1MU0A

Crystal structure of the tricorn interacting factor f1 complex with pck
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
293
structure length
293
Chain Sequence
MDQECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the tricorn-interacting aminopeptidase F1 with different ligands explain its catalytic mechanism
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
molecule keywords Proline iminopeptidase
total genus 100
structure length 293
sequence length 293
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2002-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mu0A00
3DJYA 1DINA 3WLAA 2PSHA 5CH3A 4B83A 1X2EA 2WU4A 1E3QA 3AILA 2XMSA 2Y2UA 2OLEA 3D0KA 1IVYA 4X6XA 1ACLA 1IUOA 4UBJA 5T4EA 1LPOA 2FUKA 1HL7A 1SFRA 4BBZA 1CUAA 1YASA 4X91A 3W9UA 4CI9A 2HDWA 3OOSA 5ESRA 2BCEA 3ILSA 5JAUA 3QH4A 1W6RA 1XRRA 2UZ0A 4EA6A 4LHEA 3IUQA 2WIFA 1AUOA 1HLGA 4BE4A 1XROA 1Q0RA 4AN1A 4AZ0A 1GT6A 4F5ZA 2RONA 2QXUA 4OU5A 5JD5A 2VJCA 1JJBA 5AKEA 3AIKA 3AZQA 3A2MA 5AKYA 1GQSA 3STXA 3ESCA 4H0CA 4QLAA 4Y2RA 2EDAA 2C58A 3K9BA 3ZPXA 3VDXA 1CUBA 4MEAA 2WKWA 1W52X 3LIPA 5DNWA 3NWOA 5DJ5A 5ALHA 4I19A 4Y2PA 2WJ3A 3KXPA 4QNNA 4BVKA 3C5VA 3QBJA 2B9VA 1DQZA 3WI7A 1GQRA 1ZD5A 1K8QA 3GROA 2G5TA 4L9AA 3I1YA 3K2IA 2W6CX 3G9XA 2OAEA 3FYUA 3E1GA 3F98A 4X94A 2QM0A 3AIMA 1JJFA 5DNVA 4TPKA 4YX9A 1KEZA 3SC2A 5AP9A 5EHXA 1XQVA 2IIVA 5D3ZA 4NVRA 1XLUA 5AK3A 1SCKA 4HXFB 5A7GA 3ICWA 1MU0A 3KWJA 5E4YA 1VA4A 1MAAA 3I2HA 1EDDA 4OUKX 2QUAA 2WTMA 1VJ5A 2VA9A 2XMRA 3GELA 2Z5GA 4UBKA 4ZXFA 3TGLA 4DIUA 3C8DA 3E0XA 2DHCA 2WHRA 4A5SA 1L7RA 2C0PA 4UFPA 3VVLA 1UK7A 4QE3A 2P8SA 2XUKA 2BGRA 2G4LA 4BDSA 4DSZA 5F4ZA 2HA2A 4OU4A 5AM0A 5HKAA 4E14A 1ZGBA 5ALRA 5HF6A 1CUYA 4AX4A 4BDTA 2XLCA 1P0IA 3VJLA 2O7RA 3DDUA 4J0KA 3R3XA 1BCSA 1LPNA 1R9NA 2AJLI 2XUGA 4OYYA 4EY6A 1YSCA 2JGLA 1N5RA 2IX9A 4Q3OA 3QPDA 1YAJA 3H18A 2JGMA 1CEXA 3HSSA 2HRQA 4F21A 5FLKA 3PFBA 4BC1A 2DHEA 1LBTA 3ZLTA 3K6KA 3CN7A 4UBMA 3FVTA 4NMWA 3ESDA 4WY5A 4HXEB 2ZJFA 4JYMA 3G0GA 2Y6UA 3HI4A 4LYDA 1T4MA 1BE0A 1TCBA 5AICA 1GKLA 1YS1X 4M0EA 5J3JA 2PU7A 1LGYA 3BL8A 1ORWA 4X7BA 3V9AA 1O6GA 4Y2UA 5LZ8A 4UUQA 2CUTA 3NUZA 5IVHA 5ALNA 3HYSA 2ACKA 4AO8A 2DSNA 2HIHA 5AIBA 4J0HA 3DL4A 5CH5A 4FLMA 4TGLA 2WFZA 1ZI9A 1X2BA 5ALUA 4EBBA 3H1AA 1CVLA 2CBGA 2WG1A 5E4JA 5CMLA 3QZUA 2ZYSA 1GPLA 3DCNA 2XMZA 5BWCA 5AOAA 4KE9A 4WJLA 4MJ3A 1KU0A 3PF8A 1XLVA 4FFVA 1XQYA 3N2ZB 4XWGA 4L3WA 3H0CA 4OD0A 4QDOA 1C4XA 2RI6A 5I7UA 2HADA 5EHQA 5JASA 4G8CA 4B0PA 2QTBA 5AM4A 3G9TA 2QUBA 4X93A 1K63A 1XZCA 1DWPA 4FNGA 3C6YA 2R11A 4INZA 4X97A 3PF9A 3WKBA 4FDMA 2WJ6A 4Y2QA 3R0VA 3WIOA 3MVEA 1FSSA 5I8PA 1NU8A 1MJ5A 1DX4A 4TVKA 4Z49A 5K3AA 4ZV7A 2JGEA 2XUIA 3FNBA 3GZJA 4EUSA 1G66A 2HA6A 3DQZA 4U2EA 3P2MA 3YASA 1W76A 2PKYX 5JALA 5DYTA 4EY4A 5ISMA 1R9MA 5CT6A 3IDAA 5EFZA 5AJHA 1F8UA 3B3QA 1CUDA 1AX9A 3X3HA 4DNPA 1EI9A 2WG0A 4Y2JA 3WKEA 4J0DA 5DYWA 4X00A 2NW6A 2ORYA 2XQJA 4UBNA 1TRHA 4AZ3A 5KWJA 4KYVA 2J4FA 1K6EA 4GW3A 3CN9A 5ALEA 4QDUA 3ESBA 3WWPA 5C8VA 4EB0A 4UHCA 3IA2A 1SCQA 1QZ3A 4B82A 3CCBA 3A2LA 1L7QA 3G7NA 4N5IX 4JYPA 3FAKA 1VOTA 5LKAA 4EHBA 5AK4A 5EI5A 1QIJA 1QO9A 5AH0A 1LPSA 5AIAA 5SYMA 1P0QA 1CUHA 2D0DA 3DNMA 1UZAA 2AJBA 1NU6A 4QDTA 1K5PA 3H2IA 3F96A 3M3DA 3DS8A 5ALIA 4B7ZA 1MNAA 3FOBA 5BOVA 2QVBA 4H7FA 1TIBA 4DNOA 3V1KA 1XQWA 2PL5A 2BUBA 1R50A 5A7HA 3M81A 4QDXA 4CCYA 4PSDA 2YYSA 2YASA 5LLSA 2ROQA 4FOLA 3EQ8A 4AMZA 3W06A 3VXKA 5HK9A 1N1MA 3CXUA 2XT0A 2ZJ6A 1WOMA 3H1BA 1LPPA 1G42A 4UHFA 4H7EA 2K2QB 1CUCA 4UHHA 4RPCA 2G63A 2DFPA 4BVJA 2XMDA 4B0OA 5A7FA 1MAHA 1IUNA 1XZAA 5ALOA 2ECFA 3JWEA 4U2DA 1RWQA 2RGUA 2J3QA 1EXWA 1ODSA 1XZBA 3H2GA 1CIJA 4K6KA 4LIPD 3OPMA 4Q82A 1HBJA 5ALJA 2WFLB 2WHPB 2ONCA 3S8YA 2CB9A 4Q05A 3I1IA 3G8YA 4ZWNA 1KU6A 1DT5A 3HXKA 4W1PA 1EB8A 1QIKA 1VXOA 4HRYA 4KE7A 2HA7A 1LPAB 1THTA 1UOOA 2BJHA 4NZZA 5HF8A 4N8EA 5K3EA 2I03A 4ZRDA 1XZGA 2JGKA 3O4JA 5CRIA 3VVMA 1BN6A 5ALLA 3CCCA 5EHZA 2HL6A 2XUHA 3GA7A 5ALGA 4DTCA 2FJ0A 4DNQA 3ZLUA 5ALDA 2AJ8A 1XRMA 5LZ9A 1CLEA 2RAUA 3U1TA 3C70A 2PSJA 2WUDA 4J0IA 3WL8A 4CG2A 3WMRA 2VF2A 4BATA 2HA0A 3D2CA 4FBLA 1YAHA 3R41A 1A7UA 4G8DA 3WWOA 3AZPA 4H77A 5C8XA 3WKCA 4F60A 5IVKA 4C4ZA 4CG3A 4XJVA 3D2AA 5AKJA 2AXEA 2XI4A 3VISA 2RHWA 2O2IA 3IUJA 5AHXA 3QITA 3I28A 5CW2A 4BAGA 3ZV7A 3WK8A 4JEIA 4M0MA 3L1JA 3WA6A 1U65A 5CXUA 1G4HA 2V96A 5KREA 2ZYIA 1DX6A 1C7JA 3O9MA 2HFKA 4K2AA 4P93A 4W1SA 2OPHA 4BAZA 3C6XA 1BU8A 5HK8A 3S2ZA 1CUIA 5IVIA 2FJPA 3ZLVA 2PBLA 2OCKA 4G9EA 3QM1A 1U2EA 2HA5A 1DTEA 4G8BA 3WYNA 4B81A 5DTIA 1CUWA 4UFOA 1AKNA 5AM5A 2QKYA 7YASA 5AOCA 2OCLA 3DYVA 4MEBA 4GWLA 3BIWA 1HKHA 4PSUA 4I4CA 4DMHA 5DYYA 4WFJA 3I2JA 2G5PA 5D7BA 2VT7A 4X3CA 4FBMA 5CH8A 1USWA 4QWWA 1WPXA 1QLWA 4MQMA 1WB4A 1WHSA 1BEEA 2BFNA 5ALQA 1XRNA 4AB1A 3EQ7A 1MNQA 4G4JA 4OYLA 4Y2VA 1EK1A 4B9AA 4B85A 4LXGA 1Q0ZA 4WY8A 5K5EA 5ALSA 1CUFA 4ARBA 3H19A 2QXTA 2WIGA 4QLOA 3G0DA 4P08A 3R3VA 4Y7DA 1UKCA 4X92A 4X85A 4KR0A 1QIHA 2RIPA 3HC7A 4U2CA 1CFJA 1CUXA 1A8UA 2WHQA 4C4YA 2CMFA 1GPNA 4KJXA 1B41A 3C5WP 4CIAA 3IUNA 1MO2A 4BE9A 1W75A 3JYHA 4XX1A 1ZD3A 