1MUZA

Nmr structure of the tumor suppressor bin1: alternative splicing in melanoma and interaction with c-myc
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
81
Chain Sequence
b'GRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKKLEKCRGVFPENFTERVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myc box dependent interacting protein 1
publication title A structure-based model of the c-Myc/Bin1 protein interaction shows alternative splicing of Bin1 and c-Myc phosphorylation are key binding determinants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 12
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2002-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1muzA00
1Y57A 2J6KA 2W10A 5IH2A 1JXOA 1J3TA 4IIOA 1T3LA 3M0PA 2FRYA 2A36A 2KRMA 2A37A 4OMOA 3ZL7C 3NPFA 4OMNA 2JMAA 5HCKA 3UATA 1UDLA 2KEAA 2IIMA 2H8HA 4M4ZA 4HVUA 2CDTA 2ED0A 4J9EA 2EYWA 4J9CA 2C0IA 1HD3A 4AG2C 4Y92A 1AWWA 1QLYA 5I22A 1UG1A 2K7AA 2W0ZA 1UGVA 5ECAA 2ABLA 2F2XA 1M27C 2J06A 1W1FA 2CREA 2DBKA 2VKNA 1OOTA 1UHCA 1PRLC 2CT4A 3M0SA 2EVRA 1BU1A 3IQLA 4DEXA 1ZSGA 2K2MA 2XMFA 4CC3A 1Z9QA 1LCKA 2CT3A 2VWFA 2K3BA 4D8KA 4DEYA 3I5SA 1W70A 1NEBA 4WCIA 4K11A 2PZ1A 4LUEA 2KGTA 4RUGA 2EBPA 1YCSB 1NEGA 2ROTA 1I07A 2AK5A 2DL3A 1V1CA 5FWCA 1SHFA 1AD5A 2KT8A 1GFCA 1G83A 5IXBA 3M0RA 3PE0A 5IHIA 1YWPA 1E7OA 1AWXA 1K1ZA 1ZLMA 1K0XA 2ECZA 1K76A 2KNBB 1U06A 2NWMA 2KRSA 1PHTA 2KYBA 1H92A 1NG2A 2DM1A 2DILA 3H0IA 1K0SA 1BBZA 3UA7A 3TSWA 2YUNA 3EG0A 1OPLA 2B86A 1RLPC 2O9VA 5GJVB 2RQVA 1KSWA 2JXBA 1UECA 1PWTA 2AZSA 1M3AA 2DJQA 4RTVA 1HJDA 1UHFA 3CQTA 1WFWA 2A08A 4RTWA 3NMZC 2EW3A 2M51A 2JT4A 5IHKA 1M8MA 1U3OA 1GFDA 2X3WD 1JQQA 4IIMA 2KT1A 2L0AA 3EG3A 2FO0A 1X69A 1AEYA 4RTUA 2KRNA 3NHNA 3REBB 2GTOA 1BB9A 2DL4A 1H8KA 4RTTA 1NYFA 1WIEA 1GRIA 2ED1A 2YUOA 3VS6A 1I1JA 1JEGA 3H0FA 2DA9A 4J9GA 3LH5A 2DE0X 1FMKA 2O9SA 1T0JA 1TUCA 1BK2A 3THKA 3VRYA 2HSPA 1PKSA 2ROLA 2HCKA 2LJ0A 2RQUA 4JZ3A 2JS2A 2DL8A 2EPDA 2LJ3A 2JM8A 1NLOC 2OJ2A 1ARKA 2DNUA 1RUWA 2ESWA 3VS2A 3JV3A 3EG2A 1SHGA 1WA7A 3ULRB 2JTEA 4EIKA 1RLQC 2V1QA 2AZVA 4J9BA 1AZGB 1AZEA 3H41A 1KJWA 2D8HA 3SHWA 3R6NA 1WX6A 3RNJA 2DL7A 1X27A 4ESRA 2EGCA 4HXJA 1HSQA 1YP5A 2SRCA 1YWOA 1VYUA 2I0NA 2AKKA 3UA6A 1MV0B 2JS0A 2V1RA 4LUDA 2VVKA 2QDLA 2RQRA 2YDLA 4GBQA 1AWJA 2DVJA 4J9IA 1T0HA 1WXTA 4Z8AA 1G2BA 1GCQC 1E6GA 1S1NA 1B3QA 4JPBW 1SRMA 2EGEA 1UUEA 2JW4A 2KXDA 1SRLA 3REAB 1XOVA 2EYZA 2F2VA 2EGAA 4F16A 1GCPA 4A63B 2J6OA 2JM9A 2FG0A 1SSHA 3FJ5A 1RI9A 1WXBA 2LP5A 1WI7A 1ABOA 3PVQA 3QWXX 2CH4W 1NLPC 2E5KA 3VS1A 1NYGA 4HCKA 4J9HA 3M0TA 2FEIA 4Z88A 2DLPA 3VS7A 4LN2A 2O88A 2GGRA 1OEBA 2CH4A 2BZYA 2DRKA 1QKWA 4RTYA 4AFSC 2EYYA 3TVTA 2K79A 4AFZC 1GBQA 2SEMA 1EFNA 4D8DA 2HEQA 1UE9A 2C0TA 3C0CA 1CKAA 2DF6A 3VS4A 2GTJA 2FRWA 2PTKA 2RMOA 1SEMA 4JZ4A 2JMCA 2OI3A 1CSKA 1PNJA 2F2WA 1YNZA 3I9QA 5FWBA 2D8JA 2G6FX 1ABQA 1VYVA 2LZ6B 4CC7A 2C0OA 3GBQA 4OMQA 1UJYA 3A98A 3EHRA 4F14A 2RF0A 2YSQA 2L3SA 2M0YA 2KROA 1U5SA 2RPNA 1QCFA 2LQWA 2DL5A 2EKHA 1E6HA 4ORZA 2BZXA 5FW9A 2CUBA 2J05A 5EC7A 3SEMA 2FPDA 3O5ZA 3RBBB 1ZUYA 4ZNXA 1GBRA 2HDAA 2OAWA 2BZ8A 2DMOA 2RNAA 4LE9A 2YUQA 1QWFA 4JJBA 1WLPB 2RN8A 2PNIA 4RTZA 1M3CA 2AKLA 1GCQA 1UFFA 2DYBA 4HVVA 3KFVA 3M0QA 1ZUUA 1H3HA 2FPFA 2X3XD 1N5ZA 2LJ1A 2CSIA 2GQIA 2GNCA 3VS3A 3QWYA 5IHNA 4AFUC 1YN8A 1FYNA 2DRMA 4LNPA 2LQNA 1JU5C 2J7IA 5L23A 2CUDA 1Z9ZA 1X6BA 2BTTA 2K9GA 1VYTA 1X6GA 2NUZA 4JJDA 1AWOA 4J9FA 2LCSA 1PRMC 1WYXA 3I5RA 4OMPA 4RTXA 1JO8A 4CC4B 1JXMA 1MUZA 2J6FA 1K9AA 4AFQC 2KR3A 2KE9A 1KFZA 1OV3A 2LMJA 2RQWA 3PVLA 1CKBA 5GJWB 3NGPA 1GL5A 1ZUKA 1AVZC 3H0HA 3EGUA 4GLMA 1I0CA 1OPKA 1SPKA 4E6RA 1B07A 4HVWA 2CSQA 2YT6A 2MCNA 3M0UA 2KXCA 4FSSA 4OMMA 3UF4A 4AG1C 1UTIA 2RQTA 2GBQA 1A0NB 1PKTA 2MOXA 1T3SA 4CC2A 4Z89A 1TG0A 5I11A 1QWEA 4R0KA 2ENMA 1ZX6A 2EQIA 2MIOA 2YUPA 2O2OA 3VS0A 2LX7A 4QT7A 2DBMA 3EG1A 2EYXA 1AOJA 1VA7A 3I35A 1M3BA 1W6XA 2P4RA 2KBTA 1WDXA 3TSZA 1MV3A 1ZBJA 2D0NA 1TUDA 1WXUA 2L3QA 2DX1A 3VRZA 4J9DA 1KIKA 2FPEA 1UJ0A 1X43A 2O31A 2A28A 3EHQA 1X2KA 2L3PA 1K4US 1IO6A 2KYMA 5IXFA 1NM7A 1QKXA 1M30A 4KRTA 2HBWA 3U23A 2L2PA 2D1XA 3VS5A 4JJCA 4F17A 1Y0MA 2K6DA 4OMLA 2LNHB 4X1VA 1X2QA
chains in the Genus database with same CATH superfamily
