1MU0A

Crystal structure of the tricorn interacting factor f1 complex with pck
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
293
structure length
293
Chain Sequence
MDQECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline iminopeptidase
publication title Structures of the tricorn-interacting aminopeptidase F1 with different ligands explain its catalytic mechanism
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
total genus 100
structure length 293
sequence length 293
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2002-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mu0A00
4LKOA 4B85A 1CR6A 4IO0A 3G02A 1PFQA 1XLWA 3V48A 4OB6A 1TAHA 2O2HA 5JALA 4HTAA 5I8PA 1DX4A 2IIVA 4BAZA 5ALYA 2OCKA 4H7IA 4BVLA 1IZ7A 2H9YA 1ZIYA 1KU6A 2WTMA 3R41A 5E4JA 2PU5A 3FBWA 4RE5A 1ZD2P 3IUQA 4BDTA 1YB7A 3H1AA 3ANTA 4XWGA 2EDAA 4CCYA 1SCKA 1LLFA 3AILA 3MVEA 5CT6A 1CUIA 5CT8A 3N2ZB 1XZDA 2V96A 4QDZA 1JJIA 2GZRA 2HIHA 4QDXA 5HZGA 4B80A 3LLCA 1WB5A 1EB8A 2YH2A 2C5FA 4JEIA 4UHBA 3FLEA 3I2JA 3TEJA 3LIIA 5FLKA 1GT6A 3QPCA 4UHDA 3LP5A 3WKBA 1IVYA 5C8VA 3T4UA 3NGMA 4H77A 1R9NA 3W05A 4X00A 5HCUA 5JANA 1EI9A 3FCXA 4G8BA 1PJAA 4KAFA 1J07A 2Z8XA 5ALIA 1BEEA 1BU8A 3HC7A 2OCIA 4Y2YA 2OGTA 5LP1A 4U2CA 1TCCA 2O2IA 5ALGA 3LIPA 3GZJA 1QIKA 4ZXFA 4QLOA 5AIAA 3WKAA 4FWBA 1GGVA 2BUBA 5AM4A 3I2GA 1W4LA 3WKCA 1P0QA 1SCIA 3ZI7A 1SCQA 1UWCA 1C4XA 5HF6A 1LPSA 2OPHA 3WK4A 1VKHA 4ZWNA 2WIFA 5EIEA 4J0IA 4Y2PA 1XZFA 2PPLA 2WG0A 4L9AA 3PFBA 4K5QA 1WOMA 1XZCA 1A8SA 4ZV9A 2V97A 4B83A 1MTZA 3H2JA 3NUZA 1VA4A 5ALNA 3C87A 3QPAA 1UKCA 1QFMA 2Z3WA 3B3QA 4QDTA 1R88A 4HAIA 2D0DA 4OU4A 4Y2SA 3IVMA 3G8YA 1N5MA 3R3ZA 2FJPA 4BRSA 2WFMA 2I78A 3HI4A 2OXEA 2OGZA 2QXTA 5FPQA 3AFIA 5A7HA 3C70A 2WG2A 1XKTA 3WZLA 1QFSA 4E46A 1BEZA 4Y7DA 3IUMA 1MN6A 2HFJA 4J0HA 3QH4A 4NZZA 3D7RA 3MUOA 1A8QA 1Z68A 5AM2A 2DSNA 3BDVA 3IUNA 3C5VA 5CH3A 4OB8A 4X93A 2VAVA 5BV7A 2H7CA 5LLSA 3R40A 3WWDA 3PUHA 5HF8A 1WB4A 3K9BA 2WUDA 1MX1A 4QZVA 2JF0A 4ZV7A 3FSGA 1ZD5A 1T2NA 5ALKA 1XZMA 1SC9A 2D5LA 2LIPA 4GHWA 1CUJA 4QA9A 3RARA 3AJAA 3T52A 4BRZA 2CEKA 3ZPXA 3G0CA 2HA6A 3E4DA 4KR0A 5AKJA 3WKDA 4UBNA 2CJPA 4QLAA 1QOZA 3HSSA 4U2EA 1ZI8A 5CH5A 4OSEA 2HA4A 4DNOA 3DYIA 3G9UA 1FFBA 4UBJA 2AJLI 3OTQA 5AICA 5ALWA 4UHCA 4O08A 5D7BA 5DLPA 1AX9A 4DSZA 2BGRA 1ZOIA 3WI7A 1ACLA 3FYUC 4Q1VA 2QS9A 4UHHA 4AB1A 2ZYIA 3N0TA 1DQZA 4L72A 4RPCA 3C6BA 2XUIA 4MQMA 2O7RA 3DD5A 1BE0A 3QVMA 4N5IX 1QO7A 4OPMA 3U0VA 5AK3A 4X85A 3G0IA 4Y2XA 1R9MA 4U2GA 3GA7A 1YAJA 1QTIA 3C6YA 1MPXA 4LHEA 1H23A 5FKJA 1ZICA 4CI9A 4XVCA 4ETWA 3V9AA 1CFJA 4IQ4A 3JWEA 4H7JA 3DJYA 5AKYA 3D2BA 5AI0A 3A2MA 3AINA 4AN1A 1BROA 2OQVA 1ZI6A 4X97A 2ZVDA 5JATA 2V9ZA 4P93A 2PKYX 4HXGA 2YYSA 4HS9A 4OYYA 5LYYA 3V1MA 3BL8A 1GXSA 2XUKA 1UOQA 1XZBA 3DOIA 3WQHA 1RWQA 2Y2VA 3ZLUA 1R3DA 1FFCA 2DQYA 2PUJA 4YX9A 3FYUA 5AKLA 5JASA 1IUPA 1J1IA 3VVMA 4TPKA 2QJRA 4A16A 2QTBA 2WIGA 1U4NA 3WKEA 2WFLB 2XB6A 1WB6A 3E1GA 4BCDA 3HJUA 2WU3A 2XLCA 2WFLA 1ZD3A 5IKXA 3AUKA 1A88A 5ALXA 3HABA 5DNUA 1AUOA 3KWJA 4GXNA 3WWOA 5ALOA 1WCYA 4PNZA 3WL6A 5CMLA 4E11A 2NW6A 5DJ5A 2WLSA 5KWJA 1XZIA 4KRYA 5CT5A 4FBLA 4PSDA 4WY5A 5AKZA 2OGSA 2XMCA 4Q3OA 3EQ9A 4KE7A 4BZZA 5K5EA 1ZJ4A 5A62A 3O4JA 4HRXA 1CPYA 2Y2UA 4BTLA 2PBLA 1XKLA 5EHZA 4AO8A 2B4KA 2V98A 1DQYA 3I1YA 3WIBA 2FJ0A 4Q34A 5JZ9A 1LNSA 3C6ZA 3F9CA 5AP9A 2XQKA 3PF9A 3L1IA 5F4ZA 2XMGA 3EIOA 4WCVA 4G8CA 4PSUA 4KE8A 1XQWA 1WPXA 3I6ZA 5DWDA 3H17A 4IHAA 1VE6A 3WWPA 3H18A 3STVA 3I1IA 3HEAA 5HF5A 1K4YA 1XZAA 4E15A 1MNAA 2XUAA 3A70A 3WYNA 5I7UA 1LPAB 4YASA 1XRQA 1ODSA 2HA5A 5ALPA 1H2XA 3F97A 1F0NA 3HXKA 4BAUA 4MEBA 4BE4A 3W9BA 1L7RA 3EF3A 3VKFA 1U2EA 3G9XA 1LPMA 1O6GA 1JI3A 4X3CA 5AI4A 5EFZA 3WL7A 2W6CX 4EA6A 4RGYA 1EXWA 3G7NA 5A2GA 2WTNA 4FNMA 1C7JA 3JYHA 3I2KA 1S8OA 4DMFA 4UFPA 4LYEA 2BAGA 5AK5A 1HDEA 1DT3A 2RAUA 3D2AA 5A7GA 2ZYRA 2XT0A 3MUNA 3IBTA 1B41A 1JJBA 1E8NA 1ORWA 5BOVA 3V1LA 2QZPA 1E3QA 4Y2UA 4Q05A 3WZMA 1HPLA 1HQDA 4EUSA 4X71A 4U2FA 1EH5A 3A2LA 2QKYA 5IH7A 4J03A 2IITA 4NVRA 3WMRA 2HDWA 3M81A 1LZKA 3WK6A 2ZJ6A 3C5WP 1CUXA 1CV2A 5LKAA 1ZD4A 4M0MA 5K3BA 3WA6A 2XI4A 4C4XA 3FLBA 4INZA 4PV7A 2BCEA 3Q0TA 2C4HA 2DR0A 1EDBA 4CIBA 1W75A 4G4JA 5FXMA 4YPVA 2YASA 2WUGA 2WG1A 3H1BA 1XRPA 4K6KA 4MJ3A 1CUAA 1EK2A 1XZEA 4D9JA 2QUBA 5AI9A 4H7DA 1WHTA 3BE8A 5KBYA 4JYMA 1XLUA 3A6ZA 1XZJA 3R0VA 3EQ7A 4UBIA 2Q0XA 4OB7A 5ALEA 4FFWA 3ZLTA 3H04A 4G4GA 1E89A 4S0XA 4F60A 4LYDA 1QE3A 2JGJA 3H2KA 3QMVA 5ALMA 3BF8A 3F8SA 4KE9A 3GELA 1SOMA 2HU7A 2GBCA 4Q3LA 4C89A 4K6HA 1E8DA 1MAAA 3IURA 3RKSA 5DYYA 5CRIA 5C8XA 4AMZA 3DLTA 1HBJA 2I3ZA 2QUAA 3SWWA 2R8BA 3B12A 4G9EA 4GDMA 2XUHA 1L7AA 3DKKA 3FVTA 4K2AA 1JU4A 5LZ5A 3FVRA 4BE9A 1GPKA 2X76A 3KXPA 2PSJA 5JADA 3H2HA 4UUQA 2Z5GA 2WHPB 2OQIA 3F96A 4FLFA 4NMWA 4QDOA 2JBWA 1ZI9A 1R50A 4G5XA 3R3VA 1F6WA 1WPRA 4I4CA 2ZJFA 4EHBA 4Z49A 4OCZA 4WY8A 4X90A 3DQZA 3GUUA 3X3HA 4X94A 1QIEA 2WQZA 5ALUA 4H35A 3SK0A 2RHTA 1E8MA 1USWA 3AZOA 4BP9A 3G0DA 1JT2A 2J4CA 5AO9A 2OAEA 5CBKA 4H7KA 4UBKA 3FNBA 4C87A 4J3JA 2GYWA 3IA2A 4TVKA 4B9EA 2JGMA 4F0JA 2RGUA 4N8DA 