5A6VA 1E66A 3BDIA 1FFAA 3UMJA 1U4NA 3F97A 1IUPA 3O4HA 5C7YA 4V2IA 1K4YA 1GGVA 3RK4A 1WB6A 5EIHA 3G9UA 4JUIA 5HQ3A 3D5EA 5FDFA 3FVRA 4ZREA 1E5TA 5C81A 1VKHA 3W9BA 4MWTA 3I2IA 4J0JA 1ODCA 2ACEA 4BCCA 4BC0A 4IO0A 2WIJA 4PV7A 2OQVA 2HA3A 2Z3ZA 2O7VA 3DLTA 3A6ZA 3VJKA 4MQLA 3V1MA 1THGA 2WSLA 4ROTA 5A2GA 5JATA 4KEAA 2Z3WA 2XQIA 1ZGCA 3L1IA 4JNCA 4YPVA 3V1LA 1EDBA 5K3FA 1CUUA 3DOHA 2VJAA 3MUNA 4OB8A 5HF9A 3WYDA 1HDEA 4JH0A 2PVSA 4J0GA 5CT8A 4ZI5A 3HABA 1JU3A 2JF0A 3FLAA 3TJMA 1R4ZA 2ZSIA 4BP9A 2QS9A 5JAOA 2XMCA 6YASA 5CXXA 1F0PA 5ALVA 1RP1A 2H9YA 2VATA 3BWXA 2XQKA 4YK7A 3KOOA 1QE3A 2PSDA 1FFEA 3ZI7A 1EX9A 2Z8ZA 4C6HA 4PSCA 4OCZA 5HFAA 1XZMA 3PFCA 1MN6A 1LNSA 1YB6A 1CR6A 3STWA 2OG1A 5FKJA 1UKAA 2VTVA 1HQDA 1XKLA 3FYUB 3D4LA 3D59A 3I6ZA 5JAHA 3O95A 4QZVA 3H2JA 2GYWA 1VXRA 1IMJA 4IHAA 5KBYA 4CG1A 3HACA 3WIBA 4C4XA 2VJBA 1S8OA 2B20A 1DWOA 4EY7A 2XUDA 1JMKC 2XB6A 3A70A 3FBWA 1AMNA 1W4LA 1QTRA 3SX4A 1LLFA 1JJIA 4H7JA 4RGYA 3NGMA 2PSFA 3LP5A 3C8HA 2C4HA 1PFQA 3O4GA 4J0CA 1WM1A 4X6YA 2J3DA 2BGNA 1UFOA 3OTQA 1H2XA 3D2BA 4Y2TA 1YS2X 3R40A 5FP0A 1H2ZA 2I3DA 5T4FA 2AJCA 3GFFA 1L7AA 5AI4A 3F67A 2Z8XA 2LIPA 3BIXA 3C87A 3G0CA 3WL7A 1QIGA 1UK6A 1TCCA 4J7AA 4MYDA 3VKFA 5D3KA 4HVTA 3H2KA 2WIKA 2QRUA 3STYA 1LPBB 2PUHA 3BJMA 5DTJA 1QTIA 3L1HA 3QMVA 3SK0A 1QIIA 2CJPA 4DMFA 3V1NA 2VSQA 1DU4A 4FNMA 1CUEA 4YASA 1O6FA 2WIDA 3FCXA 4H7DA 4FKBA 2JEZA 3WK6A 1XRQA 2XLBA 1XFDA 2ES4A 3IIIA 3D3NA 3WZLA 1E8NA 1ZOIA 2OCGA 1ZIXA 4P9NA 4PW0A 3DKRA 5FPQA 1Y7IA 1TKRA 1AURA 3HRHA 2X5XA 3WJ1A 2C5GA 1P0PA 1XZDA 3FYTA 2WM2A 1AGYA 2WLSA 4EZIA 2GBGA 1QIDA 2E3JA 1YB7A 4Q3KA 4IQ4A 2J4CA 2OQIA 1W1IA 1QJ4A 3RLIA 1X70A 3O0DA 3R3WA 1HPLA 5FXMA 1SOMA 2VEOA 1JU4A 1JI3A 1BS9A 1AZWA 5HF5A 3UUFA 1ODTC 3STUA 3FSGD 4U2GA 5HKBA 2GZSA 4GLBA 4GXNA 2JGFA 5AM2A 5K3BA 5FPPA 3OG9A 4Q34A 3UUEA 2O2GA 3O4IA 4LXHA 5FRDA 5HZGA 1OILA 4H18A 2PSEA 1E8DA 1OCEA 1N8SA 2B61A 3I2FA 4FTWA 2R8BA 4DGQA 4X95A 5FOQA 2WU3A 3SWWA 5C8ZA 3I6MA 4GBGA 4U2FA 4UPDA 4WDQA 1E8MA 5JZSA 3AINA 1TCAA 1YA4A 4BYMA 1ZJ5A 2XQFA 2AJDA 1H23A 1XLWA 2JGJA 3TEJA 3BE8A 1BCRA 4HTAA 5AKKA 4KACA 3T52A 5ALKA 3TRDA 2ZSHA 4RE6A 2XDWA 1JMYA 4HXGA 2WILA 1PV1A 1M33A 3STVA 2DQYA 3WKDA 5JZBA 4G4IA 1VZ2A 4QWMA 4AO6A 1R1DA 1WCYA 4MXDA 3C45A 5D6OA 4XIIA 3LS2A 4KAAA 2X8BA 4EY5A 2ZVDA 2JIDA 5AI0A 5JD4A 4LKOA 5DLPA 2W22A 4G4GA 3AIOA 3RKSA 4LXIA 2OCIA 1XQXA 4GHWA 4XVCA 4AXBA 1YR2A 1DWQA 1QONA 2GYVA 1JKMA 4RE5A 1CRLA 2WTNA 3I6YA 1XZJA 5ALPA 5E4TA 3DYIA 5AKLA 3ED1A 1CQWA 5IKXA 4FWBA 3PDCA 1A8QA 4EY8A 5KWIA 3WK9A 5CT4A 4E11A 2WUGA 3HEAA 4KRXA 1MT3A 3C6ZA 4UHEA 4X6UA 4ZV9A 4MWSA 2VT6A 2XMBA 1EVEA 2HFJA 3FSGA 1ZICA 1G5FA 5CBKA 5A71A 5HFNA 3A2NA 1GXSA 3V48A 3PI6A 2FX5A 3PUIA 3WZMA 1XZLA 3QPAA 3HJUA 2QMQA 2QJRA 1CUVA 4DMKA 1QFMA 2B4KA 1VZ3A 3AFIA 2XMGA 5CT5A 2XUFA 3QYJA 1A8SA 4O08A 5E2IA 2YXPX 1IZ8A 3M83A 2PX6A 3R3ZA 3KD2A 1C7IA 4J03A 3FWHA 5AKIA 1ZI8A 5JZ9A 4KRYA 2ZYRA 5AI6A 1QOZA 1Y37A 3WA7A 4MYSA 1OXMA 4I3FA 1ZI6A 3PUHA 1EHYA 1Q84A 2WG2A 3IB3A 1XRPA 3HLKA 3O9VA 5K3DA 1Z68A 1R3DA 5ALWA 5YASA 4BZZA 5CURA 5ALFA 1FFBA 5JARA 3NOXA 3W04A 4H7KA 3WWEA 1QIFA 2QR5A 2XQGA 3R3YA 5LZ4A 1AC5A 1VE6A 2C5FA 2BUAA 3ESAA 4U2BA 5LYYA 1JT2A 4UBIA 4QEKA 5JD6A 1TK3A 2ZYHA 4OB7A 1UK8A 2DCMA 4PQEA 2C7BA 2WQZA 1QO7A 4C01A 2H1IA 1EDEA 5T4BA 2QJWA 5DWDA 4RNCA 1QIEA 4HZGA 1TQHA 4AO7A 5ALMA 3W2TA 3MGAA 1H2YA 4B9EA 3QPCA 1MPXA 3FLBA 1Y7HA 1CQZA 1J2EA 2WFMA 5AK5A 1XKTA 5K3CA 5AKZA 4FLEA 1ZIYA 4L72A 1FFDA 4AN0A 1ORVA 4HAIA 4W63A 2JEYA 4H35A 2OGSA 2QT9A 3DKKA 1UXOA 1UT6A 2GYUA 1BEZA 4PF1A 4BRSA 2WHPA 4M0FA 1XZIA 4Q1VA 4J3JA 1H22A 2BAGA 2PM8A 2GBCA 3G0IA 5AM1A 2O2HA 4H7HA 1J06A 3WQHA 4G9GA 2HM7A 4C88A 3N0TA 4C87A 4PO3X 2OXEA 4W1QA 5A62A 3AUKA 5H3HA 1NX9A 2BKLA 3C6BA 4KAFA 3BF8A 1FJ2A 2D5LA 2V9ZA 2VQ6A 2Y2VA 3FLEA 3KSRA 1I6WA 3E4DA 3WWCA 3H04A 1EB9A 3I2GA 1BROA 1SC9A 2CEKA 2IITA 1CUJA 4WFKA 3WK4A 3EIOA 3DL7A 4DMCA 2HU7A 1VA5A 4DYHA 4ARAA 4BRZA 1BN7A 2WUFA 2VAVA 5ALTA 4IH1A 1ETHA 5JIBA 4UBLA 2V98A 1F6WA 3IURA 1E89A 4BCDA 5FUMA 1Q83A 3EF3A 1J1IA 4Y9SA 5FV4A 5AI8A 5JADA 1VLQA 4KAJA 4W1RA 3E3AA 2HA4A 1EA5A 4N8SA 4BTLA 2DQZA 3EBLA 1P0MA 3EQ9A 5JAPA 2OGZA 4CCYB 2XE4A 1PJAA 2HHAA 3OM8A 1F0NA 2ZJ7A 1XZKA 4FLFA 2DHDA 4X90A 4Y2YA 3I2KA 1XRLA 5AK6A 3IVMA 2XMQA 1BRTA 4CCWA 2YH2A 3LLCA 1MTZA 2I3ZA 2V97A 5HCUA 1UOPA 1QFSA 2EDCA 5HQ3B 2GZRA 3T4UA 4E15A 4X71A 1GZ7A 3QMWA 3C43A 1SCIA 4ITVA 2H7CA 2PU5A 3G0BA 3DOIA 5JYCA 1LZLA 4K5QA 1H2WA 3DD5A 4DLNA 4IH4A 3FCYA 1RYYA 5AO9A 1ISPA 1GKKA 4H7IA 3G02A 4FMPA 4B6GA 1DQYA 4P92A 4ETWA 3LCRA 5LP1A 3WL6A 2XUAA 1J07A 2BUCA 2I78A 1XZFA 3WK5A 3AJAA 2EEPA 4E46A 1JFRA 2C0QA 3QVMA 3B5EA 3GBSA 4L0CA 1QGED 4S0XA 5K3FB 3MUOA 2Y1KA 4LYEA 3ICVA 1FFCA 2H7XA 1CPYA 1YA8A 1MX1A 2PUJA 2PPLA 5EIEA 4HS9A 2QOEA 3F8SA 3G9ZA 4N8DA 3Q8WA 4AMYA 1LZKA 4IH9A 1UOQA 5I9IA 3RM3A 2HRRA 5EHNA 3HZOA 3IUMA 4BVLA 5IH7A 1WPRA 3WWDA 1XZEA 2VAXA 1DT3A 4GDMA 4UBOA 1ZJ4A 2CKMA 2RHTA 3BJRA 2Y6VA 3WL5A 3Q0TA 3PE6A 3W05A 2JGIA 5IVDA 4DNFA 3AZOA 5BV7A 4BTVA 1LBSA 1CUZA 4KE8A 4CFSA 1A88A 1UWCA 4N5HX 1VE7A 4K6GA 2GBFA 3ZWQA 