4MMLA 1JXOA 3VJPA 1C0MA 4IIOA 2CZ1B 1T3LA 3A8OB 4OMOA 2A37A 3ZL7C 4OMNA 2ZPEB 1NJIR 2PVGB 4KUIA 2IIMA 2E4HA 1G3TA 5CK9A 3INZA 1MMGA 4KGXB 2DTOA 2EYWA 2CKKA 4J9CA 3OW2P 3CCUA 1KHCA 1U1TA 2CP2A 5I22A 2K7AA 5ECAA 5GAN7 1WGSA 2HAXA 2KK4A 1W2BA 1G3SA 1M27C 2J06A 1W1FA 4QQ6A 4RKUE 3G71A 3CCEQ 2DBKA 2E3HA 1YIJT 1B7TA 4B9XA 1UHCA 3VUZA 1OX9A 3IQLA 3LGLA 2MWOA 3JB9D 1ZSGA 3E9FA 1Z9QA 1LCKA 3LYIA 4F7UE 2VWFA 1N27A 3I56Q 4D8KA 4DEYA 3M56A 1W70A 1NEBA 3AHUA 1VQ4Q 4K11A 3SB2A 2KGTA 3HSBA 2BUDA 3HFNA 4M7DB 1VQOQ 4BE0A 3A1PA 3H6ZA 1EIFA 2KT8A 4DA4A 3CCJT 1JJ2A 1TTHB 1NJIU 1GFCA 5CQYA 2GCXA 1E7OA 4M75C 4JRPA 2ECZA 1U06A 2OTLQ 2NWMA 4QVDA 1PHTA 3RKYA 4GLKA 3JCMc 3VU3C 1YI2T 3R6OA 2WACA 3G4ST 1UECA 2DYIA 2CZ6B 4RTVA 4PKCC 1HJDA 1X75C 4M77D 3CCLT 3EFRA 3X25B 2HD0A 2M51A 3LW5E 4RG2A 2Y4XA 1MGQA 1LVKA 5IHKA 1VQ7A 1M8MA 3CCUQ 5KE3A 4NL2A 2JN0A 1JQQA 3CC7T 4C0FA 3E19A 5A2QE 2DZCA 1VQLT 1YJNQ 1AEYA 2E5QA 4LXCA 5DM7R 2DL4A 1H8KA 3DB4A 4RTTA 4RCCA 3CCRT 1VQ8T 4PJNA 1YFNA 4XK8E 1BI0A 2YUOA 2ED1A 2P84A 3VS6A 1I1JA 4ZGEB 1YIJA 3LH5A 5LJ3f 4FSXA 2JUFA 2O9SA 1RAHB 4J8OA 1RADB 1T0JA 1TUCA 1BK2A 2M1HA 3CCMQ 5FU7B 2JS2A 1M5Q1 1WHHA 1RUWA 2DNUA 4QQGA 2GQVA 3VS2A 3JCMW 1SHGA 2QA4T 1NBEB 4A53A 4EIKA 3UWNA 4M77C 4UC4A 1HK9A 3CC2T 1FMWA 1NPPA 2COZA 4FCYA 4PJOD 1KJWA 1WX6A 2A7YA 2DL7A 2EGCA 1FX7A 2I0NA 2QAZA 3PIOA 2JS0A 4LUDA 1OZ2A 1D0YA 1YI2A 2MMPA 4E7JA 9ATCB 1G2BA 1GCQC 3MEAA 2EGEA 1UUEA 1KK7A 1SRLA 3WVDB 2EYZA 1I8FA 4F16A 2JM9A 1R8OB 2FG0A 3QDFA 4NS5A 1RI9A 3JCMf 4ME7A 3CC4T 1K73R 1VQ9A 3QWXX 3HTRA 3GNFB 5C6SA 4KUDK 2E64A 2D0QB 1VQLA 4Z88A 1YIJQ 2DLPA 3G7ZA 1ZQ1A 2DKGA 4LN2A 5FROA 3M59A 5HK3A 3UDCA 3QG1A 2E65A 3CCRA 2QEXT 3EFOA 3M54A 4RTYA 4BDZA 1VQ8A 3DKMA 3GIBA 5I2SA 4N0AA 3TU4K 1GBQA 4YTLA 2HEQA 5CKBA 2C0TA 2QQ9A 3C0CA 3VS4A 3GF5A 2GTJA 2FRWA 1G3YA 2CP3A 4A4GA 3CCJQ 5LJ5f 3CBPA 5GAOr 1VQMT 1CSKA 5IN1A 2F2WA 5D6YA 5FWBA 5LJ3g 1ABQA 1QCNA 1VYVA 2LZ6B 2C0OA 2X4JA 1K73U 1RAIB 3N5BB 1ZSZA 3EHRA 1Q86C 1O75A 2L3SA 4HCCA 1YI2Q 2M0YA 1N8RC 3HRTA 3CC2A 1I4K1 4C8QA 1D0ZA 2LQWA 3OYCA 4OB0B 3FLGA 3G4SQ 1WJRA 2J05A 1X6OA 4M75B 1ZUYA 2YRDA 3CEYA 3OS0A 1M1GA 3OMGA 2RNAA 3CCLQ 3DB3A 1WLPB 2DERA 1M1KC 2AKLA 1VQNT 2DYBA 3HRUA 4PJOF 2LJ1A 2XKOC 3CC7Q 3RMSA 2GNCA 3PNWC 4C5GA 3CCQT 1VQLQ 2G3RA 2FZCB 4LNPA 3A8HB 2J7IA 1PC0A 2VGNA 1X6BA 5IT9E 3OYAA 4M7DD 3V7CA 2EQJA 2KSSA 3CC4A 3CCRQ 1PRMC 2NUPB 3I5RA 4C8QG 2CP6A 2EFIA 1VQ8Q 4E7SA 3M4GA 2J6FA 4AT1B 4EMHA 2QI2A 1V29B 2KE9A 4A4FA 2R57A 2LMJA 2RQWA 4XU3A 5GJWB 3JCMg 3H0HA 4C92F 4R55A 4LDUA 5HKCA 2XIDA 2YT6A 4E47A 3EGXA 4M78G 2QEXA 4LDWA 4FSSA 4AG1C 3FRNA 2COYA 2PQWA 1UGPB 2IPOB 1UTIA 4EMKC 2QA4Q 5EG2A 4OVAA 2GBQA 2X9HA 1M90R 3E1SA 1VQKT 5GAN6 3CBMA 5A0GA 3CC2Q 2JNGA 1LNXA 4OGCA 4MMKA 1Q7YC 5I11A 2RO0A 5KE2A 1QWEA 4R0KA 1ZX6A 2DJZA 4X9DA 4ZTJA 2NUTA 2O2OA 1AT1B 1QP2A 3CPWS 3VS0A 2LX7A 1M4ZA 2LQ8A 5LJ5g 2KQWA 2KMTA 4WF2A 2D9TA 1Y07A 2EYXA 1AOJA 1VA7A 4M77B 2HNIA 2CGHA 1TS9A 1W6XA 3PGGA 1B34A 4M7DC 2DFUA 1Q81C 2CS7A 3BY7A 2QGGA 3VRZA 1KIKA 2FPEA 3RKXA 1UJ0A 4E7LA 4XU1A 5GMKm 3CC4Q 1M90U 3SD4A 3NFCA 3CCSA 3U23A 1QVFA 3CCQA 2DIGA 3CCVT 2LNHB 5GAMh 3QZ9B 1Y57A 2QXFA 2W10A 2JJ9A 3OB9A 1J3TA 2DXTA 2DIQA 1WHJA 1IB8A 2FRYA 3A8MB 1S72T 2MPXC 2OTJT 4DQ2A 3NPFA 3EFSA 2QEXQ 3UATA 1UDLA 2KEAA 2H8HA 2LCCA 4KH1B 4HVUA 2ZZDA 4FT2A 2ATCB 3OW2A 4AG2C 4Y92A 3HL8A 1KQ2A 2W0ZA 3RUXA 2F2XA 1VQMQ 2XD0A 2JVVA 4L5GA 4ZN3A 1WQWA 2E12A 2EQMA 4JLIA 2XMFA 3WXMB 4DBQA 2CYZB 1VUBA 2CT3A 1NZ9A 4C5IA 1WJSA 4QVCA 1RAEB 3I5SA 1VQKA 2QK0A 3QZ5B 1RI0A 1TXQA 4LDXA 3MHXA 1YCSB 3OYEA 2AK5A 2DL3A 1V1CA 2RI2A 1TU0B 2O01E 1U8RA 3J81E 3RESA 4ELZC 1SKUB 1G83A 4M78C 1P92A 1Y96B 3KUFA 3FJPA 2QASA 1VQNQ 1YJWT 1K1ZA 3KBGA 2V8IA 4HCBA 5FU6C 3CCEA 2XU8A 1NG2A 3CCQQ 4BB7A 2DM1A 2DILA 3CXCA 1BIBA 1K0SA 1SG5A 1SF9A 3GP8A 4BI3A 2L5QA 3I56A 4CRIA 3MP8A 1HYOA 2AZSA 1M3AA 1VQ4A 2DJQA 4F7UG 1UHFA 3CQTA 4PLLA 3CPWP 4RTWA 1VQOA 3X24B 1TOVA 2JT4A 2HKQB 4E7ZA 1ZA2B 3DLMA 2RJEA 1S72A 4IIMA 2OTJA 2L0AA 2FO0A 3D7SB 1FXXA 1X69A 3P8DA 4BY6C 1D09B 3QYHB 2OTLA 2KRNA 4M7AD 2GTOA 1BB9A 3OYHA 1QVFP 4HCZA 3QO3A 3BE3A 4O5VA 1VQKQ 1NYFA 1WIEA 4J6XA 1R0CB 2AT1B 4QW2A 3H0FA 3LX7A 1XJWB 4RCBA 4RG8A 3M4YA 1FMKA 1QVPA 3BDLA 4OMFB 3THKA 3VRYA 4CI0C 4EMKB 3MPUB 2KY9A 2EPDA 2M16A 1WHKA 2JM8A 1NLOC 1VQPT 3GOXA 2OJ2A 4PJJA 3EGDB 1D3BB 1MNEA 2ESWA 2DETA 2WSFE 5GMKl 3JV3A 4JJNK 3ULRB 1WA7A 1YJNA 4J9BA 1EZZB 2VUBA 3L42A 3NTIA 1KC8C 1I5LA 1AZEA 2D8HA 4J5YA 3V8KA 5KYUB 2H3JA 3SHWA 4C0DC 4ESRA 1C1AA 1NPRA 