA 1PL1A 4AJ6A 1K0CA 1SD9A 5IIZA 4J57E 2KOKA 3BOAA 2OJLA 4IVFA 1YVLA 3IBHA 4TXOA 1OC9A 3DVXA 2HSMA 1M2AA 3F0IA 2GGTA 5IMZA 4RQRA 2RLIA 2EFCA 5A34A 1Z3EA 4PGTA 2LS5A 4NV2A 3BD2A 1UN2A 1EOGA 5J3RA 3FZ5A 3ZMLA 3PR8A 3HHVA 4ISDA 2IFQA 3C71A 4GQCA 3LJRA 5ECOB 2YP6A 3IHGA 2NTOA 3TUEA 1GNWA 3KZQA 2WW0A 2R4VA 2R0CA 2ES7A 4MJBA 1NM3A 3EC3A 2X64A 1ERWA 2YWMA 2GDRA 3QPMA 5AN1A 3MSZA 1A8YA 3ZL5A 3CYNA 3TKQA 1K3YA 2FNOA 1XCCA 2J9HA 4PTSA 4N3ZA 22GSA 4PUAA 3TCOA 1S3RA 2HRAA 1GSUA 5DAKA 4ZL9A 4FH8A 5IMAA 5D9WA 3FRCA 2X49A 2L5LA 5G1LA 3F3RA 1M0UA 4N0ZA 1KEBA 3FMWA 2FCHA 4GSNA 2V32A 3LW9A 2B1LA 4YH2A 2AJQB 3NIVA 1J9BA 5HR0A 2H1BA 4QL9A 3RDWA 1SK1A 1R7HA 1JLWA 5J4UA 3GH9A 1V98A 3TOTA 5A4UA 3LG6A 4PHZC 3LWAA 3ZZXA 5ECNB 2VLTA 1BAYA 3H93A 3QCPA 3A2WA 3ZIJA 4MJCA 2KP2A 5INYA 1TRVA 4BVXB 2YJHA 3GKXA 1GSFA 3M1GA 2F8AA 3IHQA 1N25A 2B3SA 4LMWA 2YV9A 4TR4A 1K0MA 1M99A 1AUCA 10GSA 1C72A 2CT6A 2MMOA 1JHBA 3S9FA 2FA8A 2NBSA 3H8QA 3UBKA 2O5VA 2XPDA 4DSSB 3QAWA 4I8BA 5ECQB 1HNBA 4TXVA 4G0IA 4WETA 1GH2A 3TJKA 4NWYA 2DMMA 1Y25A 2E2GA 6GSXA 5ID2B 3KTBA 5EPFA 2WVXB 2NDOA 3DEXA 4Q5RA 4BA7A 1ZYNA 4ZL7A 2IMFA 1DE1A 3DXBA 2WVZA 4IKHA 3GTUB 4ACSA 3ERWA 1NSWA 4PUFC 5DJMA 1QGVA 3F8UA 2AUVA 2VOCA 1SJ6A 3I43A 2OA7A 5IQYA 5F8BA 1GTBA 3LEFA 3D0ZA 4NHWA 2JSYA 3LORA 3KP8A 5GAPD 2NVLA 2VAFA 2YCDA 2K6VA 3H1NA 3MNGA 5AGYA 1TK0B 4ID0A 5H5QA 2N5BA 2LJAA 5A1NB 1DSBA 3CMIA 1TK8B 1AAZA 4WBRD 4KF9A 4KH7A 1F3AA 3ZMKA 3US3A 1X5EA 1SJZA 4TN8A 1N2AA 2GSSA 5IPHA 2FA4A 5GSSA 4EE0A 1Y6EA 4K6XA 1A0FA 3EU3A 4XRAA 1PMTA 2B5YA 2K18A 3GL5A 3KTLA 1PQNA 5ENUA 3VK9A 3SBCA 1SJIA 5LCZA 2FWFA 3D4TA 2DJ3A 3QMXA 4N0VA 1VF2A 3D21A 1O7UA 1MDKA 1SVOA 1TRWA 3GKKA 4N10A 4TVEA 4XS4A 4XHMA 4V1Ap 3RPPA 2LSTA 2M46A 3HY2A 4OO5A 2B5EA 5ECKB 1O85A 1GLPA 1TRSA 5IOWA 4HZ2A 4D73A 3CHXC 5D73A 4YAVA 5DQSA 2PVOC 3CSJA 1VF4A 4N30A 4YQUA 5IMFA 1J0FA 3H79A 3E3EA 3IR4A 1EOHA 1XWGA 4AKXB 3FKFA 2X8CA 1URMA 5IMCA 1XW6A 2FWGA 1T4ZA 1ZYQB 2OE3A 5CRWA 2PN8A 3A2VA 2VM2A 3CTFA 3HZ8A 2DMLA 3FYGA 4Z7XA 3WT2A 4IJIA 3FY7A 5J5NA 2A2RA 1AC1A 2IWTA 3L9VA 5DJLA 3GX8A 2A2SA 3VWWA 2LNTA 1MTCA 4F82A 5DALA 3ED3A 1PKZA 2C0GA 2FY6A 2IN3A 4IBPA 3C1SA 5ECHB 2VCTA 2GVPA 1ZOFA 1X9SB 1THXA 2G0FA 1B8XA 3DIEA 1TRUA 2I1UA 3MWHA 1QQ2A 1JZWA 3DMLA 2RIIA 1UVZA 2ALBA 2VM1A 1K0NA 4KGIA 2CX3A 4K2XA 3TGZA 1QK8A 3WT1A 4K7IA 5ECRB 1USBA 3TU3B 1WJKA 3PINA 5H5SA 3IC8A 1V57A 2QC7A 1ZCPA 5IPGA 5JCGA 2PERA 2DSAA 4AGSA 1GTAA 5A4VA 5B6NA 2HXKA 4AI6A 1PL2A 1FB0A 4PI2C 2VL2A 4EDYA 1F3BA 2WW3A 4HU9A 2YJ7A 3TRQA 4L8EA 4X43A 4MJAA 1T3BA 4HS1A 4KSMA 2H76A 4WR4A 4X0XA 2B6MA 4RI6A 3IC4A 4MMMA 1U87A 2L4CA 2MBSA 3TKSC 1V58A 3R3EA 2FWEA 3MYDA 4O5QA 2O8VB 3PPUA 2RUEA 4K1FA 3TJGA 2H01A 5FHIA 2L4QA 2C3TA 4GSTA 2E0QA 1JFUA 7GSSA 2MMZA 3UOMA 1TK5B 2GTUA 2CA8A 1ZMAA 3CRUA 4KDXA 1BYEA 4OFTA 2PGTA 1TXXA 1Q4JA 4MZWA 4LA1A 3JCML 1TJDA 2H72A 3QFAC 4BVYA 2A4VA 4L5OA 3D22A 4I6XA 1PKWA 3CWGA 1ZZYA 5IO2A 1F9MA 4EL1A 1UA5A 2B5XA 4AKIA 1GP1A 2HI7A 5HR3A 2CZ2A 4HSCX 3TOUA 3GSSA 2YZUA 3F6FA 1RK4A 6GSTA 3IAM2 4OO4A 1GL8A 3FZ9A 3TKRA 2CVDA 2HSNA 4K9ZA 1OKDA 4WEYA 3R2QA 4HZ4A 2GSTA 2FHEA 5J4VA 2L6CA 5BMUA 4MJEA 4TOPA 1B4QA 4WF5A 4GSSA 3HVXA 1SL1B 2EFEA 4BL7A 1MD3A 1XXUA 2OE0A 3GHAA 2QA2A 4OD7A 2CAQA 1QXHA 1XWAA 6GSYA 2VCWA 19GSA 2H19A 4PXOA 4ECBA 2KP1A 4G2EA 2R5GA 2IMDA 2GQMA 4XIHA 4L0UA 1Z6NA 2ZUPA 5ECIB 2C0EA 1M9AA 4CHSA 2R37A 1ERTA 4DEJA 5KOXA 14GSA 2XBIA 3O76A 3TKSE 3BCIA 4JEDA 1SU9A 1TU7A 4JBBA 1OE8A 2XHFA 3CBUA 3N9JA 4USSA 2RM6A 1SKWB 1OE7A 5HR1A 1F2EA 2IJYA 4EVMA 3QAGA 1GRXA 1PRXA 2DKHA 2H71A 4JU5A 4XS6A 4TR0A 5E4WA 3ZYWA 16GSA 2EFDA 4MPFA 1B9YC 3ZFBA 1U3IA 5A5HB 4OWYA 3HMJG 2YZHA 1WE0A 5KN3A 2WB9A 1XFLA 5F07A 5D96A 6GSUA 5HR2A 4ECIA 3KGKA 2HFDA 5ELGA 2FUG2 2RUFA 5A5KA 3KMOA 1Z7RA 4QL7A 4Q5FA 4MF5A 2LJKA 5DDLA 2P5QA 1DE2A 4ECJA 4NAXA 1K0OA 3J7Yb 2C1YA 2FLSA 3ERFA 2MYGA 4EIQA 20GSA 5J9BA 1GLQA 2GLRA 4TR3A 1XOBA 2HYXA 4CY8A 5JWQB 1GULA 1U3AA 1XW9A 1SKSB 3EMXA 1GTIA 3GKMA 1FAAA 2DIZA 3CXGA 3NZNA 2PUKC 1YKCA 4P3YB 3FHKA 1MEKA 6GSSA 2OACA 1S4BP 1T7PB 2HSMB 4BVXA 5G2ZA 4EO3A 1TU8A 2OADA 3DKSA 1XWBA 2HSHA 4ZB9A 1NHYA 4RI7A 4G10A 1TTZA 2C3NA 2LNSA 3U6VA 1NHOA 2YNXA 3ZVJD 4DSSA 1YEWC 2H6YA 2HT9A 1K0AA 2LRCA 5C04A 1YDKA 1BF5A 3RHCA 3UVTA 5JWRB 1ERVA 2WJUA 2K9FA 2WDUA 2K8SA 5EL8A 3GSTA 1NW2A 2H0HA 5CYYA 3VURA 4MDCA 3Q19A 2B7KA 3D6IA 3GIXA 4FXYP 1PSQA 4IP6A 2H74A 4ECCA 4F2IA 1JLVA 5D8IA 1F37A 2B1KA 4GXZA 1BEDA 1I1IP 5CRHA 1ZYEA 5HQPA 4MF7A 3ZREA 2R0PA 3CSHA 4O32A 2GZPA 3ERGA 3Q6OA 2VCQA 2ON5A 2OT3A 2IMEA 1TI3A 2WS2A 2AYTA 3CSIA 3IAS2 5JWOB 2VL9A 5A1NA 3QD9A 1SD8A 3QDNA 3HZ4A 2AV4A 4NHZA 2KHPA 1E6BA 4G0KA 4ZXGA 4ILFA 3EPTA 3O6TA 2F9SA 3QAVA 3LFLA 4V2NA 1PA3A 5FWGA 5J47A 1H4OA 1VF1A 3VI5A 2WW1A 1JZOA 1XW5A 5ECMB 5D9VA 1Y1UA 2YV7A 4N11A 1B48A 2IIYA 2WZSA 4GDFA 4NV5A 2ZCTA 4DVCA 5AIXA 1B9XC 3P8WA 4HI7A 1YF1A 4BPYA 1KTEA 4K7NA 3TJBA 1E2YA 4EC0A 1M2DA 1A8LA 3KH9A 3QFBC 1FOVA 1SVLA 4KUNA 2HZFA 2V2GA 3VWUA 3M9KA 5E59A 4J56E 2BMXA 1WOUA 1M3JA 5JCWA 2O87A 3O3TA 2VD0A 3Q18A 3RGBC 2N5FA 4PNGA 3GH6A 5J4YA 4MK3A 3UARA 4Z2UA 3FR9A 4LL1B 1ACVA 5IO0A 5IMDA 2R2JA 4O7HA 4Q5QA 4Z2RA 2F8FA 1A2MA 5L71A 3GNJA 3D4MA 2HE3A 3F4RA 2IL3A 2IMKA 3W6GA 5IMVA 4O5RA 3MDKA 1U88A 1XVQA 1AW9A 3E0UA 2I3YA 2DJ1A 2I9HA 5B8BA 4MZCA 3UJ1A 3ZLPA 1TP9A 3LXZA 4IW9A 1RQMA 3HVSA 2YN1A 2MZCA 3WGXA 3GL3A 4MZBA 2L5OA 4IN0A 2O89A 2GZZA 2P5RA 4ZBAA 1ERUA 2FWHA 3HJMA 4L5LA 4XS4B 3M0FA 2JL4A 1GUMA 5IOXA 4MPGA 3DD3A 4I5QA 3HA9A 4V2LA 1OC8A 3TDGA 4IS0A 1OVNA 3WGDA 2ON7A 1S3CA 4D73B 2HRNA 1K3OA 1ZL9A 2CX4A 3ZIVA 4RUVA 3CTGA 2C80A 2X99A 3W8SA 5G1KA 2AAWA 2E2MA 3F9UA 5KN0A 3DVWA 4MP4A 3UAPA 1OC3A 5C00A 4Z2TA 2OBKA 2GSRA 1XWKA 3PH9A 5KEJA 3VWVA 3LSZA 4MABA 5G30A 4K0NA 2V6OA 1EZKA 4LMVA 5J40A 2H6ZA 3L78A 4FYCA 4MH2A 5GSTA 3LYKA 3IA1A 3IXRA 5CNWA 4I97A 4KDYA 3VPQA 3HKRA 5B6MA 1TOFA 1AQVA 2VCXA 5JCUA 6GSWA 1PGTA 4WR5A 2HSYA 1LU4A 2IMIA 4HU7A 1R5PA 5KN2A 3EE2A 4KAEA 2H1LA 1M7TA 3IPZA 3C7MA 4E8EA 2O36A 5ABRA 3GUSA 3KXOA 2GT5A 1X9WB 4QQ7A 4GF0A 3RBTA 2JACA 2H1DA 1FO5A 4ZBBA 1SKRB 4OFMA 3DRNA 1SK2A 4GTUA 3IK7A 4LL4B 3A5IA 2PVQA 4XTSA 2M80A 2VKZG 2VLVA 4XS1A 4F0CA 1W89A 2C8UA 2V41A 1GSSA
chains in the Genus database with same CATH topology
2PMTA 1O81A 2C3QA 1WIKA 4V2MA 1XVWA 1EV9A 3IK9A 5EY6A 1A0RP 3C8EA 3CRTA 2H0IA 2A2PA 1SYXA 3P2AA 1ZGNA 4MH3A 1WWJA 3M8NA 11GSA 2GQLA 4G0LA 12GSA 3N5OA 1QUWA 2LUSA 3L0HA 1TDIA 3QR6A 3EU4A 4HOJA 2V1MA 3UMAA 2H66A 1I9DA 5ECPB 4AJ7A 4I2UA 4JZQA 3KP9A 2CQ9A 4OCFA 1HD2A 2HRKA 4NPBA 3DWVA 2JSZA 2DIYA 5F0GA 4KCAA 3F4TA 2CV4A 4E8HA 2A4HA 2DLXA 3L9SA 1ON4A 1U6TA 1PD21 5ELAA 3IE3A 4BWQA 2LV3A 4X1UA 4L0WA 1AIUA 1FOHA 3IDVA 4OMVA 4TKYA 1PN0A 5A5HA 4ZB6A 4KE3A 1JZDA 3GV1A 1R26A 1IYIA 4JE1A 4YQVA 5DQYA 3ZRDA 1GUHA 4PQIA 2IPAA 4EKZA 4K7OA 2KLXA 5B8AA 2CAIA 1OYJA 1SVMA 1YZXA 4K2DA 4IQ1A 4ZIJA 2O85A 2EFHA 1YJ6A 3HD5A 5BMUB 2RM5A 1M9BA 2LTKA 4K5SA 2DC5A 1GWCA 1EV4A 1YKAA 1VRSD 4KCEA 1GSEA 4K0GA 1T00A 1I5GA 2AHEA 1QFNA 2KUCA 4G01A 3GYKA 3L9UA 4HEA2 4QMKA 2GT6A 2HZEB 2DKIA 3KMNA 4K5RA 2VCVA 1BG1A 4EF0A 4IHUA 1FG4A 1O73A 2VLUA 1B4PA 2VL2C 3FW2A 4HUAA 3UVHA 1HNAA 4DSQA 2JZTA 2EIQA 4PQ1A 3WD6A 4FQUA 4MNNA 3KEBA 4AJ8A 1X5CA 3TRXA 4HQZA 1PN9A 4JRRA 3F6DA 1DBYA 5KOWA 17GSA 1ML6A 3NOFA 2VD1A 3GURA 1RW1A 1XOAA 4HJMA 4TR1B 3RAZA 4GRFA 2M72A 1OKTA 5LNKe 1BG5A 2EC4A 2C0DA 3OR5A 5CAXA 4F0BA 4F03A 2PPTA 4A5PA 3DGQA 3GFKA 1V40A 4TXOB 2OE1A 1OC9B 4IELA 5GZZB 3VFIA 4AKGA 1ZYPA 5A34B 2YWNA 4TW5A 1ST9A 2H1GA 4NMUA 4TRXA 1O8XA 3DYRA 4HDEA 4E68A 1CQGA 3HDCA 1Q98A 2MBTA 4PX1A 2ZNMA 2IFQB 3I69A 2H70A 4PNFA 4XCSA 3Q74A 5ID2A 4LLRA 3VLNA 1TI1A 2XBQA 2JZRA 2MMAA 4Q5NA 2F51A 4KA0A 3LGCA 1SYRA 2LJRA 2TRXA 2GS3A 4V1Ag 4KW6A 1SENA 4PQHA 2DJKA 4KNDA 3C73A 4CY6A 3GTUA 2DBCA 1IYHA 1WRYA 1XZOA 4IJ3A 