4FHZA 1TAHA 3WK7A 4D9JA 2X76A 4G5XA 2XUQA 1T2NA 5LZ5A 3LIIA 1ACJA 2HU8A 3B12A 4GEGA 4OPMA 4DSAA 4WFIA 3R3UA 2XUOA 3PICA 5AKHA 3M82A 1B6GA 4GI1A 2DR0A 4OSEA 4OB6A 4Y2SA 5CTAA 3BF7A 1N5MA 3H2HA 3KWFA 4QDZA 4UHDA 5EGNA 3H17A 4UFNA 4GECA 4B84A 1U8EA 5LIPA 2XUPA 5DNUA 2QZPA 1EK2A 3KDAA 2GBIA 2WJ4A 1UK9A 1ZD2P 1QIMA 4AQDA 4DM7A 2HU5A 4KE6A 1WHTA 4W9RA 1CV2A 3ANTA 4K6HA 4UHBA 2OAGA 5LZ2A 2WUEA 5CT9A 5SYNA 1UKBA 4BZWA 3D7RA 5LKRA 1R88A 3IULA 1YCDA 5AKGA 3RARA 3WKAA 1IZ7A 2JBWA 1WB5A 1EVQA 4BP8A 5AI5A 4FFWA 3VJMA 3U0VA 1D07A 1GPKA 4A16A 4F0JA 3STTA 4ZGBA 5AM3A 4BB0A 3GUUA 4WDRA 1CUGA 3OURA 4A23A 3DEAA 4HRXA 2VJDA 1ZD4A 3FYUC 4PNZA 2XUJA 3WJ2A 4BCBA 4CIBA 5LZ7A 3ANSA 3F9CA 4WCVA 1EINA 2H7YA 1XZHA 4QA9A 3JW8A 2OGTA 4BAUA 4Y2XA 5BWBA 2Q0XA 4G1FA 5AKXA 1CUSA 3BXPA 5ALYA 1MX5A 4C89A 1AQLA 5AOBA 3QMMA 5EIAA 3OC0A 5ALZA 4B80A 4Q3LA 3BDVA 2WFLA 2CZQA 3IBTA 4NS4A 5JANA 5ALXA 5T4HA 1MX9A 1EH5A 5AI9A 1LPMA
chains in the Genus database with same CATH superfamily
3KT8A 4O2LA 1YI8A 3QEBZ 2P6RA 3WLAA 2BGMA 1ZOPA 1Z4JA 5CDYA 3C4VA 3KJXA 1Q50A 4JP8A 2HBYA 5MFZA 2NQ2C 3PC6A 5FI0B 3I4LA 1C7QA 5FUVA 3GIWA 1E3QA 3AILA 5L4NA 4WEQA 3RVKA 3WFZA 2LKDA 1V37A 3D0KA 3OKFA 4IDCA 3NG1A 2H0AA 1PYOA 1OFIA 4JP5A 4QO8A 4BX2A 4WY2A 4CIVA 3LC1O 1IUOA 3R0QA 3U7FB 3KBBA 1XXHB 1AIPA 5T4EA 5LMZA 1JFLA 1XPUA 1K06A 4KO4S 1C1DB 3U7QA 4RLSA 4FWTA 1P1FA 4LRQA 5FD8A 3MJCA 1SVKA 2ABWA 1E58A 2O0LA 2O0HA 2AI3A 1O8BA 2ZW9A 3MTEA 2VBFA 2OBYA 2OFWA 4FOOA 4RANA 4L74A 1YASA 1VL8A 1UBSB 4CI9A 4MV3A 5A9RA 2GF9A 4JFAA 3MCAA 2O8EB 1SK8A 3ILSA 5DCLA 2AEFA 3KQKA 1Z4NA 3JYLA 2DQKA 5TT1A 4R7ZA 5KTRA 1C3OB 4EA6A 4UUAA 1J7KA 4DQDA 3MCUA 3DMFA 4JK3A 4OAPA 5ANRB 4YMTA 2EV9A 4G3XA 2ZTUA 2AK3A 5JSFA 4UCXA 3BK2A 2GD6A 3E5HA 3MHPA 4Q1BA 2ZI4A 4M49A 5AYVA 1J1ZA 4IBOA 4D6XA 1UXIA 1P6XA 3KYCB 5CG2A 3F9RA 2ZKIA 1ZWLA 1US8B 4C3VA 4OU5A 2QXUA 5JD5A 1JIKA 4UU1A 2BDUA 2O3TA 5LA6F 1PJ3A 1RHUA 3AIKA 3B6KA 4P3YA 4B6EA 3N53A 1IWOA 2I66A 1VCMA 3A2MA 3PK0A 2ERYA 2XHZA 2UYCA 2RD2A 3DMPA 3T1QA 3HRIA 2FN9A 3ESCA 3WNZA 4EG7A 4K9SA 3QJ5A 1WZCA 4Y2RA 2FW8A 1U0GA 3G2OA 1T1IA 3HYNA 4IIXA 4XLTA 3HU2A 4YJKA 2GEJA 5EJIA 3U80A 3QJGA 4I1RA 3RRYA 5CJ2A 1NC3A 2V4ZA 4XIFA 4CMEA 4KCGA 1WZIA 2PZLA 3EZ2A 2ZITA 1CJKC 1JN0A 4O0LA 1KTIA 4NBRA 2FR1A 1NZJA 1CUBA 4HWSA 5E6SB 2WSYB 4MEAA 1BYIA 1MGPA 4L5IA 4YAUA 2HW8A 5DNWA 2C5LA 3OIWA 3ZKWA 4M53A 4B45A 7MDHA 3AVQA 4HDSB 1GARA 5EVCA 2J7KA 2PDAA 1CFZA 2H7VA 3EZLA 4JR2A 4UD6A 3RTBA 4EFKA 2WJ3A 3MYRA 4WIAA 2CXSA 1IXZA 3MTAA 4TLBA 4FSHA 4JJGA 2C2GA 3S27A 4KWTA 1VCNA 3C41J 4JXKA 1M83A 4QNNA 5TRTA 3EWSA 1HSZA 2B9VA 2BFFB 1EM8A 1G5RA 2D2EA 4CF3A 1ADGA 3LYAA 3QEMA 2CXTA 3L41A 1BD4A 1K8QA 1KI6A 1F8FA 2HNKA 1L4EA 1XL1A 1O5IA 2JLYA 4CLHA 4B6JA 1Q1ZA 2WQ7A 2QNBA 1QE0A 3E61A 4PR3A 4H60A 2I33A 1V5WA 2HLDD 3PUZA 4LY9A 4I66A 1YUMA 1G7SA 1LW7A 4XPIB 2NZWA 4UTPA 1DIHA 1MOQA 1S3FA 3SQNA 4YQFA 4UNQA 4ZKEA 4OJKA 3CZAA 3BRWA 4I9NA 4ZOBA 1HNZB 4IVRA 1JJFA 1MKYA 4N03A 5HE9A 3KZ1E 3IMKA 3KR1A 2CNOA 1N3LA 1VIYA 4QYWA 4ZYYA 1N2BA 1CQJA 1PFVA 3DWGA 4UC0A 1KKMA 3W2EA 2ZE8A 4D3ZA 1T9DA 1Q3KA 2I7DA 1XLUA 3DZFA 4LC9A 4NVRA 4NOMA 2ATXA 2GAAA 1RM0A 4QU9A 2VYNA 4W7SA 5DHUA 1MU0A 1ZFNA 2FPGB 3S1AA 6GPBA 3X43A 1AXRA 4I08A 1KQNA 4EENA 3N2KB 1UBNA 1XVTA 3Q5EA 4MLDA 4L16A 1IIBA 3X1XA 4JYZA 1JSLA 3DOEA 3U3DA 5CITA 1RAIA 4P35A 4D9IA 5IXYA 2G36A 2OP0A 4GL2A 5AVSA 2WTMA 4PG7A 1VJ5A 2NV6A 2OV8A 2ZAGA 2CVFA 1YULA 2FPRA 1S5PA 2JLBA 1Z16A 2W6QA 3W4JA 4ZO8A 4BKQA 4IOJA 3ZXIA 2FW1A 1AUQA 2JC3A 3MS2A 3OKAA 3AB7A 3V80A 1G9TA 4BQEA 3MFYA 2WHRA 4KLZA 4HXYA 1E77A 2C0PA 2G9ZA 4ETMA 3G7UA 2Z8YA 2GASA 1OGJA 1Z5OA 1VJ0A 1TZCA 3CNHA 3IKLA 3K0FA 3S2IA 4C0LA 4IZ6A 2E85A 3WIEA 1ZK2A 2OD2A 5BUCA 2GF0A 1XRSB 2BGRA 5F3RA 1L5ZA 5F3DA 3TFOA 2H4WA 2G4LA 2P5TB 5HSGA 1MIOB 2BFDA 4J1NA 1D1SA 5AW5A 1ECLA 2PBZA 3BXGA 1D0IA 1XKXA 3FTFA 5CBPB 4OU4A 5HKAA 2W2XA 1Q91A 3R09A 4H6PA 4DQVA 5C52B 2GTIA 1Z6GA 2H0RA 1V16A 4PZ0A 4XTRA 1GXSB 3ZY5A 2HHHB 5E7QA 3ZV4A 1IU9A 1Y8AA 4BDTA 1BWQA 3ZCRA 3DAGA 4BLRA 4I6EA 2Q2OA 1WCIA 3O8QB 4UATA 3C3JA 1JLHA 3DEHA 3VJLA 4ARVA 4ZK6A 3SYLA 1ZEJA 3AHHA 5GZ3A 2Q6KA 4NRDA 2OXCA 2GZDA 3V33A 4EHDA 4PX5A 3WTBA 4K7JA 2I71A 3SZRA 4EATA 2D54A 2JH9A 4FSDA 3K5HA 1IONA 2TMGA 5UKDA 3F1KA 5DW0A 2Z9DA 1U0LA 2W6PA 1YU6A 4K8OA 4EY6A 2EU8A 5BWNA 4LJSA 2ZJ4A 1YSCA 2JGLA 3AKEA 4FN5A 5FLEX 2IX9A 1ODFA 4B2IA 1UKEA 3IAM6 1U0JA 1ULAA 1G6OA 2LWIA 2XYQA 3H18A 2GN8A 3HUFA 3QPDA 4FD3A 4RSRA 3GXBA 2PX2A 3IAAA 3K0BA 5A05A 3IJEB 1Y5NA 4F21A 2JVIA 2P2LA 3ID6C 2OBBA 4BC1A 1LBTA 3IUSA 4RJJA 3WSVA 3QWHA 2D7DA 1I2CA 3K6KA 3CN7A 5EZQA 5FFMA 4NMWA 3KQSA 1FFXA 1RPAA 3JR3A 4HXEB 1XQ9A 2ZU0C 2ZJFA 4O8CA 3W8RA 1MORA 1L3CA 5IPFA 2WBLC 3KB6A 4TMFA 4UU7A 3AG6A 2VZ0A 2YWXA 3UGJA 2EG9A 3UFXB 1F51E 4J2HA 3WNCA 5TR9A 3DW1X 3VDRA 4BLPA 3KSDO 1T5DX 2QG4A 3FMOB 4EUFA 1TMYA 4QBTA 5J3JA 1N77A 1LGYA 5JZMA 3VKVA 3ECCA 1ZXBA 2C5HA 1ISMA 1MXFA 1B1AA 3ESYA 4OQFA 3BGDA 4W5RA 4BMNA 3JPWA 1U7ZA 4WJKB 4BEBA 1UAYA 1W9HA 3QNMA 4YHBA 1IOLA 1O6GA 1XU4A 2IXTA 3TBHA 4YT8A 3VH1A 1DTWA 2P2SA 4UUQA 3UAXA 3ZQUA 5HKKD 2CUTA 