1MU0A

Crystal structure of the tricorn interacting factor f1 complex with pck
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
293
structure length
293
Chain Sequence
MDQECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline iminopeptidase
publication title Structures of the tricorn-interacting aminopeptidase F1 with different ligands explain its catalytic mechanism
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
total genus 100
structure length 293
sequence length 293
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2002-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mu0A00
1YA4A 5AKIA 1MAHA 4NS4A 4BAZA 3NGMA 3U1TA 4UBIA 2XUGA 2WFMA 1HBJA 2WTMA 1L7AA 4X3CA 1XZBA 5AOCA 4B82A 1EVQA 4G5XA 3WI7A 5AHXA 5E4YA 1MAAA 1TCBA 4KEAA 1XQXA 2QZPA 1DINA 2VEOA 3IUMA 3ICVA 2W6CX 4YX9A 3EF3A 2CJPA 5E2IA 1FJ2A 4KR0A 4K6GA 3M82A 4N8SA 2XT0A 1ZD2P 4LHEA 1J06A 2AJ8A 4QWWA 3I6YA 4JYMA 3ANSA 3F96A 2XUKA 3R3WA 1JU3A 1NU6A 3PFBA 3H1AA 1CQWA 1RP1A 2WG1A 1A88A 2H7YA 1VKHA 1J07A 3LLCA 1UK6A 4FLEA 1TAHA 1W1IA 3HXKA 1OILA 4ROTA 1UK9A 2GBIA 4Q34A 2RHTA 3AZOA 4DM7A 2WFLB 2RI6A 3VVLA 3RM3A 1XZGA 4AO7A 5K3EA 1UKCA 4H7EA 1CUWA 1THGA 4DNFA 1ZI9A 2DR0A 2HRRA 4B0PA 1QIKA 3O0DA 1ACLA 3OM8A 1VLQA 1TIBA 3H2KA 4BAUA 1XRPA 5ALNA 4CCWA 3STVA 2Q0XA 1DQZA 1XQYA 1H2XA 3WWOA 4QDUA 4TGLA 1XRMA 1ZD5A 1AMNA 2VAVA 2YASA 1K8QA 3DDUA 4L0CA 2FX5A 3WLAA 1VJ5A 1WPXA 2AJDA 4BAGA 1CUGA 2WFZA 3FSGD 3HC7A 1QOZA 3H2IA 2IITA 1WB5A 5CW2A 4O08A 5CT9A 4C6HA 1J2EA 4CG1A 4Q3OA 3R0VA 4C88A 2I78A 2JF0A 1FFEA 4GI1A 3MUNA 5IH7A 1TQHA 1EHYA 2PU5A 5LZ2A 4C4ZA 1JJIA 4C89A 3BJMA 1XZLA 3ZWQA 4H7IA 4JNCA 2Z3ZA 1K63A 4U2CA 2VJCA 5FPPA 1MPXA 1ODSA 2BKLA 4BZZA 2BUBA 4IH1A 3B12A 2WIGA 2VJAA 4EHBA 5DNUA 1VZ2A 5ALMA 3QYJA 1MO2A 2XUQA 1BEEA 4X6XA 5FKJA 4BYMA 3EQ7A 2HU5A 2JGFA 1SCQA 5K3FB 1G5FA 4RE6A 3FWHA 2OGSA 3DOHA 4Y2RA 1DWQA 4INZA 2HRQA 1T4MA 4A23A 6YASA 3HSSA 5CRIA 2WJ4A 4FTWA 3R3XA 1I6WA 2WFLA 3F98A 1ZJ5A 4QEKA 2BUCA 4HXEB 2UZ0A 2Y2UA 2HDWA 3R3UA 2OLEA 2WG0A 4Y2XA 1CUYA 5C8VA 4OSEA 3VDXA 3F67A 3BIXA 4OB7A 2J4FA 3ZLVA 3EQ9A 1J1IA 2QJRA 3I1YA 1W75A 2XUIA 1SFRA 4U2FA 5K5EA 4W9RA 5FXMA 1CUVA 3SX4A 2PPLA 2Y2VA 4Y2VA 3BE8A 1G66A 5AJHA 2XMDA 3RARA 3MGAA 4UHBA 4B83A 5DYYA 1X2BA 4MEAA 4PNZA 2H7XA 3IUJA 5T4HA 3EIOA 3I6MA 4ZGBA 2BGNA 1P0QA 2ORYA 4BCCA 2AJBA 1UFOA 4BTVA 1F0NA 1UOQA 1Y37A 1ZIXA 4YASA 4H7FA 5ALTA 3FOBA 2ROQA 3QBJA 4GEGA 3AZQA 3X3HA 4OB8A 4Y2SA 2XDWA 5H3HA 2ZYRA 2JGJA 4X7BA 5D3KA 4BRZA 2WM2A 2ONCA 4ETWA 5DTJA 1K5PA 2HA6A 1A8SA 2XI4A 1IZ7A 4L3WA 3WA7A 5K3FA 4MYSA 2AJLI 1GXSA 2YYSA 2XUFA 2PKYX 1N1MA 2H9YA 1R4ZA 3G0IA 3E3AA 3JWEA 4KJXA 1MX5A 4B81A 4JYPA 2HA2A 3Q0TA 3D5EA 1DX6A 1N5RA 4KE6A 3FYTA 3I2IA 3WK4A 4MJ3A 5CBKA 2HL6A 3H17A 3H0CA 2ZJFA 3HACA 4QDZA 3C5VA 3WWCA 5BOVA 1QONA 2VJDA 1WB6A 3QVMA 3IUQA 4F60A 5AKZA 2BCEA 3BWXA 2XMZA 2WHRA 4H35A 2FUKA 5LP1A 3ANTA 3LP5A 1ZI8A 2HFKA 2OXEA 3C43A 2X8BA 5AKYA 2XB6A 2OCKA 3L1JA 2HA4A 2XUDA 3W04A 4P08A 5ALGA 1XZCA 3G9UA 4AN0A 2XQKA 5A6VA 4KAFA 1IUNA 2JGEA 1YR2A 4G8DA 1AGYA 5ALYA 1QIHA 4DSAA 1CUEA 3OG9A 3WK7A 5JIBA 5LKRA 1F6WA 1ORVA 4GW3A 4MWTA 2QRUA 3F97A 1VXOA 2W22A 5AK3A 2ZJ6A 3VJMA 1JJFA 2XMQA 2VQ6A 2HA3A 4FMPA 5BWBA 1CUDA 2V96A 2RGUA 1QLWA 3WIBA 4FOLA 2C4HA 3FYUB 4QA9A 2JGIA 3QPDA 1C7IA 4DNPA 5AKKA 3UMJA 4FFWA 3I28A 1YS1X 2C5GA 1XRQA 3WYNA 5AOAA 2QR5A 1EDBA 4GXNA 2QT9A 4E11A 4OYYA 2ECFA 3GA7A 1JFRA 1UXOA 3DS8A 5EHZA 3EQ8A 1OXMA 2HU8A 5AM0A 5ISMA 1C7JA 3DL7A 2B61A 5EHNA 2WJ6A 4W1SA 5D6OA 1R50A 3CN7A 1JI3A 2XQFA 5A62A 1XKLA 5ALSA 3IIIA 1R9MA 1W52X 3PF8A 3G0GA 4RNCA 5HKAA 5A7GA 4F0JA 3FCXA 3VISA 1W76A 4BE9A 2CBGA 1WOMA 4G4GA 2V9ZA 1A8QA 2QXTA 2ACKA 2I3DA 2B4KA 3WKCA 7YASA 3OOSA 3ZLUA 2HA0A 5LIPA 2HA7A 5DNWA 4CG2A 5BWCA 4L9AA 1JT2A 4EA6A 5A71A 5DJ5A 4PSUA 4Y2YA 5AKXA 3RLIA 5CH8A 1ACJA 5HFAA 1QO9A 3I2FA 2WIKA 4H18A 5C7YA 4U2EA 2ZSHA 5DTIA 1BCRA 1GT6A 5CXUA 4MXDA 3ZPXA 5FP0A 2Z8XA 4XJVA 3W9BA 1MU0A 4BDTA 1S8OA 5HZGA 1A7UA 1CEXA 1C4XA 2BAGA 3UUFA 4WFIA 2RONA 2WTNA 4FDMA 1THTA 4AZ0A 1EB8A 3FYUA 5EHQA 1MTZA 5HF9A 4DTCA 4IH9A 1VE7A 4X6UA 5F4ZA 4PO3X 1ODTC 2Y1KA 3VJLA 5ALVA 1AKNA 1E66A 1MNAA 4WY5A 3LCRA 2XQIA 2ZJ7A 2GBGA 2OCGA 4BP9A 5AKEA 1U8EA 3WL8A 4H7HA 1YAJA 1XZJA 4DYHA 1GQSA 4OYLA 4U2BA 4DSZA 1ZIYA 2HADA 3GUUA 4ITVA 1VE6A 5BV7A 3W05A 4EY4A 3N0TA 4E14A 4MEBA 1CQZA 1KU0A 1Y7IA 4XWGA 4KAAA 4BVKA 4D9JA 1GQRA 2ACEA 2X76A 3A70A 3DNMA 4FBLA 2RIPA 5LLSA 4EY8A 4J0KA 2VT6A 3U0VA 2QS9A 4XX1A 2HA5A 1ZD3A 5AKLA 4ZRDA 1XRRA 2WUEA 1LPOA 3STXA 4DMKA 5J3JA 2G5PA 3C70A 4F21A 3GBSA 3BF8A 3T52A 1CUUA 4BCBA 2WLSA 1AX9A 1T2NA 3PUHA 4LIPD 3Q8WA 3M3DA 2QUBA 3QM1A 1QTIA 2B20A 1XRNA 1CLEA 1CUFA 5K3AA 3PI6A 2CZQA 2BFNA 3R3YA 4UHEA 1P0MA 3W06A 5K3CA 4I4CA 1O6FA 1XKTA 1N8SA 3ESCA 4ZREA 1PJAA 3AUKA 2Y6UA 1AQLA 5ALLA 2XUAA 2XQJA 2G5TA 2XLCA 3IDAA 1ZJ4A 1YSCA 2XE4A 1VZ3A 5LZ5A 3H18A 2H7CA 4G4JA 3UUEA 5A7HA 4OCZA 2R8BA 1QO7A 1Q0ZA 5CH3A 1EDEA 4J0CA 1UK8A 3H2GA 2JGLA 1WHTA 1BU8A 3RK4A 3V1MA 4H7JA 3DLTA 1WB4A 3WWDA 3E4DA 2AJCA 2VSQA 4QDOA 3E0XA 3AIKA 4UBJA 5FOQA 3D2CA 4DMFA 1VXRA 2OG1A 