4UBOA 4Y2RA 1TQHA 2PX6A 1AZWA 1L7QA 2YXPX 1J2EA 4JYPA 2B20A 3F98A 3O4IA 4KYVA 1BCSA 5EIHA 3C45A 4A5SA 4CFSA 2XQIA 2GBIA 2HADA 4BYMA 3JW8A 4ITVA 4X6XA 2XDWA 4EY4A 5T4HA 3CCCA 3VJLA 4AN0A 2RI6A 5JZBA 5YASA 3FLAA 1G5FA 5CXUA 1UT6A 2J3QA 2WU4A 5T4FA 3C43A 1TKRA 5LKRA 3WL8A 1MX5A 5FUMA 1N8SA 5EHNA 1ACJA 2ZJ7A 4F5ZA 1K5PA 4PO3X 1XQVA 5A71A 1CEXA 5AOAA 3WK8A 3H0CA 4FBMA 1EB9A 3IIIA 1DTEA 4MYSA 3O95A 1XZLA 1YR2A 3DNMA 1MAHA 4GW3A 3S2ZA 5ALFA 4NS4A 1OCEA 1FFEA 4H0CA 3AZQA 1K8QA 5HKAA 4JH0A 3ILSA 1VOTA 1N1MA 1BCRA 2BKLA 5AIBA 5ALJA 1QTRA 4QWWA 4BBZA 5LZ2A 3PF8A 3P2MA 1VJ5A 1YASA 2HFKA 5I9IA 1CUZA 1TCAA 1U65A 4U2DA 1MO2A 4DNPA 2XMSA 4DMHA 5K3AA 2HL6A 3E0XA 3FCYA 4IH4A 3STXA 1CUVA 5CT9A 3G9TA 5ALLA 1XRNA 2BUCA 1W1IA 1DX6A 2WHQA 3VJMA 1E66A 3BDIA 2XUPA 1KU0A 4B0OA 1X70A 3DEAA 2QOEA 1QJ4A 4C88A 1UXOA 3ESDA 5AKXA 4W9RA 1CRLA 2ORYA 5JD6A 2Y6VA 1QGED 4MEAA 5ALDA 3W2TA 1IMJA 5DYWA 3M82A 3U1TA 2CUTA 1MT3A 4FMPA 5JAUA 4EBBA 4FFVA 1AC5A 5AM1A 1XZGA 2EDCA 2XUQA 4V2IA 2C5GA 4FKBA 2QRUA 4GWLA 2BJHA 2RHWA 2JGLA 1YA4A 4JUIA 3G0BA 4UFNA 1ZGCA 5IVHA 5KWIA 3DS8A 1QIJA 2C0QA 4MWTA 1Q84A 4X91A 3AZPA 1CVLA 4WFIA 3VJKA 3S8YA 1JU3A 5D3KA 4W1PA 2W22A 3UUFA 1RYYA 2XLBA 4OYLA 1JKMA 4BC0A 5D6OA 1AURA 1LPOA 4J0JA 3DOHA 1JJFA 2DQZA 1VXOA 4BCBA 1CIJA 2Z3ZA 3D2CA 3YASA 5DTJA 2HU5A 1WHSA 1P0PA 2VA9A 2XUGA 2ACKA 2ECFA 3BIWA 4E14A 1LGYA 5C81A 1VZ3A 2JEYA 1P0IA 4N5HX 4G4IA 3O9MA 5ALZA 5FPPA 3TGLA 3BIXA 4CG1A 2QJWA 5ALHA 3F67A 4BP8A 1NU6A 1UFOA 4DTCA 1AKNA 2QM0A 1GPLA 5K3FB 2BFNA 4A23A 4ZGBA 4QE3A 1LPPA 3WWEA 3PE6A 4EY7A 1DU4A 5C8ZA 2GYUA 2XMBA 5E4TA 1CQZA 5IVIA 1EVEA 3BWXA 1F0PA 1GKKA 1H22A 2WJ6A 2XUOA 4DM7A 1X2EA 4W63A 3V1KA 4MYDA 4MWSA 3ESCA 4KAJA 1CUSA 5AH0A 4ZREA 2XMDA 5AKKA 3V1NA 2HA3A 3KOOA 3L1HA 4P08A 1C7IA 4CG3A 2VJDA 5SYNA 4X7BA 1YB6A 1U8EA 5ALVA 4J0GA 2HA0A 4CG2A 1YS1X 5BWCA 2PSHA 2VAXA 2PU7A 4UFOA 2WIDA 2WIJA 1CUHA 1UK7A 4H7HA 5AM0A 1Q0ZA 3R3YA 1XQYA 5JAHA 1BN6A 4EY8A 1JFRA 2QR5A 3ESBA 1MX9A 4W1QA 2ONCA 2QVBA 5ISMA 2VSQA 3STTA 4L3WA 4K6GA 3OM8A 5DTIA 3OC0A 1ZGBA 4P92A 1LBTA 3QM1A 3VISA 1EX9A 1K6EA 5D3ZA 2XUDA 2OG1A 4J0DA 3RM3A 5E2IA 4DGQA 5K3DA 3QMMA 2CZQA 3L1JA 4B6GA 4HXEB 1XRLA 4KJXA 4QDUA 1A8UA 1NU8A 2PVSA 2WILA 5LZ7A 3I2FA 4I3FA 1UKBA 2AJDA 3WIOA 3M83A 3VDXA 1YS2X 2Y1KA 3B5EA 3OURA 5AK6A 3ESAA 3PICA 1EVQA 3CN7A 4KEAA 1ZIXA 2G5PA 3HACA 2JGIA 3IDAA 4Y2JA 4KRXA 4GLBA 4H7FA 2AJCA 1EINA 2XQJA 1Q0RA 2OLEA 4PF1A 4BATA 3KWFA 1MJ5A 2E3JA 2EEPA 1LZLA 4FDMA 1UOOA 5AOBA 1LPBB 4DSAA 2PM8A 1UOPA 4LXGA 2QT9A 2VJCA 5JD4A 3FWHA 4LIPD 4C4ZA 2DHEA 5FRDA 4UHEA 4MXDA 1CUUA 4C01A 3WK9A 4CCYB 1LPNA 4AO6A 2VEOA 1MNQA 4PW0A 1IUOA 2AJ8A 2VT7A 3ANSA 5AI5A 5HF9A 1FJ2A 4UPDA 1DINA 2PSEA 3IULA 1GKLA 5ESRA 5ALTA 1OXMA 4RE6A 3I6YA 3UMJA 2AJBA 1FSSA 4OU5A 3DL4A 1GPNA 1CUGA 2CB9A 1ORVA 2XMRA 2OCGA 1AGYA 5EHQA 1ISPA 1BRTA 3I2IA 5AHXA 5CURA 4B0PA 4IH9A 2VJBA 1Y7IA 5E4YA 4M0EA 1CUBA 2R11A 4J0CA 1TCBA 2H1IA 4L0CA 5CXXA 2HM7A 3R3WA 4B82A 2DFPA 4UBLA 5CTAA 4MQLA 5AM5A 3LS2A 5FV4A 5IVDA 5JAOA 3STYA 1ODCA 4AMYA 1YCDA 4X6YA 5K3EA 2WJ4A 1UK6A 2PSDA 1GQSA 2WHPA 1NX9A 5DNVA 4BC1A 2XUJA 3QBJA 5EHXA 5JZSA 1QIIA 3FSGD 4J7AA 3I6MA 1CUCA 3TJMA 1UK9A 2ROQA 4CCWA 5FDFA 1G66A 3DDUA 4GI1A 2JGEA 3VVLA 1KEZA 5LZ4A 1EDEA 2FUKA 5AKIA 2GYVA 4W1RA 2JGKA 4EY5A 2XE4A 1JMKC 5LZ8A 3C8HA 3WA7A 3O4HA 3O9VA 2HA7A 1XRRA 3H2GA 3WWCA 5SYMA 1TRHA 1QIFA 2AXEA 1EA5A 2WKWA 3K6KA 5H3HA 4X92A 1WM1A 3HYSA 3CN9A 3ZV7A 4BB0A 4N8SA 5AJHA 3ZWQA 3D59A 3IUJA 1QIGA 5KREA 2P8SA 5AKGA 1CLEA 4QNNA 5HFNA 4F21A 2RIPA 1DT5A 4HVTA 2WIKA 1QIDA 2WM2A 1AMNA 5AKEA 3R3XA 1G4HA 3BJMA 4LXHA 1QIMA 5JYCA 5A6VA 1CUWA 2WJ3A 5DNWA 1QZ3A 4P9NA 1PV1A 3FAKA 5J3JA 4B84A 2WUEA 1T4MA 2OAGA 4Q3KA 1HL7A 2RONA 3TRDA 1QIHA 3C8DA 1A7UA 4GEGA 1HKHA 3AIKA 3KDAA 1FFAA 1DWOA 2DHCA 4ZRDA 4RNCA 4GECA 4C4YA 1Y37A 2XUFA 5ALQA 4X6UA 3R3UA 5JIBA 3LCRA 1SFRA 5HQ3B 1QLWA 4FHZA 3GROA 1IZ8A 1IUNA 3H2IA 3I2HA 4J0KA 4KE6A 3G0GA 4AQDA 1EK1A 5FP0A 3QITA 5LIPA 5HQ3A 4N8EA 2WSLA 5AI6A 1GZ7A 5CW2A 2PL5A 3QPDA 6YASA 5BWBA 4QWMA 3CCBA 3K2IA 4EY6A 3D4LA 4X95A 4DYHA 2XQGA 2UZ0A 3DCNA 1THTA 4XIIA 1W52X 3QMWA 2O2GA 5T4BA 5CH8A 5T4EA 4WFKA 4FNGA 5JARA 2PSFA 3G9ZA 2CBGA 4BVKA 3O0DA 4PQEA 3RK4A 2HRQA 1O6FA 4BZWA 7YASA 2VTVA 4G1FA 4CIAA 1CUFA 1BS9A 1OILA 4FOLA 2X8BA 5EGNA 4OUKX 4TGLA 2WHRA 2CMFA 1QO9A 2B9VA 1XZHA 4ARAA 1CQWA 4DMCA 3NOXA 1EHYA 3MGAA 3W06A 3O4GA 3FYTA 2WFZA 1THGA 4HZGA 4EB0A 1ODTC 4HRYA 4FTWA 3QYJA 2HHAA 3STWA 3C6XA 2FX5A 2XMQA 4AXBA 5IVKA 3DKRA 4H18A 3CXUA 1XROA 5EI5A 2GBGA 1FFDA 1H2ZA 3A2NA 3ED1A 1I6WA 1RP1A 5LZ9A 3FOBA 5ALRA 4ROTA 5AOCA 4XX1A 3ZLVA 3WLAA 2VQ6A 4Y2TA 4C6HA 2DHDA 2HU8A 5EIAA 1B6GA 1UKAA 4ARBA 3QZUA 3GBSA 4XJVA 1VLQA 3PDCA 3DL7A 5C7YA 3FYUB 4WJLA 3GFFA 3ICVA 2VATA 4LXIA 1D07A 5HFAA 5JAPA 2ES4A 2XQFA 4DNQA 5K3CA 1F8UA 4DNFA 4H7EA 3AIMA 2O7VA 3SX4A 1YA8A 1VZ2A 3PFCA 3DYVA 1H2WA 1UK8A 5K3FA 1EDDA 4B81A 4BVJA 2WUFA 4AO7A 1VE7A 3WJ2A 3H19A 3WL5A 4M0FA 3BF7A 1X2BA 1R1DA 3WYDA 4Q82A 1M33A 2Z8ZA 3D3NA 1MU0A 4DMKA 1HLGA 3PUIA 3RLIA 2ZSIA 4WDRA 1W76A 4JNCA 2GZSA 3WJ1A 2ZYSA 1JMYA 4BCCA 