1MD4A 2PWJA 5DAKB 4ZB8A 2CVKA 5HFIA 1JZRA 1EP8A 4NXIA 4X4JA 5ECSA 3MAKA 2REMA 4GQFA 2LQOA 2D2ZA 1AXDA 3GMFA 2LQQA 2Z9SA 3GN3A 3D5JA 2OBIA 1FHEA 3WGEA 3H4KA 1Z9HA 2YPMA 8GSSA 3SWLA 3ZTLA 1J08A 3KCMA 3G9BA 1AQXA 4ZB7A 5DBQA 5IM9A 1YQ1A 2F3MA 4GCIA 3TKSA 5F06A 4WXTA 3U5RE 5A4WA 5F05A 4EXJA 2L59A 1VGLA 3A2XA 1TXUA 2H75A 1R4WA 3C1RA 2FD3A 1BJXA 1Z6MA 1FW1A 4POBA 1GSQA 1T1VA 1T8EB 2B7JA 5H5RA 1QMVA 4KX4A 1XWCA 1X0RA 1R5AA 1WPIA 3TB2A 1PX6A 5B7CA 4JR4A 3V1WA 1GNEA 3ME8A 1H75A 3ZITA 3P90A 1FB6A 1MDIA 5G5EA 4W66A 4MCUA 5J9CA 3AY8A 2FGXA 2HRFA 4ML6A 5D93A 1X5DA 5J41A 1GTUA 2X8GA 2K8VA 1SL2B 3KD0A 2N5AA 1LBKA 4JR6A 4POLA 5CO3A 2EIRA 3GX0A 3IV4A 2TRCP 2H6XA 3RHBA 1OAZA 1F6MC 3I6AA 2H1AA 3ZFLA 4K8MA 1AQWA 5G5FA 1THOA 3VWXA 2EIOA 4WF4A 2X4AA 3RPNA 3HVVA 1VF3A 3IOSA 3KM6A 3FEUA 9GSSA 4FIWA 3A5WA 3VPTA 5KN1A 5CRGA 1FVKA 2L57A 3EWLA 3EURA 1T4YA 2XC2A 2YWIA 18GSA 4KDUA 4HQSA 5DCHA 3HCZA 2HQTA 2L6DA 4POMA 1HYUA 4HJ2A 3GA4A 1YEXA 13GSA 2LKUA 5HFGA 3FK8A 3HJPA 2CZ3A 1SK0A 3PGTA 2P0GA 4ZILA 4AKHA 2C0FA 4O92A 2R6KA 1V2AA 5HFKA 4IGJA 1ABAA 1WP0A 4YKGA 4OFNA 1G6YA 5AISA 5GAND 5AIVA 4XRDA 2WCIA 1A24A 6GSVA 1CQHA 1G7OA 3VI7A 3G7IA 2GSQA 3FZ4A 2GZYA 1HNCA 4ICYA 3BCKA 2OKAA 2NPBA 5DVBA 4IQAA 4FYBA 3IRAA 3UBLA 2H8LA 2LEGA 4CDOA 1G7EA 3GKNA 1V9WA 3TJJA 2HLSA 4ML1A 2H0GA 1K3LA 3FR3A 2C4JA 4IP1A 1TKDB 2DJJA 3UIWA 1O8WA 4YKFA 2WULA 3HJOA 2E7PA 4MA9A 4J2FA 2JADA 1K0BA 3EVIA 1EWXA 3BJ5A 5DALB 3F63A 5COHA 5FT3A 3HYPA 2JU5A 3F4SA 2CVBA 5CP1A 1GSYA 1G0TA 4GLTA 1MDJA 3EYTA 2QSIA 3APSA 2QA1A 4POKA 4KB3A 4BWSA 3EMPA 3UL3A 2DJ0A 2X8HA 1Z7PA 1FVJA 2UV8G 1S3DA 3J7Yk 1WMJA 2I4AA 1BX9A 3TRPA 2WFCA 1ILOA 2WRTA 3W8JA 3KIJA 2VUPA 4EDZA 3LQ7A 4CW9A 1YF0A 1KBNA 4ZBDA 1KNGA 4WBJA 3LYPA 4I2TA 1GUKA 2AB6A 3FZAA 1PX7A 1YY7A 5BRTA 3GRXA 3ZVJA 1UC7A 1A2LA 2MMNA 1GSDA 1N8JA 3EINA 3HXSA 4O5UA 4DSRA 4ZL8A 2UZ8A 3LXTA 2XPEA 3F3QA 1TW9A 3L4NA 3I9V2 1XBSA 1YEPA 2H73A 1EP7A 1BQ7A 2R3XA 4FO5A 4FYUA 3BBYA 1S3AA 2JZSA 1O6JA 5LD0A 4AF2A 2LRNA 2O7KA 2TIRA 3TKPA 4ULXA 3E9JB 3QOUA 3A3TA 3P7XA 2H30A 2G2QA 5G31A 4BVYB 2VL3A 2WZ9A 3WYWA 2R0GA 4H86A 5CRDA 2VO4A 4G9HA 2HNLA 3G7YA 2J23A 5EVOA 4MLYA 1EGOA 1A2JA 2WGRA 2LRTA 1K0DA 3G7JA 3M3MA 1EEJA 3UEMA 2I81A 2P31A 2PBJA 4PURA 1HQOA 1EGRA 4EIPA 3ISOA 2HSNB 5D9XA 2HZEA 3M9JA 1X9MB 2YWOA 1Z5YE 4RQXA 1SL0B 3ME7A 2BJXA 2PU9C 2VCZA 2QKEA 4MF6A 3KJYA 2HRKB 4BL7B 4YAPA 4GWRA 4WKWA 3K8NA 1W4VA 4KSOA 4F9ZA 1XPVA 1M2BA 3APQA 1LJRA 5D9TA 3FR6A 1XIYA 1G6WA 2BTOT 3TJFA 2VIMA 1A23A 4G19A 2GQKA 2YANA 3APOA 5CREA 5ECLB 4YQMA 4OCEA 3KH7A 1DUGA 2DJ2A 3MIXA 2V6KA 4TR1A 4EUYA 1EEMA 2YOIA 5DCGA 2QGVA 1PL1A 4AJ6A 1K0CA 1SD9A 5IIZA 4J57E 2KOKA 3BOAA 2OJLA 4IVFA 1YVLA 3IBHA 4TXOA 1OC9A 3DVXA 2HSMA 1M2AA 3F0IA 2GGTA 5IMZA 4RQRA 2RLIA 2EFCA 5A34A 1Z3EA 4PGTA 2LS5A 4NV2A 3BD2A 1UN2A 1EOGA 5J3RA 3FZ5A 3ZMLA 3PR8A 3HHVA 4ISDA 2IFQA 3C71A 4GQCA 3LJRA 5ECOB 2YP6A 3IHGA 2NTOA 3TUEA 1GNWA 3KZQA 2R4VA 2R0CA 2ES7A 4MJBA 1NM3A 3EC3A 2X64A 1ERWA 2YWMA 2GDRA 3QPMA 5AN1A 3MSZA 1A8YA 3ZL5A 3CYNA 3TKQA 1K3YA 2FNOA 1XCCA 2J9HA 4PTSA 4N3ZA 22GSA 4PUAA 3TCOA 2HRAA 1GSUA 5DAKA 4ZL9A 4FH8A 5IMAA 5D9WA 3FRCA 2X49A 2L5LA 5G1LA 3F3RA 1M0UA 4N0ZA 1KEBA 3FMWA 2FCHA 4GSNA 3LW9A 2V32A 2B1LA 4YH2A 2AJQB 3NIVA 1J9BA 5HR0A 2H1BA 4QL9A 3RDWA 1SK1A 1R7HA 1JLWA 5J4UA 3GH9A 1V98A 3TOTA 5A4UA 3LG6A 3LWAA 3ZZXA 5ECNB 2VLTA 1BAYA 3H93A 3QCPA 3A2WA 3ZIJA 4MJCA 2KP2A 5INYA 1TRVA 4BVXB 2YJHA 3GKXA 1GSFA 3M1GA 2F8AA 3IHQA 1N25A 2B3SA 4LMWA 2YV9A 4TR4A 1K0MA 1M99A 1AUCA 10GSA 1C72A 2CT6A 2MMOA 1JHBA 3S9FA 2FA8A 2NBSA 3H8QA 3UBKA 2O5VA 2XPDA 4DSSB 3QAWA 4I8BA 5ECQB 1HNBA 4TXVA 4G0IA 4WETA 1GH2A 3TJKA 4NWYA 2DMMA 1Y25A 2E2GA 6GSXA 5ID2B 3KTBA 5EPFA 2NDOA 3DEXA 4Q5RA 4BA7A 1ZYNA 4ZL7A 2IMFA 1DE1A 3DXBA 4IKHA 3GTUB 4ACSA 3ERWA 1NSWA 4PUFC 5DJMA 1QGVA 3F8UA 2AUVA 2VOCA 1SJ6A 3I43A 2OA7A 5IQYA 5F8BA 1GTBA 3LEFA 3D0ZA 4NHWA 2JSYA 3LORA 3KP8A 5GAPD 2NVLA 2VAFA 2YCDA 2K6VA 3H1NA 3MNGA 5AGYA 1TK0B 4ID0A 5H5QA 2N5BA 2LJAA 5A1NB 1DSBA 3CMIA 1TK8B 1AAZA 4WBRD 4KF9A 4KH7A 1F3AA 3ZMKA 3US3A 1X5EA 1SJZA 4TN8A 1N2AA 2GSSA 5IPHA 2FA4A 5GSSA 4EE0A 1Y6EA 4K6XA 1A0FA 3EU3A 4XRAA 1PMTA 2B5YA 2K18A 3GL5A 3KTLA 1PQNA 5ENUA 3VK9A 3SBCA 1SJIA 5LCZA 2FWFA 3D4TA 2DJ3A 3QMXA 4N0VA 1VF2A 3D21A 1O7UA 1MDKA 1SVOA 1TRWA 3GKKA 4N10A 4TVEA 4XS4A 4XHMA 4V1Ap 3RPPA 2LSTA 2M46A 3HY2A 4OO5A 2B5EA 5ECKB 1O85A 1GLPA 1TRSA 5IOWA 4HZ2A 4D73A 5D73A 4YAVA 5DQSA 2PVOC 3CSJA 1VF4A 4N30A 4YQUA 5IMFA 1J0FA 3H79A 3E3EA 3IR4A 1EOHA 1XWGA 4AKXB 3FKFA 2X8CA 1URMA 5IMCA 1XW6A 2FWGA 1T4ZA 1ZYQB 2OE3A 5CRWA 2PN8A 3A2VA 2VM2A 3CTFA 3HZ8A 2DMLA 3FYGA 4Z7XA 3WT2A 4IJIA 3FY7A 5J5NA 2A2RA 1AC1A 2IWTA 3L9VA 5DJLA 3GX8A 2A2SA 3VWWA 2LNTA 1MTCA 4F82A 5DALA 3ED3A 1PKZA 2C0GA 2FY6A 2IN3A 4IBPA 3C1SA 5ECHB 2VCTA 2GVPA 1ZOFA 1X9SB 1THXA 2G0FA 1B8XA 3DIEA 1TRUA 2I1UA 3MWHA 1QQ2A 1JZWA 3DMLA 2RIIA 1UVZA 2ALBA 2VM1A 1K0NA 4KGIA 2CX3A 4K2XA 3TGZA 1QK8A 3WT1A 4K7IA 5ECRB 1USBA 3TU3B 1WJKA 3PINA 5H5SA 3IC8A 1V57A 2QC7A 1ZCPA 5IPGA 5JCGA 2PERA 2DSAA 4AGSA 1GTAA 5A4VA 5B6NA 2HXKA 4AI6A 1PL2A 1FB0A 2VL2A 4EDYA 1F3BA 4HU9A 2YJ7A 3TRQA 4L8EA 4X43A 4MJAA 1T3BA 4HS1A 4KSMA 2H76A 4WR4A 4X0XA 2B6MA 4RI6A 3IC4A 4MMMA 1U87A 2L4CA 2MBSA 3TKSC 1V58A 3R3EA 2FWEA 3MYDA 4O5QA 2O8VB 3PPUA 2RUEA 4K1FA 3TJGA 2H01A 5FHIA 2L4QA 2C3TA 4GSTA 2E0QA 1JFUA 7GSSA 2MMZA 3UOMA 1TK5B 2GTUA 2CA8A 1ZMAA 3CRUA 4KDXA 1BYEA 4OFTA 2PGTA 1TXXA 1Q4JA 4MZWA 4LA1A 3JCML 1TJDA 2H72A 3QFAC 4BVYA 2A4VA 4L5OA 3D22A 4I6XA 1PKWA 3CWGA 1ZZYA 5IO2A 1F9MA 4EL1A 1UA5A 2B5XA 4AKIA 1GP1A 2HI7A 5HR3A 2CZ2A 3TOUA 3GSSA 2YZUA 3F6FA 1RK4A 6GSTA 3IAM2 4OO4A 1GL8A 3FZ9A 3TKRA 2CVDA 2HSNA 4K9ZA 1OKDA 4WEYA 3R2QA 4HZ4A 2GSTA 2FHEA 5J4VA 2L6CA 5BMUA 4MJEA 4TOPA 1B4QA 4WF5A 4GSSA 3HVXA 1SL1B 2EFEA 4BL7A 1MD3A 1XXUA 2OE0A 3GHAA 2QA2A 4OD7A 2CAQA 1QXHA 1XWAA 6GSYA 2VCWA 19GSA 2H19A 4PXOA 4ECBA 2KP1A 4G2EA 2R5GA 2IMDA 2GQMA 4XIHA 4L0UA 1Z6NA 2ZUPA 5ECIB 2C0EA 1M9AA 4CHSA 2R37A 1ERTA 4DEJA 5KOXA 14GSA 2XBIA 3O76A 3TKSE 3BCIA 4JEDA 1SU9A 1TU7A 4JBBA 1OE8A 2XHFA 3CBUA 3N9JA 4USSA 2RM6A 1SKWB 1OE7A 5HR1A 1F2EA 2IJYA 4EVMA 3QAGA 1GRXA 1PRXA 2DKHA 2H71A 4JU5A 4XS6A 4TR0A 5E4WA 3ZYWA 16GSA 2EFDA 4MPFA 1B9YC 3ZFBA 1U3IA 5A5HB 4OWYA 3HMJG 2YZHA 1WE0A 5KN3A 2WB9A 1XFLA 5F07A 5D96A 6GSUA 5HR2A 4ECIA 3KGKA 2HFDA 5ELGA 2FUG2 2RUFA 5A5KA 3KMOA 1Z7RA 4QL7A 4Q5FA 4MF5A 2LJKA 5DDLA 2P5QA 1DE2A 4ECJA 4NAXA 1K0OA 3J7Yb 2C1YA 2FLSA 3ERFA 2MYGA 4EIQA 20GSA 5J9BA 1GLQA 2GLRA 4TR3A 1XOBA 2HYXA 4CY8A 5JWQB 1GULA 1U3AA 1XW9A 1SKSB 3EMXA 1GTIA 3GKMA 1FAAA 2DIZA 3CXGA 3NZNA 2PUKC 1YKCA 4P3YB 3FHKA 1MEKA 6GSSA 2OACA 1T7PB 2HSMB 4BVXA 5G2ZA 4EO3A 1TU8A 2OADA 3DKSA 1XWBA 2HSHA 4ZB9A 1NHYA 4RI7A 4G10A 1TTZA 2C3NA 2LNSA 3U6VA 1NHOA 2YNXA 3ZVJD 4DSSA 2H6YA 2HT9A 1K0AA 2LRCA 5C04A 1YDKA 1BF5A 3RHCA 3UVTA 5JWRB 1ERVA 2WJUA 2K9FA 2WDUA 2K8SA 5EL8A 3GSTA 1NW2A 2H0HA 5CYYA 3VURA 4MDCA 3Q19A 2B7KA 3D6IA 3GIXA 1PSQA 4IP6A 2H74A 4ECCA 4F2IA 1JLVA 5D8IA 1F37A 2B1KA 4GXZA 1BEDA 5CRHA 1ZYEA 5HQPA 4MF7A 3ZREA 2R0PA 3CSHA 4O32A 2GZPA 3ERGA 3Q6OA 2VCQA 2ON5A 2OT3A 2IMEA 1TI3A 2WS2A 2AYTA 3CSIA 3IAS2 5JWOB 2VL9A 5A1NA 3QD9A 1SD8A 3QDNA 3HZ4A 2AV4A 4NHZA 2KHPA 1E6BA 4G0KA 4ZXGA 4ILFA 3EPTA 3O6TA 2F9SA 3QAVA 3LFLA 4V2NA 1PA3A 5FWGA 5J47A 1H4OA 1VF1A 3VI5A 1JZOA 1XW5A 5ECMB 5D9VA 1Y1UA 2YV7A 4N11A 1B48A 2IIYA 4GDFA 4NV5A 2ZCTA 4DVCA 5AIXA 1B9XC 3P8WA 4HI7A 1YF1A 4BPYA 1KTEA 4K7NA 3TJBA 1E2YA 4EC0A 1M2DA 1A8LA 3KH9A 3QFBC 1FOVA 1SVLA 4KUNA 2HZFA 2V2GA 3VWUA 3M9KA 5E59A 4J56E 2BMXA 1WOUA 5JCWA 2O87A 3O3TA 2VD0A 3Q18A 2N5FA 4PNGA 3GH6A 5J4YA 4MK3A 3UARA 4Z2UA 3FR9A 4LL1B 1ACVA 5IO0A 5IMDA 2R2JA 4O7HA 4Q5QA 4Z2RA 2F8FA 1A2MA 5L71A 3GNJA 3D4MA 2HE3A 3F4RA 2IL3A 2IMKA 3W6GA 5IMVA 4O5RA 3MDKA 1U88A 1XVQA 1AW9A 3E0UA 2I3YA 