3F9CA 2GBCA 5JD4A 4C01A 1AUOA 5T4EA 2OQVA 4JEIA 5IVKA 1BCSA 2GYVA 4IO0A 3O4GA 2WKWA 4CIAA 5HK8A 4ARAA 5AM2A 4U2GA 1IUPA 3H2HA 5KBYA 5CH5A 1VA5A 4EY6A 4G8BA 3M83A 4B80A 4YK7A 3CN9A 2OQIA 3R3VA 4WY8A 3LS2A 4FWBA 4HXFB 5FLKA 5JARA 1LLFA 3PICA 4J0GA 3DOIA 2V97A 4S0XA 2C5FA 4XIIA 1LPSA 2C0PA 4AMYA 3ILSA 3HLKA 3WZLA 2WILA 1MT3A 4A16A 4UBMA 2IIVA 1CFJA 1LPBB 3DD5A 1XZDA 4FFVA 1LBTA 2XMCA 4EBBA 4QE3A 5AM4A 4I19A 2PUHA 1XZIA 5E4JA 4HXGA 1QIEA 3C6ZA 4J7AA 2O7VA 5HKBA 3K9BA 4OD0A 1P0PA 5CT6A 4BE4A 5LKAA 4QNNA 3BDVA 1EI9A 2RHWA 4KACA 4UFPA 1EDDA 1CV2A 3G8YA 3AJAA 4PSDA 4UFNA 4Y9SA 2DCMA 5JZSA 1YB7A 5ALOA 1BN7A 4FKBA 5KWJA 4UHCA 5ALFA 5AI9A 3OPMA 3LIPA 4MYDA 4LKOA 1QIJA 5HF5A 5HK9A 5AM1A 1QIDA 2IX9A 3G9XA 1LBSA 5JANA 2R11A 2VTVA 1ZGBA 4UBNA 1QZ3A 3CCBA 4K5QA 3C87A 5JAUA 3WK8A 4ZXFA 3VKFA 2VT7A 1AURA 3SK0A 3E1GA 4FLFA 5ALDA 3D3NA 1XFDA 4PV7A 2EDCA 1XZHA 4W1QA 1MN6A 3D0KA 4V2IA 4AXBA 3OC0A 4EB0A 4N8DA 1WPRA 3WKDA 1ZOIA 2GZSA 2J3DA 1SOMA 3FYUC 5DWDA 4EY7A 2G4LA 5JD6A 1UOOA 2H1IA 1DT3A 4CCYB 5CMLA 4QLAA 4Y7DA 3HEAA 5ALQA 1JMYA 3G0BA 3F8SA 4U2DA 1FSSA 5I7UA 1E8NA 3I2GA 1JMKC 2JBWA 3HJUA 3MVEA 4X95A 3DYIA 1QIGA 1EA5A 3I2JA 4B85A 5JASA 2D0DA 2QMQA 2RAUA 4Y2TA 1DWPA 2V98A 5DYTA 4K2AA 5AK5A 1F8UA 2PL5A 3SWWA 4I3FA 4MQMA 3WK5A 1GGVA 1ISPA 5EGNA 3NOXA 3L1HA 4AMZA 4L72A 4WFJA 1CIJA 1YB6A 2QUAA 5JD5A 2DQZA 2BGRA 3TRDA 4UUQA 3V1LA 2GBFA 3IULA 4LXIA 5EI5A 5ALPA 1LGYA 5EIHA 4E15A 5JZBA 1TK3A 3QPAA 1CUIA 5AO9A 1LPPA 1CUCA 4GDMA 3D2BA 1EX9A 4UFOA 4X6YA 3IUNA 3R41A 1R1DA 1XQVA 2CUTA 3M81A 1DQYA 2WIJA 4BVJA 5AI4A 3BJRA 3QMWA 3C6YA 3WJ2A 1H22A 1USWA 3G9ZA 5HQ3B 1BE0A 1PFQA 4H0CA 2GYWA 2PSEA 3KD2A 3WL7A 1RYYA 2LIPA 1Q84A 2XLBA 3TJMA 1GZ7A 5C8ZA 3BL8A 1MNQA 1LPMA 1UWCA 4UBOA 2GZRA 3KDAA 1XZFA 4NMWA 3C5WP 5AM3A 5T4BA 1IMJA 2OCLA 2XUHA 4Y2PA 3LIIA 2DQYA 3VVMA 4CCYA 1GKLA 2Z8ZA 1HL7A 4N5IX 4P9NA 5FV4A 4J0DA 4W1PA 1N5MA 2EEPA 3GFFA 1EVEA 3R40A 5ESRA 2DHDA 2VAXA 2NW6A 5FPQA 2ZSIA 3S2ZA 2XMGA 1K4YA 5AOBA 1HLGA 1XQWA 4KE9A 3STYA 4AO6A 3BIWA 1GPNA 3I1IA 5ALKA 1ZI6A 4GLBA 3JW8A 5C8XA 5D3ZA 1YS2X 3SC2A 2Z3WA 2PVSA 4AQDA 1UK7A 3DJYA 1ORWA 5EIEA 1R9NA 1XROA 4BZWA 2C7BA 1X2EA 1H2YA 5IKXA 1QJ4A 2DHEA 5CXXA 4PF1A 2VJBA 3FBWA 4TVKA 4CG3A 1OCEA 1BRTA 5ALEA 5DNVA 4BB0A 1H2ZA 4LYEA 5C81A 4WCVA 5AI0A 1NU8A 4GECA 1TKRA 5JYCA 2YXPX 4J03A 5HQ3A 4AB1A 3PUIA 2I3ZA 3WL6A 3D59A 1CUSA 4F5ZA 3V1KA 1GPKA 1Z68A 3FSGA 2WSLA 4GBGA 2Y6VA 1B41A 4X92A 2QM0A 3GELA 4BC0A 5LZ8A 1A8UA 4M0EA 1Y7HA 1AC5A 4K6HA 1HKHA 3GROA 5IVDA 4BTLA 4DMHA 1CUHA 2G63A 5LZ7A 3O9VA 1BS9A 4HZGA 2HIHA 2CKMA 4X97A 3KXPA 2WHPB 4PSCA 5ALRA 2ZYSA 5DLPA 3H2JA 3H04A 3DYVA 2FJPA 2PSJA 5JADA 4X91A 3K6KA 1CUAA 1MX1A 3I6ZA 4J0IA 1FFBA 3OURA 1W6RA 2QJWA 4B0OA 1R88A 4BDSA 4Y2QA 3WYDA 3I2HA 2VATA 1UKAA 5I8PA 2XQGA 5ALUA 5AKJA 4EUSA 4WJLA 2YH2A 3IBTA 4WDRA 4DNQA 3KWFA 3MUOA 5FDFA 3I2KA 4W1RA 1EB9A 3R3ZA 4EY5A 5A2GA 4MQLA 2K2QB 2OCIA 5AM5A 3QPCA 2HHAA 1TRHA 4Q3LA 5AICA 1CUZA 3V1NA 2GYUA 3C6XA 2B9VA 5JAPA 3GZJA 4PW0A 3IVMA 3STTA 4KRXA 3AFIA 1QIIA 4X00A 4E46A 3HRHA 1SCKA 4UHDA 4Y2JA 4G1FA 3TGLA 3O4HA 1G4HA 1X70A 4Y2UA 3B3QA 3FAKA 2XMRA 1ZGCA 2D5LA 3BDIA 2PUJA 2PM8A 2QKYA 3AZPA 4J0HA 4W63A 5SYMA 4X93A 5IVHA 4DMCA 1DU4A 2XUPA 3KSRA 3CCCA 1AZWA 4XVCA 3IURA 1W4LA 4X90A 5KWIA 1BROA 2OPHA 4G9GA 2WIFA 4OB6A 1ZD4A 4BRSA 3WKBA 4QZVA 3AIOA 3V48A 3WKAA 4C4YA 4H77A 2OAGA 4B84A 5HCUA 5FUMA 2WUGA 5LZ9A 5DYWA 1DT5A 5JALA 5I9IA 1G42A 3P2MA 2E3JA 2WU4A 1QE3A 2WHPA 3WZMA 4ARBA 1NX9A 4HRYA 2JEYA 5ALWA 3TEJA 2HM7A 3QMVA 3FLEA 5JAOA 1HQDA 2CMFA 4JH0A 4DNOA 5K3BA 2OAEA 3WQHA 4A5SA 4G4IA 4IHAA 2JIDA 3G0DA 2J3QA 3WA6A 1EK2A 4HRXA 4LXGA 3A6ZA 1U2EA 1YASA 3PFCA 1ETHA 3WKEA 4N8EA 3NWOA 1EH5A 5EHXA 5LYYA 3G0CA 2VA9A 1SCIA 4BC1A 2BJHA 1GKKA 1MJ5A 3QH4A 5AI6A 1HDEA 3KWJA 4HAIA 5CT4A 1XLVA 1VA4A 5AIBA 5CTAA 3ESDA 3C6BA 3WIOA 4G9EA 4CI9A 5ALZA 3WK6A 1H23A 4CFSA 5AKGA 4HTAA 1EXWA 4TPKA 3FLBA 5ALIA 1U4NA 4OUKX 1CUBA 1U65A 3ZI7A 2ES4A 3STWA 1CVLA 2HFJA 3PF9A 1YCDA 2PBLA 4AZ3A 3DKKA 1IVYA 2OGZA 4J0JA 1KEZA 2FJ0A 4ZI5A 1ZICA 3PDCA 4NZZA 3QMMA 2PX6A 3DQZA 3S8YA 3VXKA 1VOTA 1EK1A 4NVRA 1PV1A 5ALJA 1QIMA 4CIBA 1DX4A 3FNBA 4UHHA 2WU3A 2DSNA 3WK9A 2BUAA 3HI4A 4K6KA 3AINA 1YAHA 2ZYHA 3WWPA 3W2TA 1TCCA 3ZV7A 1DWOA 3BXPA 1CPYA 1FFCA 4HS9A 4G8CA 2HU7A 3BF7A 2J4CA 4H7KA 4HVTA 2XUJA 3DEAA 2P8SA 3H19A 3A2MA 2O2GA 4B9AA 3DCNA 4OPMA 4BATA 3PE6A 4QLOA 3T4UA 3K2IA 5CURA 1QGED 2PSFA 5AIAA 1O6GA 1QTRA 4IH4A 3WMRA 5E4TA 5HF8A 4OU5A 2WHQA 3KOOA 4N5HX 2O7RA 4ZV7A 1CUJA 4FNMA 5ALXA 1E5TA 3FLAA 2WJ3A 3N2ZB 1GPLA 4BCDA 4UBKA 4AN1A 4Z49A 5JATA 2JGKA 1RWQA 4LYDA 1QIFA 1ODCA 3FCYA 4B6GA 1WHSA 2QTBA 4FHZA 3NUZA 3STUA 3CXUA 3QZUA 5AI8A 3ESAA 3AIMA 4WFKA 4DLNA 1D07A 1JJBA 2JEZA 3QITA 5KREA 1E89A 5EIAA 1EINA 1F0PA 4GHWA 3C45A 4DIUA 4M0MA 3RKSA 3OTQA 5AI5A 1UT6A 2QXUA 4X85A 3O9MA 2JGMA 4C87A 4WDQA 1HPLA 4UPDA 3A2NA 3DKRA 4Q82A 4B9EA 2I03A 2DFPA 1IUOA 1LZLA 3AILA 5CT5A 1BEZA 4LXHA 2PSDA 3H1BA 1DTEA 5AP9A 1WCYA 1Q0RA 3G7NA 4QDTA 2VF2A 2XMBA 4IQ4A 4FNGA 4YPVA 3D4LA 5HF6A 1QFSA 1FFDA 2PU7A 4Q3KA 1L7QA 4AO8A 3WL5A 1UZAA 