3NUZA 2QZ9A 3L8CA 2H4JA 3RREA 3ZZUA 4WKOA 5JPIA 4EI2A 1VHJA 1F6DA 3FW1A 2XNDD 3EVAA 4PNPA 3ZVRA 1DQPA 1UIRA 3S2YA 3RR2A 4YAEA 1E2IA 4EYKA 3AF4A 3OPYB 4ZZ0A 2R66A 3ZS8A 1FYVA 5D1HA 4BOYA 2WFZA 5IABA 5M7EA 1X2BA 3EFHA 4YH1A 5LYJB 3VU0A 2ZI6A 3BERA 1WB9A 2BH2A 4FOSA 3DFZA 1SIBE 3AFMA 4EBBA 3I04M 2I1LA 2QQGA 3H1AA 1RMYA 2WG1A 4X1KB 1R18A 2OA0A 2IDZA 5K8VA 5IFLA 1COZA 4MA4A 4Q12A 3DCNA 2H11A 4BMXA 2XMZA 1NJSA 4V39A 3U44B 2OHGA 3P0RA 5BWCA 3WO1A 3ZI0A 4RJKA 3IBFA 3KM0A 4UVIA 2H3EA 3DWEX 1W36B 4XE5A 3VC1A 1XLVA 1X86B 1HLPA 1XQYA 3N2ZB 1KS2A 2WICA 4XWGA 2QMYA 4L3WA 4A2CA 2RGRA 4IGIA 4MMZB 5AVYA 4QOEA 3BSWA 4DSNA 1U63A 1NSTA 3F8TA 4UJ3A 4YMLA 1Z0DA 4RH3A 2RI6A 2VHZA 3EDRA 5KYYB 4TQUS 3DUFA 1QUEA 4GNKA 5IDWA 5JCJA 3OOEA 3M3PA 4ZMRA 2FEWB 1DNPA 1NY5A 4B7CA 3JQDA 1AQIA 3GUHA 3L7MA 4NR0A 3AKYA 4IV8A 4N7MA 5JASA 1OFHA 3Q9SA 3TPCA 3I61A 4H3HB 4XR9A 2XNKA 4ZI2A 1HWYA 3B70A 2C2MA 2X6QA 3DE6X 1G4AE 4E5UA 4L1KA 1TXGA 1T8UA 2AZTA 5AJXA 4UNRA 1XZCA 3HN2A 2N0SA 4N12A 2ZDQA 4FNGA 4WESB 4U0KA 3IE2A 2BM1A 2CLOB 4INZA 3LECA 4FK8A 2YMPA 4KQKA 5BSGA 4UNNA 5L3QB 2WPDD 4NYMQ 5EUCA 2PXHA 3H11A 1SOVA 4NEHB 4RD1A 4RVDA 3L4BC 1W29A 3UHFA 2GEDA 3PF9A 4GMXA 4FDMA 4Y2QA 4C6RA 3P9YA 3G8DA 2ZAMA 1Y33E 4QPCA 5D01A 4EOGA 1UC8A 2HHLA 3I64A 3MVEA 1FSSA 2H1HA 4K9DA 1KDZA 1KOLA 4S24A 1WTCA 1DC5A 3CE9A 4Q03A 3UV3A 3OT4A 4DT1A 4G2NA 2W2NA 1F4LA 1YR9A 2WWWA 1EIZA 2ZBVA 3LBFA 4S1OA 1KF0A 2OXTA 5FUXA 4Z49A 4UCQA 1LDBA 4NZ9A 2QE6A 3R75A 1AQYA 1PE0A 3GQBB 4HKTA 1IM5A 5DGHA 3TUJC 2UZ4A 3FNBA 1G5TA 2ANBA 3BZUA 3GJQA 4C0BA 3VKUA 3ZHXA 3NBXX 4AJ2A 3OQHA 2Q1TA 1SNYA 3NGXA 1G66A 1YBMA 1ZUNA 3DKVA 4E88A 3LWZA 3PIRA 3OD1A 4DUPA 4HH1A 3FDXA 4I50A 5KOJA 4F3TA 2J09A 4CM1A 4DDUA 2AC4A 1NN1A 3JASB 4EY4A 1T9BA 4PRYA 1R9MA 2EQBA 2ISSD 2TYSB 3AKDA 3LE8A 4YDQA 2PT9A 1KY3A 1YMVA 1XG5A 3LUHA 5ETJA 2VCYA 1B3RA 4G85A 3G0HA 1KY5A 2QWXA 3A32A 2AWNA 3H4VA 3UG6A 4DNPA 4GMDA 3WLSA 2V6JA 4U7DA 5A0VA 1EI9A 1PL0A 2OWEA 2VAWA 4HS4A 5AJTA 4Y2JA 3TM4A 4B5LA 4BO0A 2OHJA 1Q7CA 3FMVA 3WKEA 1W36D 2HUPA 2MR6A 4X00A 4IQ8A 1V11B 1DRJA 4XYMA 3D1JA 2XQJA 1KOGA 2KB0A 1JT9A 4UBNA 2NV2B 3KJGA 3RS4A 3EPHA 3OH8A 5JDCC 2W58A 2CWDA 3IXQA 4HQRA 1K6EA 1VL5A 5I4BA 3RRBA 1QS0A 4Q3DA 2IZZA 3QSGA 1S2DA 2FRDA 5ALEA 2VI5A 4QDUA 5FNZA 3ESBA 4I8DA 4Q1EA 3GPCA 2ODEA 2AI2A 4L6IA 4RZQA 3WHPA 3ZDFA 3PUWA 2IZOA 3BWBA 4DIOA 4EB0A 2XRZA 4IGAA 5FOSA 4JHLA 4MS1B 2ZJ1A 2EFDB 2LW7A 5KTSA 2BRUA 1IY2A 1TIKA 4OMFG 4PGAA 5ADUS 3GY0A 3A1DA 5GTDA 2VZLA 1F8GA 2F2TA 1H5QA 5LUAA 1GO2A 1QZZA 1KJJA 1DRWA 3N2YA 3B7PA 3EWIA 4FB5A 1TEHA 1X7ZB 4ADSG 3A2LA 5M04A 3WJAA 1KI8A 3CZCA 4QSMA 4RMIA 3QG1A 1PI3A 2BCGY 3ZZMA 3GEIA 2AYYA 3A05A 4DREA 2R4TA 2O7QA 5JPDA 4DTIA 4R40A 1GQ2A 1VOTA 4RHXA 3KAPA 1H65A 2QSJA 1YRHA 1AUVA 3E53A 1CDEA 4RGQA 4REQA 2QUZA 2W8BA 4D0LB 5KJFA 2OECA 4V0RA 1GAWA 3A9CA 1S9HA 4DZRA 4JV5B 2MR5A 5ESXA 4DM3A 1VI6A 3KKLA 4GI2A 1OU0A 1NI5A 3O47A 4HFRA 4DG9A 4GKAA 4IOMA 4W5WA 3L6UA 1LC3A 5AK4A 1UFQA 4D9KA 3EGOA 4EJMA 5ELMA 3B5JA 1M2FA 1WDLA 1RZRA 1LPSA 5L51A 2P3QA 3NNSA 3O5AA 1AA6A 4D8YA 4ZTUB 4ZVMA 1KEVA 2Q07A 3C74A 2P40A 5CX1B 1WMSA 4UDNA 5IM5A 3B3FA 1QH0A 4MKHA 1PDWA 3DNMA 2TMKA 3OSUA 2XD9A 3B13B 2NPOA 5KU7A 1W4ZA 2XAUA 1NU6A 1JGTA 4QDTA 4UHJA 5E1DA 1JYSA 4N40A 2JLXA 2D2FA 3H2IA 2ZANA 4NBVA 1PEKE 1V9CA 5EXDA 1UCFA 3DS8A 5EKSA 2AR7A 4OHKA 1Q0TA 4H0NA 4XFDA 3RV3A 3GNSA 4TWZA 5A4KA 2ST1A 1NVFA 4MCAA 1Y9AA 4H7FA 2QD3A 3AEKB 4RLHA 3CVYA 1TMKA 3IUBA 1ENZA 3OJLA 3UJPA 3PU6A 4MA5A 4Q9LA 2Z5VA 3TJZA 2PO7A 1U6KA 1PK8A 3A1UA 1XDSA 3N0VA 4Z0PA 2G40A 1DCMA 2X15A 4B5KA 5BWOA 4GAEA 3H8SA 5DYNA 1EFPB 1NXWA 4N41A 1ODJA 2JFFA 1HMYA 3HL4A 3HP7A 3W9YA 1I1NA 2D13A 4ENPA 1TLTA 1SU4A 1XCOA 1DAEA 1NUHA 2GVZC 4TSFA 5GONF 4JS0A 3T4XA 2C2ZA 5CVVA 1FUEA 1A72A 3CXUA 1ZRMA 1YZGA 2XXJA 4M4SA 3L8YA 1RI2A 1IRXA 1WOMA 1T0JB 1W30A 4JJAA 4LQLA 5T8KC 5BN4A 4R41A 1GPH1 1Z63A 3A1SA 1N4AA 4YJ2F 1JQ3A 2JJMA 1S1MA 3NJRA 2EGHA 5J2UB 2Y8EA 4E2WA 4UHFA 4F97A 3QBTA 4PQGA 1JEAA 2MSNA 4DC0A 1QPZA 1DRUA 1H4TA 4KGDA 2IS1A 1X1RA 2P35A 1YBHA 4W6ZA 3QQPA 3P4XA 4PO9A 4WT7A 3I1FA 1T15A 4KQFA 1IZ9A 2DFLA 4A0GA 2PD4A 4BB5A 1IUNA 1XZAA 3H2BA 3VI4B 3R8FA 1OT3A 3B53X 2EZ4A 2CL5A 2KWIA 2YY7A 3II6X 4XGRA 5T41A 5IKOA 1CEEA 4BMSA 3ZDBA 3A37A 4ZU3A 3TLYA 2GK4A 1M10A 3HU3A 4B33A 4RH0A 1PJSA 1PJCA 3BS4A 2CLIB 2JLSA 1XZBA 3OLXA 5DNDA 4D42A 1SG6A 1RACA 1CIJA 4K6KA 4YP0A 4FYXA 3BIJA 4MUJA 4YRGA 3E3LA 1KZ6A 3KX2A 4IHJB 2WV9A 2F55A 2B4YA 3OPMA 3C6KA 3LKZA 2HRBA 1HBJA 2C59A 4V03A 5ALJA 1DBQA 1RJ9A 2NZUG 1Z28A 3LX5A 2QVYX 2ONCA 2WHPB 3S8YA 2CB9A 1TW3A 2UYOA 3GEGA 4YP7A 1KI3A 1GAEO 3H5TA 4EM6A 2QN3A 3IAS1 5C8YF 4EFMA 1O4VA 4CW7A 3G8YA 4ZWNA 1XZQA 2QRQA 1WO8A 2Y3IA 1UH5A 3RUAA 4L0DA 2H08A 2UVDA 3DF9A 3DZDA 4FNOA 4H9GA 4IMJB 4RVOA 4FZ5A 4X1YB 4BIMA 4MSUA 1T3TA 1AHHA 1JH9A 1DWUA 1B14A 3LC7O 3HKBA 2M6SA 5D7NA 1QIKA 3KHUA 1G8FA 2QN6A 1ZVVA 1F5SA 3VOSA 2QY9A 2VYCA 3TQFA 4AY5A 3E4CA 221PA 4PIMA 3TTYA 3WB1A 3ETGA 3M6WA 4XOUA 4P32A 1E5VA 3VNUA 5C34B 2CJWB 3BORA 3EVDA 1VTKA 1BXGA 4AQYB 4YAFA 4G1UC 4EB3A 2XCOA 4OBEA 4INAA 1TD9A 1R4NB 1L0BA 