2DJ1A 2I9HA 5B8BA 4MZCA 3UJ1A 3ZLPA 1TP9A 3LXZA 4IW9A 1RQMA 3HVSA 2YN1A 2MZCA 3WGXA 3GL3A 4MZBA 2L5OA 4IN0A 2O89A 2GZZA 2P5RA 4ZBAA 1ERUA 2FWHA 3HJMA 4L5LA 4XS4B 3M0FA 2JL4A 1GUMA 5IOXA 4MPGA 3DD3A 4I5QA 3HA9A 4V2LA 1OC8A 3TDGA 4IS0A 1OVNA 3WGDA 2ON7A 1S3CA 4D73B 2HRNA 1K3OA 1ZL9A 2CX4A 3ZIVA 4RUVA 3CTGA 2C80A 2X99A 3W8SA 5G1KA 2AAWA 2E2MA 3F9UA 5KN0A 3DVWA 4MP4A 3UAPA 1OC3A 5C00A 4Z2TA 2OBKA 2GSRA 1XWKA 3PH9A 5KEJA 3VWVA 3LSZA 4MABA 5G30A 4K0NA 2V6OA 1EZKA 4LMVA 5J40A 2H6ZA 3L78A 4FYCA 4MH2A 5GSTA 3LYKA 3IA1A 3IXRA 5CNWA 4I97A 4KDYA 3VPQA 3HKRA 5B6MA 1TOFA 1AQVA 2VCXA 5JCUA 6GSWA 1PGTA 4WR5A 2HSYA 1LU4A 2IMIA 4HU7A 1R5PA 5KN2A 3EE2A 4KAEA 2H1LA 1M7TA 3IPZA 3C7MA 4E8EA 5ABRA 3GUSA 3KXOA 2GT5A 1X9WB 4QQ7A 4GF0A 3RBTA 2JACA 2H1DA 1FO5A 4ZBBA 1SKRB 4OFMA 3DRNA 1SK2A 4GTUA 3IK7A 4LL4B 3A5IA 2PVQA 4XTSA 2M80A 2VKZG 2VLVA 4XS1A 4F0CA 1W89A 2C8UA 2V41A 1GSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMT A;  1O81 A;  2C3Q A;  1WIK A;  4V2M A;  1XVW A;  1EV9 A;  3IK9 A;  5EY6 A;  1A0R P;  3C8E A;  3CRT A;  2H0I A;  1SYX A;  3P2A A;  1ZGN A;  4MH3 A;  1WWJ A;  3M8N A;  11GS A;  2GQL A;  4G0L A;  12GS A;  3N5O A;  1QUW A;  2LUS A;  3L0H A;  1TDI A;  3QR6 A;  3EU4 A;  4HOJ A;  2V1M A;  3UMA A;  2H66 A;  1I9D A;  5ECP B;  4AJ7 A;  4I2U A;  4JZQ A;  3KP9 A;  2CQ9 A;  4OCF A;  1HD2 A;  2HRK A;  4NPB A;  3DWV A;  2JSZ A;  2DIY A;  5F0G A;  4KCA A;  3F4T A;  2CV4 A;  4E8H A;  2DLX A;  3L9S A;  1ON4 A;  1U6T A;  1PD2 1;  5ELA A;  3IE3 A;  4BWQ A;  2LV3 A;  4X1U A;  4L0W A;  1AIU A;  3IDV A;  4OMV A;  4TKY A;  4ZB6 A;  4KE3 A;  1JZD A;  3GV1 A;  1R26 A;  1IYI A;  4JE1 A;  4YQV A;  5DQY A;  3ZRD A;  1GUH A;  4PQI A;  2IPA A;  4EKZ A;  4K7O A;  2KLX A;  5B8A A;  2CAI A;  1OYJ A;  1YZX A;  4K2D A;  4IQ1 A;  4ZIJ A;  2O85 A;  1YJ6 A;  3HD5 A;  2RM5 A;  1M9B A;  2LTK A;  2DC5 A;  1GWC A;  1EV4 A;  1YKA A;  1VRS D;  4KCE A;  1GSE A;  4K0G A;  1T00 A;  1I5G A;  2AHE A;  1QFN A;  2KUC A;  4HEA 2;  3GYK A;  3L9U A;  2GT6 A;  2HZE B;  3KMN A;  2VCV A;  4EF0 A;  4IHU A;  1FG4 A;  1O73 A;  2VLU A;  1B4P A;  2VL2 C;  3FW2 A;  4HUA A;  3UVH A;  1HNA A;  4DSQ A;  2JZT A;  2EIQ A;  4PQ1 A;  3WD6 A;  4FQU A;  3KEB A;  4AJ8 A;  1X5C A;  3TRX A;  4HQZ A;  1PN9 A;  4JRR A;  3F6D A;  1DBY A;  17GS A;  1ML6 A;  3NOF A;  2VD1 A;  3GUR A;  1RW1 A;  1XOA A;  4HJM A;  4TR1 B;  3RAZ A;  4GRF A;  2M72 A;  1OKT A;  5LNK e;  1BG5 A;  2EC4 A;  2C0D A;  3OR5 A;  5CAX A;  4F0B A;  4F03 A;  2PPT A;  3DGQ A;  3GFK A;  1V40 A;  4TXO B;  2OE1 A;  1OC9 B;  4IEL A;  5GZZ B;  3VFI A;  2YWN A;  4TW5 A;  1ST9 A;  2H1G A;  4NMU A;  4TRX A;  1O8X A;  3DYR A;  4HDE A;  1CQG A;  3HDC A;  1Q98 A;  2MBT A;  4PX1 A;  2ZNM A;  2IFQ B;  3I69 A;  2H70 A;  4PNF A;  4XCS A;  3Q74 A;  5ID2 A;  4LLR A;  3VLN A;  1TI1 A;  2XBQ A;  2JZR A;  2MMA A;  4Q5N A;  2F51 A;  4KA0 A;  3LGC A;  1SYR A;  2LJR A;  2TRX A;  2GS3 A;  4V1A g;  4KW6 A;  1SEN A;  4PQH A;  2DJK A;  4KND A;  3C73 A;  3GTU A;  2DBC A;  1IYH A;  1WRY A;  1XZO A;  4IJ3 A;  1MD4 A;  2PWJ A;  5DAK B;  4ZB8 A;  2CVK A;  5HFI A;  1JZR A;  1EP8 A;  4NXI A;  5ECS A;  3MAK A;  2REM A;  4GQF A;  2LQO A;  2D2Z A;  1AXD A;  3GMF A;  2LQQ A;  2Z9S A;  3GN3 A;  3D5J A;  2OBI A;  1FHE A;  3WGE A;  3H4K A;  1Z9H A;  2YPM A;  8GSS A;  3SWL A;  3ZTL A;  1J08 A;  3KCM A;  3G9B A;  1AQX A;  5DBQ A;  5IM9 A;  1YQ1 A;  2F3M A;  4GCI A;  3TKS A;  5F06 A;  4WXT A;  3U5R E;  5A4W A;  5F05 A;  4EXJ A;  2L59 A;  1VGL A;  3A2X A;  2H75 A;  1R4W A;  3C1R A;  2FD3 A;  1BJX A;  1Z6M A;  1FW1 A;  4POB A;  1GSQ A;  1T1V A;  1T8E B;  2B7J A;  5H5R A;  1QMV A;  4KX4 A;  1XWC A;  1X0R A;  1R5A A;  1WPI A;  3TB2 A;  1PX6 A;  5B7C A;  4JR4 A;  3V1W A;  1GNE A;  3ME8 A;  1H75 A;  3ZIT A;  3P90 A;  1FB6 A;  1MDI A;  5G5E A;  4MCU A;  5J9C A;  3AY8 A;  2FGX A;  2HRF A;  4ML6 A;  5D93 A;  1X5D A;  5J41 A;  1GTU A;  2X8G A;  2K8V A;  1SL2 B;  3KD0 A;  2N5A A;  1LBK A;  4JR6 A;  4POL A;  5CO3 A;  2EIR A;  3GX0 A;  3IV4 A;  2TRC P;  2H6X A;  3RHB A;  1OAZ A;  1F6M C;  3I6A A;  2H1A A;  3ZFL A;  4K8M A;  1AQW A;  5G5F A;  1THO A;  3VWX A;  2EIO A;  4WF4 A;  3RPN A;  3HVV A;  1VF3 A;  3IOS A;  3KM6 A;  3FEU A;  9GSS A;  4FIW A;  3A5W A;  3VPT A;  5KN1 A;  5CRG A;  1FVK A;  2L57 A;  3EWL A;  3EUR A;  1T4Y A;  2XC2 A;  2YWI A;  18GS A;  4KDU A;  4HQS A;  5DCH A;  3HCZ A;  2HQT A;  2L6D A;  4POM A;  1HYU A;  4HJ2 A;  3GA4 A;  1YEX A;  13GS A;  2LKU A;  5HFG A;  3FK8 A;  3HJP A;  2CZ3 A;  1SK0 A;  3PGT A;  2P0G A;  4ZIL A;  2C0F A;  4O92 A;  2R6K A;  1V2A A;  5HFK A;  4IGJ A;  1ABA A;  1WP0 A;  4OFN A;  1G6Y A;  5AIS A;  5GAN D;  5AIV A;  4XRD A;  2WCI A;  1A24 A;  6GSV A;  1CQH A;  1G7O A;  3VI7 A;  3G7I A;  2GSQ A;  3FZ4 A;  2GZY A;  1HNC A;  3BCK A;  2OKA A;  2NPB A;  5DVB A;  4IQA A;  4FYB A;  3IRA A;  3UBL A;  2H8L A;  2LEG A;  4CDO A;  1G7E A;  3GKN A;  1V9W A;  3TJJ A;  2HLS A;  4ML1 A;  2H0G A;  1K3L A;  3FR3 A;  2C4J A;  4IP1 A;  1TKD B;  2DJJ A;  3UIW A;  1O8W A;  2WUL A;  3HJO A;  2E7P A;  4MA9 A;  4J2F A;  2JAD A;  1K0B A;  3EVI A;  1EWX A;  3BJ5 A;  5DAL B;  3F63 A;  5COH A;  5FT3 A;  3HYP A;  2JU5 A;  3F4S A;  2CVB A;  5CP1 A;  1GSY A;  1G0T A;  4GLT A;  1MDJ A;  3EYT A;  2QSI A;  3APS A;  4POK A;  4KB3 A;  4BWS A;  3EMP A;  3UL3 A;  2DJ0 A;  2X8H A;  1Z7P A;  1FVJ A;  1S3D A;  3J7Y k;  1WMJ A;  2I4A A;  1BX9 A;  3TRP A;  2WFC A;  1ILO A;  2WRT A;  3W8J A;  3KIJ A;  2VUP A;  4EDZ A;  3LQ7 A;  4CW9 A;  1YF0 A;  1KBN A;  4ZBD A;  1KNG A;  4WBJ A;  3LYP A;  4I2T A;  1GUK A;  2AB6 A;  3FZA A;  1PX7 A;  1YY7 A;  3GRX A;  3ZVJ A;  1UC7 A;  1A2L A;  2MMN A;  1GSD A;  1N8J A;  3EIN A;  3HXS A;  4DSR A;  4ZL8 A;  2UZ8 A;  3LXT A;  2XPE A;  3F3Q A;  1TW9 A;  3L4N A;  3I9V 2;  1XBS A;  1YEP A;  2H73 A;  1EP7 A;  1BQ7 A;  2R3X A;  4FO5 A;  4FYU A;  3BBY A;  1S3A A;  2JZS A;  1O6J A;  5LD0 A;  4AF2 A;  2LRN A;  2O7K A;  2TIR A;  3TKP A;  4ULX A;  3E9J B;  3QOU A;  3A3T A;  3P7X A;  2H30 A;  2G2Q A;  5G31 A;  4BVY B;  2VL3 A;  2WZ9 A;  3WYW A;  4H86 A;  5CRD A;  2VO4 A;  4G9H A;  2HNL A;  3G7Y A;  2J23 A;  5EVO A;  4MLY A;  1EGO A;  1A2J A;  2WGR A;  2LRT A;  1K0D A;  3G7J A;  3M3M A;  1EEJ A;  3UEM A;  2I81 A;  2P31 A;  2PBJ A;  4PUR A;  1HQO A;  1EGR A;  3ISO A;  2HSN B;  5D9X A;  2HZE A;  3M9J A;  1X9M B;  2YWO A;  1Z5Y E;  4RQX A;  1SL0 B;  3ME7 A;  2BJX A;  2PU9 C;  2VCZ A;  2QKE A;  4MF6 A;  3KJY A;  2HRK B;  4BL7 B;  4YAP A;  4GWR A;  4WKW A;  3K8N A;  1W4V A;  4KSO A;  4F9Z A;  1XPV A;  1M2B A;  3APQ A;  1LJR A;  5D9T A;  3FR6 A;  1XIY A;  1G6W A;  2BTO T;  3TJF A;  2VIM A;  1A23 A;  4G19 A;  2GQK A;  2YAN A;  3APO A;  5CRE A;  5ECL B;  4YQM A;  4OCE A;  3KH7 A;  1DUG A;  2DJ2 A;  2V6K A;  4TR1 A;  4EUY A;  1EEM A;  2YOI A;  5DCG A;  2QGV A;  1PL1 A;  4AJ6 A;  1K0C A;  1SD9 A;  5IIZ A;  4J57 E;  2KOK A;  3BOA A;  2OJL A;  4IVF A;  3IBH A;  4TXO A;  1OC9 A;  3DVX A;  2HSM A;  1M2A A;  3F0I A;  2GGT A;  5IMZ A;  4RQR A;  2RLI A;  1Z3E A;  4PGT A;  2LS5 A;  4NV2 A;  3BD2 A;  1UN2 A;  1EOG A;  5J3R A;  3FZ5 A;  3ZML A;  3PR8 A;  3HHV A;  4ISD A;  2IFQ A;  3C71 A;  4GQC A;  3LJR A;  5ECO B;  2YP6 A;  2NTO A;  3TUE A;  1GNW A;  3KZQ A;  2R4V A;  2ES7 A;  4MJB A;  1NM3 A;  3EC3 A;  2X64 A;  1ERW A;  2YWM A;  2GDR A;  3QPM A;  5AN1 A;  3MSZ A;  1A8Y A;  3ZL5 A;  3CYN A;  3TKQ A;  1K3Y A;  2FNO A;  1XCC A;  2J9H A;  4PTS A;  22GS A;  4PUA A;  3TCO A;  2HRA A;  1GSU A;  5DAK A;  4ZL9 A;  4FH8 A;  5IMA A;  5D9W A;  3FRC A;  2L5L A;  5G1L A;  3F3R A;  1M0U A;  4N0Z A;  1KEB A;  2FCH A;  4GSN A;  2V32 A;  2B1L A;  4YH2 A;  2AJQ B;  3NIV A;  1J9B A;  5HR0 A;  2H1B A;  4QL9 A;  3RDW A;  1SK1 