3WJ1A 5ALHA 2OGTA 2O2IA 3ESBA 5D7BA 5AK6A 1E3QA 4KRYA 1LNSA 2WG2A 1XLUA 1XZMA 1LPAB 1MX9A 2C58A 4X94A 1TCAA 4FLMA 3HYSA 3IA2A 4P93A 3O4JA 1BN6A 1KU6A 2Z5GA 4KE8A 2WUFA 1IZ8A 1CUXA 1M33A 5LZ4A 4KE7A 5T4FA 5CT8A 2WUDA 4ZWNA 4RE5A 4QDXA 4BVLA 3C8HA 1JU4A 2O2HA 3A2LA 2CEKA 5HFNA 1XZEA 2CB9A 3G02A 5YASA 2QVBA 4H7DA 5SYNA 5JAHA 2XUOA 4JUIA 1CRLA 1H2WA 3FVTA 4UBLA 1R3DA 2AXEA 1XLWA 1XZAA 3HZOA 4BBZA 1P0IA 1CR6A 4RPCA 4Q1VA 2XMSA 5AH0A 1B6GA 3WWEA 3YASA 3HABA 4RGYA 4J3JA 3O4IA 1LZKA 1K6EA 2PSHA 4P92A 4B7ZA 1E8MA 1XRLA 4FBMA 3EBLA 3ED1A 1LPNA 3W9UA 1L7RA 3O95A 1QFMA 2C0QA 1UOPA 4AX4A 2WIDA 5A7FA 4M0FA 4DGQA 4GWLA 2QOEA 4QWMA 1E8DA 3DL4A 3IB3A 3D2AA 1Q83A 1UKBA 4PQEA 2ZYIA 1WM1A 4MWSA 2ZVDA 4X71A 5EFZA 4Q05A 1FFAA 3JYHA 4OU4A 5K3DA 3VJKA 1XZKA 3V9AA 1YA8A 3G9TA 4UHFA 2DHCA 5FRDA 4C4XA 3C8DA 4BP8A 2EDAA 4KYVA 5AKHA 2X5XA 3B5EA 5IVIA 1SC9A 5AK4A 3ZLTA 3ICWA 4KAJA 2WQZA 3D7RA 3FVRA 4ZV9A 5JZ9A 1JKMA 3L1IA 4EZIA
chains in the Genus database with same CATH superfamily
2BBTA 2EP8A 1YA4A 2P9CA 3NBXX 4M3NA 4C0LA 5GONB 3KYBA 2VHTA 4NS4A 4Q9AA 2OORA 1XRSB 2GN9A 2OGUA 2V4MA 4GPD1 2ZBEA 1CZKA 1KI6A 4YP6A 4YRCA 4R2HA 5JH7F 2QU8A 3ZWWA 3NW9A 2XV1A 5J4HA 2CN1A 3GRAA 5KAPA 1IY1A 2O2JA 3WBFA 2BFBA 4O1IA 3D6VA 4YRKA 3HKBB 3V8NA 5JJLA 2IE0A 5CA1B 3N05A 3X1JA 2XUGA 1CR4A 1RIFA 4FHCA 2C5LA 1M2FA 4GZMA 1HBJA 1NZDA 2J3EA 4EKNB 3SJCA 1CZLA 2XT6A 3V8QA 3VU3A 4H3SA 1O9HA 3R7AA 4OA8A 1CNFA 3AKZA 2BKXA 1JRLA 1XZBA 3BIFA 3RYCB 4LJ8A 3HXQA 1EVQA 2A5GA 2Q5FA 3SFZA 4MUNA 4ERXA 2B4AA 4NF2A 5AHXA 4PX3A 2I6GA 3LWBA 3U44A 2PO5A 3HFSA 3IDOA 1E2MA 1J2YA 3E9MA 3Q7RA 4DQKA 3N8IA 1NQOA 4IZOA 1XK6A 5G3ZA 1KEUA 2ENWA 4CKBB 2IS4A 3DJFA 2VJQA 1DINA 3A4YA 1JG7A 1FMTA 1NJ6A 3ICVA 4WJZA 5FPSA 5JS1A 3EFBA 5HBGA 3RUEA 1NW3A 4QYIB 5FCDA 4BN5A 1EA7A 1D09A 3ANLA 3B60A 3CZRA 3PHHA 4XIFA 2CXOA 3T5MA 1NNEA 5E2IA 1NBEA 1HYBA 2YIVX 1DX9A 5JJIA 1J8FA 3PGMA 1X7ZA 3ZCQA 4WNYA 3F6EX 1D03A 4XB1A 3M82A 2QVLA 2C4VA 2EF1A 2PMWB 3K0AB 2PL9A 2C2OA 5A3SA 2GPSA 2GRUA 1NW9B 4LNAA 1PN3A 3AB3A 4CIYA 2ZKLA 4LHEA 4ENVA 5E9WA 2W48A 3HBJA 3AVWA 4KPEC 1RAAA 4CMKA 4Q3DA 1FRQA 1DS6A 1KJNA 3T5PA 4UTNA 1L8OA 3NM5A 4F1JA 4JL6A 4BKUA 1NU6A 3L6RA 5DHSA 1QK5A 4CM5A 3PFBA 4UOZA 3IHKA 4UVGA 5I7VA 1P5FA 3SNKA 1J25A 4TX1A 2PQ0A 1AHIA 4Y1EA 1VGVA 7ADHA 4J4HA 2G9NA 2EQAA 1CD5A 4E5DA 1E7MA 1DKRA 2J41A 3FJOA 4DRYA 1K3TA 1P2FA 1WCV1 2H7YA 1OF1A 3BPSA 3G0OA 1J07A 5LDHA 2B2NA 5K05A 1NXVA 2OMEA 4A0GA 3HCPA 3CZCA 2R6JA 1QNLA 1Z15A 1T9GR 3HFRA 2OZPA 4MJXA 2Q7XA 2WC1A 4M22A 2QSUA 1UK9A 4O1MA 5H3CA 5JUWA 2JFWA 1CQXA 1E1QA 2FSVA 3ZH9B 4DJJA 1P31A 1XLTC 2GPWA 4JLKA 4UNIA 5L40A 4Q34A 1ZNYA 2B3TA 2VQFB 2A4MA 4OBXA 2WFLB 4TMFA 2RI6A 3TLJA 4KDCA 1G6KA 5J59A 3LBNA 1EDOA 1UKCA 2HBZA 4MV4A 1EFRA 3UJBA 5B7PA 1XZNA 5DCWA 2FQ1A 3MTQA 4DE5A 4BQIA 4NG4A 4DNFA 1FQKA 5FBLB 2DR0A 1YE3A 1PEAA 4ITUA 1LDEA 1ZGJA 4QYSA 1M7BA 5HDQA 1V11A 2IDJA 4Z5XA 2I6XA 3VJRA 4TTJA 4ETMA 1OT3A 2HJSA 1FL9A 1DI0A 4FJ2A 4BAUA 2NU6B 3CMCO 1GAJA 1MEEA 1RMTA 3EOAI 3MHPA 5ALNA 5FL3A 4CCWA 4Z1OA 1EXVA 1W5TA 2RARA 1ZVJA 3CM0A 2WNSA 1C50A 5FL7D 3EVDA 3OO0A 5JSZA 1E4EA 3EZ2A 3OMLA 2SICE 4QDUA 5FUYA 1N7JA 1A4IA 2I71A 1XRMA 5EXSA 3IMGA 3R0QA 4LNUB 5FTJA 5K09A 1OGYA 1US8A 4TSFA 5KWVA 2ZUBA 2XGGA 4P0QB 3FROA 5HUJA 4LF6B 3TRIA 4PLGA 5JR3A 1IQ0A 2OV2A 9ATCA 3OEYA 3R5HA 1CUGA 3EZGA 1W35A 3LUGA 1KRXA 4PTYA 5DK6A 4NCBA 3E35A 5EZ5A 4EF4A 3E9YA 3F9RA 3PNBA 1WB5A 2RG1A 4MVJI 1VMKA 3SBDA 4ZYVA 3PNYA 4JC0A 4BNXA 1M8PA 1L4MA 1QLHA 3ZKWA 5AW1A 2O3RA 5M5BA 1FC0A 4BQNA 3VTAA 1VP3A 5FD8A 4FOPA 2O8FA 3QKRA 3R0VA 2FG6C 4N5MA 3DE3X 3EXIA 4C88A 3OZIA 2I78A 1PI3A 5IXJA 3FWYA 4LJ7A 3V4PB 1X19A 3FE2A 3C1OA 1IM2A 1FFEA 2Q62A 3OWOA 4GI1A 4NDNE 5G41A 3T1NA 3NCHA 1KS9A 2ZIFA 3N9IA 2Q4BA 1TQHA 2XCIA 2C9MA 4O4IA 3TKAA 4F6LA 2PUGA 2FP4B 5LR6A 4HPJB 2I5PO 3PNMA 1JJIA 1N92A 4XVQA 4I9FA 3VPCA 3DEZA 4RC9A 3DVLA 1GAXA 2A9RA 4DLUA 4YUZA 3IOYA 3KUKA 3ON5A 4MVJD 5F3DA 5C35A 1KFCB 2A14A 1CG6A 4M8LA 3OA2A 2JZCA 1K63A 3Q6NA 5T8KC 1QH8B 4U2CA 4UZSA 1ELOA 1NBME 1MPXA 1DG3A 3I6IA 3WRVA 3GPLA 4JBHA 1ZN9A 3OEEA 3R0IA 3I9OA 1LY1A 2BKLA 3K9CA 1JKXA 1XXHE 3A9VA 3CNHA 4E70A 3EPRA 5LLDA 3PQCA 1Z29A 3B12A 3L82B 3UT6A 1IXSB 4YJ3F 5LA6A 1M1YA 2VJAA 1T0UA 2PKRA 4Z9BA 8ADHA 2JHCA 1GG9A 3G13A 2IXDA 2NT4A 5DHRA 2BVNA 2EF0A 1VZ2A 1MV8A 3PHGA 3RHZA 3GARA 4JP5A 3BH6A 3HZRA 2EFEB 1P3Y1 5IDWA 4B3BA 1JR2A 4QIHA 2XUQA 5L7WA 1JL3A 1GNPA 5KPDA 3VYVA 3ETGA 2QN8A 4YP0A 1BHJA 1JZTA 1Z8DA 2JGFA 1R8QA 5DW3A 5DBHX 1AGRA 4RE6A 1E3DA 1LNQA 3OLZA 2EFJA 2O8VA 4LYYA 4KCGA 2AG6A 1SKYB 3FWHA 3VI4B 4HGYA 1XTJA 2WWYA 2GZ2A 5JPCA 1V4VA 1K4KA 1Y9EA 4J9VA 4NR0A 5EKTA 1X1AA 4Y2RA 1DWQA 3QGMA 4M7OA 1EM8A 3D6UA 4INZA 1YNSA 1GNRA 2B3DA 2HRQA 4MYRA 2IHJA 3HB5X 2YQ5A 1J1UA 5ER9A 3KKMA 4KK4A 5IXYA 1YRYE 3NIGB 3V33A 3U1BA 1SZPA 4HDSA 4DIMA 4I0WB 1DRUA 1T36B 1XCMA 3WSWA 5JEDA 1E0JA 3T5TA 1BO6A 2UUAB 1IY8A 1OJLA 3F98A 3I61A 1EFTA 4JYAB 4YAKA 3PQEA 2A0UA 1ORRA 3IAUA 1XAIA 3PQ6A 4NPAA 5T57A 4MP3A 4CLOB 1YT5A 1VJCA 5LVAA 1W0CA 5K8UA 4O2BA 5AUPB 2C4NA 4XPIA 1O94D 2HDWA 4X1YA 3TI7A 4EQ6B 4Q24A 