1R4ZA 2XMZA 1XZKA 1CUDA 2BUAA 4B9AA 1XQXA 5AKHA 3SC2A 1GQRA 2HRRA 5AI8A 4Y2QA 3HZOA 2ZYHA 1QONA 2K2QB 1VXRA 3W9UA 4AZ3A 3VXKA 5FOQA 4HXFB 4GBGA 3Q8WA 2QXUA 3M3DA 2ZSHA 2DCMA 2G5TA 1YSCA 3ICWA 1P0MA 2X5XA 4IH1A 1CUEA 5CT4A 3HRHA 1XRMA 2PUHA 4DLNA 4Y9SA 3AIOA 1H2YA 5HK8A 2G4LA 1LBSA 1AQLA 4KACA 2OCLA 3EBLA 3OG9A 1TIBA 3KSRA 3UUEA 4G8DA 5A7FA 3NWOA 1G42A 1W6RA 4PSCA 1UZAA 3I28A 3WK7A 4YK7A 2I3DA 3D5EA 3D0KA 2Y6UA 3EQ8A 2CKMA 1Q83A 2VT6A 3IB3A 1ETHA 4EZIA 1N5RA 4I19A 2C0PA 2B61A 4FLMA 3BJRA 4AZ0A 5HK9A 3OOSA 4UBMA 1DWQA 5ALSA 4QEKA 1J06A 2JGFA 1Y7HA 3OPMA 1VA5A 2J4FA 4OD0A 2C58A 5AK4A 2C7BA 1E5TA 1BN7A 1ZJ5A 4G9GA 4KAAA 4B7ZA 4FLEA 1K63A 3KD2A 4DIUA 2J3DA 5JD5A 4BAGA 4UHFA 1TK3A 4AX4A 3PI6A 1XLVA 2H7XA 2I03A 3W04A 2VJAA 4WDQA 3STUA 2HA2A 4BTVA 4U2BA 2JIDA 3BXPA 2ACEA 4Y2VA 5HKBA 1YAHA 1DWPA 2GBFA 4WFJA 5AM3A 5DYTA 4BDSA 1CUYA 2BGNA 4ZI5A 3WK5A 2G63A 2QMQA 4W1SA 2H7YA 3HLKA 2JEZA 3E3AA 2VF2A 1XFDA 2IX9A
chains in the Genus database with same CATH superfamily
5IG2A 1BDHA 1EWYA 3A7DA 1IEVA 4CVNA 4UCQA 1VRVA 5FL3A 3ZWKA 2QMUA 2NU9A 2A84A 1YQXA 4DIMA 4ZVPA 5EA2A 3G02A 1OLUB 4MRMA 3LQKA 2P90A 5JALA 4ENUA 2O2HA 1D2CA 4YRIA 4HTAA 3RBZA 4S04A 1DX4A 4ZKDA 1J8FA 5EFOA 2EFCB 1K98A 4FFBA 4KH1A 5ALYA 4H7IA 5B4TA 3HB5X 1COZA 1DOZA 1TM2A 5B1YA 1S7CA 1O97C 3R0ZA 3PQ5A 4X41A 4BQQA 3OTHA 1HNXB 2ZRKA 3QVGA 1C3XA 5TEWA 1RYNA 4FCVA 3NNNA 2Q5EA 1PJRA 4CEIB 5TXGA 2D8MA 3WHIA 3A1FA 3PEEA 3VR0A 4OMFG 2ZJBA 2YVKA 3V1TC 2GPBA 3SF8B 4CIVA 1D1SA 3LECA 4UMFA 1PSZA 5T57A 1TI7A 4BDTA 5HQJA 1T6YA 4QJ3A 1PR1A 3K0SA 5FR1A 1U7XA 2OD2A 3TOSA 3L93A 1UPUA 4RS3A 2C07A 3IPYA 2EDAA 3ZE6A 4CCYA 1PT9A 1WSDA 4K9MA 1E2BA 4U7GA 1L2TA 5D3MB 2I8CA 5ECYA 1A82A 1G5TA 5CT6A 4GPEA 2ONJA 1SKMA 3ZGXA 1K4KA 3I34X 5CT8A 3SC2A 2WB4A 3LXUX 4JUBA 1JJIA 3E22B 4QDXA 1LUAA 3WGUA 1RXIA 1DNPA 1N9GB 3L7JA 1NC3A 3GXBA 4EVIA 4KPYA 2C5FA 1UQTA 4WK4B 3WO0A 1X7ZA 1EX1A 3D02A 5EGSA 1FTSA 2QXYA 3FLEA 1X7YA 2P75A 3G2JA 3I2JA 3TEJA 1L5QA 3LIIA 4F2DA 1GUYA 4D44A 1ZR4A 3NYIA 5JISA 4TYQA 2Q3FA 3QPCA 3FNEA 4IFIA 3RR2A 3SYNA 5HGXA 1IVYA 1EK0A 1I3LA 2VDOB 5C8VA 1TK9A 2WU0A 1VLLA 4GOLD 4DIKA 2SBTA 2YIVX 2NP6A 2VYFA 5JSQA 5TMPA 2IXGA 4H77A 4YQFA 1R9NA 1OAAA 4Q9HA 4DHEA 1U7DA 3ZDZB 1WY7A 3JALA 2QZZA 1NQWA 5CJJA 4YEDA 5JANA 3FCXA 2V6GA 4P81A 4U7PB 1GZHB 3SE0A 3A2KA 1C8KA 5REQA 1P1JA 2EEZA 3NIFB 3I8OA 4FMCB 3W1WA 1Y9DA 2FOLA 2Z8XA 3H6KA 1ZM9A 5K0GA 2ODTX 3H6GA 4GMFA 4UUNA 1ZU4A 3DVSX 3CNLA 2OB2A 5TNXA 2ZDGA 4GOKA 5BRNA 4S1OA 3TLKA 4A6EA 1BU8A 4KGDA 1ZGJA 4HAOA 1QX4A 5JS8A 1KK2A 2Y8EA 4ENTA 3NU1A 1JIQA 5F77A 3JR3A 3SLGA 2ZJYA 2AOWA 2JAUA 1TTTA 2OUIA 2I34A 5BR1A 1E0SA 1QGYA 1NVBA 1TCCA 4XWAA 2WA2A 1QH1A 2G25A 2O2IA 1SRRA 4OJTA 3RB8A 3E0QA 4LVOA 2Q4RA 4FILA 4JP2A 5BSRA 1ZXLA 1QQ6A 2QRJA 5ALGA 5LOVA 2JD0A 2XYGA 2QQFA 5E6RA 2A5GA 4IHJB 3MQ4A 4Q47A 3I0ZA 2FFJA 5AIAA 4FWBA 5AVKA 2GFIA 4NS1A 1GGVA 1KAEA 4FHGA 4OKIA 1UMCA 5AM4A 4QJBA 2N9UA 1LW6E 4R1QA 1JFFB 1DIOB 3I2GA 3QLVA 4J0FA 3SKVA 1XDGA 1TRKA 1VIMA 4LWQA 2ICAA 2B3DA 4RENA 4TT3A 4YQEA 2YV5A 2JJ1D 5T6BA 3WKCA 3IAM6 5LMUB 4YDHB 2A3RA 3ZI7A 3EY4A 2I4MA 2JIRA 1ZM2A 2HXGA 2DCUA 2Q1TA 3D9QX 2YQZA 3EOAI 5DASA 3V4OA 3BMNB 1GPWB 5A3QA 2HJRA 1RCUA 5FD8A 1UWVA 2IEDA 4H6PA 2VWQA 1S02A 3HB4X 2Q5CA 4TVSA 2IRWA 3VR2A 1JXMA 2MR5A 3AF4A 4KTTE 2JGAA 4J0IA 3K5PA 5D85A 3SFTA 1XZFA 5D5QA 2D1RA 2G80A 2I7CA 1OX5A 2JW5A 1IN6A 1V3VA 2BFFB 2WG0A 3NS7A 4MRSA 3U4CA 3H1PA 5FL7D 1X7DA 3PFBA 2IYEA 3CWZA 3UICA 3CUSA 2GSWA 2Y68A 3LVBA 4K5QA 4PX5A 5IC6A 2XKKA 1WOMA 1Z6TA 2CLFB 1XZCA 2VTEA 3T1VA 4PLHA 3FKQA 5E1BA 4F06A 2UXDB 1I4WA 3M9LA 3AR9A 4P5PA 1OREA 2V97A 4J91A 2I54A 1RWMA 4EB8A 3AEYA 4LYJA 3K5HA 3H2JA 3QJYA 3C3WA 1DFHA 3GR6A 4DLYA 1JNYA 3HFRA 4LOKA 1P75A 2XWQA 5GONA 3OAAD 3RKRA 1VA4A 3KCNA 4KFSA 4JXZA 3LU1A 4II7A 2XGJA 2HXYA 1UKCA 1XDZA 5GMOA 4YRZA 2WPDA 4LJ5A 5ITWA 1QFMA 2YV4A 2Z3WA 2IV2X 4S12A 3FPAA 2O0HA 2XWSA 4QDTA 5F5XA 4ND4A 2ANBA 3GQBA 5HTKA 4O4JA 4U00A 4QU0A 5JC8A 5HP4A 3P0FA 2A78A 2RARA 1T3GA 5FBKA 1YVUA 5JH7B 3BCHA 3NHUA 1XSEA 3KYIB 1BGVA 3IVMA 4RKWA 3S7ZA 3CLTD 3VAYA 1NVMB 3DTYA 4GT1A 5K0ZA 2ZI6A 5D6NA 1Z0AA 2FWPA 2VVTA 4EYEA 4KQFA 1J8MF 2C2ZA 4JZYA 3RRYA 5FUQA 1PGPA 3WTCA 3IIKA 1N5MA 3BXEA 2BKEA 1X86B 4MGYR 4FB5A 1S8FA 5CEJA 4BRSA 2WFMA 1B0PA 1D6NA 1IY1A 4YGYA 2GERA 1RAAA 2G71A 2OGZA 1FL9A 2Z0MA 5FPQA 4QARA 2R47A 1W5TA 4IMIB 4PM4A 4NHEA 2HQ1A 3K0EA 1Z6YA 2Y1EA 1LTHR 3EQ6A 2Q2WA 5K2OA 3C3DA 3QQPA 1F48A 2WG2A 1XKTA 4ZO4A 3T5AA 2JLXA 3WZLA 4E46A 2WTAA 3H2BA 3BIFA 3P5SA 3H1FA 4OF4A 4Y7DA 4AUMA 3IUMA 5BNIA 5BXQC 6GPBA 3DVAA 1TYAE 4H60A 1G8FA 4ZOLA 4DZTA 1JB9A 2G1UA 1A8QA 1WPQA 1GL3A 1Z68A 1A04A 3BEDA 4BQOA 4CMGA 4EFLA 2CNLA 1F2UA 2YVLA 2ID8A 2IYYA 3BDVA 3PPVA 4FXOA 4OHFA 4P4UA 4TV8B 4E5NA 2Q7XA 1IXYA 4ED9A 1E2EA 1Z45A 3GEMA 2YWJA 3LC0A 4PLFA 1RRKA 3D8SA 1Z5WA 1P2FA 1N2EA 3ACBA 3N76A 3U5ZB 4MDFA 2ZBVA 2AFIB 1Z6XA 5BV7A 2HSGA 3DZBA 3DWGA 3EIQA 3Q1LA 3C85A 3R40A 3U3MA 1L9XA 1I7QB 4ZYLA 4JCCA 1UMDB 1N2BA 4FYYA 1OVMA 5LWQA 3JYQA 4JLBA 2GJ8A 2AEMA 3TOCA 3OOYA 4MV1A 5DNDA 1MX1A 1LJ8A 3TB4A 4QZVA 4BEJA 3OICA 