1UJMA 2AVDA 4NZZA 1K98A 4U7JA 3UICA 2W6JA 1V1JA 1UBFA 1XZGA 2CLFB 3COVA 4GLJA 1XHLA 4PXSA 4C07A 5H7XA 3CZRA 5HR5A 5H8WA 1ZBDA 3VVMA 1DKRA 4IDAA 3VRHA 4OMDA 4Q4JA 3GRAA 2HL6A 2QW8A 2HJSA 5DM1A 3DE7X 7REQA 1C1DA 1X0XA 1E2MA 1U3TA 2YYAA 3GA7A 3HFJA 3FNIA 3L0SA 5ALGA 5LN1A 1E2LA 1C80A 1WNTA 2D06A 2FJ0A 2H2AA 2X3YA 3UWOA 1JYFA 5CA0A 2P9TA 1K8RA 4ZT2A 2C94A 4N3AA 5ALDA 1NWCA 3ZHZA 3ZLUA 2VS1A 3MLEA 3VHXB 1ADCA 4AJHA 1ZCJA 5EJGA 1NJ5A 2J5KA 3FMPB 4OX9B 3GW8A 1G1MA 3EXG2 1HOTA 4C0XA 2PSJA 4P0PB 1RWOA 3NAMA 1PVDA 2BCJQ 3P2YA 4J0IA 4M0PA 3RWOA 1Z47A 2FGJA 3D3WA 4OAOA 3WMRA 1PVVA 4I7EA 4R1QA 4O33A 4D3FA 2EW8A 1Q0SA 3D2CA 3WGYA 3L4SO 3DAPA 1YAHA 4M1EA 1OPXA 1KA9H 2FPSA 4A1OA 1L4BA 2ODAA 4R1MA 1E79D 2V0CA 4O4IA 2QTWB 3R74A 4AJ9A 4AZ0B 4F60A 2RGYA 2FSIA 1Y4DE 2I87A 4CKBB 3GQVA 1XP8A 1QVVA 1WE2A 3ZVLA 2OAP1 5DOZA 4NBUA 1IJBA 4LECA 4C4ZA 4OI1A 2DH5A 4C78A 3GGPA 3FH0A 3JARA 4LBVA 5EUQB 3KOUA 3I92A 5DE3A 4Q39A 1JDBB 2CYBA 1J23A 5CAEB 3RFXA 1RYBA 3UMMA 4LC0A 3R7LA 1ZINA 2VHUA 2XI4A 3QGMA 2AN4A 1N5LA 3HSYA 3JVIA 4KYIB 1AN9A 1NF9A 2RHWA 5H1YA 1JEYA 3MFQA 3K94A 4NOJA 1ZW1A 3SS7X 3I28A 5CW2A 5FTWA 1EGQA 4Y6PA 2GNAA 1NBWB 3RVJA 1N2HA 4UQLA 1V5FA 2DRIA 1E4OA 2B2XA 3FTNA 3TSYA 3CFYA 4D26A 1BDIA 3AUSA 3P32A 3RRZA 4C4SA 1DKQA 1RC1A 1NMXA 4I0WB 4YCLA 4M1WA 3LUDA 5CXUA 4A2PA 1RKVA 2B8TA 4HATA 5CVTA 2XJ9A 5CPFA 4S12A 3NR2A 1U3FA 4KBFA 3LVQE 3C0KA 4TTTS 3VC7A 3VPGA 1T9AA 4RVGA 1AUXA 3FTCA 1PGOA 3U81A 1VJCA 3LUKA 1EIWA 2YWFA 1KI7A 3FNGA 2POCA 3JQFC 3T8YA 3ZBTA 1DX6A 3L0BA 4OJMX 2BFFA 3O9MA 1T8PA 1U2TA 4O0MA 4FPXA 3ZDEA 3AHCA 4GKBA 2HNBA 1DB3A 1T36A 3UGQA 4PM4A 1KI6B 2DVMA 2QN2A 4H3VA 1J09A 4FOTA 3CUTA 1QAOA 3F4LA 3NT2A 4YJ3F 4D4GA 4PZZA 1GTJ1 1Y7TA 1XNRB 2WWYA 2MYPA 5GWXA 3WHIA 1OXTA 3A4TA 1W87A 3TSOA 2IYNA 2WF5A 4XB2A 3T3IA 1I2ZA 2HEGA 3TOXA 4YUXA 1HSOA 4HL6A 3VMMA 3LV8A 2FJPA 3DT9A 3K0AB 2OSBA 1FP4A 3R6TA 1U8XX 3TIIA 2PBLA 5FBWB 1SKUA 5EOVA 2AFIB 5CDUA 1WKVA 2O52A 2HHJA 4MUFA 2OCKA 3R7NA 3LHKA 4GP9A 3TAHA 4NYJR 2OBFA 1FDTA 3PT5A 4O1MA 4OA5A 2PGXA 3TIXB 4O2BB 2AC2A 3MLAA 3NZEA 4P31A 4F12A 2FYTA 3L8GA 4HFJA 1C9YA 3L1VA 4LDJA 4XB6B 4KLNA 1AMOA 1N9KA 4V3BA 2ZBQA 3MINA 5E4FA 7YASA 1PVOA 4RHYA 2C97A 3DYVA 3OLCX 3MSCA 4MEBA 1E3TA 3RC2A 4FM9A 1GQFA 1Z35A 2ZRIA 4M0LA 4QUHA 3BIWA 4P83A 1HKHA 1ONOA 2NNLD 4AY6A 3PL1A 4FEYA 2AR9A 5ADWA 4WFJA 2DBQA 4G36A 4W8HA 2GO1A 2I4LA 3SN6A 3QVOA 3T7DA 1SD1A 2HTEA 4X3CA 1SPBS 2Y1WA 4FBMA 2RB4A 4PFJA 3SY8A 1IATA 1USWA 1XAGA 2B2NA 3N2GB 1CZOA 2E4WA 4YV0A 5JSYA 5DM60 5TQ0B 1POWA 3G5AA 3ZE6A 4B4DA 3WIVA 2W6ZA 1RBYA 3VR2A 1WB4A 4XLLA 5KU1A 1M1NA 4KQHA 3V9PA 4XWYA 5G3YA 3P26A 1K7EB 3E9RA 2OZLB 4DFDA 1NUPA 1XRNA 2Q99A 3Q8MA 4WOPA 2W6ID 1EGHA 1YZKA 3LF2A 3DAFA 1EK1A 3ZZ1A 1OLSA 3MJFA 2ZRHA 1JDJA 3OOJA 1V16B 1B42A 1YH3A 1YVDA 3DTNA 4WINA 1B0AA 5TJHA 5JRDS 4CLOB 1JR6A 1UR5A 4KDEA 5ENVA 5TMBA 2EL9A 5JLJA 3E9ZA 1ZH8A 3NWJA 1XN4A 1A95A 1MC8A 1V0JA 1VMKA 2WIGA 2Z8YM 2C4KA 4EFDA 2E21A 3DWFA 4AJIA 3IVAA 4JP3A 4NFLA 3HJRA 4BV8A 4CKEA 3NKLA 3FB4A 3FDFA 5C7IO 4U9IS 3L9XA 2OL4A 2FKNA 1P3JA 3HFGA 1J8QA 3U49A 5HP4A 3IJ5A 5KTPA 1JALA 4GPIB 1NNSA 4R9NA 4X85A 4X92A 4YACA 1MCZA 1QIHA 2RIPA 5H5JA 4CEHB 5KNDH 3KKMA 4U2CA 3PNSA 1CUXA 3W3ZB 1NLYA 1OBVA 3PNLA 5IWCA 3R9XB 3LQKA 5HCNA 1A8UA 2QVLA 3V32A 3F71A 1CQIB 1XC7A 1Q74A 1TZBA 3G82C 4BVFA 5CDSA 3CHYA 2FEMA 1FA9A 3CZ9A 2I7CA 4DSUA 4ODIA 5TMPA 1S0UA 3P52A 2IYFA 3ER9A 3SQWA 4KJXA 1L7XA 4HAZA 3C5WP 1EPUA 2ZIXA 3C3PA 2XDQA 3IXLA 1ONNA 3PXUA 2YNMC 5A1JA 1W75A 4YJHA 3QW2A 2MWMA 5CVDA 1PNQA 4S05A 1C7RA 3A25A 4JOBA 2AEMA 4QTZA 2JFPA 3SKVA 5A6VA 3PJRA 4R0NA 4TTPA 2QTLA 3AMVA 1P6QA 1O97D 2C07A 2OV1A 3W3AD 3W7AA 6Q21A 1Z08A 1TTQB 3DM5A 4DG5A 1RHRA 5ILGA 3SHOA 5EZ5A 1BVHA 3I05A 1X1EA 2CDAA 1E4YA 1XTRA 2IP4A 2XEXA 4MUNA 4LE1A 1U8ZA 4V2IA 1K4YA 1OAOC 3LHDA 3TLXA 3RK4A 4IUDS 1DEAA 4JT4A 1H1DA 2GB4A 4M2LA 2UUPA 5CJJA 1Y6JA 2OZKA 4DBLE 1J6UA 1RDFA 3D5EA 1RIFA 3A4YA 4P5PA 4FUQA 1H8HD 1UJCA 3LYLA 3PL5A 1WXHA 5KYUA 3RVDA 5DDIP 5IEJA 1FCJA 1NMYA 3OZFA 5KQPA 3UPUA 4BO9A 1BE6A 3UG7A 1VKHA 3TIFA 1PX0A 3H86A 5KWSA 2EP7A 2UYQA 2VSNA 3I45A 3I2IA 4J0JA 3FMGA 4LHSA 3F6YA 1H94A 1QGDA 4GBED 1XV5A 4XWAA 4ENRA 5EWLA 4DLWA 1OAKA 2XDAA 3LX8A 5KMGA 3R20A 1E6EA 3DLTA 2O59A 5K20A 5JRJA 3A6ZA 4M0CA 2B6HA 3VJKA 4ER6A 4MQLA 1UBGA 3D3EA 4HQFA 4ZOCA 5IF9A 4AF7A 4CM8B 1BDMA 3B5IA 4ZZ1A 1NURA 2WSLA 5FV7A 5A2GA 4CM5A 3M6UA 1GUFA 3E3NA 4NDZA 4NU8X 3RFCA 2UUBB 2XQIA 4GG1A 3UW1A 1YB4A 2B8EA 4YPVA 3KKEA 5DX8A 4Q4AA 3L7BA 4XW2A 4CUZA 1N3BA 1U4OA 1CUUA 3K5IA 3UWMA 3PGA1 4HQOA 4DDTA 1EDZA 4OY3A 2X19A 4EPVA 1VMAA 5C1OA 3ZTTA 4OX9Y 4UOEA 3HB1A 1PFWA 3ZX4A 4F4CA 4MQ6A 4TKVB 1GGKA 3WYDA 3M1LA 3UWPA 2FMKA 4B3DA 4BU1A 4JH0A 2AN9A 2VNHA 5JCPA 4M87A 3L6BA 5C4GB 1ZSVA 2PVSA 1KEEA 4PZDA 3OOHA 2H4HA 4WGGA 4J0GA 2Z30A 2PH3A 3FTQA 1QMGA 4L5JA 3M6FA 2EF1A 4ZCSA 1JU3A 2JF0A 3PQ8A 4N7JA 2OHOA 4MGEA 2BKXA 4R9VA 2GFHA 4MUMA 4RCZA 1R4ZA 4TRRA 1WHTB 3SSNA 4Z7OB 3GP8A 4WERA 1N0WA 1GUYA 1GG5A 2XTNA 4BP9A 5BQOA 3LKVA 5JAOA 4MWDA 2XMCA 4RHTA 5AR1A 1ZK3A 1R5BA 2DE0X 2Z9CA 5HYVA 3RTEA 2Q6OA 2W2KB 