A;  1R7H A;  1JLW A;  5J4U A;  3GH9 A;  1V98 A;  3TOT A;  5A4U A;  3LG6 A;  3LWA A;  3ZZX A;  5ECN B;  2VLT A;  1BAY A;  3H93 A;  3QCP A;  3A2W A;  3ZIJ A;  4MJC A;  2KP2 A;  5INY A;  1TRV A;  4BVX B;  2YJH A;  3GKX A;  1GSF A;  3M1G A;  2F8A A;  3IHQ A;  2B3S A;  4LMW A;  2YV9 A;  4TR4 A;  1K0M A;  1M99 A;  1AUC A;  10GS A;  1C72 A;  2CT6 A;  2MMO A;  1JHB A;  3S9F A;  2FA8 A;  2NBS A;  3H8Q A;  3UBK A;  2XPD A;  4DSS B;  3QAW A;  4I8B A;  5ECQ B;  1HNB A;  4TXV A;  4G0I A;  4WET A;  1GH2 A;  3TJK A;  4NWY A;  2DMM A;  1Y25 A;  2E2G A;  6GSX A;  5ID2 B;  3KTB A;  5EPF A;  2NDO A;  3DEX A;  4Q5R A;  4BA7 A;  4ZL7 A;  2IMF A;  1DE1 A;  3DXB A;  4IKH A;  3GTU B;  4ACS A;  3ERW A;  1NSW A;  4PUF C;  5DJM A;  1QGV A;  3F8U A;  2AUV A;  2VOC A;  1SJ6 A;  3I43 A;  2OA7 A;  5IQY A;  5F8B A;  1GTB A;  3LEF A;  3D0Z A;  4NHW A;  2JSY A;  3LOR A;  3KP8 A;  5GAP D;  2NVL A;  2VAF A;  2YCD A;  2K6V A;  3H1N A;  3MNG A;  5AGY A;  1TK0 B;  4ID0 A;  5H5Q A;  2N5B A;  2LJA A;  3CMI A;  1DSB A;  1TK8 B;  1AAZ A;  4WBR D;  4KF9 A;  4KH7 A;  1F3A A;  3ZMK A;  3US3 A;  1X5E A;  1SJZ A;  4TN8 A;  1N2A A;  2GSS A;  5IPH A;  2FA4 A;  5GSS A;  4EE0 A;  1Y6E A;  4K6X A;  1A0F A;  3EU3 A;  4XRA A;  1PMT A;  2B5Y A;  2K18 A;  3GL5 A;  3KTL A;  1PQN A;  5ENU A;  3VK9 A;  3SBC A;  1SJI A;  5LCZ A;  2FWF A;  3D4T A;  2DJ3 A;  3QMX A;  4N0V A;  1VF2 A;  3D21 A;  1O7U A;  1MDK A;  1TRW A;  3GKK A;  4N10 A;  4TVE A;  4XS4 A;  4XHM A;  4V1A p;  3RPP A;  2LST A;  2M46 A;  3HY2 A;  4OO5 A;  2B5E A;  5ECK B;  1O85 A;  1GLP A;  1TRS A;  5IOW A;  4HZ2 A;  4D73 A;  5D73 A;  4YAV A;  5DQS A;  2PVO C;  3CSJ A;  1VF4 A;  4N30 A;  4YQU A;  5IMF A;  1J0F A;  3H79 A;  3E3E A;  3IR4 A;  1EOH A;  1XWG A;  3FKF A;  2X8C A;  1URM A;  5IMC A;  1XW6 A;  2FWG A;  1T4Z A;  1ZYQ B;  2OE3 A;  5CRW A;  2PN8 A;  3A2V A;  2VM2 A;  3CTF A;  3HZ8 A;  2DML A;  3FYG A;  4Z7X A;  3WT2 A;  4IJI A;  3FY7 A;  5J5N A;  2A2R A;  1AC1 A;  2IWT A;  3L9V A;  5DJL A;  3GX8 A;  2A2S A;  3VWW A;  2LNT A;  1MTC A;  4F82 A;  5DAL A;  3ED3 A;  1PKZ A;  2C0G A;  2FY6 A;  2IN3 A;  4IBP A;  3C1S A;  5ECH B;  2VCT A;  2GVP A;  1ZOF A;  1X9S B;  1THX A;  2G0F A;  1B8X A;  3DIE A;  1TRU A;  2I1U A;  3MWH A;  1QQ2 A;  1JZW A;  3DML A;  2RII A;  1UVZ A;  2ALB A;  2VM1 A;  1K0N A;  4KGI A;  2CX3 A;  3TGZ A;  1QK8 A;  3WT1 A;  4K7I A;  5ECR B;  1USB A;  1WJK A;  3PIN A;  5H5S A;  3IC8 A;  1V57 A;  2QC7 A;  1ZCP A;  5IPG A;  5JCG A;  2PER A;  2DSA A;  4AGS A;  1GTA A;  5A4V A;  5B6N A;  2HXK A;  1PL2 A;  1FB0 A;  2VL2 A;  4EDY A;  1F3B A;  4HU9 A;  2YJ7 A;  3TRQ A;  4L8E A;  4X43 A;  4MJA A;  1T3B A;  4HS1 A;  4KSM A;  2H76 A;  4WR4 A;  4X0X A;  2B6M A;  4RI6 A;  3IC4 A;  4MMM A;  1U87 A;  2L4C A;  2MBS A;  3TKS C;  1V58 A;  3R3E A;  2FWE A;  2O8V B;  3PPU A;  2RUE A;  4K1F A;  3TJG A;  2H01 A;  5FHI A;  2L4Q A;  2C3T A;  4GST A;  2E0Q A;  1JFU A;  7GSS A;  2MMZ A;  3UOM A;  1TK5 B;  2GTU A;  2CA8 A;  1ZMA A;  3CRU A;  4KDX A;  1BYE A;  4OFT A;  2PGT A;  1TXX A;  1Q4J A;  4MZW A;  4LA1 A;  3JCM L;  1TJD A;  2H72 A;  3QFA C;  4BVY A;  2A4V A;  4L5O A;  3D22 A;  4I6X A;  1PKW A;  1ZZY A;  5IO2 A;  1F9M A;  4EL1 A;  1UA5 A;  2B5X A;  1GP1 A;  2HI7 A;  5HR3 A;  2CZ2 A;  3TOU A;  3GSS A;  2YZU A;  3F6F A;  1RK4 A;  6GST A;  3IAM 2;  4OO4 A;  1GL8 A;  3FZ9 A;  3TKR A;  2CVD A;  4K9Z A;  1OKD A;  4WEY A;  3R2Q A;  4HZ4 A;  2GST A;  2FHE A;  2L6C A;  5BMU A;  4MJE A;  4TOP A;  1B4Q A;  4WF5 A;  4GSS A;  3HVX A;  1SL1 B;  4BL7 A;  1MD3 A;  1XXU A;  2OE0 A;  3GHA A;  4OD7 A;  2CAQ A;  1QXH A;  1XWA A;  6GSY A;  2VCW A;  19GS A;  2H19 A;  4PXO A;  4ECB A;  2KP1 A;  4G2E A;  2R5G A;  2IMD A;  2GQM A;  4XIH A;  4L0U A;  1Z6N A;  2ZUP A;  5ECI B;  2C0E A;  1M9A A;  4CHS A;  2R37 A;  1ERT A;  4DEJ A;  14GS A;  2XBI A;  3O76 A;  3TKS E;  3BCI A;  4JED A;  1SU9 A;  1TU7 A;  4JBB A;  1OE8 A;  2XHF A;  3CBU A;  3N9J A;  4USS A;  2RM6 A;  1SKW B;  1OE7 A;  5HR1 A;  1F2E A;  2IJY A;  4EVM A;  3QAG A;  1GRX A;  1PRX A;  2H71 A;  4JU5 A;  4XS6 A;  4TR0 A;  5E4W A;  3ZYW A;  16GS A;  1B9Y C;  4MPF A;  3ZFB A;  1U3I A;  4OWY A;  2YZH A;  1WE0 A;  5KN3 A;  2WB9 A;  1XFL A;  5F07 A;  5D96 A;  6GSU A;  5HR2 A;  4ECI A;  3KGK A;  2HFD A;  5ELG A;  2FUG 2;  2RUF A;  5A5K A;  3KMO A;  1Z7R A;  4QL7 A;  4Q5F A;  4MF5 A;  2LJK A;  5DDL A;  2P5Q A;  1DE2 A;  4ECJ A;  4NAX A;  1K0O A;  3J7Y b;  2C1Y A;  2FLS A;  3ERF A;  2MYG A;  20GS A;  5J9B A;  1GLQ A;  2GLR A;  4TR3 A;  1XOB A;  2HYX A;  5JWQ B;  1GUL A;  1U3A A;  1XW9 A;  1SKS B;  3EMX A;  1GTI A;  3GKM A;  1FAA A;  2DIZ A;  3CXG A;  3NZN A;  2PUK C;  1YKC A;  4P3Y B;  3FHK A;  1MEK A;  6GSS A;  2OAC A;  1T7P B;  2HSM B;  4BVX A;  5G2Z A;  4EO3 A;  1TU8 A;  2OAD A;  3DKS A;  1XWB A;  2HSH A;  4ZB9 A;  1NHY A;  4RI7 A;  4G10 A;  1TTZ A;  2C3N A;  2LNS A;  3U6V A;  1NHO A;  2YNX A;  3ZVJ D;  4DSS A;  2H6Y A;  2HT9 A;  1K0A A;  2LRC A;  5C04 A;  1YDK A;  3RHC A;  3UVT A;  5JWR B;  1ERV A;  2WJU A;  2K9F A;  2WDU A;  2K8S A;  5EL8 A;  3GST A;  1NW2 A;  2H0H A;  5CYY A;  3VUR A;  4MDC A;  3Q19 A;  2B7K A;  3D6I A;  3GIX A;  1PSQ A;  4IP6 A;  2H74 A;  4ECC A;  4F2I A;  1JLV A;  5D8I A;  1F37 A;  2B1K A;  4GXZ A;  1BED A;  5CRH A;  1ZYE A;  5HQP A;  4MF7 A;  3ZRE A;  3CSH A;  4O32 A;  2GZP A;  3ERG A;  3Q6O A;  2VCQ A;  2ON5 A;  2IME A;  1TI3 A;  2WS2 A;  2AYT A;  3CSI A;  3IAS 2;  5JWO B;  2VL9 A;  3QD9 A;  1SD8 A;  3QDN A;  3HZ4 A;  2AV4 A;  4NHZ A;  2KHP A;  1E6B A;  4G0K A;  4ZXG A;  4ILF A;  3O6T A;  2F9S A;  3QAV A;  3LFL A;  4V2N A;  1PA3 A;  5FWG A;  1H4O A;  1VF1 A;  3VI5 A;  1JZO A;  1XW5 A;  5ECM B;  5D9V A;  2YV7 A;  4N11 A;  1B48 A;  2IIY A;  4NV5 A;  2ZCT A;  4DVC A;  5AIX A;  1B9X C;  3P8W A;  4HI7 A;  1YF1 A;  4BPY A;  1KTE A;  4K7N A;  3TJB A;  1E2Y A;  4EC0 A;  1M2D A;  1A8L A;  3KH9 A;  3QFB C;  1FOV A;  4KUN A;  2HZF A;  2V2G A;  3VWU A;  3M9K A;  5E59 A;  4J56 E;  2BMX A;  1WOU A;  5JCW A;  2O87 A;  3O3T A;  2VD0 A;  3Q18 A;  2N5F A;  4PNG A;  3GH6 A;  4MK3 A;  3UAR A;  3FR9 A;  4LL1 B;  1ACV A;  5IO0 A;  5IMD A;  2R2J A;  4O7H A;  4Q5Q A;  2F8F A;  1A2M A;  5L71 A;  3GNJ A;  3D4M A;  2HE3 A;  3F4R A;  2IL3 A;  2IMK A;  3W6G A;  5IMV A;  4O5R A;  3MDK A;  1U88 A;  1XVQ A;  1AW9 A;  3E0U A;  2I3Y A;  2DJ1 A;  2I9H A;  5B8B A;  4MZC A;  3UJ1 A;  3ZLP A;  1TP9 A;  3LXZ A;  4IW9 A;  1RQM A;  3HVS A;  2YN1 A;  2MZC A;  3WGX A;  3GL3 A;  4MZB A;  2L5O A;  4IN0 A;  2O89 A;  2GZZ A;  2P5R A;  4ZBA A;  1ERU A;  2FWH A;  3HJM A;  4L5L A;  4XS4 B;  3M0F A;  2JL4 A;  1GUM A;  5IOX A;  4MPG A;  3DD3 A;  4I5Q A;  3HA9 A;  4V2L A;  1OC8 A;  3TDG A;  4IS0 A;  1OVN A;  3WGD A;  2ON7 A;  1S3C A;  4D73 B;  2HRN A;  1K3O A;  1ZL9 A;  2CX4 A;  3ZIV A;  4RUV A;  3CTG A;  2C80 A;  2X99 A;  3W8S A;  5G1K A;  2AAW A;  2E2M A;  3F9U A;  5KN0 A;  3DVW A;  4MP4 A;  3UAP A;  1OC3 A;  5C00 A;  2OBK A;  2GSR A;  1XWK A;  3PH9 A;  5KEJ A;  3VWV A;  3LSZ A;  4MAB A;  5G30 A;  4K0N A;  2V6O A;  1EZK A;  4LMV A;  2H6Z A;  3L78 A;  4FYC A;  4MH2 A;  5GST A;  3LYK A;  3IA1 A;  3IXR A;  5CNW A;  4I97 A;  4KDY A;  3VPQ A;  3HKR A;  5B6M A;  1TOF A;  1AQV A;  2VCX A;  5JCU A;  6GSW A;  1PGT A;  4WR5 A;  2HSY A;  1LU4 A;  2IMI A;  4HU7 A;  1R5P A;  5KN2 A;  3EE2 A;  4KAE A;  1M7T A;  3IPZ A;  3C7M A;  4E8E A;  5ABR A;  3GUS A;  3KXO A;  2GT5 A;  1X9W B;  4QQ7 A;  4GF0 A;  3RBT A;  2JAC A;  2H1D A;  1FO5 A;  4ZBB A;  1SKR B;  4OFM A;  3DRN A;  1SK2 A;  4GTU A;  3IK7 A;  4LL4 B;  2PVQ A;  4XTS A;  2M80 A;  2VLV A;  4XS1 A;  4F0C A;  1W89 A;  2C8U A;  2V41 A;  1GSS A; 
#chains in the Genus database with same CATH topology
