1MUPA

Pheromone binding to two rodent urinary proteins revealed by x-ray crystallography
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
157
structure length
157
Chain Sequence
EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR URINARY PROTEIN
publication title Pheromone binding to two rodent urinary proteins revealed by X-ray crystallography.
pubmed doi rcsb
source organism Mus musculus
molecule tags Pheromone-binding
total genus 38
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 1992-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1mupA00
1QWDA 2HLVA 1EPBA 2OZQA 4I3DA 3HK1A 1KT5A 4ODDA 2KTDA 2RD7C 4O9SA 2WR6A 4QZTA 1AB0A 2WEXA 3D95A 1BM5A 1GKAA 1T8VA 3FR2A 5B29A 3D96A 3BX7A 1TVQA 1ERXA 1FENA 3CBSA 4ORUA 3NX2A 1D2UA 1I05A 2X45A 2FRSA 5KHPA 3PH6A 4BVMA 1OEKA 1E5PA 4XMGA 3WBGA 4ARHA 3EBKA 1DFVA 2KT4B 2QM9A 3ZUOA 1HBQA 3STMX 2LKKA 1PEEA 1B4MA 2AT6X 2WQAE 5IO7A 4ALOA 4AZRA 2W2FA 5F58A 5IO5A 1QQSA 3FR5A 5EEDA 5LJDA 1BSQA 2JN3A 1HBPA 5IO6A 2L9CA 4HPAA 3FMZA 4OMXA 4AZQA 4ZHCA 5EEEA 1EIIA 4QGWA 4MVLA 3P6CA 2R74A 1NP1A 2ANSA 1NP4A 1KZXA 3B2IA 1GT1A 4M7MA 5HTEA 3PEDA 4YKOA 2OVEA 1ERBA 4EXZA 4QAEA 1LF7A 5FAZA 4AYHA 4QGVA 1HN2A 3ELZA 4YGZA 2DM5A 1YIVA 3T1DA 2OFMX 1JZUA 3FR4A 3B2KA 5HAEA 3FW4A 2ASNX 3FA8A 1TXLA 5D47A 5JR8A 4ES7A 4AZMA 3KFGA 4QYPA 1LPJA 1JV4A 2FWVA 1GT3A 4D6BA 3L4RA 1SXUA 4DQ4A 5HWZA 4NNTA 1HQPA 3OJYC 1G7NA 2JU7A 2X46A 5BVSA 1OPBA 2G78A 5HBSA 1D3SA 4TQ2A 2A13A 2JU8A 5B27A 1ZNGA 5LJGA 4TJZA 1HMSA 2MM3A 3CMPA 4GRJA 5HZQA 4YBPA 1GGLA 4AZPA 1JYJA 3NQ9A 1GX9A 3NP1A 3FEPA 4MVIA 1QY1A 3WJGA 1TW4A 1OBQA 1KT4A 1LIEA 2R56A 2AT0X 2QO5A 2LB6A 3HWGA 2YG2A 5HCCC 2XKLA 1FELA 1CBSA 2HNXA 4IB6A 2WQ9A 1G85A 1FE3A 4ZJ0A 1OEEA 4YCEA 3Q6LA 1BBPA 4M6SA 1ZNDA 1AQBA 3NADA 4I9SA 5EZ2A 1NGLA 5LKFA 4HPBA 1RLBE 3FW5A 4N7DA 3I17A 4OS0A 2R73A 3NQ3A 4UU3A 4AW8A 2NP1A 2IFBA 5HA0A 4A8ZA 3AKMA 2AL0X 5F1EA 5FENA 1IKJA 3TGBA 2JOZA 3RSWA 2L68A 1Z24A 2A0AA 5EDBA 4OS8A 4CK4A 2LBAA 2QO6A 3QKGA 4YMYA 3BDRA 1BLRA 2P8GA 3P6GA 2AT3X 1SXWA 2GC9A 5L8IA 1U17A 1VYFA 5H9NA 2AT8X 1YUPA 3O22A 4LKTA 3RZYA 3BU1A 3BS2A 1GXAA 2CM4A 1BRQA 1T68X 4YGGA 3APXA 1BRPA 1X8NA 1QFVA 1TOUA 2PY1A 4HPCA 2CZTA 4YFQA 4ZHGA 4N7CA 1A18A 2CBRA 2POAA 5H9LA 2AKQA 5AQ6A 3APUA 4GETA 5F6BA 1FEMA 3BSZE 5DG4A 2W2BA 2RCQA 1GKAB 1LICA 2F73A 1YP6A 3VG4A 4ZGUA 2RA6A 5FFHA 1OBUA 3HWFA 2A2UA 3P6EA 2WUTA 4YFPA 1JBHA 5DPQA 4TKJA 5H8TA 4UU2A 1I4UA 1YP7A 5CE4A 1KZWA 5L8OA 4TKHA 2G7BA 1IFBA 3MVFA 2E4JA 4NYQA 4KIIA 4IMOA 1B8EA 3GAQA 4IB9A 2NNQA 2WWPA 3TF6A 2NNDA 3EM0A 3VG6A 3WVMA 1QABE 5K06A 2FS6A 3BRNA 2ACOA 5D48A 4ZR2A 2Q4NA 1N0SA 1YWCA 4YKMA 3CBCA 1XKIA 2QO4A 3WJBA 1IIUA 3U9PC 1O8VA 5LJEA 3NPOA 1U18A 1KT6A 3PPTA 4IAWA 5BVTA 3APVA 3C78X 1AVGI 1TOWA 4QGXA 3CWKA 3FA9A 4I3BA 3NR3A 4ZHFA 1ICNA 1HMTA 2FR3A 4ZH9A 4NP1A 1X8OA 2Q2PA 4YGHA 4NYRA 1PBOA 1LKEA 5HA1A 2Q39A 4RUUA 1CJ5A 4IAXA 1E00A 4NLJA 4GKCA 1CBIA 5L8NA 2WSJA 1BWYA 4QYNA 2CM9A 3G7XA 1FDQA 3UEXA 4WFUA 1SY2A 1ZNEA 2AMMX 4I3CA 1A2DA 4GH7A 1SY1A 3HWEA 1X8PA 3FEKA 4ORYA 1ZNKA 3B2JA 1AELA 4ALBA 1ZNLA 5H9KA 5LJHA 1GT5A 3VG5A 4EEJA 2GTFX 2NNEA 2GJ5A 1PM1X 2MO5A 3F8AA 3P6DA 3CQRA 4XMCA 3WJCA 2N93A 1LIDA 3FA6A 5EDCA 4WFVA 1LFOA 4ZHHA 2HYSA 5BVQA 5LKEA 5D4AA 1OPAA 1QFTA 4MVKA 3VG7A 3IA8A 4NNSA 1KT7A 5KICA 3U0DA 3P6FA 1SXXA 3JS1A 4PSQA 1U0XA 3NX1A 1MVGA 4ORXA 1ZNHA 5D8JA 4EDEA 3KZAA 4I9RA 3FIQA 3PP6A 2WEWA 5H9AA 4XMHA 3U03A 4RUNA 4ORSA 1VYGA 2FT9A 3EYCA 4WBKA 4IMNA 3EMMA 3KFHA 1ADLA 4YFRA 1KXOA 1L6MA 2L5PA 2FS7A 1GX8A 1IFCA 4TNNA 4Y0SA 1MDCA 4K19A 3B2HA 4TKBA 3JSQA 3ZQ3A 5KIDA 1DF3A 3PH5A 5HZ5A 2AT5X 1BSOA 4QZUA 2LFOA 5LJKA 3PECA 1CBQA 1BSYA 1R0UA 4BQUA 5HTDA 4DQ3A 1IW2A 1DZJA 5HCEC 4ZHDA 1DZMA 2MJIA 3STNA 1EXSA 5HZ6A 4Y0RA 2QOSC 1DC9A 2HZRA 4D6AA 1H91A 3TZSA 3WJEA 1CBRA 4A1YA 2FLJA 1KGLA 4NLIA 1LIFA 1MUPA 3IFBA 1UREA 3P6HA 4LZVA 1IKEA 1EQDA 1OEJA 3C77X 5C0NA 2CZUA 5LJCA 4YBUA 2XSTA 2OFRX 4AZOA 1EPAA 1T0VA 1S2PA 2OVDA 2W2AA 3I0AA 4R0BA 4IBAA 1I04A 4IB7A 1E02A 1EUOA 1ICMA 1G5WA 1EIOA 4LKPA 1ML7A 1YWBA 4A1HA 2A2GA 5HZ9A 1YWDA 1OBPA 1X8QA 2FR2A 1UZ2X 2JU3A 3C76X 1QG5A 3EBWA 3KFFA 4ZH6A 1E06A 4BOEA 3VG2A 3CR6A 1DZKA 1KT3A 1FTPA 1S7DA 1BJ7A 2ALLX 1CRBA 1DV9A 3FELA 1QY0A 3KFIA 3K3LA 4EFGA 1YWAA 1KQXA 1X89A 1ZRYA 4Y0PA 1SXYA 5LJBA 4Y0QA 1S44A 3O19A 1QY2A 3APWA 2EU7X 3DTQA 4ZCBA 3D97A 1JJXA 2LBVA 2CBSA 1G74A 1HMRA 4A60A 4GNWA 1DZPA 1JYDA 3F9DA 3UEVA 2L67A 3BLGA 1O1VA 4GE1A 1SY0A 3ELXA 1X8UA 2AH7X 4YCHA 5F7GA 4XMDA 4HFOA 5HCDC 3CQNA 4GNYA 3FA7A 1A57A 2HMBA 2Q2MA 4ZFXA 5F6ZA 1LIBA 2OVAA 3O2YA 1ACDA 3S26A 1B0OA 1PMPA 1SA8A 1JJJA 3ZUIA 1B56A 1KOIA 4LZUA 4ORWA 3AKNA 2K62A 3BY0A 3VG3A 1LNMA 3TGAA 4OS3A 1ALBA 1MX7A 4YDAA 3TGCA 2HZQA 4IB8A 3UEUA 1A3YA 4OMWA 4HPDA 4TLJA 2ACPX 2BLGA 3B2LA 3FLLA 3WXQA 1X71A 1GM6A 4YDBA 1MX8A 2RCTA 2Q9SA 3BX8A 3FENA 1EW3A 1P6PA 1KQWA 1XCAA 4AZNA 5HZ8A 4ORRA 1I06A 1O1UA 2RQ0A 3WJDA 3HWDA 3MBTA 3DSZA 4XMEA 1RBPA 2K23A 1VPRA 1EALA 4YH0A 5EPQA 5D45A 2FTBA 3KQ0A 2A3FX 1BEBA 3BU9A 2O62A 3UEWA 1SY3A 4XMFA 2G79A 3STKA 3SAOA 3WJFA 1GT4A
chains in the Genus database with same CATH superfamily