4XFDA 4RZXA 3TMYA 4WACA 3B89A 2YQ4A 4JA0A 3H13A 4TL7A 3EXEA 2OHXA 5JMOA 1IMOA 4H4DA 5JAMA 4EP1A 5EP3A 4KTVE 2JNWA 5EP4A 2WOOA 1Q77A 1V43A 3BGIA 3MB5A 1FNBA 4U63A 5B3LA 4R2LA 4L6AA 1CY7A 4LJSA 4F38A 2YVUA 3Q40A 3I30X 2ZJ0A 4ECEA 5HIJA 4DLBA 3AFNA 3MS7A 3QFCA 3QOXA 1PGOA 2Z56A 3RARA 3TL6A 5ADWA 3W8DA 2GJ4A 1JUDA 3PVSA 3ZE9A 4TTQA 1LSJA 4JKIA 3K96A 2AXQA 3E35A 4MO2A 2CVOA 4EHKA 4UTNA 1NF3A 4BNUA 1NQ5A 1QOZA 1W5FA 3HSSA 1EUCB 5F73A 3RSFA 3C6KA 1ZI8A 2VJMA 5CH5A 1BHSA 1VKNA 4Y98A 2HA4A 2HCJB 5BV8A 3IP9A 4DNOA 1OFVA 4KPUA 5ECGC 4ZAZA 4B2IA 4C0JA 1EWQA 2W6QA 2X40A 2DFKB 3B53X 1F2DA 5CDTA 2IGBA 1IHXA 2AJLI 3KJHA 4XDYA 4YP0A 1KOJA 1I4LD 3HYRA 3ZLBA 4YJ2A 2FAXA 4XZ3A 2K6GA 5KTKA 3DV9A 1Z0KA 1DRJA 1OYYA 2PKWA 3KPWA 4IRMA 2HNKA 4GH5A 5F4BA 4P0TA 7REQA 1W581 4O08A 4CM6A 5B1EA 1PBTA 3VMMA 4CCSA 1OHHD 2VP0A 5DLPA 3T0GA 5E1OA 5H1YA 4A15A 4CQMA 1QYRA 2JG3A 2Z83A 1ZOIA 2ODPA 4GVPA 1SXJE 1SVLA 3IEXA 2QENA 3NJ8A 4L4ZA 3WI7A 1U02A 2YVQA 3G6WA 4L0DA 4S2EA 4MCAA 1B1CA 2DP4E 3DHYA 3HDYA 3LKVA 2ZTHA 3RIHA 2C4MA 5LQKA 1JSZA 1HK7A 4YO7A 5FHQA 3SAJA 1W44A 3E9EA 2H2AA 4C4RA 4QD3A 4V0QA 2QLLA 2E0IA 3C6BA 4MUYA 1QH9A 2XUIA 2PNFA 4TV9F 5FADA 4MDEA 4FT4A 2XVMA 4TSFD 4CGYA 5HX7A 4HYQA 2ZVJA 3DD5A 3M6LA 1X1AA 3C7DB 5AUNB 2IZ6A 1KDOA 3H4MA 4HDSA 3OLCX 1Y82A 1BE0A 2FMKA 5KNCD 5M34A 5C46F 2H59A 3GW8A 3U0VA 1WXFA 2A0WA 4J49A 1QZTA 3F8TA 4CKBA 4PC1A 2XNDD 2FSUA 2D7JA 3MWDA 3G0IA 3MTIA 1EPUA 1PD1A 4FJ2A 2ZYTX 1JL3A 3WFJA 1BHQ1 1PTJA 5CYPA 1I2ZA 1DXOA 4N6OA 3UXEA 4DXHA 1VKJA 3D6AA 4DG5A 4EFMA 5JMPA 5HKLA 2EJUA 1E18A 3OA2A 4IXDA 3T7TA 2QG6A 1MPXA 2J9FB 4D5EA 3RIYA 2QRNA 4I1PA 3AVWA 3LFUA 1M2VA 2WHYA 1LS1A 1JEYB 1ZH0A 3URMA 2F3RA 2FPKA 2G7MC 1A0OA 2GN4A 3JRXA 3NUQA 4PVCA 5FKJA 1HDYA 5GJVC 4XVCA 2K5UA 3Q5EA 2FFRA 4ETWA 3FN4A 2C7OA 1CFJA 2GEVA 4P34A 3HV0A 1KS9A 4NHOA 1GU1A 4O1IA 3JWEA 3ZK9A 3H16A 4N3GA 4RXUA 4OUDA 3DJYA 5AKYA 4LZAA 2XZPA 1O58A 1VJCA 3S29A 4QIHA 1ZAYA 4BFCA 2IPOA 4MQ4A 5ER9A 1AGPA 4A2PA 4AN1A 1S8AA 4EELA 4UKDA 1Z62A 1GTZA 1H8ED 1DC8A 1DARA 4TTJA 3A9TA 2OQVA 5IK2D 2I22A 3TL2A 2Z3VA 3T3GA 2ISQA 3UMSA 5B57C 3LTEA 3SBXA 4IGEA 4W5RA 2QD3A 1F20A 2YWHA 5DISB 3USZA 1V5GA 3JD4A 3RTAA 1JR3E 3QW4B 2AI3A 2V9ZA 1US8A 4AW9A 2PKYX 4P93A 3OLQA 2QWXA 2CC2A 4Q9AA 3I61A 3QOYA 3P32A 1FYWA 3BL8A 4R41A 1GXSA 4JD5A 3PXDA 3TTSA 2XUKA 3UJ3X 4LJ6A 3S4YA 3K70B 4OGKA 3LKZA 4QOIA 4R8VA 4S1PA 3RFXA 4CT5A 4ITRC 1E9SA 3BX1A 4OFXA 3FMIA 3ZLUA 3DE6X 1F3LA 1WCXA 1OA1A 2WE8A 2Z9BA 3GMDA 3O3CA 3A6JA 2DQYA 2XQVA 2X5JO 3FYUA 1Q14A 2BMAA 2GEUA 3I53A 3PCRB 1J1IA 2DHQA 4BJHB 4JV5B 2O7SA 2WAMA 4A16A 4UXIA 3DSRA 3QIAA 4W8OA 2QTBA 2R3SA 4WOKA 5IM4A 4IOLA 1U4NA 4W4TA 4Z3KA 2IF2A 1DBSA 4AU1A 2WFLB 4MUMA 2OOKA 3F6RA 1KSHA 3GNLA 3QYPA 1P9NA 1QGOA 3TTUA 3L7NA 3GLGA 4DV3B 4DFDA 3E9DA 1WDMA 1JSRA 2VHCA 4DQ0A 2WVAA 5JJCA 2DE0X 4DMLA 2GTPA 2H1FA 3RIXA 3HJUA 4KK3A 1Z37A 4F5DA 2N42A 5IMSA 1P3DA 3OLZA 1NDQA 7MHTA 3AUKA 1A88A 1TC2A 5HJ2A 3TLMA 5AVUA 3EHEA 3NOQA 2GO7A 1D2NA 4BZXA 3EEBA 2UUPA 2YZ2A 3QVKA 2JBAA 1JG2A 3TEFA 4BUCA 5CDGA 4IV5A 3TVYA 1Y6QA 1AUOA 2P5UA 4JI8B 5IBPA 2GD1O 3KHTA 4FVTA 4Y6GB 5JNUA 4HWPA 3OHSX 1L5RA 2O2CA 3OP4A 3PHJA 4GXNA 3WWOA 4A1OA 3TG8A 3ZBPA 3RC3A 2NO7A 3WL6A 1L7BA 5IBRA 4MWEA 1P5RA 4IMJB 1OHHA 3HBFA 2RHOA 3H8SA 4UEKA 5LWHA 2KJQA 1QFJA 2J87A 1XMSA 4LDNA 2FI1A 3RBAA 3MCWA 2QTVA 1KHHA 4JJGA 3RTEA 2IUYA 1RKVA 2JATA 3EZ7A 3F90A 1IOZA 4HC4A 1UM9B 4XM1A 3CVOA 4WY5A 2W2LA 4P4NA 4HX9A 1OFTA 2UZIR 3H7IA 3GGSA 5E0OA 4FZRA 1KO7A 1OKKD 2OGSA 5AKZA 2P1DA 4HK4A 5KNDH 4Z0TA 4Q3OA 1BD3A 4OM8A 3RS0A 1SBHA 2TS1A 3JTEA 5JCJD 2NPFA 1KPHA 3ITKA 1KVRA 1GEGA 2G1AA 1J8QA 3WGKA 5HUQA 3KXLA 1EA7A 1PS8A 4MEJA 3V8BA 4R1UA 2BE7A 2H5LA 2PN1A 3H4VA 5CGZA 1F7UA 3I6BA 4WJKB 3VSAA 4FNAA 5FUXA 1CPYA 2PMFA 3M0EA 5EHZA 4CEHA 1PS0A 1U1FA 4BFLA 3BB3A 5HIMA 3KX2A 3A3OA 2V98A 3NXSA 4F6RA 2DB3A 2D13A 3ZQJA 3V4VB 4DS3A 1S2LA 3AQ4A 5F35A 1BU5A 3LSYA 1PYDA 3WRYC 1ZRNA 1T8UA 2FJ0A 4F96A 5JZ9A 1LNSA 4BKUA 1U2TA 4AS1A 4M76B 1R4AA 3VU0A 4NZNA 5GONF 2JIBA 1P2VA 4JP3A 1AQUA 3C6ZA 2QUHA 1Z8NA 1H6BA 4YJHB 4L5BA 5FFFA 2ZCJA 2EWMA 3H9UA 1NT4A 2ZWMA 3SPXA 4BO5A 2PX5A 3O8OA 2N46A 1RZ3A 4EYQA 5B2FA 5JCOC 5F4ZA 5JZMA 3TBFA 2IELA 1Z2DA 4V39A 4ZJYA 5JVDB 3VDQA 3KT8A 2GAJA 4G8CA 3CEHA 4O4JF 4XJTA 3DWEX 1SVIA 3JQEA 3VKVA 3ESXA 4LZOA 5CVVA 5E95A 4LE0A 5DWDA 1BOFA 5KQMA 1LDBA 3AB7A 4KYTA 1C0PA 1O95D 4CF4A 3CBQA 4ESHA 3WWPA 1Q1AA 1HRKA 3ET4A 5IJWA 4DKJA 3I1IA 1OROA 2YJNA 2VOEA 5ED4A 2FPSA 2ZKIA 5AYVA 4DYDA 3KKNA 3VMFA 3ZQ6A 1WV0A 3PT5A 3KSMA 3OZWA 3SJAA 3DXYA 4FDTA 1CW2B 5TF4A 4ZU1X 4E15A 5KYNA 1K8ZB 3NMUF 1NL3A 1OYVA 2V8BA 2HC9A 3CY6A 1G3UA 2R00A 2XW6A 2V9PA 5JRJA 3LBHA 1XRQA 2OC9A 5JAIA 1N5JA 1ODSA 3DO5A 3VYVA 2BZSA 3QUBA 1NXOA 5ALPA 1H2XA 3GLHE 3P9PA 4MQBA 4EPRA 1L7DA 2P8JA 4QFMA 4WQMA 1F0NA 4J94A 2Q3HA 1DUIA 2VHTA 4P3XA 4Q4JB 4BAUA 4C7MA 4ZVOA 4ZCTA 3EF3A 1W49A 3QOFA 3W3AA 3W5SA 5FLXA 4JAVC 3G9XA 3FTQA 4BV8A 3LQYA 1O6GA 5H0IA 4X3CA 3DT6A 5EJFA 4Y3UA 5AI4A 4D41A 5CD1A 5ERGB 1FNCA 3R7WB 3ROXA 1Z15A 3MJVA 5EXSA 121PA 1U8FO 3HKEB 4P5EA 2R8RA 4RGYA 2FF7A 4E7PA 