 2PMT A;  1O81 A;  2C3Q A;  1WIK A;  4V2M A;  1XVW A;  1EV9 A;  3IK9 A;  5EY6 A;  1A0R P;  3C8E A;  3CRT A;  2H0I A;  2A2P A;  1SYX A;  3P2A A;  1ZGN A;  4MH3 A;  1WWJ A;  3M8N A;  11GS A;  2GQL A;  4G0L A;  12GS A;  3N5O A;  1QUW A;  2LUS A;  3L0H A;  1TDI A;  3QR6 A;  3EU4 A;  4HOJ A;  2V1M A;  3UMA A;  2H66 A;  1I9D A;  5ECP B;  4AJ7 A;  4I2U A;  4JZQ A;  3KP9 A;  2CQ9 A;  4OCF A;  1HD2 A;  2HRK A;  4NPB A;  3DWV A;  2JSZ A;  2DIY A;  5F0G A;  4KCA A;  3F4T A;  2CV4 A;  4E8H A;  2A4H A;  2DLX A;  3L9S A;  1ON4 A;  1U6T A;  1PD2 1;  5ELA A;  3IE3 A;  4BWQ A;  2LV3 A;  4X1U A;  4L0W A;  1AIU A;  1FOH A;  3IDV A;  4OMV A;  4TKY A;  1PN0 A;  5A5H A;  4ZB6 A;  4KE3 A;  1JZD A;  3GV1 A;  1R26 A;  1IYI A;  4JE1 A;  4YQV A;  5DQY A;  2WW2 A;  3ZRD A;  1GUH A;  4PQI A;  2IPA A;  4EKZ A;  4K7O A;  2KLX A;  5B8A A;  2CAI A;  1OYJ A;  1SVM A;  1YZX A;  4K2D A;  4IQ1 A;  4ZIJ A;  2O85 A;  2EFH A;  1YJ6 A;  3HD5 A;  5BMU B;  2RM5 A;  1M9B A;  2LTK A;  4K5S A;  2DC5 A;  1GWC A;  1EV4 A;  1YKA A;  1VRS D;  4KCE A;  1GSE A;  4K0G A;  1T00 A;  2O3E A;  1I5G A;  2AHE A;  1QFN A;  2KUC A;  4G01 A;  3GYK A;  3L9U A;  4HEA 2;  4QMK A;  2GT6 A;  2HZE B;  2DKI A;  4BIK A;  3KMN A;  4K5R A;  2VCV A;  1BG1 A;  4EF0 A;  4IHU A;  1FG4 A;  1O73 A;  2VLU A;  1B4P A;  2VL2 C;  3FW2 A;  4HUA A;  3UVH A;  1HNA A;  4DSQ A;  2JZT A;  2EIQ A;  4PQ1 A;  3WD6 A;  4FQU A;  4MNN A;  3KEB A;  4AJ8 A;  1X5C A;  3TRX A;  4HQZ A;  1PN9 A;  4JRR A;  3F6D A;  1DBY A;  5KOW A;  17GS A;  1ML6 A;  2VD1 A;  3GUR A;  1RW1 A;  1XOA A;  3NOF A;  4HJM A;  4TR1 B;  3RAZ A;  4GRF A;  2M72 A;  3CQF A;  1OKT A;  5LNK e;  1BG5 A;  2EC4 A;  2C0D A;  3OR5 A;  5CAX A;  4F0B A;  4F03 A;  2PPT A;  4A5P A;  3DGQ A;  3GFK A;  1V40 A;  4TXO B;  2OE1 A;  1OC9 B;  4IEL A;  5GZZ B;  3VFI A;  4AKG A;  1ZYP A;  5A34 B;  2YWN A;  4TW5 A;  1ST9 A;  2H1G A;  4NMU A;  4TRX A;  1O8X A;  3DYR A;  4HDE A;  4E68 A;  1CQG A;  3HDC A;  1Q98 A;  2MBT A;  4PX1 A;  2ZNM A;  2IFQ B;  3I69 A;  2H70 A;  4PNF A;  4XCS A;  3Q74 A;  5ID2 A;  2WVX A;  4LLR A;  3VLN A;  1TI1 A;  2XBQ A;  2JZR A;  2MMA A;  4Q5N A;  2F51 A;  4KA0 A;  3LGC A;  1SYR A;  2LJR A;  2TRX A;  2GS3 A;  4V1A g;  4KW6 A;  1SEN A;  4PQH A;  2DJK A;  4KND A;  3C73 A;  4CY6 A;  3GTU A;  2DBC A;  1IYH A;  1WRY A;  1XZO A;  4IJ3 A;  1MD4 A;  2PWJ A;  5DAK B;  4ZB8 A;  2CVK A;  5HFI A;  1JZR A;  1EP8 A;  4NXI A;  4X4J A;  5ECS A;  3MAK A;  2REM A;  4GQF A;  2LQO A;  2D2Z A;  1AXD A;  3GMF A;  2LQQ A;  2Z9S A;  3GN3 A;  3D5J A;  2OBI A;  1FHE A;  3WGE A;  3H4K A;  1Z9H A;  2YPM A;  8GSS A;  3SWL A;  3ZTL A;  1J08 A;  3KCM A;  3G9B A;  1AQX A;  4ZB7 A;  5DBQ A;  2WVY A;  5IM9 A;  1YQ1 A;  2F3M A;  4GCI A;  3TKS A;  5F06 A;  4WXT A;  3U5R E;  5A4W A;  5F05 A;  4EXJ A;  2L59 A;  1VGL A;  3A2X A;  1TXU A;  2H75 A;  1R4W A;  3C1R A;  2FD3 A;  1BJX A;  1Z6M A;  1FW1 A;  4POB A;  1GSQ A;  1T1V A;  1T8E B;  2B7J A;  5H5R A;  1M3I A;  1QMV A;  4KX4 A;  1XWC A;  3RFR C;  1X0R A;  1R5A A;  1WPI A;  3TB2 A;  1PX6 A;  5B7C A;  4JR4 A;  3V1W A;  1GNE A;  3ME8 A;  1H75 A;  3ZIT A;  3P90 A;  1FB6 A;  1MDI A;  5G5E A;  4W66 A;  4MCU A;  5J9C A;  3AY8 A;  2FGX A;  2HRF A;  4ML6 A;  5D93 A;  1X5D A;  5J41 A;  1GTU A;  2X8G A;  2K8V A;  1SL2 B;  3KD0 A;  2N5A A;  1LBK A;  4JR6 A;  4POL A;  5CO3 A;  2EIR A;  3GX0 A;  3IV4 A;  2TRC P;  2H6X A;  3RHB A;  1OAZ A;  1F6M C;  3I6A A;  2H1A A;  3ZFL A;  4K8M A;  1AQW A;  5G5F A;  1THO A;  3VWX A;  2EIO A;  4WF4 A;  2X4A A;  3RPN A;  3HVV A;  1VF3 A;  4PI0 C;  3IOS A;  3KM6 A;  3FEU A;  9GSS A;  4FIW A;  3A5W A;  3VPT A;  5KN1 A;  5CRG A;  1FVK A;  2L57 A;  3EWL A;  3EUR A;  1T4Y A;  2XC2 A;  2YWI A;  18GS A;  4KDU A;  4HQS A;  5DCH A;  3HCZ A;  2HQT A;  2L6D A;  4POM A;  1HYU A;  4HJ2 A;  3GA4 A;  1YEX A;  13GS A;  2LKU A;  5HFG A;  3FK8 A;  3HJP A;  2CZ3 A;  1SK0 A;  3PGT A;  2P0G A;  4ZIL A;  4AKH A;  2C0F A;  4O92 A;  2R6K A;  1V2A A;  5HFK A;  4IGJ A;  1ABA A;  1WP0 A;  4YKG A;  4OFN A;  1G6Y A;  5AIS A;  5GAN D;  5AIV A;  4XRD A;  2WCI A;  1A24 A;  6GSV A;  1CQH A;  1G7O A;  3VI7 A;  3G7I A;  2GSQ A;  3FZ4 A;  2GZY A;  1HNC A;  4ICY A;  3BCK A;  2OKA A;  2NPB A;  5DVB A;  4IQA A;  4FYB A;  3IRA A;  3UBL A;  2H8L A;  2LEG A;  4CDO A;  1G7E A;  3GKN A;  1V9W A;  3TJJ A;  2HLS A;  4ML1 A;  2H0G A;  1K3L A;  3FR3 A;  2C4J A;  4IP1 A;  1TKD B;  2DJJ A;  3UIW A;  1O8W A;  4YKF A;  2WUL A;  3HJO A;  2E7P A;  4MA9 A;  4J2F A;  2JAD A;  1K0B A;  3EVI A;  1EWX A;  3HVN A;  3BJ5 A;  5DAL B;  3F63 A;  5COH A;  5FT3 A;  3HYP A;  2JU5 A;  3F4S A;  2CVB A;  5CP1 A;  1GSY A;  1G0T A;  4GLT A;  1MDJ A;  3EYT A;  2QSI A;  3APS A;  2QA1 A;  4POK A;  4KB3 A;  4BWS A;  3EMP A;  3UL3 A;  2DJ0 A;  2X8H A;  1Z7P A;  1FVJ A;  2UV8 G;  1S3D A;  3J7Y k;  1WMJ A;  2I4A A;  1BX9 A;  3TRP A;  2WFC A;  1ILO A;  2WRT A;  3W8J A;  3KIJ A;  2VUP A;  4EDZ A;  3LQ7 A;  4CW9 A;  1YF0 A;  1KBN A;  4ZBD A;  1KNG A;  4WBJ A;  3LYP A;  4I2T A;  1GUK A;  2AB6 A;  3FZA A;  1PX7 A;  1YY7 A;  5BRT A;  3GRX A;  3ZVJ A;  1UC7 A;  1XG8 A;  1A2L A;  2MMN A;  1GSD A;  1N8J A;  3EIN A;  3HXS A;  4O5U A;  4DSR A;  4ZL8 A;  2UZ8 A;  3LXT A;  2XPE A;  3F3Q A;  1TW9 A;  3L4N A;  3I9V 2;  1XBS A;  1YEP A;  2H73 A;  1EP7 A;  1BQ7 A;  2R3X A;  4FO5 A;  4FYU A;  3BBY A;  1S3A A;  2JZS A;  1O6J A;  5LD0 A;  4AF2 A;  2LRN A;  2O7K A;  2TIR A;  3TKP A;  4ULX A;  3E9J B;  3QOU A;  3A3T A;  3P7X A;  2H30 A;  2G2Q A;  5G31 A;  4BVY B;  2VL3 A;  2WZ9 A;  3WYW A;  2R0G A;  4H86 A;  5CRD A;  2VO4 A;  4G9H A;  2HNL A;  3G7Y A;  2J23 A;  5EVO A;  4MLY A;  1EGO A;  1A2J A;  2WGR A;  2LRT A;  1K0D A;  3G7J A;  3M3M A;  1EEJ A;  3UEM A;  2I81 A;  2P31 A;  2PBJ A;  4PUR A;  1HQO A;  1EGR A;  4EIP A;  3ISO A;  2HSN B;  5D9X A;  2HZE A;  3M9J A;  1X9M B;  2YWO A;  1Z5Y E;  4RQX A;  1SL0 B;  3ME7 A;  2BJX A;  2PU9 C;  2VCZ A;  2QKE A;  4MF6 A;  3KJY A;  2HRK B;  4BL7 B;  4YAP A;  4GWR A;  4WKW A;  3K8N A;  1W4V A;  4KSO A;  4F9Z A;  1XPV A;  1M2B A;  3APQ A;  1LJR A;  1PFO A;  5D9T A;  3FR6 A;  1XIY A;  1G6W A;  2BTO T;  3TJF A;  2VIM A;  1A23 A;  4G19 A;  2GQK A;  2YAN A;  3APO A;  5CRE A;  5ECL B;  4YQM A;  4OCE A;  3KH7 A;  1DUG A;  2DJ2 A;  3MIX A;  2V6K A;  4TR1 A;  4EUY A;  1EEM A;  2YOI A;  5DCG A;  2QGV A;  1PL1 A;  4AJ6 A;  1K0C A;  1SD9 A;  5IIZ A;  4J57 E;  2KOK A;  3BOA A;  2OJL A;  4IVF A;  1YVL A;  3IBH A;  4TXO A;  1OC9 A;  3DVX A;  2HSM A;  1M2A A;  3F0I A;  2GGT A;  5IMZ A;  4RQR A;  2RLI A;  2EFC A;  5A34 A;  1Z3E A;  4PGT A;  2LS5 A;  4NV2 A;  3BD2 A;  1UN2 A;  1EOG A;  5J3R A;  3FZ5 A;  3ZML A;  3PR8 A;  3HHV A;  4ISD A;  2IFQ A;  3C71 A;  4GQC A;  3LJR A;  5ECO B;  2YP6 A;  3IHG A;  2NTO A;  3TUE A;  1GNW A;  3KZQ A;  2WW0 A;  2R4V A;  2R0C A;  2ES7 A;  4MJB A;  1NM3 A;  3EC3 A;  2X64 A;  1ERW A;  2YWM A;  2GDR A;  3QPM A;  5AN1 A;  3MSZ A;  1A8Y A;  3ZL5 A;  3CYN A;  3TKQ A;  1K3Y A;  2FNO A;  1XCC A;  2J9H A;  4PTS A;  4N3Z A;  22GS A;  4PUA A;  3TCO A;  1S3R A;  2HRA A;  1GSU A;  5DAK A;  4ZL9 A;  4FH8 A;  5IMA A;  5D9W A;  3FRC A;  2X49 A;  2L5L A;  5G1L A;  3F3R A;  1M0U A;  4N0Z A;  1KEB A;  3FMW A;  2FCH A;  4GSN A;  2V32 A;  3LW9 A;  2B1L A;  4YH2 A;  2AJQ B;  3NIV A;  1J9B A;  5HR0 A;  2H1B A;  4QL9 A;  3RDW A;  1SK1 A;  1R7H A;  1JLW A;  5J4U A;  3GH9 A;  1V98 A;  3TOT A;  5A4U A;  3LG6 A;  4PHZ C;  3LWA A;  3ZZX A;  5ECN B;  2VLT A;  1BAY A;  3H93 A;  3QCP A;  3A2W A;  3ZIJ A;  4MJC A;  2KP2 A;  5INY A;  1TRV A;  4BVX B;  2YJH A;  3GKX A;  1GSF A;  3M1G A;  2F8A A;  3IHQ A;  1N25 A;  2B3S A;  4LMW A;  2YV9 A;  4TR4 A;  1K0M A;  1M99 A;  1AUC A;  10GS A;  1C72 A;  2CT6 A;  2MMO A;  