1QWDA 2HLVA 1EPBA 2OZQA 3SLTA 4I3DA 3WYPA 3HK1A 1KT5A 2KTSA 2RTNB 5FQ6E 2IZBA 4ODDA 2OFBA 2KTDA 2RD7C 4O9SA 2WR6A 1SRHA 4QZTA 3RDSA 1AB0A 2WEXA 3D95A 1BM5A 1GKAA 1T8VA 3FR2A 5B3MO 1IJ8A 5B29A 1SWHA 3D96A 3BX7A 1TVQA 1ERXA 1FENA 3WYQA 3CBSA 4ORUA 3NX2A 1D2UA 1I05A 3NQKA 2X45A 2FRSA 4OKAA 4C5PA 1N9MA 3PH6A 5KHPA 5K68A 4KC8A 4BVMA 1OEKA 1E5PA 4XMGA 3WBGA 2CAMA 4ARHA 1SWGA 4LQZA 3EC5A 1JMXA 3EBKA 1DFVA 2KT4B 2QM9A 4MVEA 3RDMA 1HBQA 1MEPA 3GE2A 3HTYA 3ZUOA 1VWIB 3STMX 2LKKA 1N43A 4Y59A 1PEEA 4KT5A 2AT6X 3WOVA 1B4MA 1SWTA 4DNEA 2WQAE 4U8UO 3AEHA 5IO7A 1VWRB 4ALOA 4AZRA 2OL8O 2W2FA 1LCVA 4JGLA 5F58A 5IO5A 1QQSA 3FR5A 5EEDA 5LJDA 1BSQA 2JN3A 1HBPA 4O3ZA 4BX5A 5IO6A 2L9CA 4HPAA 5B11O 3VHMA 3FMZA 3VPJE 3FYFA 4OMXA 4AZQA 5EEEA 4ZHCA 1EIIA 4QGWA 4MVLA 1PBYA 1SMPI 3P6CA 2F09A 1NP1A 2ANSA 2FGSA 2R74A 1NP4A 1KZXA 4FBVA 3B2IA 1GT1A 4M7MA 3ZI8A 4DCBA 4Y5DA 5HTEA 2IZFB 3PEDA 4YKOA 4NW4A 1RXHA 2OVEA 1ERBA 4EXZA 4QAEA 1LF7A 4GGRA 5FAZA 4AYHA 4QGVA 1HN2A 3ELZA 4YGZA 2DM5A 1YIVA 3T1DA 2OFMX 2BT9A 2LA7A 3FDCA 1JZUA 3FR4A 3B2KA 5HAEA 3FW4A 3OD9A 4GZVA 5CYBA 2ASNX 3FA8A 1TXLA 1JIWI 4EKVA 5D47A 3SLJA 5JR8A 4ES7A 4GGZA 4AZMA 3KFGA 4QYPA 4O4SA 1LPJA 1JV4A 2FWVA 3T6LA 1GT3A 4D6BA 3L4RA 3QQ2A 1SXUA 4DQ4A 1SLFB 5HWZA 4NNTA 1HQPA 3OJYC 1G7NA 2Z4HA 2JU7A 2RTCB 2X46A 5BVSA 1RSUB 2RTIB 3RE6A 1OPBA 2G78A 5HBSA 1D3SA 2BS6A 2A13A 4TQ2A 2JU8A 5B27A 1ZNGA 5LJGA 4TJZA 1HMSA 2MM3A 3CMPA 4GRJA 1W6FA 2DJFA 5HZQA 1E2TA 4YBPA 1GGLA 4AZPA 2C4IA 4IRWA 1RAVA 2AF5A 2IZHB 1JYJA 3NQ9A 1GX9A 3NP1A 2GTLN 4O4UA 4CDCA 1NQNA 1WBIA 3FEPA 4MVIA 1QY1A 2WPUA 3WJGA 2MWHA 1TW4A 1OBQA 2RTAA 4BX7A 4ID2A 1KT4A 1LIEA 2IZEB 2R56A 3PDFA 2AT0X 3ZZVA 2QO5A 2LB6A 3HWGA 2YG2A 5HCCC 3CKGA 2XKLA 4FGIB 1FELA 1HY2A 1CBSA 2HNXA 4IB6A 4CV7A 2WQ9A 2IZKA 4O3YA 1G85A 1FE3A 3S60A 1JQPA 1LELA 5BYPA 4ZJ0A 1OEEA 4PJ2A 2OL6O 2I5ZO 4YCEA 3Q6LA 1BBPA 4M6SA 3WZQA 1ZNDA 1AQBA 3NADA 4I9SA 1SWEA 5EZ2A 2RTRB 1NGLA 5LKFA 4Z28A 1SWPA 4HPBA 4O3XB 4QQ1A 1SWLA 1SWRA 3HPEA 1WUBA 2X55A 3MM0A 4FQBB 4L1NA 2BC3A 1RLBE 3FW5A 4NV8A 4N7DA 2BS5A 1SWNA 3I17A 4OS0A 2R73A 3CKFA 3NQ3A 4UU3A 2NP1A 4AW8A 5CHKA 4BX7B 2IZLB 2IFBA 5HA0A 4A8ZA 4BJ8A 1UYOX 3AKMA 2AL0X 5F1EA 5FENA 1IKJA 3EW1A 3TGBA 2JOZA 4OEMA 2L68A 5B5GA 3RSWA 3UAQA 4Z2OA 1Z24A 4MISA 2A0AA 5EDBA 4OS8A 4CK4A 2LBAA 2QO6A 2IZGB 3QKGA 3BDRA 4YMYA 1VYOA 1BLRA 2P8GA 3P6GA 2C1QA 2AT3X 1VWOB 2GH7A 2FHLA 1SXWA 1SWDA 2GC9A 2OL7A 5L8IA 2VFBA 1U17A 3S5VA 1SWQA 1VWJB 1VYFA 5H9NA 2AT8X 4CSBA 1YUPA 5IRWA 3O22A 5F2BA 4LKTA 3WZOA 2RTEB 3RZYA 2GTLM 3BS2A 3BU1A 2FKJA 1GXAA 2CM4A 2HKDA 1BRQA 1SREA 1T68X 2RTDB 1RXKA 2Y3EA 3KVNA 1MK5A 3APXA 4YGGA 1BRPA 1VWEB 1QFVA 1TOUA 1STPA 1X8NA 2CZTA 2IZIA 2PY1A 3EW2A 4HPCA 4N7CA 4YFQA 4ZHGA 1Y9TA 1A18A 2QCBA 2CBRA 2POAA 5AJCA 1HXLA 1I78A 2AKQA 5AQ6A 5H9LA 2OY7A 3VU1A 3APUA 4GETA 5F6BA 2MF6A 1FEMA 3BSZE 3T2XA 5DG4A 2W2BA 4ON1A 3F6ZB 4KC7A 3RBYA 2RCQA 3AUMO 1GKAB 1LICA 2F73A 4CDFA 3WZNA 1YP6A 3VG4A 4ZGUA 2A5CA 2RA6A 3H3IA 3HOEA 2RTJA 3MX7A 1GX3A 4GK9A 5IRUA 1LCZA 5FFHA 1I9HA 1OBUA 3HWFA 5AJBA 2A2UA 3P6EA 2WUTA 4YFPA 1JBHA 2OYBO 1FJ1E 4I95A 5DPQA 4TKJA 2M4LA 2QOMA 3NBXX 4UU2A 5H8TA 1I4UA 3ZW1A 1YP7A 3N91A 5CE4A 5L8OA 1KZWA 4TKHA 2G7BA 2OY5O 1IFBA 3MVFA 2E4JA 3PK2A 4NYQA 4KIIA 4GD9A 4IMOA 1B8EA 1SWAA 5L3YA 4CPFA 3GAQA 4IB9A 2NNQA 2VFCA 2WWPA 3TF6A 2NNDA 1KFFA 1K24A 1SWCA 2RTPB 3EM0A 1Y55X 3VG6A 1VWGB 1QABE 3WVMA 4Z27A 5K06A 2FS6A 3BRNA 3D9WA 2ACOA 5D48A 4YVBA 4ZR2A 2Q4NA 1SLGB 2RTLA 1N0SA 1YWCA 4YKMA 3CBCA 1XKIA 2QO4A 3WJBA 4L3RA 1IIUA 3U9PC 1O8VA 5LJEA 3NPOA 1U18A 1KT6A 4KH8A 4GU8A 4ML7B 3PPTA 4IAWA 3RDOA 5BVTA 3APVA 3C78X 4BX5B 1AVGI 1TOWA 4QGXA 3CWKA 3FA9A 4I3BA 3NR3A 3ZW1B 1ICNA 4ZHFA 1HMTA 2FR3A 4GDAA 4ZH9A 4NP1A 3RE5A 1VWMB 1X8OA 2Q2PA 2RTOB 4O4OA 4NYRA 4YGHA 3FIDA 1PBOA 3RY1A 1LKEA 2OF8A 5HA1A 2Q39A 4QNIA 4RUUA 1CJ5A 4IAXA 3HOLA 4MIRA 1E00A 3SZHA 2JW1A 4NLJA 3MG5A 1CBIA 3OBLA 4GKCA 5L8NA 1MOYA 2WSJA 2ZSCA 1BWYA 4QYNA 2VDFA 2CM9A 3G7XA 1FDQA 3UEXA 4WFUA 1SY2A 5IRAA 1ZNEA 1VWCB 2AMMX 2Z4IA 1K3BA 1A2DA 4GH7A 1SY1A 2X32A 1X8PA 3FEKA 3HWEA 4I3CA 1ZNKA 4ORYA 3B2JA 1AELA 4ALBA 1ZNLA 5H9KA 4U46A 5LJHA 4GGTA 1GT5A 2OVSA 2RTHB 3VG5A 4EEJA 2ZAGA 2GTFX 3JQOA 2NNEA 2RTFB 2GJ5A 4I60A 1PM1X 1W4TA 1PTSA 2MO5A 3F8AA 3P6DA 3VHHA 3CQRA 4XMCA 5FQ7E 3ZW0A 1VWHB 3WJCA 2N93A 1LIDA 3FA6A 3SOTA 4Z2VA 3VE1A 1JMZA 5EDCA 4WFVA 1LFOA 1HQQA 4KCAA 4ZHHA 2HYSA 5BVQA 1AVEA 5LKEA 2IZAA 5D4AA 1OPAA 1QFTA 3E3CA 4MVKA 3VG7A 4B55A 1UYNX 3IA8A 4NNSA 4U8UN 1KT7A 4MEEA 5KICA 4CPIA 3U0DA 3P6FA 1NBXA 1SXXA 3JS1A 4PSQA 1U0XA 1OSPO 3NX1A 1DF8A 1MVGA 2X8FA 1RXJA 4ORXA 4ZGFA 1ZNHA 5D8JA 5B10O 3LTWA 1SLEB 4EDEA 3KZAA 4I9RA 3FIQA 3PP6A 4FBRA 3ZW0B 2WEWA 5H9AA 4XMHA 3U03A 4RUNA 4ORSA 1HXZA 1VYGA 2FT9A 3EYCA 4WBKA 4I6SA 1VWLB 3RDUA 4IMNA 4JHQA 4Z6JA 3EMMA 3KFHA 1ADLA 3ZWEA 4YFRA 2BSZA 1KXOA 1L6MA 1SRIA 1N9YA 3SLOA 2L5PA 5IXGA 2G5LA 2FS7A 1GX8A 2FHNX 1IFCA 4TNNA 1VWKB 4GUZA 1N7YA 1MDCA 4K19A 4Y0SA 3B2HA 4TKBA 4OELA 3JSQA 3ZQ3A 5KIDA 1DF3A 3PH5A 1RSTB 2AT5X 1BSOA 5HZ5A 4QZUA 2LFOA 5LJKA 3PECA 1CBQA 1BSYA 1R0UA 1STRB 4BQUA 4CDEA 5HTDA 4DQ3A 1SRFA 1IW2A 3X00A 3OE3A 1DZJA 1NC9A 5HCEC 2RTKA 2X56A 4ZHDA 1SRGA 3PQUA 1DZMA 2PI3O 2MJIA 3STNA 1EXSA 3S5XA 1KL5A 5HZ6A 4Y0RA 2QOSC 1DC9A 3P24A 2HZRA 4D6AA 1KL3A 1H91A 3TZSA 3WJEA 2BHVA 2X4MA 1CBRA 2MHDA 3T2WA 5AEOA 2GTLO 2FLJA 4A1YA 1KGLA 4NLIA 3RDXA 1LIFA 2QMIA 1MUPA 1SWJA 4U8UM 3WZPA 3IFBA 3D4RA 1W5RA 1UREA 1MM9A 3P6HA 4LZVA 1IKEA 1EQDA 3T6FA 1OEJA 1SWKA 2IZJA 3C77X 4QRLA 5C0NA 2CZUA 4BBOA 4O3WA 4FBOA 2FKGA 2KW1A 5LJCA 4YBUA 4GJSA 1N4JA 2XSTA 2OFRX 2UYWA 4BX6B 4BGFA 5CSEA 4AZOA 4JO6A 1EPAA 1T0VA 2JMBA 1S2PA 2OVDA 2W2AA 3I0AA 4CPHA 2KD2A 4R0BA 1NDJA 2RTQB 4IBAA 1I04A 5K67A 4IB7A 1E02A 1EUOA 1ICMA 4HWMA 1SWSA 4GDZA 3SZIA 1EIOA 1G5WA 2RTMA 4LKPA 1ML7A 1YWBA 2AVIA 2YMSA 5JD2A 4A1HA 2IZDB 2A2GA 4O49A 5HZ9A 1YWDA 