3IEVA 2CCGA 2RGNA 1U9IC 4XCVA 4JVLA 1YDGA 2WZCA 3ZU3A 4N01A 2DG2A 2JLUA 3D7NA 1GILA 2PWPA 3SIWA 3PL5A 5P8WA 4F6RA 1JXMA 4B44A 2FE1A 3F67A 2FPWA 3G68A 1OXXK 3QF4A 4EHAA 1TKBA 1MMFB 5HIMA 3C6QA 4B7AA 3WLMA 3DV0B 4L15A 3ST7A 1TI7A 4RGBA 1JDJA 3S68A 2F3TA 4MUYA 2J4FA 1JG2A 3CRQA 2ZXFA 2HJHA 1AQ6A 2MINB 3E7PA 1K98A 3OCCA 2MYNA 4Q7LA 2NSJA 3UAWA 4RETA 3W8FA 2BLNA 5L3SA 2W83A 1BC5A 3JQFA 1J1IA 1P45A 4JJFA 4P6VF 4MIKA 4W4TA 3DHEA 2MMCA 3EC1A 2QJRA 3SYTA 4EI9A 3DVAA 1G2QA 3AUSA 3U81A 1RW4A 2PMCA 3D3JA 3E8SA 1WUTA 3H3JA 4KQEA 1II0A 2QRLA 3TLKA 1QPBA 3SX4A 4A8JC 4P5EA 1FUEA 4PHGA 4PEVA 4WI1A 3DVRX 3QLJA 4MV0A 1P2VA 4IGEA 1BJTA 5DEOA 5GM2A 1CDDA 2WBLC 4ZA2A 2BSQA 3WO0A 2XMDA 4JIMA 2EBUA 1RKXA 3MGAA 4B83A 4WEOA 4CQMD 2YMQA 3L8MA 5KUTA 3ZY3A 2VYNA 3OJ0A 2PS0A 2C4UA 3OBBA 2NTNA 4DS3A 2KSQA 3CZ9A 2OQ2A 3DDWA 1YDWA 1VMDA 1C9KA 1DO8A 2QNRA 4MEAA 4WL0A 4B3CA 2ZRMA 4JFAA 5AVSA 5T4HA 4QTXA 1ZGHA 4C2UA 4TS4A 4OOFA 3OPYI 3CLTC 1JAIA 3P0IA 1K0FA 4TQGA 3VPFA 4PYNA 4S2UA 4D4GA 4AF7A 3E3OA 3BUSA 3LZCA 3SZ3A 3UT5B 2YCLA 5JV5A 1P7ZA 4FYHA 1MRSA 5TPWB 1ST3A 1WCWA 3WHPA 4YASA 1BOFA 1N3LA 4JOSA 3AF5A 4LJ9A 1D2CA 1YQUA 4PYKA 4RW0A 5ED0A 5EPEA 3TZHA 1A9XA 3OPNA 4ZVQA 3FOBA 2HQSA 2F3SA 4TS9A 1AK9A 3DAHA 3QBJA 4BVEA 3D6AA 1FNCA 1L3BA 3NV9A 3NXSA 4D6PA 3MELA 3M4NA 3NOQA 1MHPA 1GCOA 4WQMA 2JD0A 1FDUA 3EIQA 4YT4A 3ICOA 3LY7A 4IR7A 4KXXA 1T5BA 1F2TA 1KS2A 2XDAA 3F74A 3ASUA 3QWIA 4E4RA 5JROA 2BTOA 4NJEB 2HHLA 3KTOA 1YUMA 4Q4JA 4YMGA 4ZC8A 3AJ9A 3KSUA 3H2YA 3DO6A 3LUFA 4UDNA 2IXGA 1Q20A 1H2RS 3AVQA 1ZBDA 4ETWA 1GAWA 4O25A 5HIIA 1P7YA 3PJFA 3LWDA 3K2EA 2A6PA 1LD3A 3MBIA 3AETB 1VSTA 1P80A 4WCFC 3ND8A 2X9LA 1M2OB 4JENA 4PLWA 3OLYA 5B2EA 3QUCA 4WV3A 5DGCA 4M36A 4NZ9A 3BJZA 4YHHB 2OORC 4U0JA 3E4CA 3WGVA 3UK0A 1MZVA 5KNLA 4QPDA 3PSAA 2X0KA 2X6RA 4IDPA 4FC6A 3KNZA 2PPVA 3TX2A 5MFZA 3S2GA 1EYZA 2Y0PA 4AWAA 2CK3D 5CA0A 4UNNA 3F46A 2BIFA 1ZBQA 3MT9A 4JT9A 1VBMA 4E5PA 3WHIA 2NZXA 4I4LA 6Q21A 1R4ZA 4HWPA 5JFOA 2O06A 4KJXA 1YONA 1MEOA 4IOJA 2V74B 4B6OA 4NY1A 2QAGB 1A50B 5KSPA 1TNDA 4JYPA 2EU8A 2F43A 5B6PA 3Q0TA 4FFMA 3H42B 3JASB 1R0CA 3D5EA 1RBQA 2V5VA 1EMDA 2OZVA 2RCNA 4IXDA 5FJJA 5BMOA 3RJTA 1CS0A 1Z6GA 1XK7A 3FYTA 3KZ1E 2IHNA 2ZATA 1QG0A 1T6YA 3IFSA 5AYVA 3WK4A 1CBUA 4AMUA 2ORVA 4AF6A 4BV8A 1NL3A 2Q3HA 3QX9A 3VHXB 3HACA 2WU1A 2VR1A 4RXUA 2ZTMA 2YIDA 4CLRB 3G2JA 3PWKA 1M1NB 3SNHA 1PZXA 1JLLA 1U2ZA 3BGSA 3C5VA 1CJSA 1P6QA 3QVKA 5GV8A 5BOVA 2O0KA 2JLBA 5JMOA 1D2RA 1QONA 4CRWB 2P69A 2IP1A 1F2DA 5BNTA 1JKJA 1T0BA 3CNOA 1YDMA 1TGYA 1EG2A 2NO4A 1C1YA 3WZ2A 4G37A 2E87A 3UZUA 3QKSB 2ID7A 1DUVG 3RWMB 1OIWA 4N0MA 4F4IA 4QTZA 3VSBA 3VYUB 4YRIA 3TQSA 4PPGA 5LMCA 1N8TA 2OXEA 3UWKA 1A8IA 4NEQA 2UXBB 2X8BA 2DFDA 4RQTA 4WNIA 5AKYA 3UAZA 1MIOA 1JDSA 4GICA 1OFHA 1GZ4A 4C04A 1GRCA 1VJDA 1XV5A 2AN1A 3ITDA 4RPJA 1EE1A 1TIPA 2CLSA 2HA4A 2BDUA 3PA6A 3VX3A 5EIXA 4KNYA 1MAVA 2DT8A 2EX4A 2IU3A 2QPAA 1DMSA 3I23A 5TMPA 4RQBA 5EE5B 4PQYA 5AVYA 2NV0A 1XZCA 3L0IB 2WM8A 2ZU6A 1M34B 3KALA 3AR3A 4LFBB 1TD9A 1L5KA 4OM7A 4ZQGA 2D59A 4CBVA 2DTDA 2HKIA 3CFYA 1LV7A 3B8EA 1UBSB 3PX3A 4PAWA 1Z33A 4D3SA 4M1OA 3EA4A 3RFXA 3R20A 3SZMA 2IYNA 1AGYA 2ZREA 1DCKA 1QIHA 3CJTA 5ALYA 5GVRA 3BCRA 3GGDA 4BY9E 3QHPA 4FU0A 5JIBA 3LDGA 5JH7A 4XIJA 1NV9A 4KPGA 5JXHA 4JP2A 2IZ1A 1ZIDA 2IK8A 4IYRA 2C8VA 3JQ7A 3PC4A 2FSVC 4UEWA 3IQXA 3LKBA 4HVAA 3B38A 1EBBA 3QUQA 4O4JB 4P54A 5EJMA 3PXGA 1Q0QA 4AUNA 3RSOA 1VXOA 1UBLS 3VU0A 4GNKA 5LDGA 3KL4A 3PQ4A 3V32A 3OWHA 3VJMA 1JJFA 2QW0X 3ENWA 2Q28A 1F6BA 1XCJA 2HA3A 4DV5B 1JGTA 1PD0A 3L3BA 1Z2DA 1VFPA 1ZG3A 1X1QA 3GD5A 2QNBA 3CNBA 4M9UA 1KDZA 5KJFA 4R1TA 2QLLA 1CE8B 1O4VA 2R1UA 2RAFA 1EDZA 3BB1A 4P0TA 5FNZA 5FWYA 5D3QA 1BX3A 5JBIA 3GJXC 1GPWB 1G19A 2OLJA 4FYIA 3WIBA 3NIDB 5KNBA 4AZ0B 4KR3A 4HP8A 3FYUB 1AXGA 1GU7A 2E21A 2ZVPX 3L8FA 3K5PA 3IL2A 3AKEA 2MWMA 4X1OA 4C20A 3PHBE 1ESDA 2XZOA 3O3CA 3HPRA 3KR9A 4IXWA 3USZA 4BFUA 3FVVA 3UMJA 1GSIA 5FV7A 4RHXA 4F4HA 3HJRA 3IB6A 1YS1X 3M9LA 1XRQA 3HP7A 2IPXA 5TDHA 5KU7A 5CCXA 4EFLA 5IW8A 4KVZA 2JHGA 1R4MA 3GA7A 5FFFA 2OXFA 1ADGA 4QOGA 1KNQA 4ND3A 1CQJB 4L8WB 3FFAA 3TZCA 1Y33E 3EQ8A 1YBFA 3VR2D 2ZB2A 5EHZA 1KVTA 3OFSA 2B21A 2VK2A 1MEJA 2G0AA 1IHPA 1WV1A 1TUBB 2HU8A 2JFQA 3F0TA 3O1HB 3PE4A 4Q01A 4WZBB 4HN9A 3RS2A 2VPWA 5MN5A 2JC3A 1OPRA 1YO6A 4R0VA 5IUJC 1N2IA 3DL7A 4RK4A 2QAJA 5EZYF 1G21E 2Y68A 4AJOA 3FOFC 4URYR 3I01A 1IY9A 4RBNA 1C8VB 5D6OA 3IIEA 3HA3A 1JI3A 2F67A 1EVIA 1ZH6A 2XQFA 2P77A 4MV8A 4ZYYA 2XD4A 2O8EA 2GAIA 1H2FA 4O8CA 3KKNA 1JQ3A 3LH5A 3MTAA 1JQJC 1C4WA 2X8JA 4JLVA 4BNVA 4HDMB 3ZOZA 3A3YA 1YI8A 1ZFNA 4AFNA 1WY7A 1OYOA 3O0TA 2IEZA 4X0EA 2YXNA 3OZCA 1APBA 1I8TA 3I4FA 3RIXA 4OJTA 3EMBA 1GKIA 4RVGA 5A7GA 1GIAA 4F0JA 1JFSA 4C7OA 1WOMA 1ICIA 2P6PA 1RM0A 4I8IA 3JVUA 1U7XA 3KQVA 2OFFA 2JBAB 1VMEA 1JDZA 2HK8A 2GNAA 1QRDA 1B0PA 2WR8A 1Z62A 2XGJA 3B6JA 1DWUA 1N2CE 3A7DA 4WCDA 4HSEA 1W4ZA 3LY9A 4LWPA 4TV8B 3RSFA 4Z8YA 4NE2A 1YR7A 2Q3DA 1VLVA 3B1WA 4EECA 3UHAA 1YB4A 2AMFA 3IJPA 3KV1A 4QPJC 5DNWA 5L7YA 4KUEA 2I1VB 2IYXA 4QM6A 1F3LA 4HADA 1Q91A 1TZJA 9MHTA 5ADUS 4L9AA 3EWIA 