4HXJA 2SRCA 1YWOA 3X28B 1VYUA 2AKKA 3JAME 5I21A 2VVKA 1M90C 2RQRA 2YDLA 3CCVQ 5M9OA 2P0KA 1LJOA 4J9IA 4M7AC 3LH0A 3X20B 2XDDA 3MEWA 3CCMA 5GMKi 4IUVA 1S72Q 1B3QA 4JPBW 2OTJQ 2JW4A 2KXDA 3REAB 1IGQA 4XU0A 2JTFA 5HY6A 1M2VA 5CKEA 4PJOA 8ATCB 5KYXB 3CXCP 1WI7A 1XNIA 3DLLA 3CMET 2LX9A 1ZHIA 1G3WA 2CZ0B 2E5KA 4HCKA 1XTDA 2HQEA 3EFOB 4Y91A 3OYMA 2QQBA 2EIFA 4FW1A 2XICA 4JRKA 2O88A 2GGRA 2FZGB 1PD0A 2F69A 4AFSC 2EYYA 1IXDA 2K79A 1RAFB 4D8DA 4C92A 1UE9A 2DF6A 2MI6A 3L2QA 2A0FB 4ELYC 2RMOA 4QVZA 2EJGA 4JZ4A 3SFMA 3C4SA 1YNZA 4C8QB 3JSCA 4M75F 1YJWQ 4XTYA 2G6FX 3OS5A 2QDYB 4MZTA 3A5ZB 1UJYA 2QQSA 3CBOA 1KD1C 2YSQA 5LJ3h 1N9SA 2RPNA 2R58A 1WQ7A 2DXCA 2YLBA 4M78B 1E6HA 4ORZA 2BZXA 2P4TA 2E10A 3WVEB 3OYFA 3CMAT 3MCAB 2HDAA 4KULA 1GBRA 1TWBA 4N4GA 3JCMJ 5FU6B 1QWFA 2X4WA 1K9MC 4C92G 4RTZA 4BUGA 1M3CA 2E3IA 2LTOA 3KFVA 2BKDN 3JB9F 3CCJA 1H3HA 2DK3A 1WHLA 2WSCE 3QWYA 2LNVA 2YLCA 4AFUC 3H9NA 5KYYA 2RHXA 2MWPA 3X26B 1JU5C 2CUDA 2PU9B 1YHQT 2B8AA 2NUZA 4F04B 3I55T 2K2VA 4J9FA 4ZGJB 5GANd 4CC4B 5GAN4 3G4SA 2KR3A 1KFZA 2RI5A 1TSFA 1CKBA 1Y7XA 4IURA 1WZOA 4BY6B 1AVZC 4GLMA 1OPKA 3CCLA 4PJOE 3M9QA 2QTXA 4HVWA 2MCNA 3JCMh 2DEQA 1OU9A 3M0UA 4LDVA 1VQPQ 4D6WA 3ZBDA 4BACA 2LC4A 4KGZB 3CC7A 3VV0A 4BE2A 1D1BA 1A0NB 1UGRB 2QTVA 5GMKe 3L2UA 4M77F 4CC2A 3J80E 1FWZA 3LWHA 1Q82R 3CD6T 1B34B 5D7UA 2R5AA 2JTMA 3JB9I 3QXEB 4C92E 2FHDA 4C0GA 2COWA 3E9GA 2ZGWA 2C06A 4XTVA 1DJ7B 3I35A 2P4RA 5GANe 3P8BB 2KBTA 5LJ5h 3HP9A 4XTXA 5CKHA 2O4XB 3TSZA 4B6MA 5KYWB 3META 4C0DB 1NJIC 3M57A 3OYJA 2L3QA 3S3OA 3JCMV 5GAMj 2QA4A 1X43A 2O31A 1I81A 1K4US 1IO6A 4N4HA 5IXFA 3CMEQ 1QKXA 4M7AB 5GAMd 1M30A 2XI9A 3NTKA 2A3LA 2M0OA 2DPPB 4QKUA 2VXEA 4OMLA 4OF1A 1Q82U 4X1VA 1K8AR 2J6KA 2K5IA 5IH2A 3GNGA 4FYYB 4X9CA 3M0PA 2BE9B 2GFAA 2QG9B 2A36A 2KRMA 1YHQA 2FVUA 3I55A 4M4ZA 1QVGS 6AT1B 5GMKh 4RMOA 1V76A 4MDWA 1BKBA 3OS1A 2YWWA 4BE1A 3PT9A 5CQXA 1GXIE 1UGVA 2ABLA 2CREA 2EQKA 2YXYA 1VIFA 4F7UB 2Y4YA 3QJ6A 1BU1A 4BDYA 4L59A 1IHVA 1QW1A 1G8XA 2DEUA 2YHTA 3UT1A 3SWNA 4BI4A 3MO8A 2QQAA 1WHGA 2LRQA 4Y28E 5GANh 5GAN8 4KH0B 4LUEA 2DTIA 1KQSS 5GAMe 1K8AU 2EBPA 1UGQB 3CD6A 1I07A 3CMAQ 3OSSC 5IXBA 4M7DE 3M0RA 1IREB 1YWPA 1AWXA 3G6ET 4GY5A 2X35A 1MMAA 1ZLMA 4OB1B 4VUBA 1K76A 5A0DA 2KNBB 1VQMA 3V7SA 1Q95G 4PLIA 5D6WA 3MKDA 2YUNA 3FIFA 1OPLA 1ZBXA 2B86A 5KH6A 1RLPC 3EG9A 3PIPA 2O9VA 2DTHA 2X51A 5GJVB 3OBWA 1KSWA 2JXBA 2VGMA 1YHQQ 4HT9A 1PWTA 3I55Q 1IZ6A 3C95A 3CPWA 1RABB 2RH2A 3NMZC 5GAOq 2ZPFB 4J83A 5KYNA 1OZ3A 2RJFA 4EMGA 2EW3A 1PSEA 4ZN1A 4C8QD 5DY9A 2P0PA 1UGSB 5KCHA 2KT1A 3EG3A 2PUKB 1VQNA 3VYGA 2ZPIB 3OY9A 3REBB 1MMNA 1PSFA 4M78D 2XHCA 3EH1A 3S6WA 1W4SA 3QYGB 2E1HA 3CD6Q 4J9GA 4DOWA 2VV5A 4N0AC 2DE0X 3MP1A 3V8LA 1OYXA 3ER0A 5CR2A 2HSPA 2ROLA 2LJ0A 2RQUA 2DL8A 3G1JA 4WTOB 3H8ZA 3QPHA 1ARKA 2GFUA 2MK5A 4O6JA 3EG2A 4M7DF 2JTEA 2BE7D 2ZPHB 1QP3A 5D6XA 2AZVA 2OX7A 1AZGB 1ZSZC 4IUPA 4M75A 3QBYA 2E41A 3H41A 3OQ5A 2EJFA 3RNJA 3G6EA 4LD6A 2IVWA 4C8QC 4A54A 3PFSA 1K73C 1YP5A 3ASKA 1M2OA 1MV0B 2JOYA 2FYKA 1D1CA 5J26A 2ZCFB 2QDLA 2LVMA 2DVJA 3PTAA 4FU6A 4Z8AA 2HL3A 1E6GA 1S1NA 1SRMA 2DXUA 3KXTA 2K3YA 1XOVA 4KBMB 4IKFA 2KI7A 1Y71A 1GCPA 4A63B 4FM4B 1SSHA 2NUPA 1HXDA 3G71T 2RB6A 1WXBA 2LP5A 4XTWA 4FT4A 4JUVA 4A4HA 1ABOA 1KQ1A 3PVQA 1QQJA 1KHIA 4M75G 2CH4W 1NYGA 4OGEA 3M0TA 3OYKA 2LT1A 4X34A 1RAAB 2DZ9A 4JDSA 1JB0E 1N9RA 2X4YA 3VS7A 3RIRA 1OEBA 3S3NA 3M53A 3CCVA 3J7AF 1U1SA 4LD9K 4HA8A 4PNOA 2EQUA 4ZTFA 4AFZC 1OX8A 1EFNA 2FB7A 3MP6A 5A0LA 3QUIA 2DVEA 2VB6A 2EYQA 4M78F 3JB9G 1SEMA 2JMCA 2OI3A 1PNJA 3EAEA 3QSUA 3I9QA 3G6EQ 3JRZA 5LJ3d 3ZEHA 3OYNA 4M77A 2L89A 3QKJA 4F14A 2RF0A 3URGA 1BIAA 2KROA 3JCMb 1U5SA 2QQRA 1YBYA 1D1AA 2EWNA 3MJXA 5FW9A 3UPUA 3SEMA 2RHYA 3O5ZA 4C5EA 3GLXA 4PFOA 3RBBB 1VQ7T 4ZNXA 4M7AE 2OAWA 2BZ8A 1QCOA 2YUQA 5CAIA 7AT1B 4JJBA 5KYYB 1F1BB 3OYLA 5CIUA 3OYYA 1GCQA 4M75E 4HVVA 3M0QA 3M5AA 2DAQA 1ZUUA 3A8GB 1W2BS 1WNLA 2KVQG 1N5ZA 2CSIA 2YRCA 1Q86R 5GAOp 2FL7A 1YN8A 1YJWA 4P5NA 2DRMA 1N8RR 1SSFA 2LQNA 3JCMX 2K57A 4J6YA 4M77G 1Z9ZA 2BTTA 2K9GA 1VYTA 3C94A 2Y90A 3OYDA 3T9NA 4XQ3A 1AWOA 2LCSA 1WYXA 4MZMA 4OMPA 5LJ3e 3JB9J 2V26A 1KG1A 2F5TX 4J6WA 1JXMA 1MUZA 1K9AA 4AFQC 4JRQA 1M1KR 4AMCA 3OS2A 3HKSA 1GL5A 2XG8D 4BI8B 3JCMd 1ZUKA 1JJ2S 1WPYA 1I0CA 1SPKA 4E6RA 2XK0A 2NYSA 1M1FA 5GAN5 2KXCA 3OYGA 1FMVA 2RK1A 2RQTA 2NLUA 2MOXA 3HPWA 3ME9A 1Q86U 5C0MA 1TG0A 1N8RU 2QGFB 