1LDQA 1OBPA 1LDOA 1X8QA 2FR2A 1UZ2X 2JU3A 3C76X 1QG5A 3EBWA 3KFFA 4ZH6A 3RDQA 1E06A 1SWUA 4BOEA 3VG2A 2OF9A 3CR6A 1DZKA 1KT3A 4EQAC 1FTPA 1S7DA 1BJ7A 2ALLX 3PQSA 1CRBA 1DV9A 3FELA 1QY0A 3KFIA 3SZJA 4CPHB 1AVDA 3K3LA 4JNJA 4EFGA 1YWAA 1KQXA 1X89A 1ZRYA 4Y0PA 1SXYA 5LJBA 1LUQA 1NQMA 1LCWA 4Y0QA 1S44A 2X8TA 3O19A 2OY8A 1QY2A 3APWA 2EU7X 3DTQA 4ZCBA 3D97A 1JJXA 2LBVA 2CBSA 1G74A 1HMRA 4BCSA 4A60A 4GNWA 1DZPA 1JYDA 3F9DA 1Y0GA 2A5BA 3UEVA 4INNA 1SWOA 1STSB 2L67A 4U9CA 3VHIA 3BLGA 1O1VA 3RY2A 4GE1A 1SY0A 3ELXA 1X8UA 3ZW2A 2AH7X 1Y9LA 2G8CO 2I5VO 4YCHA 5F7GA 4XMDA 4HFOA 4WHIA 5HCDC 3CQNA 2IZCB 3P02A 4GNYA 3FA7A 1A57A 2HMBA 1SWFA 2Q2MA 3RWXA 4ZFXA 5F6ZA 2OFAA 1LIBA 2OVAA 2Y32A 3O2YA 3LV4A 1ACDA 5B2AO 3S26A 2X8SA 1B0OA 1PMPA 1SA8A 1Y53X 1JJJA 3ZUIA 1B56A 1KOIA 4LZUA 4ORWA 2ZAIA 3AKNA 1VWDB 1VWQB 2K62A 4CPEA 2RN4A 1Y52X 2F01A 5B5FA 4Z2PA 3BY0A 3VG3A 1LNMA 3TGAA 4OS3A 1ALBA 1MX7A 4YDAA 3TGCA 2OY1O 4U3QA 4CDDA 1KL4A 2HZQA 2Y3FA 2A8GA 3VGWA 4IB8A 3UEUA 1A3YA 4OMWA 1SLDB 2C1SA 4HPDA 4TLJA 2ACPX 2BLGA 3B2LA 3FLLA 1SRJA 1X71A 1GM6A 4YDBA 1VWFB 1MX8A 3WXQA 4BX6A 1VWBB 4IABA 2RCTA 2RTGB 2Q9SA 3BX8A 1SWBA 3FENA 1EW3A 1P6PA 1KQWA 1XCAA 4AZNA 5HZ8A 4ORRA 1I06A 1O1UA 3V8UA 3VE2A 2RQ0A 1JJUA 2X34A 3HWDA 4O4XA 3MBTA 3WJDA 1VWNB 2RTBB 3DSZA 2JGSA 1RBPA 2K23A 4GJVA 4XMEA 3LHNA 1EI5A 1VPRA 3RKGA 1EALA 4YH0A 5EPQA 5D45A 2FTBA 1VWAB 1VWPB 4NV7A 3KQ0A 3Q34A 5FQ8E 2A3FX 1BEBA 2DJGA 3BU9A 2O62A 3UEWA 1SY3A 2UZ2A 2G79A 4XMFA 3SAOA 3STKA 3WJFA 4COTA 1GT4A
chains in the Genus database with same CATH topology
1QWDA 2HLVA 1EPBA 2OZQA 4I3DA 3HK1A 1KT5A 2KTSA 5FQ6E 4ODDA 2KTDA 2RD7C 4O9SA 2WR6A 4QZTA 1AB0A 2WEXA 3D95A 1BM5A 1GKAA 1T8VA 3FR2A 5B29A 3D96A 3BX7A 1TVQA 1ERXA 1FENA 3CBSA 4ORUA 3NX2A 1D2UA 1I05A 3NQKA 2X45A 2FRSA 5KHPA 3PH6A 4KC8A 4BVMA 1OEKA 1E5PA 4XMGA 3WBGA 4ARHA 4LQZA 3EBKA 1DFVA 2KT4B 2QM9A 4MVEA 3ZUOA 1HBQA 3GE2A 3HTYA 3STMX 2LKKA 1PEEA 3WOVA 1B4MA 4KT5A 2AT6X 2WQAE 4U8UO 5IO7A 4ALOA 4AZRA 2W2FA 4JGLA 5F58A 5IO5A 1QQSA 3FR5A 5EEDA 5LJDA 1BSQA 2JN3A 1HBPA 4O3ZA 5IO6A 2L9CA 4HPAA 3FMZA 3VPJE 3FYFA 4OMXA 4AZQA 5EEEA 4ZHCA 1EIIA 4QGWA 4MVLA 1SMPI 3P6CA 2F09A 1NP1A 2ANSA 2R74A 1NP4A 1KZXA 4FBVA 3B2IA 1GT1A 4M7MA 3ZI8A 5HTEA 3PEDA 4YKOA 4NW4A 2OVEA 1ERBA 4EXZA 4QAEA 1LF7A 5FAZA 4AYHA 4QGVA 1HN2A 3ELZA 4YGZA 2DM5A 1YIVA 3T1DA 2OFMX 2BT9A 2LA7A 1JZUA 3FR4A 3B2KA 5HAEA 3FW4A 3OD9A 4GZVA 5CYBA 2ASNX 3FA8A 1TXLA 1JIWI 5D47A 5JR8A 4ES7A 4AZMA 3KFGA 4QYPA 4O4SA 1LPJA 1JV4A 2FWVA 1GT3A 4D6BA 3L4RA 1SXUA 4DQ4A 5HWZA 4NNTA 1HQPA 3OJYC 1G7NA 2Z4HA 2JU7A 2X46A 5BVSA 1OPBA 2G78A 5HBSA 1D3SA 2BS6A 2A13A 4TQ2A 2JU8A 5B27A 1ZNGA 5LJGA 4TJZA 1HMSA 2MM3A 3CMPA 4GRJA 5HZQA 4YBPA 1GGLA 4AZPA 1JYJA 3NQ9A 1GX9A 3NP1A 2GTLN 4O4UA 3FEPA 4MVIA 1QY1A 3WJGA 2MWHA 1TW4A 1OBQA 4ID2A 1KT4A 1LIEA 2R56A 2AT0X 3ZZVA 2QO5A 2LB6A 3HWGA 2YG2A 5HCCC 4CV7A 2XKLA 4FGIB 1FELA 1CBSA 2HNXA 4IB6A 2WQ9A 4O3YA 1G85A 1FE3A 3S60A 5BYPA 4ZJ0A 1OEEA 4PJ2A 4YCEA 3Q6LA 1BBPA 4M6SA 1ZNDA 1AQBA 3NADA 4I9SA 5EZ2A 1NGLA 5LKFA 4HPBA 4O3XB 4QQ1A 4FQBB 4L1NA 1RLBE 3FW5A 4N7DA 2BS5A 3I17A 4OS0A 2R73A 3NQ3A 4UU3A 4AW8A 2NP1A 2IFBA 5HA0A 4A8ZA 3AKMA 2AL0X 5F1EA 5FENA 1IKJA 3TGBA 2JOZA 3RSWA 2L68A 3UAQA 1Z24A 4MISA 2A0AA 5EDBA 4OS8A 4CK4A 2LBAA 2QO6A 3QKGA 4YMYA 3BDRA 1BLRA 2P8GA 3P6GA 2AT3X 1SXWA 2GC9A 5L8IA 1U17A 3S5VA 1VYFA 5H9NA 2AT8X 4CSBA 1YUPA 3O22A 4LKTA 3RZYA 2GTLM 3BS2A 3BU1A 1GXAA 2CM4A 1BRQA 1T68X 4YGGA 3APXA 1BRPA 1X8NA 1QFVA 1TOUA 2PY1A 4HPCA 2CZTA 4YFQA 4ZHGA 4N7CA 1Y9TA 1A18A 2CBRA 2POAA 5AJCA 2AKQA 5H9LA 3VU1A 5AQ6A 3APUA 4GETA 5F6BA 1FEMA 3BSZE 5DG4A 2W2BA 4ON1A 3F6ZB 4KC7A 3RBYA 2RCQA 1GKAB 1LICA 2F73A 1YP6A 3VG4A 4ZGUA 3H3IA 2RA6A 3HOEA 3MX7A 4GK9A 5FFHA 1OBUA 3HWFA 5AJBA 2A2UA 3P6EA 2WUTA 4YFPA 1JBHA 4I95A 5DPQA 4TKJA 2M4LA 3ZW1A 3NBXX 4UU2A 5H8TA 1I4UA 1YP7A 3N91A 5CE4A 5L8OA 1KZWA 4TKHA 2G7BA 1IFBA 3MVFA 2E4JA 4NYQA 4KIIA 4IMOA 1B8EA 3GAQA 4IB9A 2NNQA 2WWPA 3TF6A 2NNDA 3EM0A 3VG6A 3WVMA 1QABE 5K06A 2FS6A 3BRNA 2ACOA 5D48A 4ZR2A 2Q4NA 1N0SA 1YWCA 4YKMA 3CBCA 1XKIA 2QO4A 3WJBA 4L3RA 1IIUA 3U9PC 1O8VA 5LJEA 3NPOA 1U18A 1KT6A 4KH8A 4GU8A 4ML7B 3PPTA 4IAWA 5BVTA 3APVA 3C78X 1AVGI 1TOWA 4QGXA 3CWKA 3FA9A 4I3BA 3NR3A 3ZW1B 1ICNA 4ZHFA 1HMTA 2FR3A 4ZH9A 4NP1A 1X8OA 2Q2PA 4O4OA 4NYRA 4YGHA 1PBOA 1LKEA 5HA1A 2Q39A 4QNIA 4RUUA 1CJ5A 4IAXA 3HOLA 4MIRA 1E00A 2JW1A 4NLJA 4GKCA 1CBIA 3OBLA 5L8NA 2WSJA 1BWYA 4QYNA 2CM9A 3G7XA 1FDQA 3UEXA 4WFUA 1SY2A 1ZNEA 2AMMX 2Z4IA 4I3CA 1A2DA 4GH7A 1SY1A 3HWEA 1X8PA 3FEKA 4ORYA 1ZNKA 3B2JA 1AELA 4ALBA 1ZNLA 5H9KA 5LJHA 1GT5A 2OVSA 3VG5A 4EEJA 2ZAGA 2GTFX 3JQOA 2NNEA 2GJ5A 1PM1X 2MO5A 3F8AA 3P6DA 3ZW0A 3CQRA 4XMCA 5FQ7E 3WJCA 2N93A 1LIDA 3FA6A 3SOTA 3VE1A 5EDCA 4WFVA 1LFOA 4KCAA 4ZHHA 2HYSA 5BVQA 5LKEA 5D4AA 1OPAA 1QFTA 3E3CA 4MVKA 3VG7A 3IA8A 4NNSA 4U8UN 1KT7A 5KICA 3U0DA 3P6FA 1SXXA 3JS1A 4PSQA 1U0XA 3NX1A 1MVGA 2X8FA 4ZGFA 4ORXA 1ZNHA 5D8JA 4EDEA 3KZAA 4I9RA 3FIQA 3PP6A 4FBRA 3ZW0B 2WEWA 5H9AA 4XMHA 3U03A 4RUNA 4ORSA 1VYGA 2FT9A 3EYCA 4WBKA 4I6SA 4IMNA 3EMMA 3KFHA 1ADLA 3ZWEA 4YFRA 1KXOA 1L6MA 2L5PA 2FS7A 1GX8A 1IFCA 4TNNA 4Y0SA 1MDCA 4K19A 3B2HA 4TKBA 3JSQA 3ZQ3A 5KIDA 1DF3A 3PH5A 5HZ5A 2AT5X 1BSOA 4QZUA 2LFOA 5LJKA 3PECA 1CBQA 1BSYA 1R0UA 4BQUA 5HTDA 4DQ3A 1IW2A 3OE3A 1DZJA 5HCEC 4ZHDA 3PQUA 1DZMA 2MJIA 3STNA 1EXSA 3S5XA 5HZ6A 4Y0RA 2QOSC 1DC9A 3P24A 2HZRA 4D6AA 1H91A 3TZSA 3WJEA 2BHVA 1CBRA 2MHDA 5AEOA 2GTLO 2FLJA 4A1YA 1KGLA 4NLIA 1LIFA 2QMIA 1MUPA 4U8UM 