1JHB A;  3S9F A;  2FA8 A;  2NBS A;  3H8Q A;  3UBK A;  2O5V A;  2XPD A;  4DSS B;  3QAW A;  4I8B A;  5ECQ B;  1HNB A;  4TXV A;  4G0I A;  4WET A;  1GH2 A;  3TJK A;  4NWY A;  2DMM A;  1Y25 A;  2E2G A;  6GSX A;  5ID2 B;  3KTB A;  5EPF A;  2WVX B;  2NDO A;  3DEX A;  4Q5R A;  4BA7 A;  1ZYN A;  4ZL7 A;  2IMF A;  1DE1 A;  3DXB A;  2WVZ A;  4IKH A;  3GTU B;  4ACS A;  3ERW A;  1NSW A;  4PUF C;  5DJM A;  1QGV A;  3F8U A;  2AUV A;  2VOC A;  1SJ6 A;  3I43 A;  2OA7 A;  5IQY A;  5F8B A;  1GTB A;  3LEF A;  3D0Z A;  4NHW A;  2JSY A;  3LOR A;  3KP8 A;  5GAP D;  2NVL A;  2VAF A;  2YCD A;  2K6V A;  3H1N A;  3MNG A;  5AGY A;  1TK0 B;  4ID0 A;  5H5Q A;  2N5B A;  2LJA A;  5A1N B;  1DSB A;  3CMI A;  1TK8 B;  1AAZ A;  4WBR D;  4KF9 A;  4KH7 A;  1F3A A;  3ZMK A;  3US3 A;  1X5E A;  1SJZ A;  4TN8 A;  1N2A A;  2GSS A;  5IPH A;  2FA4 A;  5GSS A;  4EE0 A;  1Y6E A;  4K6X A;  1A0F A;  3EU3 A;  4XRA A;  1PMT A;  2B5Y A;  2K18 A;  3GL5 A;  3KTL A;  1PQN A;  5ENU A;  3VK9 A;  3SBC A;  1SJI A;  5LCZ A;  2FWF A;  3D4T A;  2DJ3 A;  3QMX A;  4N0V A;  1VF2 A;  3D21 A;  1O7U A;  1MDK A;  1SVO A;  1TRW A;  3GKK A;  4N10 A;  4TVE A;  4XS4 A;  4XHM A;  4V1A p;  3RPP A;  2LST A;  2M46 A;  3HY2 A;  4OO5 A;  2B5E A;  5ECK B;  1O85 A;  1GLP A;  1TRS A;  5IOW A;  4HZ2 A;  4D73 A;  3CHX C;  5D73 A;  4YAV A;  5DQS A;  2PVO C;  3CSJ A;  1VF4 A;  4N30 A;  4YQU A;  5IMF A;  1J0F A;  3H79 A;  3E3E A;  3IR4 A;  1EOH A;  1XWG A;  4AKX B;  3FKF A;  2X8C A;  1URM A;  5IMC A;  1XW6 A;  2FWG A;  1T4Z A;  1ZYQ B;  2OE3 A;  5CRW A;  2PN8 A;  3A2V A;  2VM2 A;  3CTF A;  3HZ8 A;  2DML A;  3FYG A;  4Z7X A;  3WT2 A;  4IJI A;  3FY7 A;  5J5N A;  2A2R A;  1AC1 A;  2IWT A;  3L9V A;  5DJL A;  3GX8 A;  2A2S A;  3VWW A;  2LNT A;  1MTC A;  4F82 A;  5DAL A;  3ED3 A;  1PKZ A;  2C0G A;  2FY6 A;  2IN3 A;  4IBP A;  3C1S A;  5ECH B;  2VCT A;  2GVP A;  1ZOF A;  1X9S B;  1THX A;  2G0F A;  1B8X A;  3DIE A;  1TRU A;  2I1U A;  3MWH A;  1QQ2 A;  1JZW A;  3DML A;  2RII A;  1UVZ A;  2ALB A;  2VM1 A;  1K0N A;  4KGI A;  2CX3 A;  4K2X A;  3TGZ A;  1QK8 A;  3WT1 A;  4K7I A;  5ECR B;  1USB A;  3TU3 B;  1WJK A;  3PIN A;  5H5S A;  3IC8 A;  1V57 A;  2QC7 A;  1ZCP A;  5IPG A;  5JCG A;  2PER A;  2DSA A;  4AGS A;  1GTA A;  5A4V A;  5B6N A;  2HXK A;  4AI6 A;  1PL2 A;  1FB0 A;  4PI2 C;  2VL2 A;  4EDY A;  1F3B A;  2WW3 A;  4HU9 A;  2YJ7 A;  3TRQ A;  4L8E A;  4X43 A;  4MJA A;  1T3B A;  4HS1 A;  4KSM A;  2H76 A;  4WR4 A;  4X0X A;  2B6M A;  4RI6 A;  3IC4 A;  4MMM A;  1U87 A;  2L4C A;  2MBS A;  3TKS C;  1V58 A;  3R3E A;  2FWE A;  3MYD A;  4O5Q A;  2O8V B;  3PPU A;  2RUE A;  4K1F A;  3TJG A;  2H01 A;  5FHI A;  2L4Q A;  2C3T A;  4GST A;  2E0Q A;  1JFU A;  7GSS A;  2MMZ A;  3UOM A;  1TK5 B;  2GTU A;  2CA8 A;  1ZMA A;  3CRU A;  4KDX A;  1BYE A;  4OFT A;  2PGT A;  1TXX A;  1Q4J A;  4MZW A;  4LA1 A;  3JCM L;  1TJD A;  2H72 A;  3QFA C;  4BVY A;  2A4V A;  4L5O A;  3D22 A;  4I6X A;  1PKW A;  3CWG A;  1ZZY A;  5IO2 A;  1F9M A;  4EL1 A;  1UA5 A;  2B5X A;  4AKI A;  1GP1 A;  2HI7 A;  5HR3 A;  2CZ2 A;  4HSC X;  3TOU A;  3GSS A;  2YZU A;  3F6F A;  1RK4 A;  6GST A;  3IAM 2;  4OO4 A;  1GL8 A;  3FZ9 A;  3TKR A;  2CVD A;  2HSN A;  4K9Z A;  1OKD A;  4WEY A;  3R2Q A;  4HZ4 A;  2GST A;  2FHE A;  5J4V A;  2L6C A;  5BMU A;  4MJE A;  4TOP A;  1B4Q A;  4WF5 A;  4GSS A;  3HVX A;  1SL1 B;  2EFE A;  4BL7 A;  1MD3 A;  1XXU A;  2OE0 A;  3GHA A;  2QA2 A;  4OD7 A;  2CAQ A;  1QXH A;  1XWA A;  6GSY A;  2VCW A;  19GS A;  2H19 A;  4PXO A;  4ECB A;  2KP1 A;  4G2E A;  2R5G A;  2IMD A;  2GQM A;  4XIH A;  4L0U A;  1Z6N A;  2ZUP A;  5ECI B;  2C0E A;  1M9A A;  4CHS A;  2R37 A;  1ERT A;  4DEJ A;  5KOX A;  14GS A;  2XBI A;  3O76 A;  3TKS E;  3BCI A;  4JED A;  1SU9 A;  1TU7 A;  4JBB A;  1OE8 A;  2XHF A;  3CBU A;  3N9J A;  4USS A;  2RM6 A;  1SKW B;  1OE7 A;  5HR1 A;  1F2E A;  2IJY A;  4EVM A;  3QAG A;  1GRX A;  1PRX A;  2DKH A;  2H71 A;  4JU5 A;  4XS6 A;  4TR0 A;  5E4W A;  3ZYW A;  16GS A;  2EFD A;  4MPF A;  1B9Y C;  3ZFB A;  1U3I A;  5A5H B;  4OWY A;  3HMJ G;  2YZH A;  1WE0 A;  5KN3 A;  2WB9 A;  1XFL A;  5F07 A;  5D96 A;  6GSU A;  5HR2 A;  4ECI A;  3KGK A;  2HFD A;  5ELG A;  2FUG 2;  2RUF A;  5A5K A;  3KMO A;  1Z7R A;  4QL7 A;  4Q5F A;  4MF5 A;  2LJK A;  5DDL A;  2P5Q A;  1DE2 A;  4ECJ A;  4NAX A;  1K0O A;  3J7Y b;  2C1Y A;  2FLS A;  3ERF A;  2MYG A;  4EIQ A;  20GS A;  5J9B A;  1GLQ A;  2GLR A;  4TR3 A;  1XOB A;  2HYX A;  4CY8 A;  5JWQ B;  1GUL A;  1U3A A;  1XW9 A;  1SKS B;  3EMX A;  1GTI A;  3GKM A;  1FAA A;  2DIZ A;  3CXG A;  3NZN A;  2PUK C;  1YKC A;  4P3Y B;  3FHK A;  1MEK A;  6GSS A;  2OAC A;  1S4B P;  1T7P B;  2HSM B;  4BVX A;  5G2Z A;  4EO3 A;  1TU8 A;  2OAD A;  3DKS A;  1XWB A;  2HSH A;  4ZB9 A;  1NHY A;  4RI7 A;  4G10 A;  1TTZ A;  2C3N A;  2LNS A;  3U6V A;  1NHO A;  2YNX A;  3ZVJ D;  4DSS A;  1YEW C;  2H6Y A;  2HT9 A;  1K0A A;  2LRC A;  5C04 A;  1YDK A;  1BF5 A;  3RHC A;  3UVT A;  5JWR B;  1ERV A;  2WJU A;  2K9F A;  2WDU A;  2K8S A;  5EL8 A;  3GST A;  1NW2 A;  2H0H A;  5CYY A;  3VUR A;  4MDC A;  3Q19 A;  2B7K A;  3D6I A;  3GIX A;  4FXY P;  1PSQ A;  4IP6 A;  2H74 A;  4ECC A;  4F2I A;  1JLV A;  5D8I A;  1F37 A;  2B1K A;  4GXZ A;  1BED A;  1I1I P;  5CRH A;  1ZYE A;  5HQP A;  4MF7 A;  3ZRE A;  2R0P A;  3CSH A;  4O32 A;  2GZP A;  3ERG A;  3Q6O A;  2VCQ A;  2ON5 A;  2OT3 A;  2IME A;  1TI3 A;  2WS2 A;  2AYT A;  3CSI A;  3IAS 2;  5JWO B;  2VL9 A;  5A1N A;  3QD9 A;  1SD8 A;  3QDN A;  3HZ4 A;  2AV4 A;  4NHZ A;  2KHP A;  1E6B A;  4G0K A;  4ZXG A;  4ILF A;  3EPT A;  3O6T A;  2F9S A;  3QAV A;  3LFL A;  4V2N A;  1PA3 A;  5FWG A;  5J47 A;  1H4O A;  1VF1 A;  3VI5 A;  2WW1 A;  1JZO A;  1XW5 A;  5ECM B;  5D9V A;  1Y1U A;  2YV7 A;  4N11 A;  1B48 A;  2IIY A;  2WZS A;  4GDF A;  4NV5 A;  2ZCT A;  4DVC A;  5AIX A;  1B9X C;  3P8W A;  4HI7 A;  1YF1 A;  4BPY A;  1KTE A;  4K7N A;  3TJB A;  1E2Y A;  4EC0 A;  1M2D A;  1A8L A;  3KH9 A;  3QFB C;  1FOV A;  1SVL A;  4KUN A;  2HZF A;  2V2G A;  3VWU A;  3M9K A;  5E59 A;  4J56 E;  2BMX A;  1WOU A;  1M3J A;  5JCW A;  2O87 A;  3O3T A;  2VD0 A;  3Q18 A;  3RGB C;  2N5F A;  4PNG A;  3GH6 A;  5J4Y A;  4MK3 A;  3UAR A;  4Z2U A;  3FR9 A;  4LL1 B;  1ACV A;  5IO0 A;  5IMD A;  2R2J A;  4O7H A;  4Q5Q A;  4Z2R A;  2F8F A;  1A2M A;  5L71 A;  3GNJ A;  3D4M A;  2HE3 A;  3F4R A;  2IL3 A;  2IMK A;  3W6G A;  5IMV A;  4O5R A;  3MDK A;  1U88 A;  1XVQ A;  1AW9 A;  3E0U A;  2I3Y A;  2DJ1 A;  2I9H A;  5B8B A;  4MZC A;  3UJ1 A;  3ZLP A;  1TP9 A;  3LXZ A;  4IW9 A;  1RQM A;  3HVS A;  2YN1 A;  2MZC A;  3WGX A;  3GL3 A;  4MZB A;  2L5O A;  4IN0 A;  2O89 A;  2GZZ A;  2P5R A;  4ZBA A;  1ERU A;  2FWH A;  3HJM A;  4L5L A;  4XS4 B;  3M0F A;  2JL4 A;  1GUM A;  5IOX A;  4MPG A;  3DD3 A;  4I5Q A;  3HA9 A;  4V2L A;  1OC8 A;  3TDG A;  4IS0 A;  1OVN A;  3WGD A;  2ON7 A;  1S3C A;  4D73 B;  2HRN A;  1K3O A;  1ZL9 A;  2CX4 A;  3ZIV A;  4RUV A;  3CTG A;  2C80 A;  2X99 A;  3W8S A;  5G1K A;  2AAW A;  2E2M A;  3F9U A;  5KN0 A;  3DVW A;  4MP4 A;  3UAP A;  1OC3 A;  5C00 A;  4Z2T A;  2OBK A;  2GSR A;  1XWK A;  3PH9 A;  5KEJ A;  3VWV A;  3LSZ A;  4MAB A;  5G30 A;  4K0N A;  2V6O A;  1EZK A;  4LMV A;  5J40 A;  2H6Z A;  3L78 A;  4FYC A;  4MH2 A;  5GST A;  3LYK A;  3IA1 A;  3IXR A;  5CNW A;  4I97 A;  4KDY A;  3VPQ A;  3HKR A;  5B6M A;  1TOF A;  1AQV A;  2VCX A;  5JCU A;  6GSW A;  1PGT A;  4WR5 A;  2HSY A;  1LU4 A;  2IMI A;  4HU7 A;  1R5P A;  5KN2 A;  3EE2 A;  4KAE A;  2H1L A;  1M7T A;  3IPZ A;  3C7M A;  4E8E A;  2O36 A;  5ABR A;  3GUS A;  3KXO A;  2GT5 A;  1X9W B;  4QQ7 A;  4GF0 A;  3RBT A;  2JAC A;  2H1D A;  1FO5 A;  4ZBB A;  1SKR B;  4OFM A;  3DRN A;  1SK2 A;  4GTU A;  3IK7 A;  4LL4 B;  3A5I A;  2PVQ A;  4XTS A;  2M80 A;  2VKZ G;  2VLV A;  4XS1 A;  4F0C A;  1W89 A;  2C8U A;  2V41 A;  1GSS A; 