4E88A 1U0OC 2PWPA 1X1CA 3QXGA 1GTVA 4FEAA 1KI6B 2WTNA 4LSGA 3S70A 2TSYB 2G67A 3KQWA 3VKUA 2CZGA 3V2HA 4B3GA 3G5AA 2E4WA 3OLYA 3UB2A 2WUWE 3HMKA 3V4SA 3TOZA 1TA9A 4DMFA 2ZQZA 3O2JA 4MW5A 4DSNA 5A4JA 1YFJA 2BAGA 1M75A 3KUXA 4QGBA 4XXHA 5AK5A 3ITNA 1VJRA 1E2KA 1FEZA 1JZSA 1NUAA 4XB1A 2GMWA 4BUJA 1OFHA 2PGOA 2ZYRA 2GR9A 4NP6A 1K2WA 2FUEA 4LVNA 1B41A 2AYYA 4MAFA 4D4MA 4H1WA 4AI6A 3QUCA 1E3WA 2NXWA 4KUHA 1NG1A 5J43A 1TM3E 2XCTB 3THYB 2QZPA 2AIRA 4Y2UA 4D3XA 3THSA 4LKRA 1L3IA 1YWGO 3QEOA 1ESNA 3KTDA 2Z4SA 2GHQA 3QLUA 2PGXA 3BGSA 4PLTA 3TW4A 3ORYA 2JKVA 2B9EA 1M54A 4A82A 3BH6A 5EUMA 4DR4B 5D5PA 1EH5A 4UPVA 1OV4A 3SHOA 5IAKA 2W58A 1DJPA 5JPIA 2C5AA 1K9SA 3L6EA 2ZJ6A 2BTQB 2FZKA 1IJFA 4LOAA 1NYTA 1Q7BA 2X1MA 4L4YA 1C0EA 3T38A 3DLBA 3M6MD 1U7OA 2QG9A 2AWNA 1N0WA 2O8NA 4EKYA 2HTEA 3UHFA 3FTPA 2YYAA 2XI4A 1KYWA 2WMYA 1G7TA 1SPXA 4WBNF 5FB3A 1BVHA 4LCBA 4XLLA 5IT4A 2NV2B 2GS9A 3QKRA 1NW9B 3HDTA 1NNUA 4PV7A 4OBXA 3Q9UA 4IL5A 3IV9A 5IFKA 1T35A 3GARA 4Y1FA 5A6SA 1B8VA 2H9IA 2ZJ3A 4FMDF 1ENYA 3D5TA 3KELA 4DWOA 4M1ZA 2VUIB 3L07A 4L8GA 4PRYA 1EDBA 2ZSJA 3PS9A 2RGDA 3GRRA 4R2KA 4CIBA 3TFOA 3PVZA 3OCCA 1YC2A 3QLJA 4HFRA 3E7XA 3S1AB 3JARB 1Y81A 4FGJA 1WCIB 4Y6OA 5G1OA 2C31A 3R5FA 3X1MA 3CT6A 4D9NA 1FU4A 3KSUA 4RJJA 3C7TA 3IP7A 2WG1A 1ZJJA 3M1YA 1BMFD 3OQHA 5CA1F 3HU3A 1KI4A 2AX3A 2VJOA 3IV6A 3L7OA 1LDNA 4YCAA 3T61A 5EZYF 5AI9A 2ZTLA 4O2BB 3G68A 1U3FA 1ZOPA 1HLDA 5JI2E 4OHYA 3JASB 4H7DA 2ZZMA 4XD7D 4LWPA 3FKSD 3MS2A 4ZO9A 4YQYA 2AMYA 1MEOA 1T36B 2ERXA 1UBNA 1XTBA 2G83A 4QJ5A 5AJXA 3UJ6A 4F3NA 1O03A 2J3LA 3A6ZA 5BVGA 2WYVA 4KX3A 1BRMA 4WY2A 3E70C 1WOYA 4RH0A 3U9SA 5AQ1A 1O94C 1T8TA 3F46A 4ZHQF 1Q20A 1LFAA 1Z5ZA 2NO4A 2POCA 3E9MA 4QSMA 5TY0A 2WT9A 5B7NA 3MHTA 2FLVA 2QSJA 2Y1FA 2BBWA 1BZYA 1HT1E 4BNDB 3DV0A 1AO0A 3UTDA 2O8CA 3PNPA 3KZMA 4XQ9A 1OXTA 3BRSA 4G4GA 4JB2A 4YAJA 3K32A 2Q1UA 1G7RA 3NWEA 4CM9D 4ZAWA 2IOQA 4XDZA 2WNSA 1DV2A 1NP7A 2GCGA 3IE0A 2CUZA 2FWNA 3H2KA 3QMVA 3BF8A 1EGHA 3EB9A 4EATA 3A3YA 3GELA 4KXMA 5FA8A 3LYUA 2BR5A 4UTXA 3ZGOA 3GRCA 1LX7A 2VDLB 3T3EA 4YCLA 4LRSB 3LOPA 1RHKA 2QA5A 2IVZA 2XVYA 3HUUA 3RK0A 4Q3LA 3QLEA 4BNNA 4DY4A 3L8EA 2QQ5A 1AUXA 4K6HA 4Z54A 3KKEA 1E98A 5CYFA 1N2XA 1MAAA 2QD1A 3IURA 3T99A 5AXBA 5KB3A 3RKSA 1ENOA 3FTNA 3H8WA 3GK3A 4PINA 1UFVA 3NJ4A 2ZPUA 5I7EA 1XTSA 5J59A 3KWLA 3RWOA 4AMZA 4PYJA 1HNWB 1RLUA 5J23A 1NN0A 3DZFA 3I5MA 4FE7A 4XJXA 5LNK6 4CMAA 1HBJA 2P2LA 4PLCA 4R31A 3B12A 5E8RA 4GDMA 2AZMA 2DJ5A 5J9FA 4F1JA 3VZRA 3KU1A 3CURA 3EFOA 4NV1A 2JK1A 2R84A 3G8AA 3HPRA 2FCRA 5KSPA 1W4CA 5JXHA 3FVTA 5ERXA 1JU4A 2BDEA 1QCDA 4XOUA 3PHHA 3NRBA 5L3SB 1L5YA 1T91A 2D62A 3PHBE 4HLDA 2ZUUA 2ODNA 4ATNA 4CTMA 1LJLA 3LTNC 4UAGA 4BV2A 1X0XA 3Q72A 4ILEA 3ZHVA 5IHPA 1WU8A 3H2HA 1JPNA 4BHTA 2CHGA 2VTKA 4UUQA 3SFVA 5MFZA 1FTYA 4B43A 3F4LA 5DH9A 1T4GA 3M2PA 1ZH4A 4U5QA 3BWMA 4JEUA 5AVJA 3EUWA 2VDVE 1U3CA 3P4UA 4UVEA 1XU7A 1ZMTA 1ZI9A 2VQSA 2DF8A 4QPNA 4F93B 4W5JA 4EI2A 1AQJA 4GI5A 3RTCA 1VJ1A 4ONEA 2BF7A 3ZWOA 1JKJA 1X6VA 1NNSA 1HMPA 2FHSA 4L4UA 3ZZTA 5B7GA 2O52A 2NSJA 1XAIA 3OKAA 5DI3B 3U7IA 2PWBA 2RGEA 1Z36A 3AEUB 3PR1A 4RABA 1CD5A 2IZOA 2REXB 2IYNA 2XWBF 3MWYW 3ETLA 4WY8A 3ZGYA 4G89A 5HRCA 3ETDA 3DQZA 1KERA 3GUUA 3QXSA 1IDOA 3BWBA 3QGMA 1QIEA 3DOEA 3IBFA 2WQZA 4N01A 2ZAMA 1PBNA 4HNSA 5AQEA 1DEOA 1JEAA 2D0PB 5FUWA 4OI0A 4AS2A 1E8MA 1SGWA 1KO4A 2FUNB 1SUCA 1HG1A 1XG5A 2CNKA 4FX5A 4G5GA 4JXKA 1KF0A 1GKIA 4JC4A 4GMKA 4PXYA 3CLHA 3NONA 1IE3A 2CNWA 1HDOA 2J4CA 2AKYA 2BFPA 2CJWB 1N5LA 2XODA 3OF5A 1U5BB 1DBIA 1VI6A 1Z17A 1NWCA 2XE8A 2ZROA 2ZITA 1JHOA 5JJBA 4D8TA 1BMFA 4H4EA 1GJRA 4MVJA 1NSYA 2IU4A 2W98A 4U2KA 1CY4A 3FNBA 4XGNA 4AXXA 1UXKA 1NVUQ 2DX7A 2G04A 2I33A 1RKXA 4RULA 5AUOB 2OO5A 1AQYA 2AZTA 2ZRIA 4RTRA 2N47A 2B99A 5EKXA 1EZZA 5K45A 3EGOA 3EF0A 4LSWA 3FDJA 1EUYA 3FMGA 4O2AA 1L7QA 4GQAA 3SYTA 2YXPX 1KZHA 1KARA 1J97A 3JD2A 2O2XA 2XYRA 4C7BA 2GN9A 3EGEA 4MTCA 3T1YB 3R7LA 4EKDA 1RQPA 1T0PA 3O4IA 4RVGA 4NBLA 1C9YA 1RYBA 2WI8A 1N8TA 3D4IA 3HJGA 2Y0PA 4RAQA 2NUBA 4AULA 4CLHA 1AGNA 2ZK7A 3ZTYA 5EXXA 1YZ3A 1JHPA 4L51A 3GA0A 1O9BA 2QUZA 3WJ7A 2YUIA 3VDNB 3DMNA 1ZC3A 2H1RA 4CFSA 2VRBA 1PT5A 1B00A 4D4LA 1JRLA 1ZSYA 3WGGA 2GPWA 1W4AA 5F9MA 2J3IA 4IKPA 1DUSA 2HR1A 1QB7A 2BKXA 1FDRA 4HZUA 4V3BA 5ABPA 1KJNA 4EA8A 3NC4A 2PTGA 3MCVA 4ITVA 4X6XA 2XDWA 2OZLB 2O59A 4DV4B 3D6UA 2QQGA 5T4HA 1AU9A 3CCCA 4MARA 3KB2A 1D04A 3C8MA 3VJLA 4CV0A 1NPDA 1N5DA 3GD5A 4G56A 3K6SB 1KC1A 1SC6A 3CEJA 3UKJA 2RI6A 5EEGA 2P3SA 1EJ0A 3ZNNA 4GYYA 3QEMA 3TD2A 3E9NA 3K9QO 5YASA 4RCYA 2BGJA 3C5HA 4IIFA 1NYLA 4MYTA 4PU0A 5DGTA 3AEKB 4KV9A 5U9CA 5B64A 4CQNA 2OECA 1G18A 2VYND 3VPXA 3EJ6A 5TX7A 3QRWA 5LKRA 1VI5A 1F51E 1RSZA 3GWGA 4NCNA 3BZWA 3S2EA 3GUCA 2KM1A 3P27A 2WKQA 1ZM7A 1E9RA 1N8SA 3WLJA 2FK7A 5FPTA 1KOLA 4AG6A 3L0DA 4MVJM 2ZJ7A 4LHYA 4CV2A 1FZTA 1CVIA 1I0IA 4ME6A 4YPVA 3V00A 1K5PA 1O96B 4IXTA 5LYJA 4U9IS 1WA5A 2NLOA 4JL6A 5CHEA 5FA6A 2FW8A 3R5SA 1U7PA 2ERYA 3DEZA 1BFDA 4L22A 4TL9A 2SECE 3P9QA 3KKKA 7ABPA 3AJ8A 1SQGA 3T5GA 1G16A 5KNCH 1R16A 2DWCA 3O95A 1JN0A 3R74A 1XZLA 1YR2A 4ANFA 2BLNA 3KE8A 