3IFBA 3D4RA 1UREA 3P6HA 4LZVA 1IKEA 1EQDA 1OEJA 3C77X 4QRLA 5C0NA 2CZUA 4O3WA 4FBOA 5LJCA 2KW1A 4YBUA 2XSTA 2OFRX 4AZOA 1EPAA 1T0VA 2JMBA 1S2PA 2OVDA 2W2AA 3I0AA 2KD2A 4R0BA 4IBAA 1I04A 4IB7A 1E02A 1EUOA 1ICMA 4HWMA 4GDZA 1EIOA 1G5WA 4LKPA 1ML7A 1YWBA 2YMSA 4A1HA 2A2GA 4O49A 5HZ9A 1YWDA 1OBPA 1X8QA 2FR2A 1UZ2X 2JU3A 3C76X 1QG5A 3EBWA 3KFFA 4ZH6A 1E06A 4BOEA 3VG2A 3CR6A 1DZKA 1KT3A 4EQAC 1FTPA 1S7DA 1BJ7A 2ALLX 3PQSA 1CRBA 1DV9A 3FELA 1QY0A 3KFIA 3K3LA 4EFGA 1YWAA 1KQXA 1X89A 1ZRYA 4Y0PA 1SXYA 5LJBA 4Y0QA 1S44A 2X8TA 3O19A 1QY2A 3APWA 2EU7X 3DTQA 4ZCBA 3D97A 1JJXA 2LBVA 2CBSA 1G74A 1HMRA 4A60A 4GNWA 1DZPA 1JYDA 3F9DA 3UEVA 4INNA 2L67A 4U9CA 3BLGA 1O1VA 4GE1A 1SY0A 3ELXA 1X8UA 3ZW2A 2AH7X 1Y9LA 4YCHA 5F7GA 4XMDA 4HFOA 4WHIA 5HCDC 3CQNA 3P02A 4GNYA 3FA7A 1A57A 2HMBA 2Q2MA 3RWXA 4ZFXA 5F6ZA 1LIBA 2OVAA 3O2YA 3LV4A 1ACDA 3S26A 2X8SA 1B0OA 1PMPA 1SA8A 1JJJA 3ZUIA 1B56A 1KOIA 4LZUA 4ORWA 2ZAIA 3AKNA 2K62A 2RN4A 3BY0A 3VG3A 1LNMA 3TGAA 4OS3A 1ALBA 1MX7A 4YDAA 3TGCA 4U3QA 2HZQA 4IB8A 3UEUA 1A3YA 4OMWA 4HPDA 4TLJA 2ACPX 2BLGA 3B2LA 3FLLA 3WXQA 1X71A 1GM6A 4YDBA 1MX8A 4IABA 2RCTA 2Q9SA 3BX8A 3FENA 1EW3A 1P6PA 1KQWA 1XCAA 4AZNA 5HZ8A 4ORRA 1I06A 1O1UA 3V8UA 3VE2A 2RQ0A 4O4XA 3WJDA 3HWDA 3MBTA 3DSZA 4XMEA 1RBPA 2K23A 3LHNA 1EI5A 1VPRA 3RKGA 1EALA 4YH0A 5EPQA 5D45A 2FTBA 3KQ0A 5FQ8E 2A3FX 1BEBA 3BU9A 2O62A 3UEWA 1SY3A 4XMFA 2G79A 3STKA 3SAOA 3WJFA 4COTA 1GT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QWD A;  2HLV A;  1EPB A;  2OZQ A;  4I3D A;  3HK1 A;  1KT5 A;  4ODD A;  2KTD A;  2RD7 C;  4O9S A;  2WR6 A;  4QZT A;  1AB0 A;  2WEX A;  3D95 A;  1BM5 A;  1GKA A;  1T8V A;  3FR2 A;  5B29 A;  3D96 A;  3BX7 A;  1TVQ A;  1ERX A;  1FEN A;  3CBS A;  4ORU A;  3NX2 A;  1D2U A;  1I05 A;  2X45 A;  2FRS A;  5KHP A;  3PH6 A;  4BVM A;  1OEK A;  1E5P A;  4XMG A;  3WBG A;  4ARH A;  3EBK A;  1DFV A;  2KT4 B;  2QM9 A;  3ZUO A;  1HBQ A;  3STM X;  2LKK A;  1PEE A;  1B4M A;  2AT6 X;  2WQA E;  5IO7 A;  4ALO A;  4AZR A;  2W2F A;  5F58 A;  5IO5 A;  1QQS A;  3FR5 A;  5EED A;  5LJD A;  1BSQ A;  2JN3 A;  1HBP A;  5IO6 A;  2L9C A;  4HPA A;  3FMZ A;  4OMX A;  4AZQ A;  4ZHC A;  5EEE A;  1EII A;  4QGW A;  4MVL A;  3P6C A;  2R74 A;  1NP1 A;  2ANS A;  1NP4 A;  1KZX A;  3B2I A;  1GT1 A;  4M7M A;  5HTE A;  3PED A;  4YKO A;  2OVE A;  1ERB A;  4EXZ A;  4QAE A;  1LF7 A;  5FAZ A;  4AYH A;  4QGV A;  1HN2 A;  3ELZ A;  4YGZ A;  2DM5 A;  1YIV A;  3T1D A;  2OFM X;  1JZU A;  3FR4 A;  3B2K A;  5HAE A;  3FW4 A;  2ASN X;  3FA8 A;  1TXL A;  5D47 A;  5JR8 A;  4ES7 A;  4AZM A;  3KFG A;  4QYP A;  1LPJ A;  1JV4 A;  2FWV A;  1GT3 A;  4D6B A;  3L4R A;  1SXU A;  4DQ4 A;  5HWZ A;  4NNT A;  1HQP A;  3OJY C;  1G7N A;  2JU7 A;  2X46 A;  5BVS A;  1OPB A;  2G78 A;  5HBS A;  1D3S A;  4TQ2 A;  2A13 A;  2JU8 A;  5B27 A;  1ZNG A;  5LJG A;  4TJZ A;  1HMS A;  2MM3 A;  3CMP A;  4GRJ A;  5HZQ A;  4YBP A;  1GGL A;  4AZP A;  1JYJ A;  3NQ9 A;  1GX9 A;  3NP1 A;  3FEP A;  4MVI A;  1QY1 A;  3WJG A;  1TW4 A;  1OBQ A;  1KT4 A;  1LIE A;  2R56 A;  2AT0 X;  2QO5 A;  2LB6 A;  3HWG A;  2YG2 A;  5HCC C;  2XKL A;  1FEL A;  1CBS A;  2HNX A;  4IB6 A;  2WQ9 A;  1G85 A;  1FE3 A;  4ZJ0 A;  1OEE A;  4YCE A;  3Q6L A;  1BBP A;  4M6S A;  1ZND A;  1AQB A;  3NAD A;  4I9S A;  5EZ2 A;  1NGL A;  5LKF A;  4HPB A;  1RLB E;  3FW5 A;  4N7D A;  3I17 A;  4OS0 A;  2R73 A;  3NQ3 A;  4UU3 A;  4AW8 A;  2NP1 A;  2IFB A;  5HA0 A;  4A8Z A;  3AKM A;  2AL0 X;  5F1E A;  5FEN A;  1IKJ A;  3TGB A;  2JOZ A;  3RSW A;  2L68 A;  1Z24 A;  2A0A A;  5EDB A;  4OS8 A;  4CK4 A;  2LBA A;  2QO6 A;  3QKG A;  4YMY A;  3BDR A;  1BLR A;  2P8G A;  3P6G A;  2AT3 X;  1SXW A;  2GC9 A;  5L8I A;  1U17 A;  1VYF A;  5H9N A;  2AT8 X;  1YUP A;  3O22 A;  4LKT A;  3RZY A;  3BU1 A;  3BS2 A;  1GXA A;  2CM4 A;  1BRQ A;  1T68 X;  4YGG A;  3APX A;  1BRP A;  1X8N A;  1QFV A;  1TOU A;  2PY1 A;  4HPC A;  2CZT A;  4YFQ A;  4ZHG A;  4N7C A;  1A18 A;  2CBR A;  2POA A;  5H9L A;  2AKQ A;  5AQ6 A;  3APU A;  4GET A;  5F6B A;  1FEM A;  3BSZ E;  5DG4 A;  2W2B A;  2RCQ A;  1GKA B;  1LIC A;  2F73 A;  1YP6 A;  3VG4 A;  4ZGU A;  2RA6 A;  5FFH A;  1OBU A;  3HWF A;  2A2U A;  3P6E A;  2WUT A;  4YFP A;  1JBH A;  5DPQ A;  4TKJ A;  5H8T A;  4UU2 A;  1I4U A;  1YP7 A;  5CE4 A;  1KZW A;  5L8O A;  4TKH A;  2G7B A;  1IFB A;  3MVF A;  2E4J A;  4NYQ A;  4KII A;  4IMO A;  1B8E A;  3GAQ A;  4IB9 A;  2NNQ A;  2WWP A;  3TF6 A;  2NND A;  3EM0 A;  3VG6 A;  3WVM A;  1QAB E;  5K06 A;  2FS6 A;  3BRN A;  2ACO A;  5D48 A;  4ZR2 A;  2Q4N A;  1N0S A;  1YWC A;  4YKM A;  3CBC A;  1XKI A;  2QO4 A;  3WJB A;  1IIU A;  3U9P C;  1O8V A;  5LJE A;  3NPO A;  1U18 A;  1KT6 A;  3PPT A;  4IAW A;  5BVT A;  3APV A;  3C78 X;  1AVG I;  1TOW A;  4QGX A;  3CWK A;  3FA9 A;  4I3B A;  3NR3 A;  4ZHF A;  1ICN A;  1HMT A;  2FR3 A;  4ZH9 A;  4NP1 A;  1X8O A;  2Q2P A;  4YGH A;  4NYR A;  1PBO A;  1LKE A;  5HA1 A;  2Q39 A;  4RUU A;  1CJ5 A;  4IAX A;  1E00 A;  4NLJ A;  4GKC A;  1CBI A;  5L8N A;  2WSJ A;  1BWY A;  4QYN A;  2CM9 A;  3G7X A;  1FDQ A;  3UEX A;  4WFU A;  1SY2 A;  1ZNE A;  2AMM X;  4I3C A;  1A2D A;  4GH7 A;  1SY1 A;  3HWE A;  1X8P A;  3FEK A;  4ORY A;  1ZNK A;  3B2J A;  1AEL A;  4ALB A;  1ZNL A;  5H9K A;  5LJH A;  1GT5 A;  3VG5 A;  4EEJ A;  2GTF X;  2NNE A;  2GJ5 A;  1PM1 X;  2MO5 A;  3F8A A;  3P6D A;  3CQR A;  4XMC A;  3WJC A;  2N93 A;  1LID A;  3FA6 A;  5EDC A;  4WFV A;  1LFO A;  4ZHH A;  2HYS A;  5BVQ A;  5LKE A;  5D4A A;  1OPA A;  