4X65B 2ZLBA 2ZJ8A 5TRTA 4BVFA 3C3BA 3KTAB 1CRQA 1DJQA 4WZ6A 5GGYA 3MUEA 2GERA 3Q41A 1NUHA 4IINA 2J9RA 2WPDA 2Y1FA 3FNFA 5D5QA 5AKXA 2IZ0A 1RYZA 2ODNA 2OHHA 4KQ2A 3IT2A 4UEQA 1DQRA 3V2UA 1KYVA 1Y7TA 2Z5FA 1OXVA 1FP4A 4FHDA 3RWOA 1U9ZA 3QU7A 1T9BA 4E09A 3KYJB 3NO4A 1XYVA 3KJFA 4GI2A 4C21A 1RC1A 1ULTA 2XZTA 2QRPA 4WLUA 1TJ3A 1BCRA 1HSOA 1M6EX 2OP1A 4OHRA 4E6PA 1FY2A 1GPJA 2J6HA 5KDDA 3AUXA 4UTZA 2HCFA 3R9IA 2QN3A 1RVV1 4B5KA 1GT6A 1M83A 1SU4A 1W88A 2G7MC 2A9PA 2Z9CA 4JV5B 5F73A 4BJHB 1COWA 5D1HA 2RGEA 2PGJA 3F2VA 4JB8A 2BCJQ 2YC2C 4N3AA 4R1NA 2Z8XA 4RTLA 5HZGA 1OB5A 1MU0A 4BDTA 1GPH1 5B55A 1RQGA 3TPFA 3KBBA 5K0NA 1L7PA 2GCOA 4TWRA 3DGFC 1HT2E 2JIOA 4AS2A 1YQ9A 2CUNA 4R0MA 3OCWA 1FFWA 3UPUA 4WFIA 5AUQA 4XSGA 1E6UA 2YWFA 4H31A 1ZUWA 1SBZA 1KOGA 4FDMA 1XGKA 2RGNC 4XH9B 3B5IA 3G5UA 5ILQA 2A35A 3PC6A 4ZOLB 1OIVA 3FETA 3BL6A 2R7LA 3FBTA 2PZEA 3IT3A 4C03A 5D00A 3CNQS 4OGLA 4HTFA 4DTCA 5FFMA 3LLMA 4BIIA 1G3IA 2YBEA 3T3EA 5BWBA 1E5XA 4RMJA 5EUBA 3VPBA 2IPOA 1ODTC 4QRIA 3I53A 1WXGA 1ZVMA 1E3IA 1LLUA 2Y1KA 4R16A 1SEPA 2A9VA 3BWDD 3GT7A 4WK0B 4I55B 3RWBA 5KNBH 3SC6A 1Q7BA 2VDRB 3MEQA 1SHKA 1I5EA 1AKNA 2EZ8A 5H7XA 1MNAA 1ZL0A 1J0XO 2HCRA 3JQFC 4KDRA 5KKNB 1JB9A 4U7PB 4PLYA 1E9FA 2GBGA 2OCGA 3L7OA 2V1UA 2OCXA 1E32A 1U8EA 3E7WA 4KXWA 3C6KA 3UN1A 4H7HA 4QDKA 3GEMA 4XGNA 2ENUA 2QAIA 3RDPA 3ZJ5A 1XZJA 3EIXA 4GMDA 4MQUA 4N3GA 2ZTUA 4N0PA 1V8BA 2ID9A 2F1IA 4X20B 1GQSA 4O3FA 2WY2D 3RYHB 3USES 4ZALA 8ATCA 5LIRA 3KYCA 1VB3A 1Q1QA 3P4YA 5KYXA 5M2QA 1IATA 1P7VA 4M60A 4UM5A 2BYTA 1Y1QA 2E5FA 4QECA 4BP1A 4DSZA 5B1YA 4PBSA 3GUUA 5HJ2A 3ZNQA 5JNUA 4YA6A 3UATA 1D1SA 2GWHA 1FNSA 3CTPA 2P75A 3WMXA 4YP7A 3I5UA 3MSCA 4P35A 5IKOA 3IEKA 5J5AA 2BFEA 2FFBA 4CMEA 1LWNA 1THMA 4MR7B 5F51A 1E3EA 5KWEA 4BXOA 3W05A 3RNOA 2YBDA 1YU6A 3DZHA 3HEBA 2IQ5A 1T9HA 3RS8A 3EIWA 2E4VA 5AHWA 1YTUA 4LHZA 4N48A 1Z6TA 2R60A 2GRAA 2PLFA 4D8UA 2A84A 4G0WA 1A8HA 3EVFA 1DRVA 3W1EA 5KJCA 1NFQA 1TC1A 3FIUA 4ZCQA 2WOOA 1J56A 4Q3CA 2BGGA 1UBCA 1YDHA 2OBBA 4WXHA 2CMKA 1XMQB 3H05A 3SC4A 2QDXA 5CB4F 3CZ5A 1U8AA 1YIDA 3BXEA 4WADA 1M0EA 1QO0A 2BFMA 4NNPA 1C2TA 1W36C 2QTLA 3P9ZA 4IS2A 2NO6A 1Z6YA 4JI2B 1D0VA 1O7JA 4LX8A 4YXFA 5BOSB 1TGVA 2VHXA 4KQWA 1NXOA 4UVEA 4WKCA 4ZVLA 1ZD3A 2POQX 1GJRA 2ZI6A 4KPYA 5DHTA 3ENQA 4H0NA 5SY6A 3STXA 5C3MA 2NUPA 3C70A 4F21A 2FSIA 4GBJA 1U0SY 3BF8A 2VDWA 1S1CA 3V8EA 3T52A 1CUUA 4BQQA 4DLVA 3OCXA 3GYBA 1LF5A 1TTHA 3O3MB 4QHYA 5ENZA 1H8HD 3JXEA 2E1PA 3W3AA 5GJVC 1JYFA 4FN5A 4NONA 5A3RA 4NMMA 3E7FA 1I9CA 3Q8WA 4HH4A 2HSWA 3QM1A 2YVAA 3W7AA 3CH5A 421PA 3K6RA 4YAGA 2BZSA 1SG6A 1U0EA 1BX0A 4G1VA 1NW5A 3VTKA 3WLTA 1P4RA 3BXOA 1ZUNB 3IV6A 2UZ1A 3NAGA 2VRBA 1ZMOA 5JPIA 1NVUQ 4C4OA 1HYHA 5KS2A 1CUFA 2A0FA 2Y1WA 1C81A 1SURA 2D06A 4FM9A 4G0XA 1T6XA 1WVMA 3EWAA 5DSXA 1VECA 5K3AA 3F7TA 4BNDA 2VUHB 3O75A 1XMIA 3RI3A 1K8XB 2QVZX 5K3CA 10MHA 2OPBA 3CT6A 5IANA 1V6CA 3EG9B 1P5ZB 2VXBA 1T13A 1QUEA 2XTAA 3ZZMA 1CJBA 2HSDA 4NYIQ 1DEOA 2Q5CA 4FNAA 1RLTA 3AUKA 1HYEA 2Y6UA 4F06A 5IJ9A 2XUAA 1CYDA 2QQ5A 5JQWA 2HJRA 2HPVA 1Z4PX 1ZJ4A 4L78A 6LDHA 3FPBA 3PXDA 4KIWA 5JAQA 1NLFA 2JLCA 2QM7A 5GP1A 4AC9A 4U7TB 3DOFA 5LZ5A 4M7RA 4Z7OB 2X2FA 3HFGA 5ADWA 3A4LA 4XUCA 4KQXA 5AVKA 4G4JA 1QV7A 3IQGX 1YL5A 1Z6PA 2R8BA 4ASUA 4UNPA 3VC1A 4CJXA 1SUWA 1FFYA 3COJA 2FX2A 1ORIA 2QIOA 1LTQA 2W00A 3ZHRA 5EY5B 2E4XA 4CIVA 1N9GA 3EXG1 1XXHB 4ZZIA 3P52A 2W6JA 2IUYA 2Q45A 5E2BA 5KTSA 1N75A 2FZGA 3VPDA 4DQ0A 1ULBA 3PEYA 1AT1A 1CY1A 3GEDA 3RIMA 4EHLA 3ERCA 1WHTA 2C7VA 4QBFA 2G9QA 3KDPA 4LHVA 3WAKA 5JS7A 4MHTA 1T9CA 2BHTA 3KYDA 4G1CA 4RKWA 3RK4A 2GXSA 4DRXB 4DDVA 2VJNA 5C8YB 3CVYA 1P4SA 3S1SA 3WWDA 5L51A 4EJMA 2CXXA 2AJCA 4YLYA 4QDOA 2AG8A 2JFOA 2QENA 5KTRA 2CNWA 3H8JA 4CR6A 4F3RA 5DTQA 1BHQ1 2QL9A 5TQ2B 2IELA 4BB5A 2DHQA 5IULC 3LD9A 3F9CA 4GMFA 1QXSA 5I4IA 2GBCA 5JD4A 4KGVA 3ZGZA 1DCFA 1RZRD 2PL1A 2FSPA 1GCAA 1AUOA 2PR7A 5T4EA 1G60A 2C2GA 5IJXA 3UKDA 2QQ0A 5IVKA 1HEYA 1BCSA 1JEOA 3DCYA 4O2RA 1PG2A 2QPOA 4JSRA 3TNLA 1D1QA 3U09A 3H5NA 4LQDA 3UXHA 3L77A 4RJIA 3VR6A 4MRMB 5BR8B 1D6SA 4EBFA 3OCJA 2BT4A 2NU9A 3PK0A 4ARAA 3AUYA 4DNXA 1X9IA 2WLTA 1Z4NA 2OC9A 1IUPA 4MVJF 4RENA 2O8CB 3ZDDA 3MINA 1JIQA 2X5NA 3GDWA 2FKNA 3NNNA 2IKSA 4KPFC 4AF8A 2C7PA 4GYJA 1VA5A 5JAZA 3OH8A 3BILA 4LQLA 1GDTA 1F14A 1VI5A 3ZI0A 1AZSC 1EUCB 2FVYA 4GLFA 3D1JA 2V6MA 2VF5X 2ZUCA 1E79A 2WVHA 5DMHA 1W25A 3GPBA 4CKYA 3EVZA 4FYXA 1ZH4A 3SBXA 5EUCA 1FYEA 4B80A 1A76A 4NP6A 3GJZA 3W4IA 1N9ZA 3A1SA 3G6KA 3U7JA 1R6UA 4TKUA 2OQIA 4GPAA 4V0KA 3QXGA 4CV2A 1TJPB 1XEWY 3NGXA 4MH0R 4CF6A 3RAPR 1G4UR 5I9SA 3VZPA 3H1PA 1AB5A 2LXNA 4YALA 2A1TR 5JARA 4OJMX 3CRNA 2LTAA 3DT6A 4R8SA 3R3HA 3DTTA 4FYWA 3DOIA 4XLZA 4RTQA 1E1LA 2NYVA 3IVGA 4P7BA 2BFPA 2HNKA 3WHKA 2IS2A 3Q5GA 5LSAA 4I1YA 3ROXA 1JQAA 1X3SA 5EYPA 1F2UA 4QOFA 1G5RA 2PXXA 4KK3A 4UZEA 4Q9IA 4AJHA 1LJ8A 2G40A 3GGCA 4AMYA 1H0SA 4JLMA 1W85B 4F5DA 1TLTA 1C1XB 1SXJD 3EXG2 4GX0A 4IIHA 4PZ9A 5HFJA 3WZLA 1Y6GA 1GM5A 3IR7A 1ZOOA 1FSFA 2G77B 4LE2A 3HM2A 4A16A 3M4YA 3M89A 3VC7A 3ZS9A 3UJNA 2ZJ4A 1PFUA 3QVOA 2K4MA 4BV3A 5LD2B 3V46A 4OQZA 2VUSA 1LPBB 