4KWEA 4DDWA 2H9YA 4JI1B 4G25A 5IAEA 2VATA 2JI4A 2BMAA 4RADA 4HUJA 3BWXA 4I2VA 4YK7A 4GQAA 1I4LD 2B5VA 4XGKA 4KRFA 2XE8A 2PSDA 3IALA 1U3GA 4HT3B 1HDZA 3LFTA 1M8KA 4GPD1 4PICA 5BSTA 5EIBC 2YOHA 2UXBB 1QLJA 2BY4A 1SKQA 2IWHA 3CM0A 2X8LA 3U56A 3DDZX 2GF2A 3DUWA 3GYGA 2OBNA 3MGKA 4ENUA 5JR3A 3JTMA 4HDNB 4Q00A 2O3QA 2A94A 5EQJB 2P4SA 2ZBFA 1NPTO 3N5CA 3P96A 1UXGA 1JIJA 2Q62A 3TZQA 4BN0A 4NTZA 1N0VC 3W78A 1SIUA 2Y68A 3H8JA 3SX0A 2O5VA 4WLNA 2HKIA 2DKNA 3IA7A 2H5EA 4R1PA 3LUFA 4E1VA 5E9JA 3PC7A 2BHTA 2RCNA 3H5RA 1K7SN 1GFSA 1NBAA 3I6ZA 2PMEA 2IYSA 1Z2EA 4NNOA 4PCUA 1JHDA 3DG9A 1GZUA 4U00A 1XSEA 5JAHA 3GFTA 1GTG1 2P77A 4RS3A 4Q4HB 1AF4A 2NYRA 2WOJA 3AQ4A 3B85A 1IN7A 4JN6B 3S1LA 4WE3A 4RTNA 2GYWA 2ZIVB 4R2XA 1VSTA 2XD4A 4TMWA 4DZZA 3F90A 2J9YB 4LI3X 2BBOA 1A9ZA 5LBIA 2J6CA 1XNHA 2Q3BA 3AFOA 4PS0A 5LMUB 1OTHA 3OZRA 2GLUA 3QHQA 1LC0A 1KK1A 2BMFA 3IESA 1S8OA 1VDMA 4MVJA 1NJ8A 4OK6A 3SXPA 1ZA1A 2V54A 3SBXA 2FX2A 4EY7A 2H65A 1KQ3A 4OJYA 5JMTA 1FXWA 2RGNA 3SHTA 4TL6A 3DD1A 5C8XA 2PA3A 2ZB2A 2CFRA 4GE0A 5J4YA 4Y9DA 1UMKA 2V65A 3EDOA 3OIFA 1DAKA 2IYEA 2ZBRA 4FDUA 4X5OA 2PKRA 5IARA 4WLOA 2E6UX 1OU4A 1EFDN 1SXJD 4OF4A 3NTOA 2JEOA 1BMFA 1NATA 4WX2B 5LOVB 3ORFA 4H7JA 4V0SA 4UD2A 1CVRA 2C4HA 4C6SA 2Q3LA 2IBSA 2EFCB 4D82A 1E1QA 4X6YA 4JBXA 2J3DA 3T9BA 3KR9A 3KEGA 5JOQA 4ISCA 2XZDA 1JSZA 1UFOA 2GN6A 4LMBA 2AW3A 3IHWA 4TLCA 1T2VA 3AEQB 5LLDA 1SHKA 4XA8A 4XX0B 3ZEAA 2Q5CA 3R40A 1UF9A 4OG2A 2RI1A 4S1VA 2AJCA 1GDHA 1U2SA 1U90A 3GFFA 1DLJA 3RVPA 5LQUA 2CFOA 2NAFA 2XTJA 1L5SA 3H9BA 3ZBUA 1KJWA 2EXXA 5H16A 1LS6A 1SIWA 1NVWQ 3FNQA 4KI0A 4TXHA 1XNJA 3QKIA 3M5DA 4JL6A 2SKEA 3G0CA 3RU3A 1S3SA 3O6VA 1Y89A 4CLEA 1JEQB 3QMPA 2OCXA 3FSJX 1XELA 5DGXA 1JKJB 2DF8A 1WVMA 3IOCA 5T3UA 5J4LA 5LNK1 1M54A 2JCGA 4R8SA 3ZK8A 4B6RA 3TD2A 2WIKA 4DWJA 1BMDA 1TECE 3STYA 3M4ZA 16PKA 2FPOA 2VPXA 3KOMA 3RUEA 2PLFA 1WXGA 5DTJA 1ZS9A 4EW6A 4NCJA 2A9JA 3I83A 4DMFA 3SVLA 3EGXA 3ZHRA 5AW0A 3WMGA 5DTEA 3S3TA 1JZQA 4DW8A 1XEXB 1QO0D 1P9NA 1XLTA 2PKQP 5BV1A 1WBJB 2X3UA 4K03A 4OYRA 3AFHA 2PWZA 3KJIA 3T1OA 4QVKA 3SDSA 4E30A 2C31A 2VHQA 4KIGA 2WIDA 2AOTB 5ELXA 2LVBA 3FCXA 4FKBA 4ILKA 2XW6A 1GCOA 3MWLA 4B3FX 4QQRA 4HH0A 1M2OA 4RBNA 1TL7C 1NBOA 3RHZA 1P1JA 3U7IA 3EEFA 3WK6A 5IZ4A 1XXHE 4LHVA 4NOKA 3QXXA 5IK2A 4GLOA 2RSLA 4YRQA 2EX0A 1E3MA 1PZEA 1YACA 4UAJA 4LZLA 3ZBPA 5J1SB 1TU3A 1JSXA 1DO8A 1ZK1A 1KAMA 1J9EA 3WZLA 5I4CA 4K0KB 3HADA 2OCGA 4RM3A 3EVBA 1B0UA 4D5GA 3U16A 4KXQA 2HX1A 3WRYC 1R8YA 4EF6A 4PW0A 4HUQA 3Q98A 3WLOA 1IFXA 4F3KA 1WV1A 2VWPA 1RWNA 5FI5A 3CUWA 3TVTA 2X5XA 3OCUA 2AMYA 3G7SA 3C16C 2BEWA 3OZEA 3VM6A 4JSYA 3QPVA 5LB4A 2R60A 3ZDCA 4B3RB 3LHIA 3FYTA 3AY6A 1OKKA 1SRQA 3NH6A 3K4PA 3S1SA 2FW6A 4ZP1A 5HHTA 2IDKA 3B82A 4IIYA 1EE9A 2ZUDA 1B8VA 4S0ZA 2QYHA 4U2KA 1NJFA 3TRIA 3QLVA 2IY7A 4RSHA 3N0XA 1RC0A 4JNKA 2GBGA 4DLPA 5CX4A 4YIKA 2E4XA 3JQQA 2PNJA 5T6MA 1YB7A 4UW9A 3UAWA 3V1YA 3ZJYA 4F11A 4YRAA 4MA0A 1OUMA 3T1TA 1W85B 2J4CA 2PFGA 3ZIAD 2ZSDA 1O6ZA 1CY7A 5F73A 4N48A 4TMKA 3W8DA 1VYVA 3E81A 3OAAD 4QJ4A 3RLIA 1R37A 4EW1A 1SCAA 1MB2A 2M1ZA 2XNHA 1SKBA 5A5VA 3TTTA 4K6OA 3C14C 2UZ1B 1CY4A 3KJEA 3UJ7A 1AZSC 2XRMA 2VEOA 3BMQA 1LI5A 1FS5A 4QTXA 3WB0A 3OTWA 3A4NA 2GA8A 3UOAB 1AZWA 1E2QA 3RDPA 3UUFA 1SD5A 1YE3A 3VYUB 2ZP1A 1B8PA 2D4HA 1JVNA 3ZG6A 3ZW7A 4EO4A 3QV1A 1H05A 2CJWA 3IMFA 1LV7A 4G8JA 4EA9A 5JH7F 1OFUX 3TD6A 2HT6A 3C3EA 4XWTA 2PTGA 5JO0A 1AMUA 1ND6A 3LFHA 2XBMA 1NONA 3OG9A 1R00A 3P2JA 3L8DA 1UAAA 2ZLBA 2M2IA 2BGIA 2C1XA 2REQB 3G2KA 3JZAA 1WZEA 3O4IA 5CB4A 5HBRA 4Q4JB 2A4MA 3MYYA 5TPZA 2FQXA 2JJ2A 4LJYA 2PSEA 2N3ZA 1L5YA 2ODBA 2FWAA 3GRCA 1OCEA 4US0R 3HK2A 4AI6A 4G0OA 2GS9A 4WK6A 5LU8A 5I7SA 4F6RA 2FZKA 1IK4A 3PDWA 3ROEA 3OF2A 2PS3A 8MHTA 1BQ4A 4X95A 2B1RA 3NHLA 1ZD8A 3JQAB 4OTZA 4RCYA 1YRYE 1V7QA 3LZ6A 1VG8A 3VH4A 4DCPA 2HF8A 3WS7A 4ZEWA 3GI1A 2L82A 4FKZA 3LF1A 2ZIZA 3PJEA 4GBGA 1EGMB 3QF4B 3Q0EA 4KODA 2NZ2A 2NSHA 2HK8A 1GYQA 1WY7A 5B6IA 4TZTA 3W5VA 5JZSA 2BTOA 1EAMA 4HB4A 2EG5A 5I8ZA 2HMWA 5CNIA 5DT9A 4YMHA 3RIMA 1EVYA 2GJKA 5F7OA 4B6FA 5CEEA 4URYR 1NXPA 1FXWF 5AQ1A 4XCQA 1RRCA 1XLWA 1TFUA 4CQLB 4MZDA 4G07A 5TX7A 4LFBB 2JGJA 3CEPB 3QOWA 1U81A 1X7XA 4LDNA 3PEEA 4PC6A 5CCDA 1OF1A 1IPHA 1EQUA 3FZGA 3TEFA 4HTAA 3UH0A 4CCSA 4LSMA 1NVEA 3PXCX 1OAOA 4TVSA 2E2WA 4DDVA 4F91B 3CB2A 3KQWA 3TQCA 4HCJA 1VE3A 4GMHA 4RE6A 2ODQA 1JMYA 1HT2E 3GLVA 1DLIA 1K0FA 1E3IA 5CLHA 3RAEC 1FUKA 1GA1A 5KC9A 3FHCB 2WOOA 1QTQA 3ONWA 5LDHA 4EJSC 2R6JA 3GFPA 1WP9A 3WKDA 1B8NA 2Q45A 1TAUA 2QJFA 3LBYA 2VLIA 2RBKA 5H68A 3QE0A 3PFHA 4QWMA 4G0QA 5I7VA 1AKYA 3V1TC 1WCYA 2GZMA 4UE2A 5FOXA 5IHXA 1M6YA 4LX8A 1W46A 5FO1A 4HY3A 4LQDA 1FDRA 1ACMA 2R1TA 1XBTA 2I99A 3BH7A 1WKCA 4QG7A 3V2UA 3VOAA 3DT8A 1NVAA 1T2DA 4L51A 3BMCB 4KAAA 2X8BA 1G16A 4YR7A 1QB7A 3NS7A 3F5DA 4LWQA 2R65A 1DAFA 4MWEA 4QLBA 2BI4A 2ZVDA 2UVPA 2JIQA 1JAYA 2JIDA 3RT7A 2FSGA 2IVZA 2ZULA 4NCIA 4LKOA 2GUWA 1M75A 5H4HA 2HAEA 4A26A 4KXNA 5DLPA 1IBKB 4BIIA 3L0IB 1VLLA 1UWVA 2E1RA 2YS7A 2W22A 4US2R 5EWJB 3O3MB 4G4GA 3AIOA 3RKSA 1OYVA 3ZH9B 2FFQA 1KETA 2EEZA 2OCIA 1YNSA 4QVIA 2XGJA 