1QFT A;  4MVK A;  3VG7 A;  3IA8 A;  4NNS A;  1KT7 A;  5KIC A;  3U0D A;  3P6F A;  1SXX A;  3JS1 A;  4PSQ A;  1U0X A;  3NX1 A;  1MVG A;  4ORX A;  1ZNH A;  5D8J A;  4EDE A;  3KZA A;  4I9R A;  3FIQ A;  3PP6 A;  2WEW A;  5H9A A;  4XMH A;  3U03 A;  4RUN A;  4ORS A;  1VYG A;  2FT9 A;  3EYC A;  4WBK A;  4IMN A;  3EMM A;  3KFH A;  1ADL A;  4YFR A;  1KXO A;  1L6M A;  2L5P A;  2FS7 A;  1GX8 A;  1IFC A;  4TNN A;  4Y0S A;  1MDC A;  4K19 A;  3B2H A;  4TKB A;  3JSQ A;  3ZQ3 A;  5KID A;  1DF3 A;  3PH5 A;  5HZ5 A;  2AT5 X;  1BSO A;  4QZU A;  2LFO A;  5LJK A;  3PEC A;  1CBQ A;  1BSY A;  1R0U A;  4BQU A;  5HTD A;  4DQ3 A;  1IW2 A;  1DZJ A;  5HCE C;  4ZHD A;  1DZM A;  2MJI A;  3STN A;  1EXS A;  5HZ6 A;  4Y0R A;  2QOS C;  1DC9 A;  2HZR A;  4D6A A;  1H91 A;  3TZS A;  3WJE A;  1CBR A;  4A1Y A;  2FLJ A;  1KGL A;  4NLI A;  1LIF A;  1MUP A;  3IFB A;  1URE A;  3P6H A;  4LZV A;  1IKE A;  1EQD A;  1OEJ A;  3C77 X;  5C0N A;  2CZU A;  5LJC A;  4YBU A;  2XST A;  2OFR X;  4AZO A;  1EPA A;  1T0V A;  1S2P A;  2OVD A;  2W2A A;  3I0A A;  4R0B A;  4IBA A;  1I04 A;  4IB7 A;  1E02 A;  1EUO A;  1ICM A;  1G5W A;  1EIO A;  4LKP A;  1ML7 A;  1YWB A;  4A1H A;  2A2G A;  5HZ9 A;  1YWD A;  1OBP A;  1X8Q A;  2FR2 A;  1UZ2 X;  2JU3 A;  3C76 X;  1QG5 A;  3EBW A;  3KFF A;  4ZH6 A;  1E06 A;  4BOE A;  3VG2 A;  3CR6 A;  1DZK A;  1KT3 A;  1FTP A;  1S7D A;  1BJ7 A;  2ALL X;  1CRB A;  1DV9 A;  3FEL A;  1QY0 A;  3KFI A;  3K3L A;  4EFG A;  1YWA A;  1KQX A;  1X89 A;  1ZRY A;  4Y0P A;  1SXY A;  5LJB A;  4Y0Q A;  1S44 A;  3O19 A;  1QY2 A;  3APW A;  2EU7 X;  3DTQ A;  4ZCB A;  3D97 A;  1JJX A;  2LBV A;  2CBS A;  1G74 A;  1HMR A;  4A60 A;  4GNW A;  1DZP A;  1JYD A;  3F9D A;  3UEV A;  2L67 A;  3BLG A;  1O1V A;  4GE1 A;  1SY0 A;  3ELX A;  1X8U A;  2AH7 X;  4YCH A;  5F7G A;  4XMD A;  4HFO A;  5HCD C;  3CQN A;  4GNY A;  3FA7 A;  1A57 A;  2HMB A;  2Q2M A;  4ZFX A;  5F6Z A;  1LIB A;  2OVA A;  3O2Y A;  1ACD A;  3S26 A;  1B0O A;  1PMP A;  1SA8 A;  1JJJ A;  3ZUI A;  1B56 A;  1KOI A;  4LZU A;  4ORW A;  3AKN A;  2K62 A;  3BY0 A;  3VG3 A;  1LNM A;  3TGA A;  4OS3 A;  1ALB A;  1MX7 A;  4YDA A;  3TGC A;  2HZQ A;  4IB8 A;  3UEU A;  1A3Y A;  4OMW A;  4HPD A;  4TLJ A;  2ACP X;  2BLG A;  3B2L A;  3FLL A;  3WXQ A;  1X71 A;  1GM6 A;  4YDB A;  1MX8 A;  2RCT A;  2Q9S A;  3BX8 A;  3FEN A;  1EW3 A;  1P6P A;  1KQW A;  1XCA A;  4AZN A;  5HZ8 A;  4ORR A;  1I06 A;  1O1U A;  2RQ0 A;  3WJD A;  3HWD A;  3MBT A;  3DSZ A;  4XME A;  1RBP A;  2K23 A;  1VPR A;  1EAL A;  4YH0 A;  5EPQ A;  5D45 A;  2FTB A;  3KQ0 A;  2A3F X;  1BEB A;  3BU9 A;  2O62 A;  3UEW A;  1SY3 A;  4XMF A;  2G79 A;  3STK A;  3SAO A;  3WJF A;  1GT4 A; 
#chains in the Genus database with same CATH topology
 1QWD A;  2HLV A;  1EPB A;  2OZQ A;  3SLT A;  4I3D A;  3WYP A;  3HK1 A;  1KT5 A;  2KTS A;  2RTN B;  5FQ6 E;  2IZB A;  4ODD A;  2OFB A;  2KTD A;  2RD7 C;  4O9S A;  2WR6 A;  1SRH A;  4QZT A;  3RDS A;  1AB0 A;  2WEX A;  3D95 A;  1BM5 A;  1GKA A;  1T8V A;  3FR2 A;  5B3M O;  1IJ8 A;  5B29 A;  1SWH A;  3D96 A;  3BX7 A;  1TVQ A;  1ERX A;  1FEN A;  3WYQ A;  3CBS A;  4ORU A;  3NX2 A;  1D2U A;  1I05 A;  3NQK A;  2X45 A;  2FRS A;  4OKA A;  4C5P A;  1N9M A;  3PH6 A;  5KHP A;  5K68 A;  4KC8 A;  4BVM A;  1OEK A;  1E5P A;  4XMG A;  3WBG A;  2CAM A;  4ARH A;  1SWG A;  4LQZ A;  3EC5 A;  1JMX A;  3EBK A;  1DFV A;  2KT4 B;  2QM9 A;  4MVE A;  3RDM A;  1HBQ A;  1MEP A;  3GE2 A;  3HTY A;  3ZUO A;  1VWI B;  3STM X;  2LKK A;  1N43 A;  4Y59 A;  1PEE A;  4KT5 A;  2AT6 X;  3WOV A;  1B4M A;  1SWT A;  4DNE A;  2WQA E;  4U8U O;  3AEH A;  5IO7 A;  1VWR B;  4ALO A;  4AZR A;  2OL8 O;  2W2F A;  1LCV A;  4JGL A;  5F58 A;  5IO5 A;  1QQS A;  3FR5 A;  5EED A;  5LJD A;  1BSQ A;  2JN3 A;  1HBP A;  4O3Z A;  4BX5 A;  5IO6 A;  2L9C A;  4HPA A;  5B11 O;  3VHM A;  3FMZ A;  3VPJ E;  3FYF A;  4OMX A;  4AZQ A;  5EEE A;  4ZHC A;  1EII A;  4QGW A;  4MVL A;  1PBY A;  1SMP I;  3P6C A;  2F09 A;  1NP1 A;  2ANS A;  2FGS A;  2R74 A;  1NP4 A;  1KZX A;  4FBV A;  3B2I A;  1GT1 A;  4M7M A;  3ZI8 A;  4DCB A;  4Y5D A;  5HTE A;  2IZF B;  3PED A;  4YKO A;  4NW4 A;  1RXH A;  2OVE A;  1ERB A;  4EXZ A;  4QAE A;  1LF7 A;  4GGR A;  5FAZ A;  4AYH A;  4QGV A;  1HN2 A;  3ELZ A;  4YGZ A;  2DM5 A;  1YIV A;  3T1D A;  2OFM X;  2BT9 A;  2LA7 A;  3FDC A;  1JZU A;  3FR4 A;  3B2K A;  5HAE A;  3FW4 A;  3OD9 A;  4GZV A;  5CYB A;  2ASN X;  3FA8 A;  1TXL A;  1JIW I;  4EKV A;  5D47 A;  3SLJ A;  5JR8 A;  4ES7 A;  4GGZ A;  4AZM A;  3KFG A;  4QYP A;  4O4S A;  1LPJ A;  1JV4 A;  2FWV A;  3T6L A;  1GT3 A;  4D6B A;  3L4R A;  3QQ2 A;  1SXU A;  4DQ4 A;  1SLF B;  5HWZ A;  4NNT A;  1HQP A;  3OJY C;  1G7N A;  2Z4H A;  2JU7 A;  2RTC B;  2X46 A;  5BVS A;  1RSU B;  2RTI B;  3RE6 A;  1OPB A;  2G78 A;  5HBS A;  1D3S A;  2BS6 A;  2A13 A;  4TQ2 A;  2JU8 A;  5B27 A;  1ZNG A;  5LJG A;  4TJZ A;  1HMS A;  2MM3 A;  3CMP A;  4GRJ A;  1W6F A;  2DJF A;  5HZQ A;  1E2T A;  4YBP A;  1GGL A;  4AZP A;  2C4I A;  4IRW A;  1RAV A;  2AF5 A;  2IZH B;  1JYJ A;  3NQ9 A;  1GX9 A;  3NP1 A;  2GTL N;  4O4U A;  4CDC A;  1NQN A;  1WBI A;  3FEP A;  4MVI A;  1QY1 A;  2WPU A;  3WJG A;  2MWH A;  1TW4 A;  1OBQ A;  2RTA A;  4BX7 A;  4ID2 A;  1KT4 A;  1LIE A;  2IZE B;  2R56 A;  3PDF A;  2AT0 X;  3ZZV A;  2QO5 A;  2LB6 A;  3HWG A;  2YG2 A;  5HCC C;  3CKG A;  2XKL A;  4FGI B;  1FEL A;  1HY2 A;  1CBS A;  2HNX A;  4IB6 A;  4CV7 A;  2WQ9 A;  2IZK A;  4O3Y A;  1G85 A;  1FE3 A;  3S60 A;  1JQP A;  