3TJRA 3BK2A 4R81A 3FMIA 4US2R 4H7PA 4JOCA 1WSWA 4YREA 3ECAA 1F60A 2EFDB 3UM9A 4KFTA 2XMCA 3IOMA 4IYJA 4C4TA 1RT9A 1CJTC 2X7JA 4PCAA 4U9IS 1JR3A 4RAQA 3GJTA 1NULA 1FFHA 1WDMA 1EXDA 3FHCB 4IWNA 2E1RA 4RF4A 1MJHA 3C6ZA 4J7AA 2O7VA 4URHA 3N87A 4FE3A 1GQFA 1UC8A 3CZ4A 4CKCA 4EY3A 1U2DA 5DLDA 1QQBA 2J5KA 1V5WA 1XMVA 3NIBA 4GSYA 1UDWA 3FUWA 4TTPA 1VYUA 1DUSA 1F4PA 2XITA 3EH1A 4OOEA 4F86A 3BJEA 4TTSA 3BDVA 2GJ8A 1ZLYA 4TXHA 1UM9B 3PQ8A 1WO8A 4KACA 4PZCA 3DLIA 3PUWA 4LOIA 4PSDA 1UBKS 1ZMTA 2B1RA 2ZWIA 3DBRA 2FETA 4FYKA 1GV1A 4PLVA 4Y9SA 4M7PA 4JASB 3NDJA 3I1FA 4J7UA 1N5JA 1TF7A 4G0UA 1BN7A 2AN5A 2QD2A 2O54A 3Q8LA 3Q1KA 4FKBA 4XDGA 3UVEA 1P5HA 2AOTB 4JKYA 3B2QA 4UHCA 2WWTA 5JCZA 1VHWA 2RK6A 2FOLA 4MYDA 4LKOA 1DO2A 2TSYB 1FYVA 1QIJA 1WABA 2ZIXB 3KZXA 3SHOA 1BVYF 1O6CA 3KJEA 4ITRC 4UM8B 5AM1A 5FNVA 4CUJA 1M2VA 2QTMA 2J1LA 1VFNA 5CGQB 5JANA 2YHUA 4IAOA 4M1QA 4PHTA 4RNDB 4TSRA 1BHO1 1NNLA 1I0IA 4KDEA 3RFFA 3VKWA 1PHRA 2A9OA 1G8MA 2ZPTX 1NJSA 1LJUA 4PWZA 3D02A 2HTFA 5BWNA 1OFIA 2B78A 3ZD6A 1QZ3A 5F2OA 4Q0MA 2IY7A 1QFJA 3L46A 4BU1A 5KHLB 3PRKE 3GIWA 3WGLA 1IZYA 2FRDA 2BGTA 2D54A 1FDIA 1GKYA 3N2EA 1ZDMA 4IGAA 1NNSA 3C3JA 1HDIA 3SK0A 3VAZA 3QVLA 3DMRA 3LVBA 3M3HA 5D3MB 4NYIR 1S2NA 3CUEF 3SP1A 4B4KA 2W11A 2P5YA 5EZYA 4ZVRA 1H94A 1V16A 2JCVA 2N1BA 3N5KA 2E6KA 4Q1AA 4RHFA 3T7IA 4TYNA 1SVOA 1Y80A 3TB4A 1IZ0A 4ZPJA 2F2TA 4CLDA 1NA5A 5BN1A 4AKSA 2P2YA 3KHUA 4V2IA 3OC0A 1EVLA 1G41A 3C6MA 5FEMA 1OLUB 3NDRA 1GTRA 3TAHA 4CI0B 3D4OA 5AK0A 5SZIA 2CV2A 5HIAA 2RGRA 1WPRA 4KR6A 5CYOA 1KVSA 2RJNA 4R8LA 1N4AA 2A8YA 3NBFA 2XB4A 2YIMA 5JD6A 1YFJA 1DBIA 3C0KA 3OJWA 3DE2X 3IBSA 4JC8A 1O77A 1Z18A 2RHCA 3A3NA 4GVPA 4LJYA 3PS9A 4CNBA 1JMYA 3CLVA 4HYEA 3MLEA 3NVMB 4F2PA 4U2DA 4LQ4A 3S2EA 3L7JA 1N2JA 4HDNA 2DE0X 2VQSA 1SCAA 1D6NA 2E2WA 4K8OA 4C6SA 2DT5A 4HH1A 3I52A 4AG3A 4D56A 1QU2A 4TYQA 4M8KA 3AYZB 4JZKA 1P91A 4N54A 4TKVB 3CONA 2YRWA 3H2ZA 4URXR 3MVEA 2EJCA 1I30A 3MXTA 1BMTA 1ECPA 4MLZA 3U9SA 5JI2E 1RRPA 3DYIA 4X95A 5TF0A 4BMDA 4MCAA 2HU2A 3UHOA 3L8ZA 5IJZA 5CXQA 2FW8A 2QMQA 3HDYA 3E15A 4FGZA 5FWAA 1QBGA 3B9PA 2RAUA 4XW2A 1QSGA 1Y5LA 2BOVA 1O54A 3FTPA 4Y2TA 3U4HA 3GLGE 1QS0B 2V98A 5DYTA 9GPBA 4K2AA 1VSBA 3DVQX 4DREA 3JWGA 2YHIA 1U9JA 1RRCA 2P91A 3GF4A 4GX5A 5DEIA 2VK1A 4M1YA 4PZZA 2UXDB 2V7QD 4MQ5A 1SKMA 3NOXA 1IBCA 4OJQA 4L72A 5C34B 3CWQA 4CMEC 4N5NA 1DJOA 2DQZA 4MRNA 3PEEA 3QLEA 4QULA 4CGZA 5THQA 2O14A 1RAGA 1ZWKA 4RD1A 4BEVA 4REQA 3OCZA 1FBNA 1V7QA 1PZFA 4QNMA 1VG8A 3IAFA 4QASA 4UTPA 4DKJA 1V8PA 2IF0A 5DP2A 1T5IA 5E6RA 3IULA 1ML3A 4UUBA 3SC2B 3UHFA 1M5RA 5EI5A 1KHTA 4Q7EA 1N0VC 3Q7QA 4WVFA 2XBUA 4OX9B 4E03A 2AMVA 1KIMA 3RT1A 4E15A 3ETHA 3I8SA 1HT0A 1S89A 1V96A 4MWDA 4S1VA 3UTDA 5A5VA 2NG1A 2BFOA 5AO9A 2J85A 1QP4A 1K5DA 1MAWA 2Q5LA 3OKFA 3NI2A 2G04A 4FK8A 4O6VA 1R6BX 1LPPA 2WDZA 3GZ4A 3QNWA 1CUCA 3ZTTA 4GDMA 4V0MA 2Z83A 3GNTA 1Q2XA 3GLIA 1KI3A 2OL4A 2CLKB 1TT7A 4Y18A 2IY8A 3ZDBA 4KXVA 5IWAB 2D1SA 4ZEOA 1RMQA 3J7TA 3QFCA 2H4YA 1RLJA 2C61A 2H9IA 1UXJA 2FF5A 3W1WA 5K6TA 3KQHA 3R41A 1PG0A 1JEQB 2Q3BA 1OYYA 5TQJA 4PNEA 5EJ4A 3FHTA 3M81A 1DQYA 5E0OA 3R7FA 4BVJA 4CFZA 3OFNA 1DSSG 1V3QE 3DA8A 1KAEA 4C4RA 4MAAA 4XWKA 2CHGA 1NVWQ 2LCFA 3UFBA 4Q7QA 5LMUB 4I1SA 2H2DA 2ZQYA 3WJ2A 3ZDYB 3HO8A 2I8CA 4GI5A 1FW6A 2WZQA 4L2IA 4Q9LA 5DZSA 3MT7A 3T3IA 4UU0A 1DQSA 3FY4A 3G9ZA 3VZQA 5HQ3B 2IH5A 1BE0A 4OQFA 1AV7A 3LT0A 5AVOA 2X4GA 4Q1BA 4IRMA 3HB7A 4B3RB 2AC2A 2JKVA 3DB1A 3T9EA 2FFAA 2Y1OA 4N7MA 1RYYA 1G21B 1X42A 4JUCA 3ZYCA 2NQ2C 2A0WA 2HSGA 2ZKIA 4R1OA 1S1MA 3H7AA 1DKUA 1TEVA 2D2XA 4U5XA 1NG1A 1RADA 5E3JA 4F84A 1E2PA 4L08A 3BL8A 1G63A 1MLDA 3IR5A 3V4VB 3L7YA 2HWYA 1EX7A 1LPMA 1USVA 1UWCA 1VI6A 2WJGA 5B3JA 4BB9A 4TTVA 4YCDA 3U3RA 4NMWA 1J5PA 4LEIA 4G0PA 3ILVA 3IILA 1OH7A 1X7WB 3PT9A 4D0LB 1NVGA 2V1XA 4OK6A 1QCYA 1IMJA 3IQZA 3VBCA 3VPGA 2XUHA 3KQTA 4Y2PA 3FCOA 1PR6A 3SOZA 3ZD8A 4KREA 1RC8A 2YMLA 3WYAA 1SIWA 1CULC 2YY6A 4IO1A 3EGEA 1HDCA 3RSLA 4EUHA 1CERA 3CLUC 1PZGA 2H3EA 3UK1A 1EFLA 4BBJA 4ZAFA 1AQNA 3ODGA 2QM8A 3ACBA 1GTJ1 2X6TA 1C1DA 3OTWA 2CNLA 4X8HA 1AH2A 1N2CB 1JEEA 2L2QA 5ER6A 2B4RO 3BCHA 4P9NA 4UD2A 4JA2A 3QU5A 1E3JA 3N2LA 5H80A 2N47A 2I62A 2PJUA 3GFFA 1OX4A 4CN8A 3ZDAA 4AY6A 2OV1A 3ZQKA 1ADCA 1EVEA 2OT3B 3R40A 3QBTA 4KZPA 1IQRA 1YH3A 5JW6A 1MOZA 3COPA 4BEWA 3ZWVA 2VYFA 4R3WA 1KNXA 3CKYA 2VAXA 2Q8QA 3HXLA 4PTLA 3DMTA 4ZMRA 4Z4HA 4YWJA 2OO5A 4NBUA 5ES4B 2YXDA 2NP6A 2VRCA 3M5DA 3AM1A 1FDVA 2XMGA 5DN6D 1U94A 4M49A 2QG9A 1U6KA 4KQGA 2VP6A 1HG1A 3EUAA 3OLVA 5AOBA 3MW8A 1U0FA 1C29B 1NYQA 4OBWA 5THXA 3ZQUA 1F0YA 2ZUVA 3REFA 3ILYA 1OZHA 5IS2A 4KE9A 4AKIA 1X1BA 1Z5NA 2OD2A 1S02A 4QFDA 3NWPA 4RV4A 3G23A 1JLRA 1Y7PA 2VH5R 3EQ6A 3GDHA 721PA 4OQEA 5EWLA 2WEKA 5DSTA 2A5LA 1ZI6A 1YBMA 221PA 3ADKA 3EIUA 1Z4QA 1TQ4A 1BVRA 3GT0A 5IJ0B 1IONA 3ANYB 4RTNA 5A6SA 1TJYA 3ZGLA 2Z3WA 3L8YA 4PVDA 5D5HA 4AL4A 1FZTA 1WPGA 5CTJA 4EARA 2D2VA 2Y77A 1AUQA 3DJYA 3JD2A 2RBKA 4WRRA 1OFUA 3WRXA 1HKUA 2OYCA 2FPPA 5JEEA 2C7BA 1KSFX 3D8HA 2IWRA 1NVXQ 2R6DA 3JQPA 3LLVA 1SBNE 1MH1A 1YZHA 2QL5A 5K8TA 1DNPA 1Q16A 3CCFA 4LXUA 1SH7A 