1C3VA 2O2DA 1XQXA 3CLKA 1TTPB 4XVCA 4AG6A 3KKKA 1TGVA 5F2KA 4DLSA 1JV2B 3WRYA 2EBHX 2Q9CA 1DWQA 1YKSA 2GYVA 3AH8A 2CHVA 4RE5A 2XGOA 1SELA 4TXJA 4X44A 4D02A 3PDIB 1UMBA 1XN1A 1E9VA 4FMBB 4JQSA 3WB2A 5LQKA 2IH4A 1FQWA 2VDNB 4N9QA 3K3PA 1VPLA 1WAMA 4P3PA 4TV9A 3OQMA 3IYLW 4X64B 2ZXEA 2GERA 3W2IA 1XZJA 3Q9LA 2D5AA 2P9BA 1OZAA 2XWPA 1GAJA 1XTSA 1V1RB 2ID9A 3BXEA 3GLIA 3DYIA 2BFAA 2NU9A 3KG2A 2Z83A 3I34X 1DADA 1KJYA 2YICA 4R8KA 1CQWA 2BMJA 5AVJA 2DHQA 2O1XA 1H1LA 2JFBA 4IHQA 3GLFE 3D6UA 1VRVA 2YRWA 3QLVC 3OZIA 4INOA 1XJ5A 3IMEA 5AW7A 5K0LA 1WD7A 3LT1A 1NL3A 4KGXA 1K27A 4B7UA 4LYAA 4DUZB 1Q20A 2QG6A 3Q10A 2IU0A 2PAFA 1Z9BA 3ADOA 5ERXA 5G0TA 5H80A 5K99A 4QRDA 4RUKA 1VYTA 3FGZA 2F67A 5CT4A 1J5PA 1MH1A 3WK9A 1ZX1A 2HK9A 4G5YA 4QPJC 4DSTA 1F7VA 1ZITA 4QFDA 2WUGA 2I80A 2Y99A 3NHBA 2DXIA 2HR1A 2BTEA 3PPYA 4DLRA 1SUPA 1U2ZA 2F43A 4KPFC 2PJUA 2P5YA 4NFHA 4BQOA 3AVPA 4MRSA 4U7FA 5JAIA 3LOQA 5C46F 1GD1O 1Q5PA 2FUEA 3V55A 4RTOA 1Y7LA 2JB9A 2XMBA 2GHIA 3RT1A 4BP3A 1SHUX 1H93A 2ZJYA 3TX6A 4FHGA 2Q2NA 3P27A 2BI8A 4D99A 5CM9C 1TM2A 3OHSX 1MA0A 4JUFA 4EB6A 1V43A 4YHHB 2VHYA 3GARA 3PUIA 5FL3A 3IMGA 3HXTA 4LDQA 3EPLA 1GRVA 3FWNA 3IQZA 3HLTA 2W2VA 3RUDA 5KYNA 4DXAA 4FD2A 1VRWA 1N2JA 3C48A 1SC3A 1M2VA 1TM7E 2QMQA 4DMKA 3DSRA 3Q8LA 1NW7A 1QFMA 2FMHA 2FPIB 1C3LA 2RGEA 3SJAA 4JC5A 1DAIA 1YF3A 2AZ4A 4Q16A 4YDSA 3QYJA 2HCBA 3D81A 1FOEB 4PPGA 1IUKA 2I2AA 3KALA 1IOZA 2YXPX 4LGVA 3ED5A 1G9XA 5KJEA 2QD4A 3M70A 1DO2A 2O5RA 3NANA 1ITZA 4GIBA 3R3ZA 1C7IA 1HL3A 2BMWA 2J7PA 4AF6A 1QTNA 1JLSA 3EVTA 2XVAA 3WGIA 4QQFA 5E2BA 2HI0A 2R8EA 1V4BA 2KM1A 3C5CA 4J03A 4PYNA 2YN2A 4Q9AA 1ZI8A 2F90A 5AKIA 5J2TF 3RYFA 1JHVA 1V5IA 2EZ9A 4C21A 5C32A 3D64A 1WQ3A 5CW1A 5AI6A 4KZKA 5HA5A 1TQ6A 4URXR 2W83A 2WIBA 4LZAA 3GLHA 4EPWA 1NZDA 2C84A 4O25A 3GCXA 1OXMA 4I3FA 4DWOA 3DKIA 3D2LA 2YHUA 3H0EA 1RSZA 3OM0A 3PUHA 1O95C 5FNVF 3RS2A 1W44A 3TNDA 5JEDA 1GTSA 3MNFA 1H85A 1OJLA 4CQMD 3IB3A 4L50A 4MRAA 1J8YF 4HLDA 3U3XA 1Z68A 2ARKA 2C1ZA 4BZZA 4RL4A 2B1JA 5F98A 5ALFA 1IQUA 4MVJM 2FJUA 1TO1E 2UYGA 4RDCA 3KYDB 4G5RA 2JK0A 1GR1A 1RXWA 3VR5D 1PDVA 4N65A 4I4TB 4KK4A 4QGFA 4BMDA 3KJZA 1UJ6A 2AI1A 4YJFA 4YROA 4PZCA 4MI9A 3I04A 3TZ6A 3AOGA 4MV1A 2IHTA 4PEVA 5IVPA 2P11A 3CUYA 3EOBI 4KOAA 3CVXA 2ZYTX 3UWKA 2YTZA 4B31A 3ROXA 1ML3A 4G0YA 2XQGA 4NC9A 3SJBA 1K89A 1Y5MA 1DOAA 1FE8A 2QG9A 1Z82A 1CSEE 2P41A 3Q2IA 1VE6A 1KAGA 4HGYA 1GLGA 2WT4A 2C2YA 4Q9DA 3LQQA 1KTVA 2NUTA 4Q37A 1A9PA 2AS0A 4OXIA 1NMEA 1IJFA 3IAXA 4Q9JA 5IS2A 2F4NA 3MBIA 3EZYA 4YECA 4QEKA 4CLDA 4NHOA 4II7A 1EWTA 3NAZA 2JARA 5EIOA 1E5QA 1Z07A 2NU7B 1JXOA 5ED0A 4EUNA 2DCMA 1J0DA 2JIPA 3DE4X 3M7IA 2QGZA 3PUJA 5L7TA 4HBGA 4MWGA 2JAHA 3DB2A 1P1IA 4RDIA 1CRZA 1TDJA 3VPCA 4H1UA 2PGAA 4ZYXA 3U6BA 1UANA 1Z0AA 4RIFA 5T4BA 5KYYA 4KHZA 2YW2A 2ZJOA 1VGQA 1MPTA 1U8TA 4RJIA 4DCUA 3CRQA 1DXOA 4ROSA 2A78A 3H5LA 4EYSA 4M86A 1XA0A 3CLVA 5FEMA 2VNJA 4R2LA 5G4KA 5L3ZA 3QVJA 5ALMA 1H5UA 3W2TA 3MGAA 1Q3TA 4B9EA 4P0QB 5IBQA 3KUXA 2WTXA 1LLUA 1UPUA 2XKAA 4BLQA 4D2IA 2OZPA 3ILHA 4LE2A 4ZD6A 1QRUA 1ELOA 4XCVA 3J7AC 3P0EA 2NP7A 1YQGA 2K2WA 3LQFA 5SV2A 2JHAA 1MLDA 2IJGX 5I7FA 4MW4A 2WFMA 5K51A 3FR8A 2DFDA 2C95A 4LBWA 4EKGA 4IJQA 5K3CA 1KFCB 5AKZA 1U0NA 1ATIA 5CK4A 4IDEA 3G1UA 4AN0A 3TW8A 5K8LA 4L4XA 3HSKA 4ZQHA 5A5FA 3NHAA 4L0QA 3TZCA 4AJNA 4B8YA 4EHFA 3HHPA 1YIOA 1XAHA 3UUWA 1OH5A 5HOQA 3FRIA 1TKCA 3PHHA 3CLTD 5EZYB 2H16A 3BD6A 3NIGB 4B44A 3IDSA 1RYFA 5FBZA 1K92A 1S3IA 1MQ8B 4D9GA 4GP7A 5KHLB 1Z75A 2V59A 4RLFA 4JXJA 2OGSA 2XYVA 3PTLA 4PHFA 1FLVA 3DKKA 4Y2HA 4N0QA 4ZU6X 1O89A 4Y7CA 2JDIA 1EUCA 4PHTA 1TTTA 3NOOA 1LI4A 1T2CA 2JANA 4WLUA 1OX6A 4PX2A 4XI9A 5ICEA 1SCNE 2IHUA 4AZSA 4P36A 2DZDA 1XB2A 1XZIA 3D43A 1KH1A 4J3JA 3QLJA 1U8AA 1H22A 2VLBA 2FKAA 3AU9A 3OU2A 1RI4A 3JWHA 4TYMA 5BW5A 1F2UB 5AM1A 1WUTA 1RKUA 2MSKA 4R7GA 2YVLA 3JVEA 1HEUA 1I0ZA 1T1JA 3GFRA 2RG7A 3QUSA 4CDGA 2Y4NA 4QECA 4TWAA 4Y1RA 2VG8A 2BFPA 5KAPA 5C5IA 3JZDA 4RTRA 2HM7A 2OEPA 5DGTA 3ELDA 3MAAC 1XP5A 4ZRMA 2WYHA 3KU4A 4PO3X 3JS5A 2OXEA 4I14A 4AS3A 4Q4HA 4JA0A 5A62A 3OLQA 2FDCA 4NARA 3H75A 3HY4A 2RIRA 1EJ0A 4MCHA 3Q8XB 3ORRA 2RE8A 4KSCA 5H3HA 2OHFA 2BKLA 3FSRA 5KKNB 4IIJB 3I0NA 5TXGA 1ZP6A 2F1JA 2J5XA 2QLTA 4M1YA 3K1YA 4F1JA 2RJ3A 5F2NA 4EF5A 3BF8A 2OLJA 1EQ2A 3HN6A 2PZ8A 3LBHA 1HDRA 5AOVA 3MB8A 2D5LA 1QB8A 1B15A 3WQBA 1TZ2A 3VHLB 2IZ1A 1G1AA 1MDBA 3B6MA 3V46A 2A0UA 3PHGA 5DLDA 4JJZA 2Y2VA 3IQHX 5BQFA 2CUNA 1F06A 3ZE7A 1I6WA 1SUSA 3SXJA 3WQSB 4EKYA 1EB9A 1ZH0A 4BKMA 3R7WB 5AVXA 1RQXA 2H8KA 4EGFA 1DAGA 1HRKA 4EUEA 4ZICA 5B1IA 1NG9A 1SC9A 4GRDA 1SQFA 2PGOA 3IAHA 5COAA 3RIEA 4WBSA 5JNUA 3F5QA 2BHNA 4NCAA 3O9ZA 4A6DA 1ES9A 2OV6A 2YV5A 3IR7A 1CUJA 4JITA 3FUCA 4WFKA 1ZH4A 4WN9B 3MOGA 3T7JA 3MD9A 4UARA 1WW8A 1WR8A 4HWRA 1E2PA 1K88A 3WG9A 1Y6QA 3GHHA 4M1TA 3UXYA 3UWDA 3H9UA 4MJXA 1P1HA 1R6VA 2QGNA 3V4SA 3ZHYA 1W7AA 2PVCA 4MAMA 3GRKA 3ADKA 5JQWA 1E99A 1VB5A 4IH1A 4M1QA 3QSYA 5JIBA 1XDDA 2R4UA 3KYBA 1U5BA 4UASA 2R0QC 1JHAA 2V6IA 2ZRLA 3VDMA 5CU7A 3DMTC 3IURA 4WCFC 2GGSA 2IUFA 1I94B 1N2CE 2Y9MB 3HWX1 3KQQA 1U8FO 4G56A 3S2GA 1WSAA 5E2AA 