1LEL A;  5BYP A;  4ZJ0 A;  1OEE A;  4PJ2 A;  2OL6 O;  2I5Z O;  4YCE A;  3Q6L A;  1BBP A;  4M6S A;  3WZQ A;  1ZND A;  1AQB A;  3NAD A;  4I9S A;  1SWE A;  5EZ2 A;  2RTR B;  1NGL A;  5LKF A;  4Z28 A;  1SWP A;  4HPB A;  4O3X B;  4QQ1 A;  1SWL A;  1SWR A;  3HPE A;  1WUB A;  2X55 A;  3MM0 A;  4FQB B;  4L1N A;  2BC3 A;  1RLB E;  3FW5 A;  4NV8 A;  4N7D A;  2BS5 A;  1SWN A;  3I17 A;  4OS0 A;  2R73 A;  3CKF A;  3NQ3 A;  4UU3 A;  2NP1 A;  4AW8 A;  5CHK A;  4BX7 B;  2IZL B;  2IFB A;  5HA0 A;  4A8Z A;  4BJ8 A;  1UYO X;  3AKM A;  2AL0 X;  5F1E A;  5FEN A;  1IKJ A;  3EW1 A;  3TGB A;  2JOZ A;  4OEM A;  2L68 A;  5B5G A;  3RSW A;  3UAQ A;  4Z2O A;  1Z24 A;  4MIS A;  2A0A A;  5EDB A;  4OS8 A;  4CK4 A;  2LBA A;  2QO6 A;  2IZG B;  3QKG A;  3BDR A;  4YMY A;  1VYO A;  1BLR A;  2P8G A;  3P6G A;  2C1Q A;  2AT3 X;  1VWO B;  2GH7 A;  2FHL A;  1SXW A;  1SWD A;  2GC9 A;  2OL7 A;  5L8I A;  2VFB A;  1U17 A;  3S5V A;  1SWQ A;  1VWJ B;  1VYF A;  5H9N A;  2AT8 X;  4CSB A;  1YUP A;  5IRW A;  3O22 A;  5F2B A;  4LKT A;  3WZO A;  2RTE B;  3RZY A;  2GTL M;  3BS2 A;  3BU1 A;  2FKJ A;  1GXA A;  2CM4 A;  2HKD A;  1BRQ A;  1SRE A;  1T68 X;  2RTD B;  1RXK A;  2Y3E A;  3KVN A;  1MK5 A;  3APX A;  4YGG A;  1BRP A;  1VWE B;  1QFV A;  1TOU A;  1STP A;  1X8N A;  2CZT A;  2IZI A;  2PY1 A;  3EW2 A;  4HPC A;  4N7C A;  4YFQ A;  4ZHG A;  1Y9T A;  1A18 A;  2QCB A;  2CBR A;  2POA A;  5AJC A;  1HXL A;  1I78 A;  2AKQ A;  5AQ6 A;  5H9L A;  2OY7 A;  3VU1 A;  3APU A;  4GET A;  5F6B A;  2MF6 A;  1FEM A;  3BSZ E;  3T2X A;  5DG4 A;  2W2B A;  4ON1 A;  3F6Z B;  4KC7 A;  3RBY A;  2RCQ A;  3AUM O;  1GKA B;  1LIC A;  2F73 A;  4CDF A;  3WZN A;  1YP6 A;  3VG4 A;  4ZGU A;  2A5C A;  2RA6 A;  3H3I A;  3HOE A;  2RTJ A;  3MX7 A;  1GX3 A;  4GK9 A;  5IRU A;  1LCZ A;  5FFH A;  1I9H A;  1OBU A;  3HWF A;  5AJB A;  2A2U A;  3P6E A;  2WUT A;  4YFP A;  1JBH A;  2OYB O;  1FJ1 E;  4I95 A;  5DPQ A;  4TKJ A;  2M4L A;  2QOM A;  3NBX X;  4UU2 A;  5H8T A;  1I4U A;  3ZW1 A;  1YP7 A;  3N91 A;  5CE4 A;  5L8O A;  1KZW A;  4TKH A;  2G7B A;  2OY5 O;  1IFB A;  3MVF A;  2E4J A;  3PK2 A;  4NYQ A;  4KII A;  4GD9 A;  4IMO A;  1B8E A;  1SWA A;  5L3Y A;  4CPF A;  3GAQ A;  4IB9 A;  2NNQ A;  2VFC A;  2WWP A;  3TF6 A;  2NND A;  1KFF A;  1K24 A;  1SWC A;  2RTP B;  3EM0 A;  1Y55 X;  3VG6 A;  1VWG B;  1QAB E;  3WVM A;  4Z27 A;  5K06 A;  2FS6 A;  3BRN A;  3D9W A;  2ACO A;  5D48 A;  4YVB A;  4ZR2 A;  2Q4N A;  1SLG B;  2RTL A;  1N0S A;  1YWC A;  4YKM A;  3CBC A;  1XKI A;  2QO4 A;  3WJB A;  4L3R A;  1IIU A;  3U9P C;  1O8V A;  5LJE A;  3NPO A;  1U18 A;  1KT6 A;  4KH8 A;  4GU8 A;  4ML7 B;  3PPT A;  4IAW A;  3RDO A;  5BVT A;  3APV A;  3C78 X;  4BX5 B;  1AVG I;  1TOW A;  4QGX A;  3CWK A;  3FA9 A;  4I3B A;  3NR3 A;  3ZW1 B;  1ICN A;  4ZHF A;  1HMT A;  2FR3 A;  4GDA A;  4ZH9 A;  4NP1 A;  3RE5 A;  1VWM B;  1X8O A;  2Q2P A;  2RTO B;  4O4O A;  4NYR A;  4YGH A;  3FID A;  1PBO A;  3RY1 A;  1LKE A;  2OF8 A;  5HA1 A;  2Q39 A;  4QNI A;  4RUU A;  1CJ5 A;  4IAX A;  3HOL A;  4MIR A;  1E00 A;  3SZH A;  2JW1 A;  4NLJ A;  3MG5 A;  1CBI A;  3OBL A;  4GKC A;  5L8N A;  1MOY A;  2WSJ A;  2ZSC A;  1BWY A;  4QYN A;  2VDF A;  2CM9 A;  3G7X A;  1FDQ A;  3UEX A;  4WFU A;  1SY2 A;  5IRA A;  1ZNE A;  1VWC B;  2AMM X;  2Z4I A;  1K3B A;  1A2D A;  4GH7 A;  1SY1 A;  2X32 A;  1X8P A;  3FEK A;  3HWE A;  4I3C A;  1ZNK A;  4ORY A;  3B2J A;  1AEL A;  4ALB A;  1ZNL A;  5H9K A;  4U46 A;  5LJH A;  4GGT A;  1GT5 A;  2OVS A;  2RTH B;  3VG5 A;  4EEJ A;  2ZAG A;  2GTF X;  3JQO A;  2NNE A;  2RTF B;  2GJ5 A;  4I60 A;  1PM1 X;  1W4T A;  1PTS A;  2MO5 A;  3F8A A;  3P6D A;  3VHH A;  3CQR A;  4XMC A;  5FQ7 E;  3ZW0 A;  1VWH B;  3WJC A;  2N93 A;  1LID A;  3FA6 A;  3SOT A;  4Z2V A;  3VE1 A;  1JMZ A;  5EDC A;  4WFV A;  1LFO A;  1HQQ A;  4KCA A;  4ZHH A;  2HYS A;  5BVQ A;  1AVE A;  5LKE A;  2IZA A;  5D4A A;  1OPA A;  1QFT A;  3E3C A;  4MVK A;  3VG7 A;  4B55 A;  1UYN X;  3IA8 A;  4NNS A;  4U8U N;  1KT7 A;  4MEE A;  5KIC A;  4CPI A;  3U0D A;  3P6F A;  1NBX A;  1SXX A;  3JS1 A;  4PSQ A;  1U0X A;  1OSP O;  3NX1 A;  1DF8 A;  1MVG A;  2X8F A;  1RXJ A;  4ORX A;  4ZGF A;  1ZNH A;  5D8J A;  5B10 O;  3LTW A;  1SLE B;  4EDE A;  3KZA A;  4I9R A;  3FIQ A;  3PP6 A;  4FBR A;  3ZW0 B;  2WEW A;  5H9A A;  4XMH A;  3U03 A;  4RUN A;  4ORS A;  1HXZ A;  1VYG A;  2FT9 A;  3EYC A;  4WBK A;  4I6S A;  1VWL B;  3RDU A;  4IMN A;  4JHQ A;  4Z6J A;  3EMM A;  3KFH A;  1ADL A;  3ZWE A;  4YFR A;  2BSZ A;  1KXO A;  1L6M A;  1SRI A;  1N9Y A;  3SLO A;  2L5P A;  5IXG A;  2G5L A;  2FS7 A;  1GX8 A;  2FHN X;  1IFC A;  4TNN A;  1VWK B;  4GUZ A;  1N7Y A;  1MDC A;  4K19 A;  4Y0S A;  3B2H A;  4TKB A;  4OEL A;  3JSQ A;  3ZQ3 A;  5KID A;  1DF3 A;  3PH5 A;  1RST B;  2AT5 X;  1BSO A;  5HZ5 A;  4QZU A;  2LFO A;  5LJK A;  3PEC A;  1CBQ A;  1BSY A;  1R0U A;  1STR B;  4BQU A;  4CDE A;  5HTD A;  4DQ3 A;  1SRF A;  1IW2 A;  3X00 A;  3OE3 A;  1DZJ A;  1NC9 A;  5HCE C;  2RTK A;  2X56 A;  4ZHD A;  1SRG A;  3PQU A;  1DZM A;  2PI3 O;  2MJI A;  3STN A;  1EXS A;  3S5X A;  1KL5 A;  5HZ6 A;  4Y0R A;  2QOS C;  1DC9 A;  3P24 A;  2HZR A;  4D6A A;  1KL3 A;  1H91 A;  3TZS A;  3WJE A;  2BHV A;  2X4M A;  1CBR A;  2MHD A;  3T2W A;  5AEO A;  2GTL O;  2FLJ A;  4A1Y A;  1KGL A;  4NLI A;  3RDX A;  1LIF A;  2QMI A;  1MUP A;  1SWJ A;  4U8U M;  3WZP A;  3IFB A;  3D4R A;  1W5R A;  1URE A;  1MM9 A;  3P6H A;  4LZV A;  1IKE A;  1EQD A;  3T6F A;  1OEJ A;  1SWK A;  2IZJ A;  3C77 X;  4QRL A;  5C0N A;  2CZU A;  4BBO A;  4O3W A;  4FBO A;  2FKG A;  2KW1 A;  5LJC A;  4YBU A;  4GJS A;  1N4J A;  2XST A;  2OFR X;  2UYW A;  4BX6 B;  4BGF A;  5CSE A;  4AZO A;  4JO6 A;  1EPA A;  1T0V A;  2JMB A;  1S2P A;  2OVD A;  2W2A A;  3I0A A;  4CPH A;  2KD2 A;  4R0B A;  1NDJ A;  2RTQ B;  4IBA A;  1I04 A;  5K67 A;  4IB7 A;  1E02 A;  1EUO A;  1ICM A;  4HWM A;  1SWS A;  4GDZ A;  3SZI A;  1EIO A;  1G5W A;  2RTM A;  4LKP A;  1ML7 A;  1YWB A;  2AVI A;  2YMS A;  5JD2 A;  4A1H A;  2IZD B;  2A2G A;  4O49 A;  5HZ9 A;  1YWD A;  1LDQ A;  1OBP A;  1LDO A;  1X8Q A;  2FR2 A;  1UZ2 X;  2JU3 A;  3C76 X;  1QG5 A;  3EBW A;  3KFF A;  4ZH6 A;  3RDQ A;  1E06 A;  1SWU A;  4BOE A;  3VG2 A;  2OF9 A;  3CR6 A;  1DZK A;  1KT3 A;  4EQA C;  1FTP A;  1S7D A;  1BJ7 A;  2ALL X;  3PQS A;  1CRB A;  1DV9 A;  3FEL A;  1QY0 A;  3KFI A;  3SZJ A;  4CPH B;  1AVD A;  3K3L A;  4JNJ A;  4EFG A;  1YWA A;  1KQX A;  1X89 A;  1ZRY A;  4Y0P A;  1SXY A;  5LJB A;  1LUQ A;  1NQM A;  1LCW A;  4Y0Q A;  1S44 A;  2X8T A;  3O19 A;  2OY8 A;  1QY2 A;  3APW A;  2EU7 X;  3DTQ A;  4ZCB A;  3D97 A;  1JJX A;  2LBV A;  2CBS A;  1G74 A;  1HMR A;  4BCS A;  4A60 A;  4GNW A;  1DZP A;  1JYD A;  3F9D A;  1Y0G A;  2A5B A;  3UEV A;  4INN A;  1SWO A;  1STS B;  2L67 A;  4U9C A;  3VHI A;  3BLG A;  1O1V A;  3RY2 A;  4GE1 A;  1SY0 A;  3ELX A;  1X8U A;  3ZW2 A;  2AH7 X;  1Y9L A;  2G8C O;  2I5V O;  4YCH A;  5F7G A;  4XMD A;  4HFO A;  4WHI A;  5HCD C;  3CQN A;  2IZC B;  3P02 A;  4GNY A;  3FA7 A;  1A57 A;  2HMB A;  1SWF A;  2Q2M A;  3RWX A;  4ZFX A;  5F6Z A;  2OFA A;  1LIB A;  2OVA A;  2Y32 A;  3O2Y A;  3LV4 A;  1ACD A;  5B2A O;  3S26 A;  2X8S A;  1B0O A;  1PMP A;  1SA8 A;  1Y53 X;  1JJJ A;  3ZUI A;  1B56 A;  1KOI A;  4LZU A;  4ORW A;  2ZAI A;  3AKN A;  1VWD B;  1VWQ B;  2K62 A;  4CPE A;  2RN4 A;  1Y52 X;  2F01 A;  5B5F A;  4Z2P A;  3BY0 A;  3VG3 A;  1LNM A;  3TGA A;  4OS3 A;  1ALB A;  1MX7 A;  4YDA A;  3TGC A;  2OY1 O;  4U3Q A;  4CDD A;  1KL4 A;  2HZQ A;  2Y3F A;  2A8G A;  3VGW A;  4IB8 A;  3UEU A;  1A3Y A;  4OMW A;  1SLD B;  2C1S A;  4HPD A;  4TLJ A;  2ACP X;  2BLG A;  3B2L A;  3FLL A;  1SRJ A;  1X71 A;  1GM6 A;  4YDB A;  1VWF B;  1MX8 A;  3WXQ A;  4BX6 A;  1VWB B;  4IAB A;  2RCT A;  2RTG B;  2Q9S A;  3BX8 A;  1SWB A;  3FEN A;  1EW3 A;  1P6P A;  1KQW A;  1XCA A;  4AZN A;  5HZ8 A;  4ORR A;  1I06 A;  1O1U A;  3V8U A;  3VE2 A;  2RQ0 A;  1JJU A;  2X34 A;  3HWD A;  4O4X A;  3MBT A;  3WJD A;  1VWN B;  2RTB B;  3DSZ A;  2JGS A;  1RBP A;  2K23 A;  4GJV A;  4XME A;  3LHN A;  1EI5 A;  1VPR A;  3RKG A;  1EAL A;  4YH0 A;  5EPQ A;  5D45 A;  2FTB A;  1VWA B;  1VWP B;  4NV7 A;  3KQ0 A;  3Q34 A;  5FQ8 E;  2A3F X;  1BEB A;  2DJG A;  3BU9 A;  2O62 A;  3UEW A;  1SY3 A;  2UZ2 A;  2G79 A;  4XMF A;  3SAO A;  3STK A;  3WJF A;  4COT A;  1GT4 A; 
#chains in the Genus database with same CATH homology
 1QWD A;  2HLV A;  1EPB A;  2OZQ A;  4I3D A;  3HK1 A;  1KT5 A;  2KTS A;  5FQ6 E;  4ODD A;  2KTD A;  2RD7 C;  4O9S A;  2WR6 A;  4QZT A;  1AB0 A;  2WEX A;  3D95 A;  1BM5 A;  1GKA A;  1T8V A;  3FR2 A;  5B29 A;  3D96 A;  3BX7 A;  1TVQ A;  1ERX A;  1FEN A;  3CBS A;  4ORU A;  3NX2 A;  1D2U A;  1I05 A;  3NQK A;  2X45 A;  2FRS A;  5KHP A;  3PH6 A;  4KC8 A;  4BVM A;  1OEK A;  1E5P A;  4XMG A;  3WBG A;  4ARH A;  4LQZ A;  3EBK A;  1DFV A;  2KT4 B;  2QM9 A;  4MVE A;  3ZUO A;  1HBQ A;  3GE2 A;  3HTY A;  3STM X;  2LKK A;  1PEE A;  3WOV A;  1B4M A;  4KT5 A;  2AT6 X;  2WQA E;  4U8U O;  5IO7 A;  4ALO A;  4AZR A;  2W2F A;  4JGL A;  5F58 A;  5IO5 A;  1QQS A;  3FR5 A;  5EED A;  5LJD A;  1BSQ A;  2JN3 A;  1HBP A;  4O3Z A;  5IO6 A;  2L9C A;  4HPA A;  3FMZ A;  3VPJ E;  3FYF A;  4OMX A;  4AZQ A;  5EEE A;  4ZHC A;  1EII A;  4QGW A;  4MVL A;  1SMP I;  3P6C A;  2F09 A;  1NP1 A;  2ANS A;  2R74 A;  1NP4 A;  1KZX A;  4FBV A;  3B2I A;  1GT1 A;  4M7M A;  3ZI8 A;  5HTE A;  3PED A;  4YKO A;  4NW4 A;  2OVE A;  1ERB A;  4EXZ A;  4QAE A;  1LF7 A;  5FAZ A;  4AYH A;  4QGV A;  1HN2 A;  3ELZ A;  4YGZ A;  2DM5 A;  1YIV A;  3T1D A;  2OFM X;  2BT9 A;  2LA7 A;  1JZU A;  3FR4 A;  3B2K A;  5HAE A;  3FW4 A;  3OD9 A;  4GZV A;  5CYB A;  2ASN X;  3FA8 A;  1TXL A;  1JIW I;  5D47 A;  5JR8 A;  4ES7 A;  4AZM A;  3KFG A;  4QYP A;  4O4S A;  1LPJ A;  1JV4 A;  2FWV A;  1GT3 A;  4D6B A;  3L4R A;  1SXU A;  4DQ4 A;  5HWZ A;  4NNT A;  1HQP A;  3OJY C;  1G7N A;  2Z4H A;  2JU7 A;  2X46 A;  5BVS A;  1OPB A;  2G78 A;  5HBS A;  1D3S A;  2BS6 A;  2A13 A;  4TQ2 A;  2JU8 A;  5B27 A;  1ZNG A;  5LJG A;  4TJZ A;  1HMS A;  2MM3 A;  3CMP A;  4GRJ A;  5HZQ A;  4YBP A;  1GGL A;  4AZP A;  1JYJ A;  3NQ9 A;  1GX9 A;  3NP1 A;  2GTL N;  4O4U A;  3FEP A;  4MVI A;  1QY1 A;  3WJG A;  2MWH A;  1TW4 A;  1OBQ A;  4ID2 A;  1KT4 A;  1LIE A;  2R56 A;  2AT0 X;  3ZZV A;  2QO5 A;  2LB6 A;  3HWG A;  2YG2 A;  5HCC C;  4CV7 A;  2XKL A;  4FGI B;  1FEL A;  1CBS A;  2HNX A;  4IB6 A;  2WQ9 A;  4O3Y A;  1G85 A;  1FE3 A;  3S60 A;  5BYP A;  4ZJ0 A;  1OEE A;  4PJ2 A;  4YCE A;  3Q6L A;  1BBP A;  4M6S A;  1ZND A;  1AQB A;  3NAD A;  4I9S A;  5EZ2 A;  1NGL A;  5LKF A;  4HPB A;  4O3X B;  4QQ1 A;  4FQB B;  4L1N A;  1RLB E;  3FW5 A;  4N7D A;  2BS5 A;  3I17 A;  4OS0 A;  2R73 A;  3NQ3 A;  4UU3 A;  4AW8 A;  2NP1 A;  2IFB A;  5HA0 A;  4A8Z A;  3AKM A;  2AL0 X;  5F1E A;  5FEN A;  1IKJ A;  3TGB A;  2JOZ A;  3RSW A;  2L68 A;  3UAQ A;  1Z24 A;  4MIS A;  2A0A A;  5EDB A;  4OS8 A;  4CK4 A;  2LBA A;  2QO6 A;  3QKG A;  4YMY A;  3BDR A;  