4DBFA 3OYBA 4XU2A 5LJ5j 2HQHA 3TQ7P 2D6FA 1OULA 1Y96A 4QT7A 3S3MA 1BI3A 2DBMA 4J7FA 3BFMA 5LJ5d 3CPFA 1VIEA 4Q5WA 1M1KU 1ZSZB 5HK0A 4M7AF 2FZKB 1ZBJA 2RJCA 4PJOG 1VQPA 4E2FB 3JCMe 1WXUA 4M77E 2M9UA 2ZAEA 5CCAA 1VQ9T 1VQ6T 1ZA1B 4TVRA 4J9DA 3TCJA 1Q7YR 2CP0A 3G71Q 3EHQA 1X2KA 2KYMA 4N4IA 4FIBA 4KRTA 2HBWA 3JB9H 1G5VA 1N6AA 4A4EA 1VQ5T 3VS5A 3JCMQ 5FRMA 4JS5A 2ZPGB 2RHIA 2X4XA 3BDUA 2I2LA 2L8DA 5GMKj 1X2QA 3NTHA 1YJ9T 4F7UF 2JMAA 2EJ9A 5HCKA 1Q81R 4FL6A 4DBRA 2CDTA 2ED0A 4J9EA 5LJ5e 2C0IA 1HD3A 4QQDA 4C0ZA 2XDPA 2OAUA 1AWWA 1QLYA 5CKFA 1MHNA 1UG1A 2MAMA 5CO7A 3SWNB 5GANj 1W2BP 2RA2A 1RAGB 1BCOA 2VKNA 1C6VX 1OOTA 1Q7YU 3ZFJA 3LLRA 1PRLC 2CT4A 4EMKA 3M0SA 2EVRA 3CMEA 4DEXA 3QHSA 2K2MA 4PFPA 4CC3A 3VYHB 3EGXB 2QYZA 3EGDA 1D3BA 1R77A 3TEEA 3JCMP 2K3BA 1MMDA 1IGUA 4WCIA 2PZ1A 4RUGA 4PFZA 4ZGDB 5AT1B 1NEGA 2ROTA 3BW1A 5FWCA 4OB3B 1SHFA 3Q1JA 3HRSA 1AD5A 4XTZA 5KYUA 1VQ7Q 1JJ2P 3HFOA 1Q81U 3PE0A 5IHIA 2NUTB 1UEBA 3EG9B 1TH7A 2F1LA 4M7DA 4A4KA 2RHUA 1K0XA 2AIRB 4C92D 2KRSA 3QIIA 2KYBA 2HSEB 1H92A 4IUUA 5CKDA 3H0IA 1BBZA 3UA7A 3TSWA 3RKWA 3L2RA 3EG0A 3RMQA 1VQ6A 1QMCA 4PJLA 2LQKA 2RQVA 2Z0WA 1BI1A 2E6ZA 1BI2A 2BIVA 1WFWA 2A08A 5KYXA 2RM4A 4KT0E 1I5OB 1VQ5A 4B9WA 5GAN3 1X01A 4FW2A 1OU8A 4JS4A 4ATOA 1U3OA 3CMAA 3A8LB 1GFDA 3HHTB 3LWIA 2X3WD 2MF2A 1JRIA 2H3EB 1LOJA 3M55A 5CVIA 4PJOC 2RD1A 1YJ9A 3L1AA 3L2WA 4M7DG 3L2VA 3PMTA 4RTUA 2P0QA 3FC3A 3NHNA 2E6NA 2L3RA 8AT1B 1BCMA 4Z02A 5LL6S 4EDUA 1RACB 1GRIA 2VXFA 1LPLA 1O9SA 2PUOB 1JEGA 2DA9A 5AYFA 2V8KA 2LDMA 4C92C 1PKSA 2HCKA 4JZ3A 2LJ3A 1IHWA 2CP5A 4MZPA 4IUQA 2KAFA 2E70A 2MYSA 2WSEE 4E7KA 1QVGA 1YITT 1RLQC 2YRVA 2V1QA 4M78A 5J3BA 1VQ9Q 1VQ6Q 1XQHA 3PMIA 3CCST 2K5LA 3GPLA 3R6NA 4II1A 1ACMB 4BD3A 1X27A 4LDYA 4JLGA 3RERA 1HSQA 4PK4A 2EAYA 5FLXE 3EH2A 3UA6A 3FEOA 3RR6A 2V1RA 1VQ5Q 2LCLA 4GBQA 1AWJA 4OP0A 2DXBA 2DO3A 5J39A 1T0HA 1WXTA 4JRIA 1KQSA 4E7IA 1YJ9Q 3TREA 3MEUA 5GANf 2F2VA 2EGAA 3OYIA 2J6OA 1KC8R 2PVOB 1AHJB 3FJ5A 4XTUA 2GF7A 5GAOm 1OI1A 1NLPC 3SDZA 3VS1A 4J9HA 5L8RE 4PJMA 2FEIA 1H641 1OQKA 4FYWB 3VUBA 3VKIA 2CH4A 4R56A 3F70A 2PVDB 2BZYA 2DRKA 2RK2A 4J7IA 1QKWA 3OMCA 2HKNA 3TVTA 4EPCA 2XDBA 3QJYA 2SEMA 1CKAA 1H3ZA 2PTKA 1WJQA 4OB2B 3CCET 5GAOn 1M8VA 2CZ7B 1KC8U 3E2UA 2CP7A 2K4YA 1PCXA 2HZYA 2D8JA 2VASA 4CC7A 3GBQA 4OMQA 3OA6A 1QVFS 2M02A 2VC8A 3A98A 1YITA 3FDRA 3L2ZA 3I56T 4C8QE 1VQ4T 2O4XA 3C12A 2RJDA 3FB9A 5KYWA 2RI3A 1JBMA 1QCFA 2DL5A 2EKHA 1VQOT 2CUBA 5DLOA 5EC7A 2FPDA 5GAMf 2LT4A 5DLQE 2DMOA 2VYTA 4LE9A 2HL5C 4M78E 3O8VA 3OW2S 4PL6A 4XAXB 2RN8A 2PNIA 5GAN2 1UB4A 4M7AA 1QVGP 2DD5A 1UFFA 2K3XA 1RL2A 2FPFA 2OTLT 1D0XA 3MEVA 2X3XD 2GQIA 3OBYA 2KDSA 1KD1R 3VS3A 4IUTA 1M9SA 5IHNA 1YCYA 1FYNA 4MDXA 1PG5B 2RHZA 5L23A 2ZPBB 1X6GA 4JJDA 3RDVA 2K5FA 1JO8A 1M2VB 4RTXA 5GANg 3V7RA 4PJOB 1K9MR 1PD1A 1OV3A 1Q82C 2JZ2A 1KQSP 3PVLA 3NGPA 2IG0A 3CCUT 3EGUA 4F7UA 4V2SA 1B07A 4E7HA 2CSQA 4M7AG 1VOMA 3OSVA 2EKOA 1YJNT 4OMMA 3UF4A 4L6V5 1EX4A 1BYMA 5FU7C 4HT8A 3LGFA 3CXCS 4NL3A 1YITQ 1PKTA 1KD1U 1T3SA 1MNDA 4Z89A 4C92B 3SWNC 3CCSQ 4C5HA 2ENMA 4C8QF 4FYXB 2EQIA 2MIOA 3QDRB 5IAYA 2YUPA 2AHJB 2HBPA 3CCMT 2F5KA 5KCOA 4NOYA 3EG1A 1K9MU 4HKEA 1K8AC 1M3BA 2V8JA 5LJ3j 5I2MA 4FYVB 5GAOl 1WDXA 2HMAA 1MV3A 1TUGB 1IRXA 2DD4A 2D0NA 1TUDA 4ANJA 2DX1A 2HQXA 3M58A 3AT1B 2A28A 4DOVA 5FRNA 4DBHA 3V8JA 2L3PA 4KGVB 1NM7A 1PM3A 5GAMg 2R5MA 3P8HA 1NE8A 1R0BG 2L2PA 2D1XA 4JJCA 1WHMA 4F17A 1Y0MA 2K6DA 4M75D
chains in the Genus database with same CATH topology
1Y57A 2J6KA 2W10A 5IH2A 1JXOA 1J3TA 4IIOA 1T3LA 3M0PA 2FRYA 2A36A 2KRMA 2A37A 4OMOA 3ZL7C 3NPFA 4OMNA 2JMAA 5HCKA 3UATA 1UDLA 2KEAA 2IIMA 2H8HA 4M4ZA 4HVUA 2CDTA 2ED0A 4J9EA 2EYWA 4J9CA 2C0IA 1HD3A 4AG2C 4Y92A 1AWWA 1QLYA 5I22A 1UG1A 2K7AA 2W0ZA 1UGVA 5ECAA 2ABLA 2F2XA 1M27C 2J06A 1W1FA 2CREA 2DBKA 2VKNA 1OOTA 1UHCA 1PRLC 2CT4A 3M0SA 2EVRA 1BU1A 3IQLA 4DEXA 1ZSGA 2K2MA 2XMFA 4CC3A 1Z9QA 1LCKA 2CT3A 2VWFA 2K3BA 4D8KA 4DEYA 3I5SA 1W70A 1NEBA 4WCIA 4K11A 2PZ1A 4LUEA 2KGTA 4RUGA 2EBPA 1YCSB 1NEGA 2ROTA 1I07A 2AK5A 2DL3A 1V1CA 5FWCA 1SHFA 1AD5A 2KT8A 1GFCA 1G83A 5IXBA 3M0RA 3PE0A 5IHIA 1YWPA 1E7OA 1AWXA 1K1ZA 1ZLMA 1K0XA 2ECZA 1K76A 2KNBB 1U06A 2NWMA 2KRSA 1PHTA 2KYBA 1H92A 1NG2A 2DM1A 2DILA 3H0IA 1K0SA 1BBZA 3UA7A 3TSWA 2YUNA 3EG0A 1OPLA 2B86A 1RLPC 2O9VA 5GJVB 2RQVA 1KSWA 2JXBA 1UECA 1PWTA 2AZSA 1M3AA 2DJQA 4RTVA 1HJDA 1UHFA 3CQTA 