#chains in the Genus database with same CATH homology
 2PMT A;  1O81 A;  2C3Q A;  1WIK A;  4V2M A;  1XVW A;  1EV9 A;  3IK9 A;  5EY6 A;  1A0R P;  3C8E A;  3CRT A;  2H0I A;  2A2P A;  1SYX A;  3P2A A;  1ZGN A;  4MH3 A;  1WWJ A;  3M8N A;  11GS A;  2GQL A;  4G0L A;  12GS A;  3N5O A;  1QUW A;  2LUS A;  3L0H A;  1TDI A;  3QR6 A;  3EU4 A;  4HOJ A;  2V1M A;  3UMA A;  2H66 A;  1I9D A;  5ECP B;  4AJ7 A;  4I2U A;  4JZQ A;  3KP9 A;  2CQ9 A;  4OCF A;  1HD2 A;  2HRK A;  4NPB A;  3DWV A;  2JSZ A;  2DIY A;  5F0G A;  4KCA A;  3F4T A;  2CV4 A;  4E8H A;  2A4H A;  2DLX A;  3L9S A;  1ON4 A;  1U6T A;  1PD2 1;  5ELA A;  3IE3 A;  4BWQ A;  2LV3 A;  4X1U A;  4L0W A;  1AIU A;  1FOH A;  3IDV A;  4OMV A;  4TKY A;  1PN0 A;  5A5H A;  4ZB6 A;  4KE3 A;  1JZD A;  3GV1 A;  1R26 A;  1IYI A;  4JE1 A;  4YQV A;  5DQY A;  3ZRD A;  1GUH A;  4PQI A;  2IPA A;  4EKZ A;  4K7O A;  2KLX A;  5B8A A;  2CAI A;  1OYJ A;  1SVM A;  1YZX A;  4K2D A;  4IQ1 A;  4ZIJ A;  2O85 A;  2EFH A;  1YJ6 A;  3HD5 A;  5BMU B;  2RM5 A;  1M9B A;  2LTK A;  4K5S A;  2DC5 A;  1GWC A;  1EV4 A;  1YKA A;  1VRS D;  4KCE A;  1GSE A;  4K0G A;  1T00 A;  1I5G A;  2AHE A;  1QFN A;  2KUC A;  4G01 A;  3GYK A;  3L9U A;  4HEA 2;  4QMK A;  2GT6 A;  2HZE B;  2DKI A;  3KMN A;  4K5R A;  2VCV A;  1BG1 A;  4EF0 A;  4IHU A;  1FG4 A;  1O73 A;  2VLU A;  1B4P A;  2VL2 C;  3FW2 A;  4HUA A;  3UVH A;  1HNA A;  4DSQ A;  2JZT A;  2EIQ A;  4PQ1 A;  3WD6 A;  4FQU A;  4MNN A;  3KEB A;  4AJ8 A;  1X5C A;  3TRX A;  4HQZ A;  1PN9 A;  4JRR A;  3F6D A;  1DBY A;  5KOW A;  17GS A;  1ML6 A;  3NOF A;  2VD1 A;  3GUR A;  1RW1 A;  1XOA A;  4HJM A;  4TR1 B;  3RAZ A;  4GRF A;  2M72 A;  1OKT A;  5LNK e;  1BG5 A;  2EC4 A;  2C0D A;  3OR5 A;  5CAX A;  4F0B A;  4F03 A;  2PPT A;  4A5P A;  3DGQ A;  3GFK A;  1V40 A;  4TXO B;  2OE1 A;  1OC9 B;  4IEL A;  5GZZ B;  3VFI A;  4AKG A;  1ZYP A;  5A34 B;  2YWN A;  4TW5 A;  1ST9 A;  2H1G A;  4NMU A;  4TRX A;  1O8X A;  3DYR A;  4HDE A;  4E68 A;  1CQG A;  3HDC A;  1Q98 A;  2MBT A;  4PX1 A;  2ZNM A;  2IFQ B;  3I69 A;  2H70 A;  4PNF A;  4XCS A;  3Q74 A;  5ID2 A;  4LLR A;  3VLN A;  1TI1 A;  2XBQ A;  2JZR A;  2MMA A;  4Q5N A;  2F51 A;  4KA0 A;  3LGC A;  1SYR A;  2LJR A;  2TRX A;  2GS3 A;  4V1A g;  4KW6 A;  1SEN A;  4PQH A;  2DJK A;  4KND A;  3C73 A;  4CY6 A;  3GTU A;  2DBC A;  1IYH A;  1WRY A;  1XZO A;  4IJ3 A;  1MD4 A;  2PWJ A;  5DAK B;  4ZB8 A;  2CVK A;  5HFI A;  1JZR A;  1EP8 A;  4NXI A;  4X4J A;  5ECS A;  3MAK A;  2REM A;  4GQF A;  2LQO A;  2D2Z A;  1AXD A;  3GMF A;  2LQQ A;  2Z9S A;  3GN3 A;  3D5J A;  2OBI A;  1FHE A;  3WGE A;  3H4K A;  1Z9H A;  2YPM A;  8GSS A;  3SWL A;  3ZTL A;  1J08 A;  3KCM A;  3G9B A;  1AQX A;  4ZB7 A;  5DBQ A;  5IM9 A;  1YQ1 A;  2F3M A;  4GCI A;  3TKS A;  5F06 A;  4WXT A;  3U5R E;  5A4W A;  5F05 A;  4EXJ A;  2L59 A;  1VGL A;  3A2X A;  1TXU A;  2H75 A;  1R4W A;  3C1R A;  2FD3 A;  1BJX A;  1Z6M A;  1FW1 A;  4POB A;  1GSQ A;  1T1V A;  1T8E B;  2B7J A;  5H5R A;  1QMV A;  4KX4 A;  1XWC A;  1X0R A;  1R5A A;  1WPI A;  3TB2 A;  1PX6 A;  5B7C A;  4JR4 A;  3V1W A;  1GNE A;  3ME8 A;  1H75 A;  3ZIT A;  3P90 A;  1FB6 A;  1MDI A;  5G5E A;  4W66 A;  4MCU A;  5J9C A;  3AY8 A;  2FGX A;  2HRF A;  4ML6 A;  5D93 A;  1X5D A;  5J41 A;  1GTU A;  2X8G A;  2K8V A;  1SL2 B;  3KD0 A;  2N5A A;  1LBK A;  4JR6 A;  4POL A;  5CO3 A;  2EIR A;  3GX0 A;  3IV4 A;  2TRC P;  2H6X A;  3RHB A;  1OAZ A;  1F6M C;  3I6A A;  2H1A A;  3ZFL A;  4K8M A;  1AQW A;  5G5F A;  1THO A;  3VWX A;  2EIO A;  4WF4 A;  2X4A A;  3RPN A;  3HVV A;  1VF3 A;  3IOS A;  3KM6 A;  3FEU A;  9GSS A;  4FIW A;  3A5W A;  3VPT A;  5KN1 A;  5CRG A;  1FVK A;  2L57 A;  3EWL A;  3EUR A;  1T4Y A;  2XC2 A;  2YWI A;  18GS A;  4KDU A;  4HQS A;  5DCH A;  3HCZ A;  2HQT A;  2L6D A;  4POM A;  1HYU A;  4HJ2 A;  3GA4 A;  1YEX A;  13GS A;  2LKU A;  5HFG A;  3FK8 A;  3HJP A;  2CZ3 A;  1SK0 A;  3PGT A;  2P0G A;  4ZIL A;  4AKH A;  2C0F A;  4O92 A;  2R6K A;  1V2A A;  5HFK A;  4IGJ A;  1ABA A;  1WP0 A;  4YKG A;  4OFN A;  1G6Y A;  5AIS A;  5GAN D;  5AIV A;  4XRD A;  2WCI A;  1A24 A;  6GSV A;  1CQH A;  1G7O A;  3VI7 A;  3G7I A;  2GSQ A;  3FZ4 A;  2GZY A;  1HNC A;  4ICY A;  3BCK A;  2OKA A;  2NPB A;  5DVB A;  4IQA A;  4FYB A;  3IRA A;  3UBL A;  2H8L A;  2LEG A;  4CDO A;  1G7E A;  3GKN A;  1V9W A;  3TJJ A;  2HLS A;  4ML1 A;  2H0G A;  1K3L A;  3FR3 A;  2C4J A;  4IP1 A;  1TKD B;  2DJJ A;  3UIW A;  1O8W A;  4YKF A;  2WUL A;  3HJO A;  2E7P A;  4MA9 A;  4J2F A;  2JAD A;  1K0B A;  3EVI A;  1EWX A;  3BJ5 A;  5DAL B;  3F63 A;  5COH A;  5FT3 A;  3HYP A;  2JU5 A;  3F4S A;  2CVB A;  5CP1 A;  1GSY A;  1G0T A;  4GLT A;  1MDJ A;  3EYT A;  2QSI A;  3APS A;  2QA1 A;  4POK A;  4KB3 A;  4BWS A;  3EMP A;  3UL3 A;  2DJ0 A;  2X8H A;  1Z7P A;  1FVJ A;  2UV8 G;  1S3D A;  3J7Y k;  1WMJ A;  2I4A A;  1BX9 A;  3TRP A;  2WFC A;  1ILO A;  2WRT A;  3W8J A;  3KIJ A;  2VUP A;  4EDZ A;  3LQ7 A;  4CW9 A;  1YF0 A;  1KBN A;  4ZBD A;  1KNG A;  4WBJ A;  3LYP A;  4I2T A;  1GUK A;  2AB6 A;  3FZA A;  1PX7 A;  1YY7 A;  5BRT A;  3GRX A;  3ZVJ A;  1UC7 A;  1A2L A;  2MMN A;  1GSD A;  1N8J A;  3EIN A;  3HXS A;  4O5U A;  4DSR A;  4ZL8 A;  2UZ8 A;  3LXT A;  2XPE A;  3F3Q A;  1TW9 A;  3L4N A;  3I9V 2;  1XBS A;  1YEP A;  2H73 A;  1EP7 A;  1BQ7 A;  2R3X A;  4FO5 A;  4FYU A;  3BBY A;  1S3A A;  2JZS A;  1O6J A;  5LD0 A;  4AF2 A;  2LRN A;  2O7K A;  2TIR A;  3TKP A;  4ULX A;  3E9J B;  3QOU A;  3A3T A;  3P7X A;  2H30 A;  2G2Q A;  5G31 A;  4BVY B;  2VL3 A;  2WZ9 A;  3WYW A;  2R0G A;  4H86 A;  5CRD A;  2VO4 A;  4G9H A;  2HNL A;  3G7Y A;  2J23 A;  5EVO A;  4MLY A;  1EGO A;  1A2J A;  2WGR A;  2LRT A;  1K0D A;  3G7J A;  3M3M A;  1EEJ A;  3UEM A;  2I81 A;  2P31 A;  2PBJ A;  4PUR A;  1HQO A;  1EGR A;  4EIP A;  3ISO A;  2HSN B;  5D9X A;  2HZE A;  3M9J A;  1X9M B;  2YWO A;  1Z5Y E;  4RQX A;  1SL0 B;  3ME7 A;  2BJX A;  2PU9 C;  2VCZ A;  2QKE A;  4MF6 A;  3KJY A;  2HRK B;  4BL7 B;  4YAP A;  4GWR A;  4WKW A;  3K8N A;  1W4V A;  4KSO A;  4F9Z A;  1XPV A;  1M2B A;  3APQ A;  1LJR A;  5D9T A;  3FR6 A;  1XIY A;  1G6W A;  2BTO T;  3TJF A;  2VIM A;  1A23 A;  4G19 A;  2GQK A;  2YAN A;  3APO A;  5CRE A;  5ECL B;  4YQM A;  4OCE A;  3KH7 A;  1DUG A;  2DJ2 A;  3MIX A;  2V6K A;  4TR1 A;  4EUY A;  1EEM A;  2YOI A;  5DCG A;  2QGV A;  1PL1 A;  4AJ6 A;  1K0C A;  1SD9 A;  5IIZ A;  4J57 E;  2KOK A;  3BOA A;  2OJL A;  4IVF A;  1YVL A;  3IBH A;  4TXO A;  1OC9 A;  3DVX A;  2HSM A;  1M2A A;  3F0I A;  2GGT A;  5IMZ A;  4RQR A;  2RLI A;  2EFC A;  5A34 A;  1Z3E A;  4PGT A;  2LS5 A;  4NV2 A;  3BD2 A;  1UN2 A;  1EOG A;  5J3R A;  3FZ5 A;  3ZML A;  3PR8 A;  3HHV A;  4ISD A;  2IFQ A;  3C71 A;  4GQC A;  3LJR A;  5ECO B;  2YP6 A;  3IHG A;  2NTO A;  3TUE A;  1GNW A;  3KZQ A;  2R4V A;  2R0C A;  2ES7 A;  4MJB A;  1NM3 A;  3EC3 A;  2X64 A;  1ERW A;  2YWM A;  2GDR A;  3QPM A;  5AN1 A;  3MSZ A;  1A8Y A;  3ZL5 A;  3CYN A;  3TKQ A;  1K3Y A;  2FNO A;  1XCC A;  2J9H A;  4PTS A;  4N3Z A;  22GS A;  4PUA A;  3TCO A;  2HRA A;  1GSU A;  5DAK A;  4ZL9 A;  4FH8 A;  5IMA A;  5D9W A;  3FRC A;  2X49 A;  2L5L A;  5G1L A;  3F3R A;  1M0U A;  4N0Z A;  1KEB A;  3FMW A;  2FCH A;  4GSN A;  3LW9 A;  2V32 A;  2B1L A;  4YH2 A;  2AJQ B;  3NIV A;  1J9B A;  5HR0 A;  2H1B A;  4QL9 A;  3RDW A;  1SK1 A;  1R7H A;  1JLW A;  5J4U A;  3GH9 A;  1V98 A;  3TOT A;  5A4U A;  3LG6 A;  3LWA A;  3ZZX A;  5ECN B;  2VLT A;  1BAY A;  3H93 A;  3QCP A;  3A2W A;  3ZIJ A;  4MJC A;  2KP2 A;  5INY A;  1TRV A;  4BVX B;  2YJH A;  3GKX A;  1GSF A;  3M1G A;  2F8A A;  3IHQ A;  1N25 A;  2B3S A;  4LMW A;  2YV9 A;  4TR4 A;  1K0M A;  1M99 A;  1AUC A;  10GS A;  1C72 A;  2CT6 A;  2MMO A;  1JHB A;  3S9F A;  2FA8 A;  2NBS A;  3H8Q A;  3UBK A;  2O5V A;  2XPD A;  4DSS B;  3QAW A;  4I8B A;  5ECQ B;  1HNB A;  4TXV A;  4G0I A;  4WET A;  1GH2 A;  3TJK A;  4NWY A;  2DMM A;  1Y25 A;  2E2G A;  6GSX A;  5ID2 B;  3KTB A;  5EPF A;  2NDO A;  3DEX A;  4Q5R A;  4BA7 A;  1ZYN A;  4ZL7 A;  2IMF A;  1DE1 A;  3DXB A;  4IKH A;  3GTU B;  4ACS A;  3ERW A;  1NSW A;  4PUF C;  5DJM A;  1QGV A;  3F8U A;  2AUV A;  2VOC A;  1SJ6 A;  3I43 A;  2OA7 A;  5IQY A;  5F8B A;  1GTB A;  3LEF A;  3D0Z A;  4NHW A;  2JSY A;  3LOR A;  3KP8 A;  5GAP D;  2NVL A;  2VAF A;  2YCD A;  2K6V A;  3H1N A;  3MNG A;  5AGY A;  1TK0 B;  4ID0 A;  5H5Q A;  2N5B A;  2LJA A;  5A1N B;  1DSB A;  3CMI A;  1TK8 B;  1AAZ A;  4WBR D;  4KF9 A;  4KH7 A;  1F3A A;  3ZMK A;  3US3 A;  1X5E A;  1SJZ A;  4TN8 A;  1N2A A;  2GSS A;  5IPH A;  2FA4 A;  5GSS A;  4EE0 A;  1Y6E A;  4K6X A;  1A0F A;  3EU3 A;  4XRA A;  1PMT A;  2B5Y A;  2K18 A;  3GL5 A;  3KTL A;  1PQN A;  5ENU A;  3VK9 A;  3SBC A;  1SJI A;  5LCZ A;  2FWF A;  3D4T A;  2DJ3 A;  3QMX A;  4N0V A;  1VF2 A;  3D21 A;  1O7U A;  1MDK A;  1SVO A;  1TRW A;  3GKK A;  4N10 A;  4TVE A;  4XS4 A;  4XHM A;  4V1A p;  3RPP A;  2LST A;  2M46 A;  3HY2 A;  4OO5 A;  2B5E A;  5ECK B;  1O85 A;  1GLP A;  1TRS A;  5IOW A;  4HZ2 A;  4D73 A;  5D73 A;  4YAV A;  5DQS A;  2PVO C;  3CSJ A;  1VF4 A;  4N30 A;  4YQU A;  5IMF A;  1J0F A;  3H79 A;  3E3E A;  3IR4 A;  1EOH A;  1XWG A;  4AKX B;  3FKF A;  2X8C A;  1URM A;  5IMC A;  1XW6 A;  2FWG A;  1T4Z A;  1ZYQ B;  2OE3 A;  5CRW A;  2PN8 A;  3A2V A;  2VM2 A;  3CTF A;  3HZ8 A;  2DML A;  3FYG A;  4Z7X A;  3WT2 A;  4IJI A;  3FY7 A;  5J5N A;  2A2R A;  1AC1 A;  2IWT A;  3L9V A;  5DJL A;  3GX8 A;  2A2S A;  3VWW A;  2LNT A;  1MTC A;  4F82 A;  5DAL A;  3ED3 A;  1PKZ A;  2C0G A;  2FY6 A;  2IN3 A;  4IBP A;  3C1S A;  5ECH B;  2VCT A;  2GVP A;  1ZOF A;  1X9S B;  1THX A;  2G0F A;  1B8X A;  3DIE A;  1TRU A;  2I1U A;  3MWH A;  1QQ2 A;  1JZW A;  3DML A;  2RII A;  1UVZ A;  2ALB A;  2VM1 A;  1K0N A;  4KGI A;  2CX3 A;  4K2X A;  3TGZ A;  1QK8 A;  3WT1 A;  4K7I A;  5ECR B;  1USB A;  3TU3 B;  1WJK A;  3PIN A;  5H5S A;  3IC8 A;  1V57 A;  2QC7 A;  1ZCP A;  5IPG A;  5JCG A;  2PER A;  2DSA A;  4AGS A;  1GTA A;  5A4V A;  5B6N A;  2HXK A;  4AI6 A;  1PL2 A;  1FB0 A;  2VL2 A;  4EDY A;  1F3B A;  4HU9 A;  2YJ7 A;  3TRQ A;  4L8E A;  4X43 A;  4MJA A;  1T3B A;  4HS1 A;  4KSM A;  2H76 A;  4WR4 A;  4X0X A;  2B6M A;  4RI6 A;  3IC4 A;  4MMM A;  1U87 A;  2L4C A;  2MBS A;  3TKS C;  1V58 A;  3R3E A;  2FWE A;  3MYD A;  4O5Q A;  2O8V B;  3PPU A;  2RUE A;  4K1F A;  3TJG A;  2H01 A;  5FHI A;  2L4Q A;  2C3T A;  4GST A;  2E0Q A;  1JFU A;  7GSS A;  2MMZ A;  3UOM A;  1TK5 B;  2GTU A;  2CA8 A;  1ZMA A;  3CRU A;  4KDX A;  1BYE A;  4OFT A;  2PGT A;  1TXX A;  1Q4J A;  4MZW A;  4LA1 A;  3JCM L;  1TJD A;  2H72 A;  3QFA C;  4BVY A;  2A4V A;  4L5O A;  3D22 A;  4I6X A;  1PKW A;  3CWG A;  1ZZY A;  5IO2 A;  1F9M A;  4EL1 A;  1UA5 A;  2B5X A;  4AKI A;  1GP1 A;  2HI7 A;  5HR3 A;  2CZ2 A;  3TOU A;  3GSS A;  2YZU A;  3F6F A;  1RK4 A;  6GST A;  3IAM 2;  4OO4 A;  1GL8 A;  3FZ9 A;  3TKR A;  2CVD A;  2HSN A;  4K9Z A;  1OKD A;  4WEY A;  3R2Q A;  4HZ4 A;  2GST A;  2FHE A;  5J4V A;  2L6C A;  5BMU A;  4MJE A;  4TOP A;  1B4Q A;  4WF5 A;  4GSS A;  3HVX A;  1SL1 B;  2EFE A;  4BL7 A;  1MD3 A;  1XXU A;  2OE0 A;  3GHA A;  2QA2 A;  4OD7 A;  2CAQ A;  1QXH A;  1XWA A;  6GSY A;  2VCW A;  19GS A;  2H19 A;  4PXO A;  4ECB A;  2KP1 A;  4G2E A;  2R5G A;  2IMD A;  2GQM A;  4XIH A;  4L0U A;  1Z6N A;  2ZUP A;  5ECI B;  2C0E A;  1M9A A;  4CHS A;  2R37 A;  1ERT A;  4DEJ A;  5KOX A;  14GS A;  2XBI A;  3O76 A;  3TKS E;  3BCI A;  4JED A;  1SU9 A;  1TU7 A;  4JBB A;  1OE8 A;  2XHF A;  3CBU A;  3N9J A;  4USS A;  2RM6 A;  1SKW B;  1OE7 A;  5HR1 A;  1F2E A;  2IJY A;  4EVM A;  3QAG A;  1GRX A;  1PRX A;  2DKH A;  2H71 A;  4JU5 A;  4XS6 A;  4TR0 A;  5E4W A;  3ZYW A;  16GS A;  2EFD A;  4MPF A;  1B9Y C;  3ZFB A;  1U3I A;  5A5H B;  4OWY A;  3HMJ G;  2YZH A;  1WE0 A;  5KN3 A;  2WB9 A;  1XFL A;  5F07 A;  5D96 A;  6GSU A;  5HR2 A;  4ECI A;  3KGK A;  2HFD A;  5ELG A;  2FUG 2;  2RUF A;  5A5K A;  3KMO A;  1Z7R A;  4QL7 A;  4Q5F A;  4MF5 A;  2LJK A;  5DDL A;  2P5Q A;  1DE2 A;  4ECJ A;  4NAX A;  1K0O A;  3J7Y b;  2C1Y A;  2FLS A;  3ERF A;  2MYG A;  4EIQ A;  20GS A;  5J9B A;  1GLQ A;  2GLR A;  4TR3 A;  1XOB A;  2HYX A;  4CY8 A;  5JWQ B;  1GUL A;  1U3A A;  1XW9 A;  1SKS B;  3EMX A;  1GTI A;  3GKM A;  1FAA A;  2DIZ A;  3CXG A;  3NZN A;  2PUK C;  1YKC A;  4P3Y B;  3FHK A;  1MEK A;  6GSS A;  2OAC A;  1T7P B;  2HSM B;  4BVX A;  5G2Z A;  4EO3 A;  1TU8 A;  2OAD A;  3DKS A;  1XWB A;  2HSH A;  4ZB9 A;  1NHY A;  4RI7 A;  4G10 A;  1TTZ A;  2C3N A;  2LNS A;  3U6V A;  1NHO A;  2YNX A;  3ZVJ D;  4DSS A;  2H6Y A;  2HT9 A;  1K0A A;  2LRC A;  5C04 A;  1YDK A;  1BF5 A;  3RHC A;  3UVT A;  5JWR B;  1ERV A;  2WJU A;  2K9F A;  2WDU A;  2K8S A;  5EL8 A;  3GST A;  1NW2 A;  2H0H A;  5CYY A;  3VUR A;  4MDC A;  3Q19 A;  2B7K A;  3D6I A;  3GIX A;  1PSQ A;  4IP6 A;  2H74 A;  4ECC A;  4F2I A;  1JLV A;  5D8I A;  1F37 A;  2B1K A;  4GXZ A;  1BED A;  5CRH A;  1ZYE A;  5HQP A;  4MF7 A;  3ZRE A;  2R0P A;  3CSH A;  4O32 A;  2GZP A;  3ERG A;  3Q6O A;  2VCQ A;  2ON5 A;  2OT3 A;  2IME A;  1TI3 A;  2WS2 A;  2AYT A;  3CSI A;  3IAS 2;  5JWO B;  2VL9 A;  5A1N A;  3QD9 A;  1SD8 A;  3QDN A;  3HZ4 A;  2AV4 A;  4NHZ A;  2KHP A;  1E6B A;  4G0K A;  4ZXG A;  4ILF A;  3EPT A;  3O6T A;  2F9S A;  3QAV A;  3LFL A;  4V2N A;  1PA3 A;  5FWG A;  5J47 A;  1H4O A;  1VF1 A;  3VI5 A;  1JZO A;  1XW5 A;  5ECM B;  5D9V A;  1Y1U A;  2YV7 A;  4N11 A;  1B48 A;  2IIY A;  4GDF A;  4NV5 A;  2ZCT A;  4DVC A;  5AIX A;  1B9X C;  3P8W A;  4HI7 A;  1YF1 A;  4BPY A;  1KTE A;  4K7N A;  3TJB A;  1E2Y A;  4EC0 A;  1M2D A;  1A8L A;  3KH9 A;  3QFB C;  1FOV A;  1SVL A;  4KUN A;  2HZF A;  2V2G A;  3VWU A;  3M9K A;  5E59 A;  4J56 E;  2BMX A;  1WOU A;  5JCW A;  2O87 A;  3O3T A;  2VD0 A;  3Q18 A;  2N5F A;  4PNG A;  3GH6 A;  5J4Y A;  4MK3 A;  3UAR A;  4Z2U A;  3FR9 A;  4LL1 B;  1ACV A;  5IO0 A;  5IMD A;  2R2J A;  4O7H A;  4Q5Q A;  4Z2R A;  2F8F A;  1A2M A;  5L71 A;  3GNJ A;  3D4M A;  2HE3 A;  3F4R A;  2IL3 A;  2IMK A;  3W6G A;  5IMV A;  4O5R A;  3MDK A;  1U88 A;  1XVQ A;  1AW9 A;  3E0U A;  2I3Y A;  2DJ1 A;  2I9H A;  5B8B A;  4MZC A;  3UJ1 A;  3ZLP A;  1TP9 A;  3LXZ A;  4IW9 A;  1RQM A;  3HVS A;  2YN1 A;  2MZC A;  3WGX A;  3GL3 A;  4MZB A;  2L5O A;  4IN0 A;  2O89 A;  2GZZ A;  2P5R A;  4ZBA A;  1ERU A;  2FWH A;  3HJM A;  4L5L A;  4XS4 B;  3M0F A;  2JL4 A;  1GUM A;  5IOX A;  4MPG A;  3DD3 A;  4I5Q A;  3HA9 A;  4V2L A;  1OC8 A;  3TDG A;  4IS0 A;  1OVN A;  3WGD A;  2ON7 A;  1S3C A;  4D73 B;  2HRN A;  1K3O A;  1ZL9 A;  2CX4 A;  3ZIV A;  4RUV A;  3CTG A;  2C80 A;  2X99 A;  3W8S A;  5G1K A;  2AAW A;  2E2M A;  3F9U A;  5KN0 A;  3DVW A;  4MP4 A;  3UAP A;  1OC3 A;  5C00 A;  4Z2T A;  2OBK A;  2GSR A;  1XWK A;  3PH9 A;  5KEJ A;  3VWV A;  3LSZ A;  4MAB A;  5G30 A;  4K0N A;  2V6O A;  1EZK A;  4LMV A;  5J40 A;  2H6Z A;  3L78 A;  4FYC A;  4MH2 A;  5GST A;  3LYK A;  3IA1 A;  3IXR A;  5CNW A;  4I97 A;  4KDY A;  3VPQ A;  3HKR A;  5B6M A;  1TOF A;  1AQV A;  2VCX A;  5JCU A;  6GSW A;  1PGT A;  4WR5 A;  2HSY A;  1LU4 A;  2IMI A;  4HU7 A;  1R5P A;  5KN2 A;  3EE2 A;  4KAE A;  2H1L A;  1M7T A;  3IPZ A;  3C7M A;  4E8E A;  5ABR A;  3GUS A;  3KXO A;  2GT5 A;  1X9W B;  4QQ7 A;  4GF0 A;  3RBT A;  2JAC A;  2H1D A;  1FO5 A;  4ZBB A;  1SKR B;  4OFM A;  3DRN A;  1SK2 A;  4GTU A;  3IK7 A;  4LL4 B;  3A5I A;  2PVQ A;  4XTS A;  2M80 A;  2VKZ G;  2VLV A;  4XS1 A;  4F0C A;  1W89 A;  2C8U A;  2V41 A;  1GSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...