1BLR A;  2P8G A;  3P6G A;  2AT3 X;  1SXW A;  2GC9 A;  5L8I A;  1U17 A;  3S5V A;  1VYF A;  5H9N A;  2AT8 X;  4CSB A;  1YUP A;  3O22 A;  4LKT A;  3RZY A;  2GTL M;  3BS2 A;  3BU1 A;  1GXA A;  2CM4 A;  1BRQ A;  1T68 X;  4YGG A;  3APX A;  1BRP A;  1X8N A;  1QFV A;  1TOU A;  2PY1 A;  4HPC A;  2CZT A;  4YFQ A;  4ZHG A;  4N7C A;  1Y9T A;  1A18 A;  2CBR A;  2POA A;  5AJC A;  2AKQ A;  5H9L A;  3VU1 A;  5AQ6 A;  3APU A;  4GET A;  5F6B A;  1FEM A;  3BSZ E;  5DG4 A;  2W2B A;  4ON1 A;  3F6Z B;  4KC7 A;  3RBY A;  2RCQ A;  1GKA B;  1LIC A;  2F73 A;  1YP6 A;  3VG4 A;  4ZGU A;  3H3I A;  2RA6 A;  3HOE A;  3MX7 A;  4GK9 A;  5FFH A;  1OBU A;  3HWF A;  5AJB A;  2A2U A;  3P6E A;  2WUT A;  4YFP A;  1JBH A;  4I95 A;  5DPQ A;  4TKJ A;  2M4L A;  3ZW1 A;  3NBX X;  4UU2 A;  5H8T A;  1I4U A;  1YP7 A;  3N91 A;  5CE4 A;  5L8O A;  1KZW A;  4TKH A;  2G7B A;  1IFB A;  3MVF A;  2E4J A;  4NYQ A;  4KII A;  4IMO A;  1B8E A;  3GAQ A;  4IB9 A;  2NNQ A;  2WWP A;  3TF6 A;  2NND A;  3EM0 A;  3VG6 A;  3WVM A;  1QAB E;  5K06 A;  2FS6 A;  3BRN A;  2ACO A;  5D48 A;  4ZR2 A;  2Q4N A;  1N0S A;  1YWC A;  4YKM A;  3CBC A;  1XKI A;  2QO4 A;  3WJB A;  4L3R A;  1IIU A;  3U9P C;  1O8V A;  5LJE A;  3NPO A;  1U18 A;  1KT6 A;  4KH8 A;  4GU8 A;  4ML7 B;  3PPT A;  4IAW A;  5BVT A;  3APV A;  3C78 X;  1AVG I;  1TOW A;  4QGX A;  3CWK A;  3FA9 A;  4I3B A;  3NR3 A;  3ZW1 B;  1ICN A;  4ZHF A;  1HMT A;  2FR3 A;  4ZH9 A;  4NP1 A;  1X8O A;  2Q2P A;  4O4O A;  4NYR A;  4YGH A;  1PBO A;  1LKE A;  5HA1 A;  2Q39 A;  4QNI A;  4RUU A;  1CJ5 A;  4IAX A;  3HOL A;  4MIR A;  1E00 A;  2JW1 A;  4NLJ A;  4GKC A;  1CBI A;  3OBL A;  5L8N A;  2WSJ A;  1BWY A;  4QYN A;  2CM9 A;  3G7X A;  1FDQ A;  3UEX A;  4WFU A;  1SY2 A;  1ZNE A;  2AMM X;  2Z4I A;  4I3C A;  1A2D A;  4GH7 A;  1SY1 A;  3HWE A;  1X8P A;  3FEK A;  4ORY A;  1ZNK A;  3B2J A;  1AEL A;  4ALB A;  1ZNL A;  5H9K A;  5LJH A;  1GT5 A;  2OVS A;  3VG5 A;  4EEJ A;  2ZAG A;  2GTF X;  3JQO A;  2NNE A;  2GJ5 A;  1PM1 X;  2MO5 A;  3F8A A;  3P6D A;  3ZW0 A;  3CQR A;  4XMC A;  5FQ7 E;  3WJC A;  2N93 A;  1LID A;  3FA6 A;  3SOT A;  3VE1 A;  5EDC A;  4WFV A;  1LFO A;  4KCA A;  4ZHH A;  2HYS A;  5BVQ A;  5LKE A;  5D4A A;  1OPA A;  1QFT A;  3E3C A;  4MVK A;  3VG7 A;  3IA8 A;  4NNS A;  4U8U N;  1KT7 A;  5KIC A;  3U0D A;  3P6F A;  1SXX A;  3JS1 A;  4PSQ A;  1U0X A;  3NX1 A;  1MVG A;  2X8F A;  4ZGF A;  4ORX A;  1ZNH A;  5D8J A;  4EDE A;  3KZA A;  4I9R A;  3FIQ A;  3PP6 A;  4FBR A;  3ZW0 B;  2WEW A;  5H9A A;  4XMH A;  3U03 A;  4RUN A;  4ORS A;  1VYG A;  2FT9 A;  3EYC A;  4WBK A;  4I6S A;  4IMN A;  3EMM A;  3KFH A;  1ADL A;  3ZWE A;  4YFR A;  1KXO A;  1L6M A;  2L5P A;  2FS7 A;  1GX8 A;  1IFC A;  4TNN A;  4Y0S A;  1MDC A;  4K19 A;  3B2H A;  4TKB A;  3JSQ A;  3ZQ3 A;  5KID A;  1DF3 A;  3PH5 A;  5HZ5 A;  2AT5 X;  1BSO A;  4QZU A;  2LFO A;  5LJK A;  3PEC A;  1CBQ A;  1BSY A;  1R0U A;  4BQU A;  5HTD A;  4DQ3 A;  1IW2 A;  3OE3 A;  1DZJ A;  5HCE C;  4ZHD A;  3PQU A;  1DZM A;  2MJI A;  3STN A;  1EXS A;  3S5X A;  5HZ6 A;  4Y0R A;  2QOS C;  1DC9 A;  3P24 A;  2HZR A;  4D6A A;  1H91 A;  3TZS A;  3WJE A;  2BHV A;  1CBR A;  2MHD A;  5AEO A;  2GTL O;  2FLJ A;  4A1Y A;  1KGL A;  4NLI A;  1LIF A;  2QMI A;  1MUP A;  4U8U M;  3IFB A;  3D4R A;  1URE A;  3P6H A;  4LZV A;  1IKE A;  1EQD A;  1OEJ A;  3C77 X;  4QRL A;  5C0N A;  2CZU A;  4O3W A;  4FBO A;  5LJC A;  2KW1 A;  4YBU A;  2XST A;  2OFR X;  4AZO A;  1EPA A;  1T0V A;  2JMB A;  1S2P A;  2OVD A;  2W2A A;  3I0A A;  2KD2 A;  4R0B A;  4IBA A;  1I04 A;  4IB7 A;  1E02 A;  1EUO A;  1ICM A;  4HWM A;  4GDZ A;  1EIO A;  1G5W A;  4LKP A;  1ML7 A;  1YWB A;  2YMS A;  4A1H A;  2A2G A;  4O49 A;  5HZ9 A;  1YWD A;  1OBP A;  1X8Q A;  2FR2 A;  1UZ2 X;  2JU3 A;  3C76 X;  1QG5 A;  3EBW A;  3KFF A;  4ZH6 A;  1E06 A;  4BOE A;  3VG2 A;  3CR6 A;  1DZK A;  1KT3 A;  4EQA C;  1FTP A;  1S7D A;  1BJ7 A;  2ALL X;  3PQS A;  1CRB A;  1DV9 A;  3FEL A;  1QY0 A;  3KFI A;  3K3L A;  4EFG A;  1YWA A;  1KQX A;  1X89 A;  1ZRY A;  4Y0P A;  1SXY A;  5LJB A;  4Y0Q A;  1S44 A;  2X8T A;  3O19 A;  1QY2 A;  3APW A;  2EU7 X;  3DTQ A;  4ZCB A;  3D97 A;  1JJX A;  2LBV A;  2CBS A;  1G74 A;  1HMR A;  4A60 A;  4GNW A;  1DZP A;  1JYD A;  3F9D A;  3UEV A;  4INN A;  2L67 A;  4U9C A;  3BLG A;  1O1V A;  4GE1 A;  1SY0 A;  3ELX A;  1X8U A;  3ZW2 A;  2AH7 X;  1Y9L A;  4YCH A;  5F7G A;  4XMD A;  4HFO A;  4WHI A;  5HCD C;  3CQN A;  3P02 A;  4GNY A;  3FA7 A;  1A57 A;  2HMB A;  2Q2M A;  3RWX A;  4ZFX A;  5F6Z A;  1LIB A;  2OVA A;  3O2Y A;  3LV4 A;  1ACD A;  3S26 A;  2X8S A;  1B0O A;  1PMP A;  1SA8 A;  1JJJ A;  3ZUI A;  1B56 A;  1KOI A;  4LZU A;  4ORW A;  2ZAI A;  3AKN A;  2K62 A;  2RN4 A;  3BY0 A;  3VG3 A;  1LNM A;  3TGA A;  4OS3 A;  1ALB A;  1MX7 A;  4YDA A;  3TGC A;  4U3Q A;  2HZQ A;  4IB8 A;  3UEU A;  1A3Y A;  4OMW A;  4HPD A;  4TLJ A;  2ACP X;  2BLG A;  3B2L A;  3FLL A;  3WXQ A;  1X71 A;  1GM6 A;  4YDB A;  1MX8 A;  4IAB A;  2RCT A;  2Q9S A;  3BX8 A;  3FEN A;  1EW3 A;  1P6P A;  1KQW A;  1XCA A;  4AZN A;  5HZ8 A;  4ORR A;  1I06 A;  1O1U A;  3V8U A;  3VE2 A;  2RQ0 A;  4O4X A;  3WJD A;  3HWD A;  3MBT A;  3DSZ A;  4XME A;  1RBP A;  2K23 A;  3LHN A;  1EI5 A;  1VPR A;  3RKG A;  1EAL A;  4YH0 A;  5EPQ A;  5D45 A;  2FTB A;  3KQ0 A;  5FQ8 E;  2A3F X;  1BEB A;  3BU9 A;  2O62 A;  3UEW A;  1SY3 A;  4XMF A;  2G79 A;  3STK A;  3SAO A;  3WJF A;  4COT A;  1GT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...