1WFWA 2A08A 4RTWA 3NMZC 2EW3A 2M51A 2JT4A 5IHKA 1M8MA 1U3OA 1GFDA 2X3WD 1JQQA 4IIMA 2KT1A 2L0AA 3EG3A 2FO0A 1X69A 1AEYA 4RTUA 2KRNA 3NHNA 3REBB 2GTOA 1BB9A 2DL4A 1H8KA 4RTTA 1NYFA 1WIEA 1GRIA 2ED1A 2YUOA 3VS6A 1I1JA 1JEGA 3H0FA 2DA9A 4J9GA 3LH5A 2DE0X 1FMKA 2O9SA 1T0JA 1TUCA 1BK2A 3THKA 3VRYA 2HSPA 1PKSA 2ROLA 2HCKA 2LJ0A 2RQUA 4JZ3A 2JS2A 2DL8A 2EPDA 2LJ3A 2JM8A 1NLOC 2OJ2A 1ARKA 2DNUA 1RUWA 2ESWA 3VS2A 3JV3A 3EG2A 1SHGA 1WA7A 3ULRB 2JTEA 4EIKA 1RLQC 2V1QA 2AZVA 4J9BA 1AZGB 1AZEA 3H41A 1KJWA 2D8HA 3SHWA 3R6NA 1WX6A 3RNJA 2DL7A 1X27A 4ESRA 2EGCA 4HXJA 1HSQA 1YP5A 2SRCA 1YWOA 1VYUA 2I0NA 2AKKA 3UA6A 1MV0B 2JS0A 2V1RA 4LUDA 2VVKA 2QDLA 2RQRA 2YDLA 4GBQA 1AWJA 2DVJA 4J9IA 1T0HA 1WXTA 4Z8AA 1G2BA 1GCQC 1E6GA 1S1NA 1B3QA 4JPBW 1SRMA 2EGEA 1UUEA 2JW4A 2KXDA 1SRLA 3REAB 1XOVA 2EYZA 2F2VA 2EGAA 4F16A 1GCPA 4A63B 2J6OA 2JM9A 2FG0A 1SSHA 3FJ5A 1RI9A 1WXBA 2LP5A 1WI7A 1ABOA 3PVQA 3QWXX 2CH4W 1NLPC 2E5KA 3VS1A 1NYGA 4HCKA 4J9HA 3M0TA 2FEIA 4Z88A 2DLPA 3VS7A 4LN2A 2O88A 2GGRA 1OEBA 2CH4A 2BZYA 2DRKA 1QKWA 4RTYA 4AFSC 2EYYA 3TVTA 2K79A 4AFZC 1GBQA 2SEMA 1EFNA 4D8DA 2HEQA 1UE9A 2C0TA 3C0CA 1CKAA 2DF6A 3VS4A 2GTJA 2FRWA 2PTKA 2RMOA 1SEMA 4JZ4A 2JMCA 2OI3A 1CSKA 1PNJA 2F2WA 1YNZA 3I9QA 5FWBA 2D8JA 2G6FX 1ABQA 1VYVA 2LZ6B 4CC7A 2C0OA 3GBQA 4OMQA 1UJYA 3A98A 3EHRA 4F14A 2RF0A 2YSQA 2L3SA 2M0YA 2KROA 1U5SA 2RPNA 1QCFA 2LQWA 2DL5A 2EKHA 1E6HA 4ORZA 2BZXA 5FW9A 2CUBA 2J05A 5EC7A 3SEMA 2FPDA 3O5ZA 3RBBB 1ZUYA 4ZNXA 1GBRA 2HDAA 2OAWA 2BZ8A 2DMOA 2RNAA 4LE9A 2YUQA 1QWFA 4JJBA 1WLPB 2RN8A 2PNIA 4RTZA 1M3CA 2AKLA 1GCQA 1UFFA 2DYBA 4HVVA 3KFVA 3M0QA 1ZUUA 1H3HA 2FPFA 2X3XD 1N5ZA 2LJ1A 2CSIA 2GQIA 2GNCA 3VS3A 3QWYA 5IHNA 4AFUC 1YN8A 1FYNA 2DRMA 4LNPA 2LQNA 1JU5C 2J7IA 5L23A 2CUDA 1Z9ZA 1X6BA 2BTTA 2K9GA 1VYTA 1X6GA 2NUZA 4JJDA 1AWOA 4J9FA 2LCSA 1PRMC 1WYXA 3I5RA 4OMPA 4RTXA 1JO8A 4CC4B 1JXMA 1MUZA 2J6FA 1K9AA 4AFQC 2KR3A 2KE9A 1KFZA 1OV3A 2LMJA 2RQWA 3PVLA 1CKBA 5GJWB 3NGPA 1GL5A 1ZUKA 1AVZC 3H0HA 3EGUA 4GLMA 1I0CA 1OPKA 1SPKA 4E6RA 1B07A 4HVWA 2CSQA 2YT6A 2MCNA 3M0UA 2KXCA 4FSSA 4OMMA 3UF4A 4AG1C 1UTIA 2RQTA 2GBQA 1A0NB 1PKTA 2MOXA 1T3SA 4CC2A 4Z89A 1TG0A 5I11A 1QWEA 4R0KA 2ENMA 1ZX6A 2EQIA 2MIOA 2YUPA 2O2OA 3VS0A 2LX7A 4QT7A 2DBMA 3EG1A 2EYXA 1AOJA 1VA7A 3I35A 1M3BA 1W6XA 2P4RA 2KBTA 1WDXA 3TSZA 1MV3A 1ZBJA 2D0NA 1TUDA 1WXUA 2L3QA 2DX1A 3VRZA 4J9DA 1KIKA 2FPEA 1UJ0A 1X43A 2O31A 2A28A 3EHQA 1X2KA 2L3PA 1K4US 1IO6A 2KYMA 5IXFA 1NM7A 1QKXA 1M30A 4KRTA 2HBWA 3U23A 2L2PA 2D1XA 3VS5A 4JJCA 4F17A 1Y0MA 2K6DA 4OMLA 2LNHB 4X1VA 1X2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y57 A;  2J6K A;  2W10 A;  5IH2 A;  1JXO A;  1J3T A;  4IIO A;  1T3L A;  3M0P A;  2FRY A;  2A36 A;  2KRM A;  2A37 A;  4OMO A;  3ZL7 C;  3NPF A;  4OMN A;  2JMA A;  5HCK A;  3UAT A;  1UDL A;  2KEA A;  2IIM A;  2H8H A;  4M4Z A;  4HVU A;  2CDT A;  2ED0 A;  4J9E A;  2EYW A;  4J9C A;  2C0I A;  1HD3 A;  4AG2 C;  4Y92 A;  1AWW A;  1QLY A;  5I22 A;  1UG1 A;  2K7A A;  2W0Z A;  1UGV A;  5ECA A;  2ABL A;  2F2X A;  1M27 C;  2J06 A;  1W1F A;  2CRE A;  2DBK A;  2VKN A;  1OOT A;  1UHC A;  1PRL C;  2CT4 A;  3M0S A;  2EVR A;  1BU1 A;  3IQL A;  4DEX A;  1ZSG A;  2K2M A;  2XMF A;  4CC3 A;  1Z9Q A;  1LCK A;  2CT3 A;  2VWF A;  2K3B A;  4D8K A;  4DEY A;  3I5S A;  1W70 A;  1NEB A;  4WCI A;  4K11 A;  2PZ1 A;  4LUE A;  2KGT A;  4RUG A;  2EBP A;  1YCS B;  1NEG A;  2ROT A;  1I07 A;  2AK5 A;  2DL3 A;  1V1C A;  5FWC A;  1SHF A;  1AD5 A;  2KT8 A;  1GFC A;  1G83 A;  5IXB A;  3M0R A;  3PE0 A;  5IHI A;  1YWP A;  1E7O A;  1AWX A;  1K1Z A;  1ZLM A;  1K0X A;  2ECZ A;  1K76 A;  2KNB B;  1U06 A;  2NWM A;  2KRS A;  1PHT A;  2KYB A;  1H92 A;  1NG2 A;  2DM1 A;  2DIL A;  3H0I A;  1K0S A;  1BBZ A;  3UA7 A;  3TSW A;  2YUN A;  3EG0 A;  1OPL A;  2B86 A;  1RLP C;  2O9V A;  5GJV B;  2RQV A;  1KSW A;  2JXB A;  1UEC A;  1PWT A;  2AZS A;  1M3A A;  2DJQ A;  4RTV A;  1HJD A;  1UHF A;  3CQT A;  1WFW A;  2A08 A;  4RTW A;  3NMZ C;  2EW3 A;  2M51 A;  2JT4 A;  5IHK A;  1M8M A;  1U3O A;  1GFD A;  2X3W D;  1JQQ A;  4IIM A;  2KT1 A;  2L0A A;  3EG3 A;  2FO0 A;  1X69 A;  1AEY A;  4RTU A;  2KRN A;  3NHN A;  3REB B;  2GTO A;  1BB9 A;  2DL4 A;  1H8K A;  4RTT A;  1NYF A;  1WIE A;  1GRI A;  2ED1 A;  2YUO A;  3VS6 A;  1I1J A;  1JEG A;  3H0F A;  2DA9 A;  4J9G A;  3LH5 A;  2DE0 X;  1FMK A;  2O9S A;  1T0J A;  1TUC