4P82A 1NDUA 3R7DA 1LKZA 1ZQ9A 2AHOA 2DHEA 2OM6A 2SCUB 3P96A 3I5YA 2PUVA 4PF1A 2AVDA 2HMWA 1X39A 5FBHA 4DSOA 2I7TA 1KKUA 2VJBA 2ZYTX 3OY2A 3ASVA 4HQLA 3L01A 3OZRA 5EIBC 2G07A 2PCJA 2ZETA 4ZU1X 3H1TA 3LHIA 1Q3HA 5IH3A 3RK1A 4EELA 4DCUA 3GLSA 3IRUA 5FL7A 4KSYA 2XYHA 4BB0A 4A4DA 1AA6A 1A5TA 2JGNA 3R5SA 4WCVA 2R5WA 1E63A 5IAAA 3OHSX 4GECA 2F8LA 3JQGA 1BGXT 4NOMA 4M1MA 1Y8ZA 1EQAA 3R7LA 3MMZA 4OHKA 1SVWA 4WLNA 4AP9A 3QG5A 1FX0A 1SVMA 5FI0B 4LHXA 3K9FC 4EW2A 3KQLA 2NP7A 4L07A 1WY5A 3D59A 4F5ZA 5FR2A 5LQUA 1JILA 1Z68A 3IIJA 4MA0A 4IMJB 4C43A 3GG2A 4CLHA 5KNCA 2XXAB 4BMOB 4PZDA 4B48A 2GGSA 3JQQA 3HWRA 4D8VA 2H1OA 1EGMB 4FS3A 1L4YA 4ZHQF 2PYDA 4UDYX 4O2AB 2QM0A 1T8WA 1G291 1E2NA 3HYRA 4YYEA 4OXNA 1LCIA 1IBMB 4M0EA 1RYBA 1Y7HA 1AC5A 3W6UA 2QV7A 1F0KA 5IMSA 4UMVA 5ULLA 1CNMA 5TPZD 1QQ6A 4DCSA 5I45A 2PLAA 1VJTA 2BKUA 3D31A 4QO7A 1AA9A 2JDIA 3GROA 4RZQA 3ROEA 1G64A 1A7JA 1UEIA 1VMAA 4YCAA 5GOTA 3WTCA 4Q7KA 2Y9MB 3TAXA 2G6TA 1ADBA 3SPXA 1PQ4A 2GEDA 3B3AA 4BX2A 2H2GA 1U2DC 3HBMA 2QN1A 4DCNA 2P9GA 2QQEA 1XTUA 2V6FA 2CHQA 3LOQA 2HT6A 3LT1A 3LBFA 2GHIA 5EEGA 3K0FB 3RF6A 4G5HA 4X97A 4PSCA 4MVJA 5DLPA 4IDGA 1D9XA 3CUWA 5EJ5A 2ODQA 2GN4A 3H04A 1CEQA 2XJ9A 4X91A 5GVSA 4IV8A 2WWRA 3K20A 2GRJA 1ISJA 1MP0A 3I6ZA 5IDXA 1FFBA 3VSAA 2J5BA 2X2OA 1JHDA 3O2JA 3RS3A 5EHIA 3DE4X 1SVIA 4S0ZA 4D43A 1PGOA 3U3ZA 2O8BB 2XDQA 1T8TA 3OTHA 3I2HA 4Y2QA 3T7SA 3WP0A 4FKMA 2BFDB 2DR3A 3K5HA 3UMGA 5HK9A 5KSWB 2XQGA 4Q1EA 3OUZA 3LUAA 5JVDB 5AKJA 2QRHA 4Q18A 2V3CC 1SCJA 2I1LA 1KGDA 1BE8A 4ZVSA 4WKPA 4QTYA 3IBTA 2REQB 3AHJA 4U6NA 3OJOA 4DLBA 2EG9A 2EJTA 4DCTA 3DL2A 2VT2A 2PYZA 4G26A 3KWFA 2ZYWX 4PONA 1ORTA 4R1MA 4CYMA 1I7QB 3IO3A 4MQEA 4EW3A 1Q11A 2QV0A 3CNLA 2O23A 3OZDA 4P1ZA 4X8MA 5B58C 3TZLA 4R71A 2UVQA 2I0FA 4XVRA 1N0IA 5CIQA 4MQLA 3WLFA 3NC1C 3B6EA 2BP7A 2JK0A 4GBED 1E9DA 3WLOA 3PXUA 2FRDC 1NVFA 2Q3MA 2V5UA 3FPHA 2FN3A 3I39X 3HR7A 3QPCA 4FE4A 4MYUA 5SZJA 3RC1A 1TRHA 3S44A 1Y8AA 4K9DA 1T2DA 4JX8A 1ZGZA 4Q3LA 1PK7A 4MI6A 4U3JB 4J2OA 5AICA 2ZAYA 4LI0A 5AXBA 4BO2A 4XVHA 3A32A 4IRXA 2O9JA 3W78A 1F17A 4P22A 2H5JA 5GADl 2HSEA 2H4XA 1ZCBA 3A6FA 2ZAGA 3TFQA 3H16A 4PW0A 1KEPA 3D3QA 4BFWA 2JLSA 4LDRA 1QFYA 4GF5A 1QIIA 3EW7A 2V7VA 3L9XA 4X00A 4C0KA 2JS7A 4TXNA 5JCPA 1ATIA 2IOHA 4FQ7A 4MW4A 1KJYA 3F7MA 4LVCA 3A58B 3K73O 4RY9A 1XZ8A 4I6EA 4L51A 5FQOA 3ZWBA 4EIWA 2W0SA 3LYLA 4RVHA 5KOYA 1CYEA 3PR3A 1HE4A 5JLAA 3FAKA 4CF7A 1KMNA 2Q7OE 4QOSA 2FQWA 3B6IA 1XWWA 1FU8A 4OQPA 3OIDA 1MJFA 2R7NA 2Z98A 4AAYA 1TPYA 2WPNA 3HY3A 3TQFA 2JZOA 3H87A 3U3JA 3F1KA 4CQLB 2ZT5A 1FS4A 3EPJA 3AHHA 2P2ZA 1TA9A 2OCAA 3H9BA 4Y0AA 4YV1A 1TX4B 1A4XA 1DU4A 3KSRA 3HJNA 2WE7A 4D8WA 4EPWA 3QJGA 2JRCA 4PWYA 4PXSA 3FTQA 4DHEA 2JFZA 3JSAA 4OTZA 1M1YE 1VYTA 5DLYA 3SF8B 4IG4A 4WOBA 4LC0A 5CFQA 3A3KA 1VE3A 4KGDA 2CLIB 5DLQC 3FJYA 4YMHA 4RCYA 2XXJA 2FWNA 1PL0A 4Z9FA 1Y7LA 2FF7A 3B36A 1AKQA 2KMLA 1SM4A 3WRYA 3DUFB 3NTVA 2J3IA 3TDNA 4CCAA 2W2PA 4QJ5A 3VTFA 2NUTB 4KYIB 2AX3A 3U5ZB 3F49S 5BMVF 3GOHA 4IM7A 5BXQC 1W7AA 1BKSB 3ZXSA 2CGEA 1GFIA 3VR4D 2BELA 5F98A 3MQ2A 2HQOA 5CJPA 4V3CA 1XTVA 1X1EA 4OGWA 4DV4B 2QU7A 1QR2A 2EP7A 2OAGA 2EZUA 3PC8A 3WQQA 1CVRA 3EFEA 4KO8A 5HCUA 5FUMA 3CNEA 1PX0A 1OYVA 3HBFA 1YR6A 1ZD9A 3GCWA 3GJ3A 1DEXA 3OKAA 5HM6A 1L5YA 4C0HA 3D6JA 3ONDA 5A2QA 16PKA 3KB6A 5I9IA 1FUKA 2IZZA 4NZPA 5DM70 2ZSJA 4IMPA 3SBEA 2JVKA 1M0TA 2WHPA 2DQ4A 1NMQA 1Q1AA 4ARBA 4GOJA 3ZZNA 1P81A 1XZPA 1UXGA 3EEQA 1GADO 3OU6A 2OE2A 1YDFA 2LBPA 1GZ5A 3GDFA 5IJAA 4JDUA 3JSXA 1QTQA 2VTKA 4DADA 3QMVA 2FHPA 3C15C 3KWLA 5BSUA 2FEOA 3IGFA 4JH0A 2SBTA 4YRGA 1FP2A 4UCQA 2OAEA 4HD8A 3TCKA 4PN7A 4FGSA 4G4IA 4OLFA 1C7QA 4Q9KA 3T7KA 5BPHA 4GKJB 1GZ3A 3OU2A 5C5CA 1QVRA 2J3QA 1GT91 4D79A 2I33A 2B99A 1NN5A 2ICAA 5F5XA 2ZS9A 2A0KA 3KVNA 3SYLA 3WA6A 1E92A 2NV6A 4YRJA 3T7JA 3Q3HA 2IZ6A 2NXEA 1WL8A 4HRXA 4JLAA 5B7QA 4MUFA 2VLBA 3JD4A 3PFCA 3KQQA 1ZGGA 4EKDA 4X1KB 1SQ0A 2M9MA 4F8JA 4RIGA 3PGLA 4RSMA 4AQYB 1GTSA 2HXSA 1ZSYA 1T5DX 3QBEA 2JFYA 3G0CA 1V6SA 2PVCA 3NWJA 4RMGA 5AW5A 4BC1A 1AV6A 3MILA 3KQMA 3C7AA 3LZDA 1GKKA 2CK3A 3N2KA 3QH4A 3KOZA 4RM2A 3W4JA 4D4MA 1CWUA 1IHOA 4RORA 3UAYA 3LM8A 1NPTO 3KWJA 4YY3B 3WDLA 3HCFA 3QA3E 2G1PA 2TS1A 1NI5A 4JROA 4BUJA 1WP9A 1VA4A 2QE7D 1PGQA 3WIOA 1GP2A 4TRRA 5B3JC 2HEIA 4EH1A 2QEQA 1A72A 1Y3CE 3TQTA 4YCLA 3U1VA 5J4VA 1RRKA 4B3DA 3ZZUA 1T5TA 4EUKA 2ZAMA 1XTPA 4CDGA 1E6KA 4D81A 4KR7A 2EYQA 2CD7A 3A9WA 3AP3A 3WHLA 5CFNA 3KVYA 4RA9A 3SE0A 4FI3C 1HK7A 2IOFK 4UUMA 1D1TA 5D84A 3D8TA 4IJKA 2VPPA 5DNCA 1PT5A 1U4NA 5DVZA 1V9SA 3F78A 3LGAA 2YS6A 4PR0A 3VR0A 3MJFA 3OQ6A 1CUBA 1FFSA 3WB2A 1U65A 2CE2X 2NACA 4CMIB 3WGIA 4RSHA 2ZVJA 3OQOA 5MHTA 3T9CA 1G3QA 2PMDA 1NVMB 2ZSAA 3OE7A 1RJFA 2OWDA 2UV8A 1YCDA 4NABA 5GIPE 1CJKC 4GO1A 3C98A 5DB4A 4Z99A 3WSTA 4AZ3A 3L0YA 2QZSA 2VPZA 2FEXA 1EVZA 2OGZA 4F6CA 4J0JA 5BN5A 3LLUA 2BY4A 4GQBA 4R6WA 3L4KA 3AEKA 2R5FA 1N5OX 4UTOA 1Z37A 3F1LA 3KQYA 3SZGA 3DMTC 3IMEA 3LX5A 2OO5C 3PDCA 4PFQA 4UVHA 4J1NA 2HK7A 4NZZA 1ILWA 2WMNB 4X41A 4P3KA 4HFRA 3OE5A 1YNOA 3TUZC 1HDYA 3VXKA 1EK1A 1ZJ6A 3CKMA 1C7RA 1UXHA 2CYAA 2XE6A 