4IJWA 4MUXA 1C3EA 4BCDA 5JMWA 1JDBC 5FUMA 1BCSB 4DA9A 5LQDA 2HXGA 2FP4B 3IDZA 4QD3A 1Z5VA 1GFZA 1F14A 2MYNA 4OLFA 4PTLA 4YQZA 2X5OA 5GONB 5ARDA 1S9DA 5L4SA 1RI1A 4YT4A 3ESQA 4ZEXA 1IZ0A 4QBFA 4ZVNA 1VLQA 2IVFA 2P0EA 5IJ0A 2QY6A 3NATA 4KX3A 3ST7A 5DM0A 1U99A 1EA5A 1OREA 1N5OX 3WFJA 2CCKA 3QI7A 4BRUA 1J8FA 3WGJA 3FA2A 5D1NA 3RYHA 2VNAA 3JXEA 3AC0A 5EERA 5B1SA 3QVUA 3BXHA 4QIHA 3O3NB 2H51A 1CIPA 5U1PA 4GE3A 3SZ3A 2IX3A 1Z3IX 1BFKA 5JMOA 1P4SA 3V7UA 1W4CA 4KLAA 1T9GR 3OM8A 4HNRA 1QP8A 5CYOA 1H0KA 5I5EA 1I9CA 2ZJ7A 5ARCA 4EHNA 4L6AA 4MX8A 2I1VB 4GC5A 3PEVA 2PRYA 2DHDA 1MB9A 2WVGA 1SCDA 3GN1A 3I62A 1X9HA 2XOXA 3AHIA 4HPJB 2SBTA 3ADPA 2AQIA 3KOXA 2E87A 2Q5HA 1IY9A 3I2KA 1JFFA 1NVGA 1PJZA 1SXJE 1SUCA 1WEKA 3JQ7B 4F9EA 3IPRA 3T3OA 1GDTA 2ZPAA 4X1OA 1ZW6A 1H69A 3HKDA 1FTYA 2JD2A 4V0ME 1DE0A 5K0EA 1MTZA 1RD4A 3IAUA 4IMIB 1OIVA 1OZGA 2G9QA 4KDFA 2VDUE 4L7VA 3PA8A 1PEYA 1QKIA 2CLMB 3OPQA 1A77A 3PR2B 4GWKA 1SQ0A 4QOHA 4YBRA 5F12A 5HQ3B 4UUNA 1YNOA 5M34A 5C1IA 1GWNA 2OV2A 4RY8A 4E15A 1U2DA 1AB5A 2Q0QA 3TNLA 1E0SA 2CF5A 1KQOA 3Q87B 2RGDA 3QMWA 3U9TA 3HYTA 4EABA 3ONFA 2YNMD 4HAUA 1CJCA 5FWAA 4D8UA 5ARBA 4JI8B 3KUUA 2UAGA 5BNZA 2O8CA 2BKVA 4OHRA 4CU2A 3DOIA 1HZZA 5AW2A 3AHDA 3F73A 3E5NA 4BO5A 5EQTA 2EHJA 2QEQA 1RRFA 5BYBA 1O95D 4RETA 5TGDA 3A6DA 2FUG6 4FDLA 4DLNA 4S1PA 5HWSA 3FUXA 3KHTA 1RYYA 4N49A 4R0MA 3VU9B 3P8ZA 4RIGA 4MZXA 1KNXA 4QUKA 2EHDA 1GKKA 2F7SA 3GH3A 1NLUA 2HY7A 3MWKA 4KXUA 4V0MA 4FMPA 4B6GA 1DQYA 1YJCA 4P92A 1J42A 4ETWA 4QICA 2ZWVA 4OSOA 4B4VA 1Z7EA 2VZEA 3QRWA 3WL6A 2XUAA 1EWYA 4Q01A 4AQ7A 2ZWPA 1Z7GA 4O4IF 4RPLA 3P1JA 1QR2A 3CLSD 2EEPA 3LCVB 3NHZA 4RXMA 1C7EA 2E4VA 4E46A 2Q7DA 3R5HA 4L0CA 2O1WA 1E9EA 3CB4A 1QGED 1BOFA 4BO7A 5E9QA 3ICVA 1FFCA 3E5RA 3HKEA 1XD8A 3JRXA 1GNPA 4ESEA 1ISRA 5JROA 4K6CA 4ZQBA 2K6GA 1XCBA 1ZKMA 2A14A 3NHFA 4G0VA 2NQTA 2Z08A 2QOEA 2B8JA 3T5AA 3DVRX 2QRZA 4EG0A 3GZNB 4RORA 2I2CA 4BJ1A 1PSDA 3MJSA 2VJMA 1LZKA 4H0FA 2IW3A 4EHAA 4GL4A 4QHTA 3SLRA 2FMTA 3G13A 2VKTA 5IZCA 4XUGB 3CKMA 5IEBA 2AKAB 3JATB 4JIMA 3Q4GA 2WYWA 1WVGA 2NZXA 4MWBA 1A8PA 5I9IA 3DBLB 1WMBA 1SKMA 1W9MA 3W5SA 1T3GA 2I91A 5FBLB 2EWMA 4Q3EA 1J8DA 1P7ZA 2ZIAA 2GRAA 3OUTA 4TX1A 2DR3A 2HRRA 3T1YB 5CB6A 4CM7A 4TLAA 3T15A 4D4KA 2HIAA 1G21E 3DOUA 2YV3A 3NTXA 1MJFA 1PLKA 4IUYA 3H5WA 5FTNA 1WPRA 3EYAA 4H08A 2IEYA 1K5GA 3ROPA 1XZEA 3DCIA 4OI0A 4URHA 1Z13A 4MQFA 2WAMA 4GDMA 4V1CI 2CFTA 2IEAA 5BT8A 1NP6A 1ZJ4A 5DBHX 5F76A 1E5LA 5IJAA 3K9FC 3U60B 4LF6B 1WMEA 1A9YA 1EEHA 2VP3A 4GZ3A 2PFKA 1SBQA 3PRJA 1CQXA 2R8RA 2DY0A 3K09C 3BHNA 4H4DA 1A2KC 2J3HA 2Q50A 4TQ9A 1KYZA 1TYDE 5DZSA 4EHHA 1R9GA 1EUDA 5F9FA 4XVQA 1RYDA 4CKBA 2C77A 1HE2A 3EC2A 3BE4A 4QRHA 1AGPA 1ANKA 3G2NA 3LBAA 3DL0A 1FQJA 1NPYA 1ZK4A 4MYRA 4PX3A 1WXIA 5BNFA 1IHXA 3OFND 4XJSA 3I9JA 4E2XA 3WMXA 2V3VA 1LBSA 3DZBA 4LRUA 2DSTA 1T34A 3EGEA 3IMCA 5BUQA 2HSGA 2X0IA 4CETA 2OFXA 1U7DA 3TOSA 3QU5A 3S5UA 1CUZA 2XA2A 1HGXA 1QH1B 1VP3A 1P2DA 2RH8A 1E9RA 1UWCA 2I6TA 2M1XA 2XBLA 1VE7A 2AMLA 5LBTA 3BVPA 1JTFA 3WTCA 4QXAA 1JQBA 3FHOA 2EP5A 1QH8A 1QHHB 2V7PA 4X8LA 3CRMA 2HO5A 4FZJA 4EHLA 1CHNA 2FU5C 2QK4A 4FEEA 1PL7A 4R01A 2ZQ5A 4J49A 5CVCA 4UZSA 1VRCA 2QRPA 3EEBA 3HJHA 5F1YA 4D9JA 2O0JA 2HCTA 4LZZA 3O4VA 4KZPA 3OCWA 4KV9A 4JLDA 4MGKR 3N3BC 1H2RS 1KARA 2FRDC 2XUQA 2FR8A 1IN8A 4AK9A 1NP3A 3A1VA 3VHRA 1ACJA 2QTZA 1UPXA 4Z9XA 4TT8A 1RE0A 3A6GA 5TPWB 1MTOA 4F8YA 2ZUCA 3SF8A 2ZVJA 4K9LA 5FPHA 2FP3A 1DSSG 3HZRA 1JQ5A 3PICA 5DLQC 3TD9A 5AKHA 4L8GA 3CSSA 1ZXXA 1LRLA 2V7VA 3W1WA 3L04A 3FJ1A 4O3MA 1PYDA 3NJ4A 2I34A 3CJRA 4F2PA 2G04A 4RA6A 1N5MA 4ZAZA 5TB5A 3WXMA 1OASA 5IH3A 5K6RA 1W88B 3W3AH 4J3NA 1FNDA 4LJAA 4PAMA 4UFNA 1EXNA 4MQEB 3FTEA 1Y6GA 2R3SA 5IJWA 4LFCB 3OBIA 3ROKA 3WDSA 1E3WA 1KHTA 3TFWA 2C98A 3HB4X 2WT9A 4L08A 1SPXA 3V4VB 2QZPA 3ZNOA 1NRIA 1V25A 2XRYA 3ZXXA 2GBIA 4L2IA 4OQEA 3NHWA 1GL9B 2RGWA 3LPMA 1PL8A 2PKWA 2E6KA 4R3WA 4YV7A 3QFHA 1QF7A 1Q11A 1QPGA 1YB1A 1EMDA 2IIQA 4KE6A 1JR3D 4HO1X 3ZHCA 4EAQA 3AM4A 3BSFA 3GLIB 1AN0A 1L8AA 1W5AA 3PCTA 5JAQA 5KYWA 5L6LB 1KZHA 1CLUA 3C3BA 4FMCB 2JBAA 1JQEA 4P0TA 2ILTA 2WVAA 1ZQ1A 1WIWA 2A5DA 3GLUA 4P7GA 3KSMA 3OE1A 1KJ8A 4ZIRA 3ETHA 1SA0B 4KMOA 4OJQA 3BT7A 3BG5A 2QF7A 1XD9A 4MI6A 1YZTA 1LF5A 4TYNA 1CKEA 1W4AA 3TE7A 2I2WA 2X1MA 4RF2A 5AKGA 3RARA 3TQIA 4F8JA 4B79A 3N2NA 1A9OA 4GOLD 4OBBA 3LGXA 1P4HA 5G02A 3B52X 2ISCA 3Q88A 3ZHBA 3MN1A 2QBYA 4P80A 4KXFB 2X14A 3JQCA 1OHHD 4NCNA 4YJDA 4B2PA 3VJMA 4LAFA 5BV8A 1W8DA 5BURA 3IKTA 2WU8A 1MB0A 1T5OA 1OLSB 4IEIA 4P6VF 4RZ2A 4XYEA 1GPKA 4A16A 3F46A 2QPAA 3AL3A 4QAQA 1POXA 3RFTA 3DDNA 2PX8A 3BCHA 4ZGBA 5KX5F 2OOKA 4MAFA 1ZJJA 5AM3A 1WDMA 3ZTYA 3GT7A 4KX5A 2VUTA 2VP4A 1NC1A 1DMRA 1ZMTA 3DEAA 4QYIA 2VJDA 4V24A 3X2EA 5SY6A 2P69A 1IPFA 3PWTA 2SCUB 3IT0A 4H31A 2JK1A 4RZ3A 3RHSA 3WJ2A 3M49A 2B2CA 4A4DA 4BEWA 2PRIA 4CIBA 4HRVA 2CDCA 4M98A 3R0JA 4REOA 4YBZA 4L5YA 1EWKA 3M5PA 4J90A 4HDOB 3WYFA 3AEZA 4FFBB 2Z57A 2JLZA 3AETB 4GSKA 5HUHA 2H7YA 4CEHA 4MQUA 4IJ5A 3V7NA 4UQOA 3JW8A 2IP2A 5K0BA 2YQ5A 1X7GA 4V3CA 3TW0A 5H59A 4MR7B 3H5OA 5AKXA 4EKEA 1CUSA 2BMVA 2JAXA