A;  1BK2 A;  3THK A;  3VRY A;  2HSP A;  1PKS A;  2ROL A;  2HCK A;  2LJ0 A;  2RQU A;  4JZ3 A;  2JS2 A;  2DL8 A;  2EPD A;  2LJ3 A;  2JM8 A;  1NLO C;  2OJ2 A;  1ARK A;  2DNU A;  1RUW A;  2ESW A;  3VS2 A;  3JV3 A;  3EG2 A;  1SHG A;  1WA7 A;  3ULR B;  2JTE A;  4EIK A;  1RLQ C;  2V1Q A;  2AZV A;  4J9B A;  1AZG B;  1AZE A;  3H41 A;  1KJW A;  2D8H A;  3SHW A;  3R6N A;  1WX6 A;  3RNJ A;  2DL7 A;  1X27 A;  4ESR A;  2EGC A;  4HXJ A;  1HSQ A;  1YP5 A;  2SRC A;  1YWO A;  1VYU A;  2I0N A;  2AKK A;  3UA6 A;  1MV0 B;  2JS0 A;  2V1R A;  4LUD A;  2VVK A;  2QDL A;  2RQR A;  2YDL A;  4GBQ A;  1AWJ A;  2DVJ A;  4J9I A;  1T0H A;  1WXT A;  4Z8A A;  1G2B A;  1GCQ C;  1E6G A;  1S1N A;  1B3Q A;  4JPB W;  1SRM A;  2EGE A;  1UUE A;  2JW4 A;  2KXD A;  1SRL A;  3REA B;  1XOV A;  2EYZ A;  2F2V A;  2EGA A;  4F16 A;  1GCP A;  4A63 B;  2J6O A;  2JM9 A;  2FG0 A;  1SSH A;  3FJ5 A;  1RI9 A;  1WXB A;  2LP5 A;  1WI7 A;  1ABO A;  3PVQ A;  3QWX X;  2CH4 W;  1NLP C;  2E5K A;  3VS1 A;  1NYG A;  4HCK A;  4J9H A;  3M0T A;  2FEI A;  4Z88 A;  2DLP A;  3VS7 A;  4LN2 A;  2O88 A;  2GGR A;  1OEB A;  2CH4 A;  2BZY A;  2DRK A;  1QKW A;  4RTY A;  4AFS C;  2EYY A;  3TVT A;  2K79 A;  4AFZ C;  1GBQ A;  2SEM A;  1EFN A;  4D8D A;  2HEQ A;  1UE9 A;  2C0T A;  3C0C A;  1CKA A;  2DF6 A;  3VS4 A;  2GTJ A;  2FRW A;  2PTK A;  2RMO A;  1SEM A;  4JZ4 A;  2JMC A;  2OI3 A;  1CSK A;  1PNJ A;  2F2W A;  1YNZ A;  3I9Q A;  5FWB A;  2D8J A;  2G6F X;  1ABQ A;  1VYV A;  2LZ6 B;  4CC7 A;  2C0O A;  3GBQ A;  4OMQ A;  1UJY A;  3A98 A;  3EHR A;  4F14 A;  2RF0 A;  2YSQ A;  2L3S A;  2M0Y A;  2KRO A;  1U5S A;  2RPN A;  1QCF A;  2LQW A;  2DL5 A;  2EKH A;  1E6H A;  4ORZ A;  2BZX A;  5FW9 A;  2CUB A;  2J05 A;  5EC7 A;  3SEM A;  2FPD A;  3O5Z A;  3RBB B;  1ZUY A;  4ZNX A;  1GBR A;  2HDA A;  2OAW A;  2BZ8 A;  2DMO A;  2RNA A;  4LE9 A;  2YUQ A;  1QWF A;  4JJB A;  1WLP B;  2RN8 A;  2PNI A;  4RTZ A;  1M3C A;  2AKL A;  1GCQ A;  1UFF A;  2DYB A;  4HVV A;  3KFV A;  3M0Q A;  1ZUU A;  1H3H A;  2FPF A;  2X3X D;  1N5Z A;  2LJ1 A;  2CSI A;  2GQI A;  2GNC A;  3VS3 A;  3QWY A;  5IHN A;  4AFU C;  1YN8 A;  1FYN A;  2DRM A;  4LNP A;  2LQN A;  1JU5 C;  2J7I A;  5L23 A;  2CUD A;  1Z9Z A;  1X6B A;  2BTT A;  2K9G A;  1VYT A;  1X6G A;  2NUZ A;  4JJD A;  1AWO A;  4J9F A;  2LCS A;  1PRM C;  1WYX A;  3I5R A;  4OMP A;  4RTX A;  1JO8 A;  4CC4 B;  1JXM A;  1MUZ A;  2J6F A;  1K9A A;  4AFQ C;  2KR3 A;  2KE9 A;  1KFZ A;  1OV3 A;  2LMJ A;  2RQW A;  3PVL A;  1CKB A;  5GJW B;  3NGP A;  1GL5 A;  1ZUK A;  1AVZ C;  3H0H A;  3EGU A;  4GLM A;  1I0C A;  1OPK A;  1SPK A;  4E6R A;  1B07 A;  4HVW A;  2CSQ A;  2YT6 A;  2MCN A;  3M0U A;  2KXC A;  4FSS A;  4OMM A;  3UF4 A;  4AG1 C;  1UTI A;  2RQT A;  2GBQ A;  1A0N B;  1PKT A;  2MOX A;  1T3S A;  4CC2 A;  4Z89 A;  1TG0 A;  5I11 A;  1QWE A;  4R0K A;  2ENM A;  1ZX6 A;  2EQI A;  2MIO A;  2YUP A;  2O2O A;  3VS0 A;  2LX7 A;  4QT7 A;  2DBM A;  3EG1 A;  2EYX A;  1AOJ A;  1VA7 A;  3I35 A;  1M3B A;  1W6X A;  2P4R A;  2KBT A;  1WDX A;  3TSZ A;  1MV3 A;  1ZBJ A;  2D0N A;  1TUD A;  1WXU A;  2L3Q A;  2DX1 A;  3VRZ A;  4J9D A;  1KIK A;  2FPE A;  1UJ0 A;  1X43 A;  2O31 A;  2A28 A;  3EHQ A;  1X2K A;  2L3P A;  1K4U S;  1IO6 A;  2KYM A;  5IXF A;  1NM7 A;  1QKX A;  1M30 A;  4KRT A;  2HBW A;  3U23 A;  2L2P A;  2D1X A;  3VS5 A;  4JJC A;  4F17 A;  1Y0M A;  2K6D A;  4OML A;  2LNH B;  4X1V A;  1X2Q A; 
#chains in the Genus database with same CATH topology
 4MML A;  1JXO A;  3VJP A;  1C0M A;  4IIO A;  2CZ1 B;  1T3L A;  3A8O B;  4OMO A;  2A37 A;  3ZL7 C;  4OMN A;  2ZPE B;  1NJI R;  2PVG B;  4KUI A;  2IIM A;  2E4H A;  1G3T A;  5CK9 A;  3INZ A;  1MMG A;  4KGX B;  2DTO A;  2EYW A;  2CKK A;  4J9C A;  3OW2 P;  3CCU A;  1KHC A;  1U1T A;  2CP2 A;  5I22 A;  2K7A A;  5ECA A;  5GAN 7;  1WGS A;  2HAX A;  2KK4 A;  1W2B A;  1G3S A;  1M27 C;  2J06 A;  1W1F A;  4QQ6 A;  4RKU E;  3G71 A;  3CCE Q;  2DBK A;  2E3H A;  1YIJ T;  1B7T A;  4B9X A;  1UHC A;  3VUZ A;  1OX9 A;  3IQL A;  3LGL A;  2MWO A;  3JB9 D;  1ZSG A;  3E9F A;  1Z9Q A;  1LCK A;  3LYI A;  4F7U E;  2VWF A;  1N27 A;  3I56 Q;  4D8K A;  4DEY A;  3M56 A;  1W70 A;  1NEB A;  3AHU A;  1VQ4 Q;  4K11 A;  3SB2 A;  2KGT A;  3HSB A;  2BUD A;  3HFN A;  4M7D B;  1VQO Q;  4BE0 A;  3A1P A;  3H6Z A;  1EIF A;  2KT8 A;  4DA4 A;  3CCJ T;  1JJ2 A;  1TTH B;  1NJI U;  1GFC A;  