3DE5X 3NHMA 2C2ZA 1QF7A 5ALJA 4EW1A 1VG1A 4RD3A 4K7JA 1CZUA 2P4UA 4R68A 1DX4A 4Z7JA 3TXAA 1V4BA 1I2DA 2WU3A 3ZS8A 1WXFA 4BV9A 3WK9A 3HI4A 4M9SA 4HAXA 3JQDA 4N9WA 2QSYA 4CM9D 1Z2CA 1EGHA 1YAHA 4TRMA 4YAUA 1V1RB 4GUDA 4KNWA 3AWIA 3U7HB 1TCCA 3O2SB 4QYMA 1N5LA 4EG0A 1DDGA 2PMBA 3MLAA 4L73A 1MO5A 4QBKA 1DWOA 3JVEA 4JI6B 1RWPA 3BXPA 2VZ8A 2YW2A 3E9DA 4RLSA 1D0IA 1PJ8A 3ZHYA 4AN4A 5KCMA 3S6JA 3WRXC 3GJQA 1PVVA 3K0SA 1WXHA 4YAJA 1RBZA 1RZVA 1O97C 1ZXBA 1U1IA 3D6MA 5G40A 5JZMA 4N41A 2J4CA 3OTGA 4RD6A 2VF7A 1JHZA 3SMVA 3EMVA 3ZLBA 1NQTA 1ZJWA 2CXTA 4CW7A 3HU2A 5M29A 4E2XA 4WN3A 2O2GA 3P94A 3FR7A 2MYTA 4GXQA 4DLKA 3A06A 1KO8A 1MA3A 2B35A 2I2DA 2IHKA 3NZEA 3BD8A 1T3GA 1IB6A 3QV2A 1YS7A 3Q7IA 2A33A 2CNOA 5F78A 5F52A 1DIHA 3B89A 4P7JA 5B1IA 2ZZNA 1H66A 1V7PC 2PRZA 3ND7A 1OI4A 2H31A 1E2EA 3OBIA 3PE6A 4RZHA 3TLYA 1PFGA 2ZYGA 3FLMA 5JFTA 3QEJA 2PLWA 5HBRA 2GPYA 3UWMA 5H68A 1M6WA 1IMOA 1EIWA 1Y4DE 5HEKA 3AUTA 2BSXA 2VBIA 3VR2A 5HQTA 3U40A 2PWAA 4JLOA 1EFVA 5AESA 1MFPA 1SAYA 2WUVA 5C46F 5L4LA 1SBIA 1H4QA 3COVA 3F71A 4JMPA 1UT5A 5HF8A 1K7FB 1GPDG 1ONPA 1T2VA 2AHRA 2WHQA 3CBQA 3KOOA 1S2IA 4N5HX 3MCTA 1G1MA 3ET4A 3V2HA 3V1UA 4F2DA 4YRZA 4ZGBA 1JIXA 1GR1A 3GLGB 4MUMA 5ALXA 4UOEA 4EGFA 1DPFA 1T8RA 2CVPA 1Z0IA 2YUIA 4MZXA 3HKDA 4B43A 2F3RA 1E5TA 3MG9A 2FUCA 3KETA 2JAOA 3HCDA 3N2ZB 3TPCA 4DW8A 3E27A 1BS1A 1ZAYA 4PCUA 2FK8A 4BCDA 1L5VA 4G09A 5C2JB 4N76A 2VAPA 2DQKA 1SUSA 1EE2A 1E3TA 4MW0A 5FQNA 4ZU6X 3K05A 2DOKA 1QDUA 2FZWA 5C51B 3VR5D 2QRGA 2D0IA 3GRUA 1QZTA 2D00A 3COZA 3AI7A 4MCIA 5IFKA 4KIGA 4KRFA 1FIUA 1R0LA 2CLHB 1A2BA 1WHSA 2IV3A 3DL0A 4PPQA 4ZTZB 2QTBA 2V54A 2ZR0A 4DDWA 2R1TB 3QG1A 5C7LO 1DTWB 1TTQB 3A6PC 5GV7A 1B6TA 4MA5A 1QKKA 3ANXA 2EWWA 2FEKA 3JR3A 2DQSA 2R8RA 5AI8A 3FNHA 3AU8A 4BBPA 4ZI3A 1WOYA 2X5JO 2JFPA 3AIMA 4HDCA 3ZCVA 4BEJA 3PC7A 4NE9A 4D46A 1WUJS 3K7EA 4ND7A 4WFKA 1GSHA 2OXRA 3KD3A 3QV1A 2CDCA 1XQ6A 3DZCA 4HMQA 4DLNA 3DTNA 4DV0B 3LRPA 5FLYA 4E3ZA 3NC4A 1GUFA 4B7CA 2FLWA 1MB2A 4WGGA 3BEOA 2ECQA 3R1IA 1S9DA 4U0KA 5B36A 1I0ZA 2P9JA 4LZWA 3W8NA 4EGJA 2ZP1A 2VP5A 1RYNA 3FYDA 1SKAA 3HFJA 1ND5A 4GHWA 2JPDA 4L5JA 4N0QA 4K0KB 4A7PA 4LV5B 4BGUA 3DOUA 2J9XB 5KEIA 3C3CA 3RKSA 4YDHB 3DONA 2Y27A 1MPTA 3IOBA 5G1OA 5I7SA 3U9LA 4MKRA 2PKWA 5C52B 5TSDA 2PY6A 3DHWC 3PDIA 1TLLA 2H63A 3HUFA 3E2IA 5BV8A 2EX0A 3N0VA 4HGOA 1YR8A 3DV0A 2D1QA 1BNCA 4K6MA 3RJ9A 3AF4A 4A8JB 4D9MA 4EHNA 2RK4A 3F6SA 3JZAA 4LCJA 3C1UA 3GRKA 1WJGA 3GGGA 3QOFA 4MGHA 3HP1A 4X85A 2WI8A 3L0ZA 1C9DB 1GL3A 1RI3A 2C4WA 5AVWA 1IK6A 2V7XA 2JGMA 4C87A 3W2HA 4CN9A 1BDHA 1SQSA 1X7XA 2XHEA 3E03A 3NHPA 1OR8A 1HPLA 1DAKA 3B13B 4LW8A 1SOAA 4W5OA 4CMCA 3A2NA 1DZIA 2GSWA 4WK2B 2X9QA 4XIYA 4ZHQA 3OX4A 4FJ1A 2D5CA 5FOWA 3K53A 4C5AA 5BN4B 1EKXA 3GNSA 3PFWO 3P4UA 5CT5A 4HNSA 1Z4IA 1MVNA 1N25A 2PSDA 2Q5IA 1HO3A 5LC1A 3H1BA 4A2QA 4BKQA 1L5HA 4MSUA 4RTJA 3UOWA 4X60A 1EM6A 1G0OA 1NQXA 3ROGA 1NXTA 2H48A 4MMZB 2H0QA 1ISHA 2J6CA 5AP9A 5JG7A 1ZRHA 3IAM1 4R3NA 1YQDA 3ZDEA 5E7IA 1T1SA 4HATA 4PGAA 4S04A 1E0DA 3KXLA 2XMBA 4RHEA 4IQ4A 2CL5A 3EAFA 1MJGA 4FNGA 3D4LA 3PIRA 2Z30A 2DPYA 3PGVA 4MUGA 2XB2A 2V65A 1FFDA 2P6MA 2VHYA 4UTXA 3ZVRA 4RXTA 2XVMA 3Q11A 3B82A 4N7JA 3ITNA 3HJCA 3IT0A 3IUSA 5EFOA 3WMEA 2HMUA 1UZAA 4YAFA 1QH1B 1OBVA 2I7VA 1P7PA 2YOGA 3AUUA 3OJCA 4KMOA 5ALHA 2CUZA 3RVLA 4K40A 4US1R 1DLIA 3GUCA 5D7BA 5AK6A 4K86A 3S2FA 1J97A 2NVUB 4UNSA 4A2PA 4ZOQI 5LNK1 4KRYA 4FGLA 2WG2A 4AMVA 4EX6A 1PJCA 4QOJA 2QTFA 1ONNA 1CX9B 3AEQA 2V03A 3FBGA 1A7KA 1KEEB 1E6MA 2GZ1A 2ZIGA 3D7MA 5LXTF 5HKKA 3NDBB 4WCFB 3WNVA 3PTLA 4IOLA 1XKXA 2TMKA 4GPTA 1AKWA 4JXKA 2IE8A 3IBGA 3T6KA 1FJGB 1TCAA 3HYSA 4DLPA 1YRQA 3RUAA 1YBVA 2LCIA 2HF8A 3HWX1 1KI6B 3IA2A 4NTZA 3WRYC 3SOPA 5K0LA 4FT4A 2I4LA 4Z4EA 1EP1B 2GB4A 3JRNA 3RTAA 2RD2A 3L8EA 2BFBB 3RYIA 3PA8A 4MINA 3HB1A 4RE5A 5DXAA 4QDXA 4BO6A 4BVLA 3QQ5A 3MD0A 4MICA 4OQMA 2Q6IA 5ED4A 2O2HA 2AF4C 1A69A 5KI6A 5KB3A 1XZEA 2CB9A 3PC8C 2JHAA 1B93A 3HL0A 5HE9A 2CZGA 3V7UA 3WG9A 4J0FA 1AKUA 2ZB3A 1XYYA 3DZFA 3K0KA 4ANFA 1OAAA 1N4DA 4CU5A 1PEYA 3RQIA 2C5SA 3CG4A 4D4KA 1TAGA 5HTOA 1AF7A 2C7OA 4DG5A 4DXHA 5K7SA 3EY4A 3NR2A 1P0FA 2A5FA 2PS9A 1B6RA 2FN8A 1HOTA 4LS3A 3SKXA 1CRLA 1UKYA 2AT1A 1M73E 4R6XA 4DM4A 3H9QA 1GFSA 4ZCMA 4US0R 1SRRA 1WX1A 4UBLA 4NJMA 4A0QA 2H1CA 4L4YA 2AXEA 1PD1A 2PEZA 3CX6A 3QFSA 3TSWA 4Q3EA 3DM9B 2D0OB 2O0HA 2XWSA 1P0IA 4M0UA 3BREA 5SZHB 2EBFX 1N0UA 4S2EA 4WKBA 2E37A 2REBA 2J3KA 3NGLA 4MGKR 3TLAA 5AH0A 4LZOA 3WWEA 5EL0A 2AEEA 3HABA 4FYYA 1N2ZA 4FFDA 3LX4A 3E3LA 4DC0A 3KKOA 1SXGA 1X7ZB 3B1FA 5F4BA 3HQ4O 5K45A 1C80A 2I29A 4GWKA 3UAXA 3A1CA 1LZKA 5FBWB 1M1NA 2EKBA 4G0MA 1KAGA 1Q3TA 1WKBA 2JA1A 2DPLA 2PSHA 3BHIA 5EMKA 1T9GS 1H8HA 2Z4SA 4BVHA 1T6BY 1CY0A 4LMPA 4MIOA 2P3QA 3ZDRA 2HO4A 2NZVG 3BKXA 2O5VA 2IV2X 1KEWA 2LNDA 2QHXA 2Y4OA 3P2JA 3WLSA 2JNWA 5THKA 3T34A 3QKSA 1AS0A 1DKQA 3BWVA 3E84A 1MRNA 3O9ZA 1QFMA 2G08A 1TYBE 3BN3A 4GMXA 4XQEA 5F2KA 4QVKA 5DPMA 3UJHA 3TDMA 1P44A 2IOFA 2IOYA 2VWQA 1JW9B 2GARA 2GYYA 5HCNA 2QLBA 2YYAA 4OI4A 3VO8A 1KZYC 4NLLA 4M0FA 5KOJB 4EMSA 1EXNA 5TY0A 2AYZA 1I7NA 3RANA 5CB0A