4ARCA 1CVRA 4G1EB 4NI5A 2PR7A 3U7QA 1BCRB 3S2ZA 3ONFA 1I0LA 4QLBA 1KVUA 1OCEA 2AWOA 2TECE 2A1TS 4A8PA 2I6GA 3RTDA 2GLTA 5EWJA 5HKAA 3NBFA 1TQ8A 1V7CA 2Q41A 3TTWA 5J5CA 2M6LA 3M6UA 4EEKA 1RXCA 1RBMA 4I6GA 1C2TA 2IP1A 4H08A 3GLQA 5ALJA 1QTRA 1R6UA 2ZUTA 4X61A 4HAUA 5LZ2A 2JFOA 2CLLB 4IF6A 4L3VA 3Q3HA 3P2MA 1VJ5A 4JASB 1KJ8A 2HFKA 1TQ4A 5EWLB 4DLWA 4M38A 4U6QA 1U9CA 1N9KA 1HDCA 1RKBA 4FUTA 4YLGA 1KIAA 3LYLA 1ZMOA 1XK7A 3QE2A 4IUYA 1CIPA 5F76A 4XAQA 1DQRA 1TECE 2EC5A 1C2YA 5G41A 2QPOA 3F3SA 1RXEA 4NL4H 1TF5A 4FFLA 2PWAA 3L1VA 5CYOA 5K0SA 1U7TA 4GR4A 3GFVA 1EU1A 2ZI7A 3H9QA 3K9FC 1LBQA 1DBRA 2ZIGA 1NJ1A 2H85A 3E9RA 4TTRA 3K70C 4M87A 1EEHA 4PYNA 4DAOA 3EZYA 5BPHA 3OJFA 1PZNA 3DE2X 3NVKI 4MS4B 2PZJA 1CUVA 3ADOA 1KVQA 1M72A 1OZAA 2YBEA 3AW9A 1ADBA 4QOSA 1E6KA 3P4YA 2BWJA 3AFOA 1W1IA 3DPSA 4KPGA 4O4LA 1VRCA 1DX6A 4BNJA 2WHQA 3N1UA 3KYCB 3U4QB 4KREA 2R48A 2ZRFA 2ZFUA 4ND8B 3A04A 3LT0A 3EDOA 3BDIA 2UZ3A 3ET5A 3EUAA 4RJIA 1MW8X 2ZB8A 1U8CB 1W36C 1P81A 1JIUA 2UYYA 1QJ4A 2E5WA 4LPSA 1MC5A 5G0WA 2F8LA 4WESA 4KIFA 4RY9A 2VXCA 3BE4A 4LISA 4R9UC 1YONA 4U0KA 2F43B 3WDLA 5AR1A 5F3DA 1R0RE 1N36B 2DSTA 1SC4A 2X0IA 1UPXA 3O4VA 4GWKA 1FFWA 9LDBA 2ZYDA 4X5OA 3KAKA 4HDRB 4Q1BA 4X8LA 5TQ0A 1J49A 5DKFA 1QV6A 1XCLA 3I8SA 3RRMA 2AYZA 4PZ0A 3PFKA 3ROMA 3E05A 4UULA 2X2FA 1OYOA 2WJPA 3GJ3A 4N49A 1QYCA 3LRXA 5JXGA 1G63A 3W2TA 1P5FA 1P1FA 1NT2A 1W5BA 2VNJA 3Q3CA 4EB3A 2I3GA 2QX8A 1U3TA 5IBQA 4XJSA 5FWAA 3RS7A 4UDYX 5B30A 4MX8A 1VDMA 2CUTA 3T5PA 1NJFA 2ZXFA 4LRQA 4A2QA 4OIMA 2NX2A 3UQZA 5JAUA 3DGEC 4TYNA 3LGSA 4HGNA 3RO7A 5KKCA 2O05A 1AC5A 1NXTA 4YMLA 1Z29A 3CX3A 1IN5A 1VKZA 3OT4A 4LZNA 4QEDA 4B5LA 4GWLA 1AA6A 2BJHA 2XCIA 1T34A 1RI4A 4N40A 2QUJA 2RI1A 3INYA 3PYLA 3UKOA 3VOBA 1KJZA 2VJPA 4JZKA 1UF9A 1Z35A 3I42A 3K16A 1KGSA 2A0UA 1D0VA 1KS2A 1V4BA 2CNDA 3EXFA 3JS5A 4HWGA 9GPBA 4JUIA 3E8SA 4M9QA 3GFPA 3FMFA 2HN9A 1ZGCA 3NIWA 1K7FB 1T4CA 1KPIA 3IUSA 4GBED 3WGHA 3ZZ0A 2IS4A 3RYIB 3A1UA 3DS8A 3A6HA 4L5JA 1QIJA 1PK7A 4GM4A 4YUZA 3O8QA 3SQOA 3AZPA 2VQDA 1CVLA 1ZW1A 3EVBA 4ER3A 1C8BA 4XQEA 2QZ4A 3S8YA 1HOXA 3WDKA 2VUTA 3OY2A 3N8HA 1VE3A 5K4AA 2XLBA 1XD2A 3UC5A 3LQQA 4MIOA 3ZUPA 4TZ0A 4XEUA 5B4UA 1FVHA 5KTYA 3WGIA 4RIGA 2PDAA 3TINA 3WHLA 5AHRA 4YUYA 3U6KA 4BNXA 4J0JA 4X65B 4FOSA 2X8WA 1LI7A 2XBUA 1JJFA 2CYAA 3OP1A 4KNWA 4B7UA 2WDPA 3N5CA 1U99A 1JFVA 1Q12A 4IIJB 5I3CA 2PWZA 1LXCA 2R5WA 1P5HA 4Q1AA 1F4LA 2C7PA 4ZK6A 2VYVD 3ZV5A 3RUHA 3D3WB 5DLDA 1WHSA 1P0PA 2EQAA 2P6NA 2XUGA 3N70A 3QVUA 3RQSA 4ZI7B 1QU2A 1HR0B 3VNVA 3BIWA 4WLVA 2H2HA 4L4SA 3L0IB 4E14A 4ZYVA 1P33A 5KYWB 2WWVD 2P77A 4OYRA 1R6AA 3DMHA 3MOIA 4DDUA 1Q16A 2DAPA 1FDOA 1TLTA 3HUEA 4YXWA 1R4MA 3UMYA 1P4HA 4JXXA 1V8DA 2GF9A 4JSRA 3V1UA 1GUZA 2QVCA 3WGLA 3VKWA 4X9XA 4CG1A 1NN3A 2A4KA 2QJWA 3OZ7A 4QUKA 1PWXA 3KD3A 4ZEOA 2OXRA 5DBOA 1GPH1 8ADHA 1CR2A 4ZVLA 1V2HE 5EQTA 4E03A 2QM0A 2PBRA 3H5IA 4E12A 3QHAA 1WU7A 5K3FB 1VJDA 3G2LA 1X92A 4G5HA 4IQGA 2QT0A 4JJ4A 2EZ9A 3PX3A 4IUCS 2Y0DA 3PIDA 1RJEA 3KS9A 2P9EA 1SXHA 4AP6A 4ZGBA 1REQA 1HXHA 5LLTA 3LLMA 2R8ZA 3FVQA 3WWEA 1OXXK 1TL7C 2YNMC 2VF4X 4WXMA 4KQ9A 4DRYA 4F9EA 1ECBA 3N2KB 5I9SA 5L4NA 1JPJA 1TA0A 4B73A 2IEBA 2P4SA 3SFZA 5A4IS 1MQ9A 4MR9A 1U98A 1FFSA 5E4TA 3AL3A 3LY7A 5DHSA 3W5AA 2PKEA 4JOSA 1FU8A 3KPUA 1WCV1 3EXG2 2JFVA 4EI7A 1SM4A 1Y1KE 2GBLA 3IRVA 2W7TA 3GP8A 2X86A 4NOLA 3OE1A 1T2VA 5E7QA 2BRUC 1U11A 2ZBGA 2BEJA 3DMGA 3RASA 2NTNA 3F5QA 1YBVA 4TROA 1RRMA 4BNVA 2E82A 1N57A 2ECKA 2DY1A 1JLSA 1UMBA 2EZ4A 2O1EA 3IJEB 2J7PA 2ONKA 5G1PA 2XNSA 1X2EA 3EVTA 5KVVA 1Q0TA 4ZRMA 1XNQB 2HREA 3ESCA 4B87A 4ZT6A 4KZPA 1KI2A 1E2PA 1O87A 1ZCZA 2P7HA 5CK4A 3T95A 4LTDA 3G9QA 2FZEA 2VN8A 3PA8A 3PUKA 2OWDA 3CLSC 1ZWKA 3QYAA 4MWZA 1WIWA 3ASZA 2IYQA 1UM8A 2G8NA 2JHAA 4NE9A 3WYFA 3LK7A 1GZ5A 2FOIA 4MW0A 3IEKA 5CW1A 1BEUB 4GD3Q 5AOVA 3V1NA 5FI1B 3UWOA 3ZXYA 5CDFE 5DLYA 1YTUA 1PJTA 1UJ5A 1XK6A 1XYYA 2P65A 2QZJA 2SNIE 2WNHA 3SU8A 4BLUA 4YPOA 3TB6A 3BMQB 3O4RA 4YCMA 1Z63A 4WHMA 1FY2A 3BXOA 3NI2A 4DSTA 2Y66A 2J6IA 1VB5A 4K9RA 3PUJA 3CW9A 3OQNA 5EIFA 3PXCX 5GV8A 2C7QA 3QU7A 4EWLA 4UUOA 5BPFA 3NBZC 4ZOBA 2C61A 4MPDA 4C04A 3LPDA 5ESWA 2ZAGA 3I58A 1FLVA 2B8WA 3PD1A 2PD6A 4HKTA 1FUEA 2RH8A 1MX3A 5MGNA 2NU7B 3RHFA 2PUVA 4YHHB 3PWZA 1WZEA 4PC7A 4ARIA 1UBEA 2WJJA 4H7HA 1H9CA 1V35A 5AM0A 1AK9A 1SVUA 1TF2A 5ARDA 3DLPX 1AG9A 1Q0HA 4UU8A 3RAGA 3R9IA 2OP1A 4F6CA 1JFRA 3K0CA 3A1CA 3QUAA 5CNMA 5ICSA 5IT5A 2X19A 3GL9A 1GG8A 2ONCA 2Z98A 4LDRA 1LY1A 2CW5A 1M66A 4DCTA 2FY8A 3PXUA 5EJAA 1OTXA 2GJKA 1DAIA 2IQIA 5JEDA 2XSZA 4IV0A 2JAXA 2PIDA 3F1KA 2ATVA 4KO8A 4ENQA 3IQEA 2EFJA 5LQJA 1AUQA 2Q2QA 2ZGVA 4OH7A 1GL7A 3T7KA 2DTXA 1JQEA 4G3XA 4JI7B 2P5TB 1FPQA 3IGFA 3P96A 4ETNA 4TUYA 1YMVA 4UNSA 3VBCA 2EFEB 4D3YA 3TMKA 2Q4DA 4Z99A 3B6JA 5HE8A 2JLBA 1FQWA 1R64A 4PS0A 3G7UA 4K6GA 4DC0A 5FWNA 5DTIA 2BEUA 1Y1QA 2R25B 2WD7B 2YV1A 4Y6LA 1SWVA 4P92A 1JAIA 2PKRA 5LYJF 4PZEA 4C0HA 2XEDA 5ILOA 3CWQA 4R71A 4P58A 1AXGA 4QPCA 5CCXA 5D3ZA 3CGWA 1PW5A 2ECQA 1D8AA 4RMHA 1H2BA 3L4BC 4W99A 5EIBC 5H02A 3UN1A 3BGDA 3PNSA 3A4VA 3ZV6A 3HDGA 1JSCA 3UANA 4KXLA 