5CQY A;  2GCX A;  1E7O A;  4M75 C;  4JRP A;  2ECZ A;  1U06 A;  2OTL Q;  2NWM A;  4QVD A;  1PHT A;  3RKY A;  4GLK A;  3JCM c;  3VU3 C;  1YI2 T;  3R6O A;  2WAC A;  3G4S T;  1UEC A;  2DYI A;  2CZ6 B;  4RTV A;  4PKC C;  1HJD A;  1X75 C;  4M77 D;  3CCL T;  3EFR A;  3X25 B;  2HD0 A;  2M51 A;  3LW5 E;  4RG2 A;  2Y4X A;  1MGQ A;  1LVK A;  5IHK A;  1VQ7 A;  1M8M A;  3CCU Q;  5KE3 A;  4NL2 A;  2JN0 A;  1JQQ A;  3CC7 T;  4C0F A;  3E19 A;  5A2Q E;  2DZC A;  1VQL T;  1YJN Q;  1AEY A;  2E5Q A;  4LXC A;  5DM7 R;  2DL4 A;  1H8K A;  3DB4 A;  4RTT A;  4RCC A;  3CCR T;  1VQ8 T;  4PJN A;  1YFN A;  4XK8 E;  1BI0 A;  2YUO A;  2ED1 A;  2P84 A;  3VS6 A;  1I1J A;  4ZGE B;  1YIJ A;  3LH5 A;  5LJ3 f;  4FSX A;  2JUF A;  2O9S A;  1RAH B;  4J8O A;  1RAD B;  1T0J A;  1TUC A;  1BK2 A;  2M1H A;  3CCM Q;  5FU7 B;  2JS2 A;  1M5Q 1;  1WHH A;  1RUW A;  2DNU A;  4QQG A;  2GQV A;  3VS2 A;  3JCM W;  1SHG A;  2QA4 T;  1NBE B;  4A53 A;  4EIK A;  3UWN A;  4M77 C;  4UC4 A;  1HK9 A;  3CC2 T;  1FMW A;  1NPP A;  2COZ A;  4FCY A;  4PJO D;  1KJW A;  1WX6 A;  2A7Y A;  2DL7 A;  2EGC A;  1FX7 A;  2I0N A;  2QAZ A;  3PIO A;  2JS0 A;  4LUD A;  1OZ2 A;  1D0Y A;  1YI2 A;  2MMP A;  4E7J A;  9ATC B;  1G2B A;  1GCQ C;  3MEA A;  2EGE A;  1UUE A;  1KK7 A;  1SRL A;  3WVD B;  2EYZ A;  1I8F A;  4F16 A;  2JM9 A;  1R8O B;  2FG0 A;  3QDF A;  4NS5 A;  1RI9 A;  3JCM f;  4ME7 A;  3CC4 T;  1K73 R;  1VQ9 A;  3QWX X;  3HTR A;  3GNF B;  5C6S A;  4KUD K;  2E64 A;  2D0Q B;  1VQL A;  4Z88 A;  1YIJ Q;  2DLP A;  3G7Z A;  1ZQ1 A;  2DKG A;  4LN2 A;  5FRO A;  3M59 A;  5HK3 A;  3UDC A;  3QG1 A;  2E65 A;  3CCR A;  2QEX T;  3EFO A;  3M54 A;  4RTY A;  4BDZ A;  1VQ8 A;  3DKM A;  3GIB A;  5I2S A;  4N0A A;  3TU4 K;  1GBQ A;  4YTL A;  2HEQ A;  5CKB A;  2C0T A;  2QQ9 A;  3C0C A;  3VS4 A;  3GF5 A;  2GTJ A;  2FRW A;  1G3Y A;  2CP3 A;  4A4G A;  3CCJ Q;  5LJ5 f;  3CBP A;  5GAO r;  1VQM T;  1CSK A;  5IN1 A;  2F2W A;  5D6Y A;  5FWB A;  5LJ3 g;  1ABQ A;  1QCN A;  1VYV A;  2LZ6 B;  2C0O A;  2X4J A;  1K73 U;  1RAI B;  3N5B B;  1ZSZ A;  3EHR A;  1Q86 C;  1O75 A;  2L3S A;  4HCC A;  1YI2 Q;  2M0Y A;  1N8R C;  3HRT A;  3CC2 A;  1I4K 1;  4C8Q A;  1D0Z A;  2LQW A;  3OYC A;  4OB0 B;  3FLG A;  3G4S Q;  1WJR A;  2J05 A;  1X6O A;  4M75 B;  1ZUY A;  2YRD A;  3CEY A;  3OS0 A;  1M1G A;  3OMG A;  2RNA A;  3CCL Q;  3DB3 A;  1WLP B;  2DER A;  1M1K C;  2AKL A;  1VQN T;  2DYB A;  3HRU A;  4PJO F;  2LJ1 A;  2XKO C;  3CC7 Q;  3RMS A;  2GNC A;  3PNW C;  4C5G A;  3CCQ T;  1VQL Q;  2G3R A;  2FZC B;  4LNP A;  3A8H B;  2J7I A;  1PC0 A;  2VGN A;  1X6B A;  5IT9 E;  3OYA A;  4M7D D;  3V7C A;  2EQJ A;  2KSS A;  3CC4 A;  3CCR Q;  1PRM C;  2NUP B;  3I5R A;  4C8Q G;  2CP6 A;  2EFI A;  1VQ8 Q;  4E7S A;  3M4G A;  2J6F A;  4AT1 B;  4EMH A;  2QI2 A;  1V29 B;  2KE9 A;  4A4F A;  2R57 A;  2LMJ A;  2RQW A;  4XU3 A;  5GJW B;  3JCM g;  3H0H A;  4C92 F;  4R55 A;  4LDU A;  5HKC A;  2XID A;  2YT6 A;  4E47 A;  3EGX A;  4M78 G;  2QEX A;  4LDW A;  4FSS A;  4AG1 C;  3FRN A;  2COY A;  2PQW A;  1UGP B;  2IPO B;  1UTI A;  4EMK C;  2QA4 Q;  5EG2 A;  4OVA A;  2GBQ A;  2X9H A;  1M90 R;  3E1S A;  1VQK T;  5GAN 6;  3CBM A;  5A0G A;  3CC2 Q;  2JNG A;  1LNX A;  4OGC A;  4MMK A;  1Q7Y C;  5I11 A;  2RO0 A;  5KE2 A;  1QWE A;  4R0K A;  1ZX6 A;  2DJZ A;  4X9D A;  4ZTJ A;  2NUT A;  2O2O A;  1AT1 B;  1QP2 A;  3CPW S;  3VS0 A;  2LX7 A;  1M4Z A;  2LQ8 A;  5LJ5 g;  2KQW A;  2KMT A;  4WF2 A;  2D9T A;  1Y07 A;  2EYX A;  1AOJ A;  1VA7 A;  4M77 B;  2HNI A;  2CGH A;  1TS9 A;  1W6X A;  3PGG A;  1B34 A;  4M7D C;  2DFU A;  1Q81 C;  2CS7 A;  3BY7 A;  2QGG A;  3VRZ A;  1KIK A;  2FPE A;  3RKX A;  1UJ0 A;  4E7L A;  4XU1 A;  5GMK m;  3CC4 Q;  1M90 U;  3SD4 A;  3NFC A;  3CCS A;  3U23 A;  1QVF A;  3CCQ A;  2DIG A;  3CCV T;  2LNH B;  5GAM h;  3QZ9 B;  1Y57 A;  2QXF A;  2W10 A;  2JJ9 A;  3OB9 A;  1J3T A;  2DXT A;  2DIQ A;  1WHJ A;  1IB8 A;  2FRY A;  3A8M B;  1S72 T;  2MPX C;  2OTJ T;  4DQ2 A;  3NPF A;  3EFS A;  2QEX Q;  3UAT A;  1UDL A;  2KEA A;  2H8H A;  2LCC A;  4KH1 B;  4HVU A;  2ZZD A;  4FT2 A;  2ATC B;  3OW2 A;  4AG2 C;  4Y92 A;  3HL8 A;  1KQ2 A;  2W0Z A;  3RUX A;  2F2X A;  1VQM Q;  2XD0 A;  2JVV A;  4L5G A;  4ZN3 A;  1WQW A;  2E12 A;  2EQM A;  4JLI A;  2XMF A;  3WXM B;  4DBQ A;  2CYZ B;  1VUB A;  2CT3 A;  1NZ9 A;  4C5I A;  1WJS A;  4QVC A;  1RAE B;  3I5S A;  