2FR8A 2E6KA 3ONNA 3L7BA 3K0KA 3QMMA 4GE0A 1B73A 1RQXA 4D82A 1A1VA 1K4MA 1K8XB 3L1JA 4ZAGA 1NAIA 3L9XA 4WXHA 4Z9FA 3KYDA 1KAQA 3A4TA 5F1KA 4U7WA 1JR6A 2FWBA 1EAMA 1T1EA 2Z1DA 3G5TA 3B1JA 1S2DA 4KJXA 4PX2A 5DSXA 3DBVO 2WILA 4LK3A 2PVSA 1BWPA 3JATA 3LQFA 5LZ7A 2OYRA 4F5EA 2JVIA 2AJDA 4BNHA 3M1AA 1E2MA 1IEWA 1U9IA 2LPMA 2ZJOA 2JFHA 1DO2A 1JEQA 1XLTC 2G9VA 4FDUA 4L08A 3VDXA 3IQHX 2YW2A 3RH0A 3B5EA 3QWBA 1PZFA 3I3SR 3K0AB 2ORIA 3NTVA 1CZOA 4B46A 1C5KA 4EJMA 4XUEA 4ZGWA 4E22A 1SY7A 1TLFA 2QZSA 2IYSA 2C83A 3OURA 1EFLA 3P4XA 5AK6A 1UQUA 3ENVA 2H1HA 1T9GS 4IYJA 2GD6A 4JBLA 4PWZA 3AFMA 1O97D 4IW3B 2QMOA 2PEZA 4N4AA 3WLLA 3HACA 2JGIA 4KXWA 4LX0A 1RPTA 1YC5A 1YR8A 3DDWA 2N1BA 4YIKA 1L4UA 1V16B 2YRWA 3NGXA 1DLJA 1Q0LA 1WL8A 1Y9ZA 3FG9A 3QF7A 4GLBA 4H7FA 4NU6A 4O4IB 4OP2A 3EIWA 2IIPA 5M7EA 2V3CC 3R4VA 1RBQA 3M4ZA 4RNDB 1ISRA 1B8UA 6PFKA 2L17A 3UXYA 3JQAD 1C14A 1N0VC 1Z7GA 3KQVA 3PR3A 3P19A 4O4LF 3EEOA 4OMCA 2WMOB 3IMEA 4LWOA 1W1WA 4F2GA 2PJRA 4HF7A 1B8NA 1POWA 1LZLA 4QEZA 4WN3A 1CDOA 1P29A 2J5BA 1JWBB 3IODA 5AOBA 4C0KA 2B3TA 4UMDA 2GO1A 1LPBB 4RYLA 3SVLA 1GAJA 1QVRA 4DSAA 3K0BA 2WWRA 2J0QA 3UH0A 3L82B 5FI5A 3EPKA 4LXGA 4NX2A 2FZCA 3VR6D 4F84A 3FM9A 4ALMA 1K92A 2XA2A 2JDIA 1BS1A 5JD4A 3ZGVA 4WNAA 3OZAA 5KNDA 1EUQA 3ZY2A 3FWHA 1MB0A 5GGXA 1R6VA 4IEFB 3UK7A 3BHJA 4HNTA 2X0FA 5EP2A 2DHEA 1GZ3A 3AR5A 4DXDA 4UHEA 2NZWA 1T0JB 4RYDA 3I1JA 3HDQA 4MXDA 1OSNA 1SULA 4YWHA 1I1HA 3UAOA 5F7OA 4CCYB 2E5LB 4NBVA 3VO1A 4C6TA 4AO6A 1QYWA 4F9FA 3H0KA 2JZOA 1GDTA 1DIAA 1QV9A 3WNBA 3A9UA 2AJ8A 2YHIA 4LXYA 3QNWA 3ANSA 1E1KA 1ACMA 3C41J 3PL5A 1FJ2A 2Q5QA 3A05A 3KTFA 4YR9A 4BVBA 3QFSA 1WMDA 1U1GA 1XAHA 3FGZA 3H8JA 4HGOA 2YBDA 3QNMA 4UM8B 1ZA1A 1CYDA 1XI2A 4MV3A 4D4KA 2HRCA 4M7WA 5ESRA 1OXMA 1N33B 1NUPA 4RE6A 3I6YA 2WF9A 2LGJA 1X7YB 4P38A 4RKYA 2V6FA 3MLEA 4ZOCA 3EIUA 3UCXA 3AF1A 3LOUA 4TL8A 5DM70 3P9RA 5KNBH 1I2CA 2EIHA 3MLBA 2XMRA 4IMPA 4MWOA 2OCGA 4HT3B 2F9MA 5AFSA 1CZNA 4Y7CA 1P74A 1JDNA 3AMVA 3KKPA 2AR7A 4UUBA 3VU1A 1J2YA 2IV3A 3JALB 4RSMA 4EKGA 1L7PA 2YHUA 3PITA 5C5EA 3OFJA 2G09A 3CV3A 4L74A 2VJBA 3O94A 2M1ZA 1CWUA 3NWPA 1LBIA 4M0EA 1C1YA 3SSAA 1YL6A 3DXFA 2R11A 3F5FA 3JVDA 1JDJA 2F1KA 1ZZGA 1M3SA 3ADBA 1TOAA 3IC5A 4F11A 4H2DA 1BWSA 4QPPA 2YN4A 5KKNB 1RHJA 1GCIA 1RWBA 4EJ0A 5JDCA 3VA7A 3WE7A 1JR4A 1FMJA 3ZZUA 2NN3C 3R3WA 4B82A 1YRYE 2OZKA 2ORVA 2BEWA 2ZUWA 3EFEA 4MQLA 2EP7A 3ZY6A 4IGAA 4MR8A 3LS2A 1MC1A 3FH0A 1OA0A 4EG4A 4U3JA 5FV4A 4WX2B 3L1KA 5IX8A 1RKQA 5JAOA 4NR0A 4MQFB 4CF5A 1ZFNA 3SEQA 3U48A 5LOVB 2ZUVA 3V4PB 1PSWA 1UK6A 2BZ0A 4E21A 2P5SA 4RF5A 4OHXA 3PC7A 3V8PA 3F6BX 4CRWB 5G53C 1G3QA 3K71B 3KUDA 5DNVA 4IXMA 2Z2JA 2FVYA 2FN3A 1BXRA 3SNKA 2X13A 1QIIA 2LBPA 3NVMB 1FP1D 2FMUA 3MSXA 2ID7A 1TTHA 3FSGD 1I2DA 2A0KA 3GRFA 3I6MA 4UCXA 4X1IA 2O8DB 1NUQA 3CR3C 4C4PA 4I4NA 2O14A 3M6AA 5BMVB 1HL3A 4WKNA 1LRKA 1RWPA 2CXOA 3HR8A 5C9ZA 5HW0A 1B2RA 2DWPA 4NAVA 2NTJA 3DMPA 1KEZA 1TX4B 4TMKA 3DVRX 2FUKA 5K51A 5AKIA 4CF3A 3T3OA 2IU3A 3KJFA 2BOVA 3JQAA 4MA4A 4ZVSA 2OXTA 3TCNA 3FOWA 4MA0A 4MCJA 2HBRA 3WJAA 2AFHE 2PQ2A 1F60A 3PUXA 5H70A 4EQ6B 1DAFA 4K9LA 3O4HA 1IXZA 4MI1A 1CB0A 4LBVA 4IO1A 2I7VA 4RHTA 2IHNA 1JLRA 2CCGA 1W5SA 1VBFA 3LT2A 3AVPA 4W7HA 4L9SA 4ZO8A 3WWCA 1GFIA 4ZHSA 5I4BA 1NUTA 3N2NA 4P0PB 1TRHA 2HPZA 2HKIA 1BH6A 2IEZA 2LR0A 3NBKA 3D0QA 1XHEA 3AP2A 4Y0VA 5EUQB 3ILVA 2C03A 3U6BA 2OTCA 2PEYA 4NFLA 3UMCA 2QLBA 1OC4A 4RANA 3K6KA 2LZ0A 3UATA 4R1PA 5I9LA 1CS0A 4HLNA 4X0EA 2FSIA 3RDPA 3H2SA 4LUCA 5F52A 1WEHA 1GCAA 4LX8A 3UVEA 2DJIA 3IP6A 3WP0A 5BY2A 5H7XA 1U28C 5JVDA 4C9BA 1VLHA 1Y80A 2OD7A 3B8EA 1H4TA 2WYWA 3D59A 4JJZA 3RT7A 4EMSA 5BQFA 2B1IA 3GQBB 4YRBA 1WSAA 1T10A 4QNNA 2X1VA 5CIWA 5A1JA 4CIXA 4XM0A 1SUDA 3D2LA 3IAS6 2Q4TA 2O5EA 1XZQA 1QIDA 4KH0A 1QQ7A 2ZIAA 1PJQA 4OX9Y 2I6QA 1JSLA 3TNFA 1B15A 4KRGA 1KPGA 3D7LA 2XAAA 3L40A 5A3SA 4HDAA 4EGSA 5K8VA 2OAQ1 2X7JA 4LXHA 1E3SA 3T1OA 3ZE7A 2JFYA 1RJ9B 3A6EA 3HVUA 1ZJYA 3VHQA 5G4KA 4OH1A 3DFKA 4TQAA 5TVGA 3WQSB 3D4NA 3LQ1A 2O0KA 2NXNA 2WJ3A 1YL5A 2GUWA 4W9NC 4HZUB 1V96A 2WF6A 1PV1A 1I1QB 4BX9A 3O84A 5IC5A 3N6VA 2O8BB 4B84A 2GKGA 4IPTA 1XA3A 1LVHA 2D5IA 3JVUA 3L7LA 1T4MA 2J5KA 4P82A 5EMNA 3V6MA 2OAGA 2PS1A 4Q3KA 5IXJA 3IAUA 2PTHA 1GOTA 2ZG6A 3DEHA 1ZW6A 1W47A 2Q8QA 3I52A 4X1YA 3UC9A 3PPXA 4ZVKA 2X9QA 4ZOLB 2BFEB 3KXKA 1E2JA 1YKSA 5DU2A 3SHTA 4TWJA 1CP3A 1VHTA 2F55A 2O8CB 4C07A 4TQ9A 3JZFA 3I39X 4YMUA 3QHQA 4YO8A 2C8VA 3ONVA 4GECA 1RQGA 3HB1A 4KV7A 3BFVA 1VIAA 2XUFA 4LHXA 3TQFA 1VSBA 2NZJA 2W6OA 3K1AA 4WL0A 1KEEB 5JIBA 4XB2A 2XNCA 4UXJA 4TVBA 4HH3C 1ZUHA 3RVKA 3N5KA 3IBCA 3DLAA 3GCXA 1TAUA 4GC5A 3H2IA 3I2HA 5DK4A 2CFSA 5A0FA 3C4QA 2QW0X 5FP0A 3RVMA 3PHGA 3QITA 2Z6QA 1UBHS 2OM2A 4FFPA 1ZIDA 3H5LA 1VJ0A 2CLIB 2D5AA 2VG8A 4OXXA 1M0EA 1Z4JA 5B1IA 3EXEB 4B7XA 5JRDS 2ZIEA 1PFYA 2HMTA 3RTBA 3N59A 4PYIA 2HCBA 4ZYZA 1YDMA 2XPCA 4M8NE 5CW2A 2D1QA 3D8HA 3QPDA 3H8VA 4PS1A 3UHPA 2ZBPA 3DTTA 1ULZA 2ECPA 4MW2A 3ZJ5A 4BQPA 4U7JA 1NY5A 3K2IA 4DA8A 1TJNA 1QS0B 3TGWA 1Y3IA 2OHHA 3ZHTA 4BX3A 3LC1O 1XWFA 2AN5A 5G0VA 4DCPA 4WZAA 4ZXPA 1NYRA 1KSGA 2NAPA 3U17A 5CM9C 5BN1A 2I99A 2XGMA 3C0KA 4Z5XA 1XAGA 2CCJA 2CLCX 3A1NA 3GLKA 2IX3A 2TYSB 2PUGA 3LE8A 2V0GA 3S2SA 4QT4A 2UZ0A 2R65A 4ZEWA 3PRJA 1W52X 4ZT7A 3ZCTA 1E2HA 1OX6A 4XIYA 4AJNA 3QPVA 1SAYA 3E5MA 2HHHB 3AJDA 2CK3A 3L0ZA 4YJ2B 4IDQA 1HC7A 5FEUA 4PPFA 3GH3A 3G2QA 1M1YE 1G98A 1Q1EA 1UZNA 2L18A 4LOIA 3SMQA 4ZT5A 4UOZA 2WZBA 5HZKA 4BFVA 5D84A 4AY3A 3O8CA 3C4VA 1TYDE 1NN5A 1PUIA 4F4JA 3SOZA 4OAPA 1SEPA 2QVLA 3NHPA 3WG9A 4Q1FA 2FPLA 3IPLA 2ZBFA 3QQ5A 4O2LA 3KV3O 5FF9A 1MRZA 3PNLA 1E94E 4D6YA 2AUTA 1B16A 3WRXA 2CFOA 2QNIA 3DO8A 4BZWA 2B94A 3UBTA 4RMNA 3FOEC 4G1FA 4JCOA 1U4OA 1N9ZA 4O2RA 2XYQA 5A4MS 3M1LA 3GUHA 4C1BA 4LI0A 1OILA 3FE2A 3I37X 4RLHA 4A4DA 4CLOA 1W0JD 2QLNA 3IFSA 4CF6A 4DPLA 1CJTC 1P73A 2BBOA 3RVRA 3JX9A 3A0RB 1QO9A 4RHYA 5C1IA 3EZGA 1WXEA 3DE1X 3HY4A 3ZJYA 1P9LA 1H2EA 2B9VA 4OMUA 4TXNA 4ARAA 4CKBB 5JSHA 4DMCA 2Z08A 2BFBA 2WJWA 4O8CA 4CMKA 3F7TA 1ZD1A 4GSKA 4Q4LA 1BW9B 3PU6A 1GRCA 3CLUC 2P4UA 2JHCA 1JAZA 4N3AA 4ZCRA 4HLQB 1ONSA 1THGA 3II6X 4EB0A 4ALIA 4O4HB 4HPWA 3TAUA 3QYJA 4WK2B 2HHAA 2O8EA 2GJSA 2A4MA 3STWA 2ANCA 4HGYA 3ORHA 1O9HA 2OAP1 3A9SA 4RMIA 1AKRA 4XVRA 3A3PA 2JFFA 2ZDQA 3A9CA 4OXKA 3ZK8A 2H1SA 4U4AA 3HBNA 1WZ2A 4ND7A 3GH1A 1C1XA 2QZ9A 2X8JA 3U3DA 2P2CA 4YRCA 1XROA 1R27A 3JQFC 4Q9IA 2GBGA 3KT3A 4IQ0A 3A2NA 2G0NA 4J9VA 3VR5D 4UQLA 3J81A 1HKUA 4OUDB 3ED1A 2J08A 2DUUA 2QGNA 5TJHA 4TLDA 5DHFA 1RP1A 1AHNA 1ZNXA 1KK0A 1IQ0A 3L5KA 2JIZD 3LT4A 1OF1A 5J5VA 3H9JA 3W2HA 1KETA 1Z25A 4G36A 1V2GA 1A3CA 1YD7A 2FU5C 4ZN6A 2NTEA 4YQZA 4D92A 4X66B 5LL6P 2ZIFA 1YB2A 1KMCA 1IG3A 1C7ZA 2C98A 3R4CA 3ZS8A 3FZYA 3BMOA 2X4DA 1RHUA 3HKBB 1YHNA 4ITUA 4NQRA 4XX1A 2V0CA 1A71A 3CONA 2PKXA 3CZMA 4YUWA 3SM3A 1UBOS 3A1SA 3S81A 4UM9D 2Q3MA 5EE9A 5AESA 3PQ4A 1VG0B 2YMMA 2YJ6A 2Q5FA 2Q2NA 2VQ6A 1GXSB 2FWJA 1OD6A 2YHSA 4UJ5A 2XZTA 3UOGA 1ELOA 2E87A 3BH7A 1YI1A 5CFPA 1Z3IX 5FX2A 1V0JA 2J59A 5EIAA 3TDKA 1B6GA 1A9OA 1NASA 3FTEA 2P30A 1R4NA 3LX4A 3DEFA 4XJVA 3ZKWB 1DRKA 1VLQA 1BVRA 3KYJB 4BO7A 3TRKA 2VUHB 3SSOA 3FYUB 3KUCA 3WBKA 2R6AA 4DEYA 3ICVA 2IV7A 1FTNA 1NF2A 2VATA 2VHQA 4WJLA 4FMBB 4LXIA 1M1YB 1H9BA 4FCCA 4MHOA 2PIAA 4PAGA 3R20A 4HNRA 4F3CA 3BEOA 4PCUA 2HSJA 3ELUA 5KTOA 1IFXA 4YJDA 1D1PA 5HRAA 1QFYA 2XAUA 3BL6A 3CZAA 1MJGA 1SUAA 3TUZC 1R5BA 3SXJA 4LW8A 4ZI2A 1OZFA 3I9V6 1D1TA 3FPSA 3GJ0A 3OZCA 4BECA 2HW8A 1NM5C 4GL2A 1QQ5A 1WLYA 1YIDA 1M34E 1E3JA 2C2XA 3V7FA 3TF5A 4LQLA 1MQ8B 2OPBA 3I0NA 5DHAA 3W8EA 2WP8J 3D64A 3L8YA 1R0ZA 3LW7A 4DNFA 3RCBA 821PA 4RVOA 2HLDD 2NU6A 3AU9A 3AIIA 2E37A 2REBA 4WMLA 2LNDA 2OV2A 4Y18A 1XQ6A 5FJIA 4WXEA 1RWKA 2R1UA 2FJUA 2WP0A 3RSCA 1TQDA 4YUXA 1UK8A 4K05A 4ZAVA 5LJLA 1B3RA 2ZWAA 3L8FA 8OHMA 4BVJA 2HMAA 5AW4A 4DJAA 4DCGA 5B3JA 5CLJA 5DNAA 5E0KB 1SXPA 3H19A 3OJCA 5FJJA 1YZUA 2NV6A 4L95C 1GPBA 2QTVB 5CBPA 3AG5A 3WL5A 1GYPA 3Q2OA 4E4TA 5CD9A 3ZJTA 2QROA 4M0FA 3Q3GE 4BNTA 5A5DA 3DZCA 4UHJA 4M1KA 4UREA 3RHZA 3W2EA 2Y0CA 4ZQGA 1R1DA 3BAFA 1W88B 4Q82A 4U7FA 1RMYA 4PQYA 4M8SA 3TLJA 3S55A 2IXBA 3D3NA 3SYLA 1EJ6A 3PUIA 3F6PA 1CXZA 3OLXA 5CHYA 5FT9A 3RLIA 3DMTA 3SIPA 3IP1A 2GCPA 4UVHA 5DLQC 1HG0A 2GZSA 5EN4A 2YL2A 3SC2B 3T7JA 1GGNA 3JAWA 3OQIA 4LOHA 1FXUA 1JMYA 4LGYA 2HV9A 4BCCA 3FHCB 1I7PA 4Q1EA 1YVEI 1F12A 3G0HA 1PWEA 3COSA 4RFSA 4YJFB 4F6RB 1ZHFA 2H0QA 2ZT6A 3CLRC 1JEEA 1KQFA 3PX2A 3N8IA 5T6MA 2GKOA 2X8AA 1NW7A 4CMEC 2MMCA 3EVZA 3ZYZA 2ZYAA 3T9EA 3VH4A 1HZZA 4GMDA 4AZ3A 2MYTA 4ZIRA 2GB4A 1JQ5A 4B6QA 2Q6IA 5TQJA 2C8KA 4UXHA 2XJ9A 4RETA 1GQYA 2X7HA 4C0XA 2ZT5A 4DUGA 2VQFB 1MJGM 1P80A 1IONA 3GJTA 3LH5A 1PI3A 2HDNB 3BKXA 3EAFA 4HJRA 5EMHA 3M3DA 2P27A 2Q3LA 3HCDA 3QY9A 3PTAA 1YDEA 2PAAA 1DAGA 2F59A 3GY0A 2HU2A 2OFXA 4JXJA 1TMYA 2R96A 3UG6A 3KAJA 1JTVA 4R8SA 1J9EA 1PEDA 1VPEA 1WXXA 1Z2CA 5CT4A 4E1BA 3RYCB 4FOTA 5AUQA 1ZJWA 2CXRA 2PUHA 3GVIA 1GGFA 1Y5LA 3QV1A 4K26A 4L0QA 1UT8A 5EC8A 5ECWA 5HK8A 4PGGA 2PNJA 3UOAB 4AICA 1LSUA 1AQLA 3TRJA 2BEVA 5J1TB 4HWRA 3IKTA 4G9BA 3RANA 4I8IA 1U9ZA 4IHQA 2ZBRA 1ZEJA 3ZNQA 1KFKB 1W8IA 5EERA 4DSUA 2ALJA 2H4FA 3EBLA 4UZFA 4JOCA 1GZDA 1X7XB 2ZI9A 3OG9A 1SQFA 3KSRA 2GN6A 3CIFA 1D9XA 3E8MA 2JLWA 4RDXA 5JE8A 3PJEA 1RWXA 1P61B 1UZAA 2FKAA 2ZIWB 1IPEA 3I28A 2ORWA 5CDHA 1GPMA 5AVWA 4X60A 1Q1BA 3ZBTA 4D8WA 1HUQA 1ZN2A 2ZIVB 5IFLA 3M5DA 4G86A 4YCDA 4HAYA 1TT5A 2EIXA 3IDOA 2CKMA 3H2YA 1L5GB 4HH1A 1Q1NA 3ZW9A 3PXGA 1RXWA 3DLIA 2ET6A 3OE7A 2AXNA 2P0YA 2EKLA 3D3JA 3WIUA 3QUTA 4RTLA 3OOSA 4EH1A 4HP8A 3LT5A 3MK31 4QEKA 2G1JA 2QBYB 1ICEA 4M9RA 3C24A 3M49A 3ACCA 4HR7A 1XX6A 4NK4A 3CZ4A 4RTPA 2IA5A 2JGFA 5LDGA 3GIDA 3DYBA 3OPMA 5HJEA 3OX2A 2CHFA 1A9YA 3QFHA 1ZCFA 1DHTA 2E89A 4I66A 3OPQA 2QN2A 3KQNA 2C7BA 3B1FA 3TCXB 4E5KA 1P39A 1DFIA 1QAQA 2YWCA 3P2KA 1I4TD 1V3UA 1XFAA 1TEZA 1GQOA 3I9MA 3AI2A 1G8MA 3IHWA 1PV2A 3S28A 1ZCAA 3ZE0B 4RZ2A 4D02A 2COKA 3HB0A 1KFJB 1EWRA 2MTBA 4JQZA 1SJ9A 4NCKA 2ONZA 4BAGA 1XJWA 5IAOA 4Y9TA 2D8AA 3L0OA 4IZOA 2PVPA 4HBGA 3WRWA 3EVAA 3MMXA 3GEGA 4RPKA 1JJAA 1PKXA 4BRWA 2WICA 1TK3A 1NQVA 3OU7A 4CL0A 3UGTA 3L7CA 2H7XA 3NYQA 1OU4A 4KLCA 1RLTA 4WINA 4ENWA 1N34B 3KE9A 4LI3X 1ND5A 4K28A 2F1JA 5AJWA 3U40A 3V5NA 2YTZA 4DLSA