1VQK A;  2QK0 A;  3QZ5 B;  1RI0 A;  1TXQ A;  4LDX A;  3MHX A;  1YCS B;  3OYE A;  2AK5 A;  2DL3 A;  1V1C A;  2RI2 A;  1TU0 B;  2O01 E;  1U8R A;  3J81 E;  3RES A;  4ELZ C;  1SKU B;  1G83 A;  4M78 C;  1P92 A;  1Y96 B;  3KUF A;  3FJP A;  2QAS A;  1VQN Q;  1YJW T;  1K1Z A;  3KBG A;  2V8I A;  4HCB A;  5FU6 C;  3CCE A;  2XU8 A;  1NG2 A;  3CCQ Q;  4BB7 A;  2DM1 A;  2DIL A;  3CXC A;  1BIB A;  1K0S A;  1SG5 A;  1SF9 A;  3GP8 A;  4BI3 A;  2L5Q A;  3I56 A;  4CRI A;  3MP8 A;  1HYO A;  2AZS A;  1M3A A;  1VQ4 A;  2DJQ A;  4F7U G;  1UHF A;  3CQT A;  4PLL A;  3CPW P;  4RTW A;  1VQO A;  3X24 B;  1TOV A;  2JT4 A;  2HKQ B;  4E7Z A;  1ZA2 B;  3DLM A;  2RJE A;  1S72 A;  4IIM A;  2OTJ A;  2L0A A;  2FO0 A;  3D7S B;  1FXX A;  1X69 A;  3P8D A;  4BY6 C;  1D09 B;  3QYH B;  2OTL A;  2KRN A;  4M7A D;  2GTO A;  1BB9 A;  3OYH A;  1QVF P;  4HCZ A;  3QO3 A;  3BE3 A;  4O5V A;  1VQK Q;  1NYF A;  1WIE A;  4J6X A;  1R0C B;  2AT1 B;  4QW2 A;  3H0F A;  3LX7 A;  1XJW B;  4RCB A;  4RG8 A;  3M4Y A;  1FMK A;  1QVP A;  3BDL A;  4OMF B;  3THK A;  3VRY A;  4CI0 C;  4EMK B;  3MPU B;  2KY9 A;  2EPD A;  2M16 A;  1WHK A;  2JM8 A;  1NLO C;  1VQP T;  3GOX A;  2OJ2 A;  4PJJ A;  3EGD B;  1D3B B;  1MNE A;  2ESW A;  2DET A;  2WSF E;  5GMK l;  3JV3 A;  4JJN K;  3ULR B;  1WA7 A;  1YJN A;  4J9B A;  1EZZ B;  2VUB A;  3L42 A;  3NTI A;  1KC8 C;  1I5L A;  1AZE A;  2D8H A;  4J5Y A;  3V8K A;  5KYU B;  2H3J A;  3SHW A;  4C0D C;  4ESR A;  1C1A A;  1NPR A;  4HXJ A;  2SRC A;  1YWO A;  3X28 B;  1VYU A;  2AKK A;  3JAM E;  5I21 A;  2VVK A;  1M90 C;  2RQR A;  2YDL A;  3CCV Q;  5M9O A;  2P0K A;  1LJO A;  4J9I A;  4M7A C;  3LH0 A;  3X20 B;  2XDD A;  3MEW A;  3CCM A;  5GMK i;  4IUV A;  1S72 Q;  1B3Q A;  4JPB W;  2OTJ Q;  2JW4 A;  2KXD A;  3REA B;  1IGQ A;  4XU0 A;  2JTF A;  5HY6 A;  1M2V A;  5CKE A;  4PJO A;  8ATC B;  5KYX B;  3CXC P;  1WI7 A;  1XNI A;  3DLL A;  3CME T;  2LX9 A;  1ZHI A;  1G3W A;  2CZ0 B;  2E5K A;  4HCK A;  1XTD A;  2HQE A;  3EFO B;  4Y91 A;  3OYM A;  2QQB A;  2EIF A;  4FW1 A;  2XIC A;  4JRK A;  2O88 A;  2GGR A;  2FZG B;  1PD0 A;  2F69 A;  4AFS C;  2EYY A;  1IXD A;  2K79 A;  1RAF B;  4D8D A;  4C92 A;  1UE9 A;  2DF6 A;  2MI6 A;  3L2Q A;  2A0F B;  4ELY C;  2RMO A;  4QVZ A;  2EJG A;  4JZ4 A;  3SFM A;  3C4S A;  1YNZ A;  4C8Q B;  3JSC A;  4M75 F;  1YJW Q;  4XTY A;  2G6F X;  3OS5 A;  2QDY B;  4MZT A;  3A5Z B;  1UJY A;  2QQS A;  3CBO A;  1KD1 C;  2YSQ A;  5LJ3 h;  1N9S A;  2RPN A;  2R58 A;  1WQ7 A;  2DXC A;  2YLB A;  4M78 B;  1E6H A;  4ORZ A;  2BZX A;  2P4T A;  2E10 A;  3WVE B;  3OYF A;  3CMA T;  3MCA B;  2HDA A;  4KUL A;  1GBR A;  1TWB A;  4N4G A;  3JCM J;  5FU6 B;  1QWF A;  2X4W A;  1K9M C;  4C92 G;  4RTZ A;  4BUG A;  1M3C A;  2E3I A;  2LTO A;  3KFV A;  2BKD N;  3JB9 F;  3CCJ A;  1H3H A;  2DK3 A;  1WHL A;  2WSC E;  3QWY A;  2LNV A;  2YLC A;  4AFU C;  3H9N A;  5KYY A;  2RHX A;  2MWP A;  3X26 B;  1JU5 C;  2CUD A;  2PU9 B;  1YHQ T;  2B8A A;  2NUZ A;  4F04 B;  3I55 T;  2K2V A;  4J9F A;  4ZGJ B;  5GAN d;  4CC4 B;  5GAN 4;  3G4S A;  2KR3 A;  1KFZ A;  2RI5 A;  1TSF A;  1CKB A;  1Y7X A;  4IUR A;  1WZO A;  4BY6 B;  1AVZ C;  4GLM A;  1OPK A;  3CCL A;  4PJO E;  3M9Q A;  2QTX A;  4HVW A;  2MCN A;  3JCM h;  2DEQ A;  1OU9 A;  3M0U A;  4LDV A;  1VQP Q;  4D6W A;  3ZBD A;  4BAC A;  2LC4 A;  4KGZ B;  3CC7 A;  3VV0 A;  4BE2 A;  1D1B A;  1A0N B;  1UGR B;  2QTV A;  5GMK e;  3L2U A;  4M77 F;  4CC2 A;  3J80 E;  1FWZ A;  3LWH A;  1Q82 R;  3CD6 T;  1B34 B;  5D7U A;  2R5A A;  2JTM A;  3JB9 I;  3QXE B;  4C92 E;  2FHD A;  4C0G A;  2COW A;  3E9G A;  2ZGW A;  2C06 A;  4XTV A;  1DJ7 B;  3I35 A;  2P4R A;  5GAN e;  3P8B B;  2KBT A;  5LJ5 h;  3HP9 A;  4XTX A;  5CKH A;  2O4X B;  3TSZ A;  4B6M A;  5KYW B;  3MET A;  4C0D B;  1NJI C;  3M57 A;  3OYJ A;  2L3Q A;  3S3O A;  3JCM V;  5GAM j;  2QA4 A;  1X43 A;  2O31 A;  1I81 A;  1K4U S;  1IO6 A;  4N4H A;  5IXF A;  3CME Q;  1QKX A;  4M7A B;  5GAM d;  1M30 A;  2XI9 A;  3NTK A;  2A3L A;  2M0O A;  2DPP B;  4QKU A;  2VXE A;  4OML A;  4OF1 A;  1Q82 U;  4X1V A;  1K8A R;  2J6K A;  2K5I A;  5IH2 A;  3GNG A;  4FYY B;  4X9C A;  3M0P A;  2BE9 B;  2GFA A;  2QG9 B;  2A36 A;  2KRM A;  1YHQ A;  2FVU A;  3I55 A;  4M4Z A;  1QVG S;  6AT1 B;  5GMK h;  4RMO A;  1V76 A;  4MDW A;  1BKB A;  3OS1 A;  2YWW A;  4BE1 A;  3PT9 A;  5CQX A;  1GXI E;  1UGV A;  2ABL A;  2CRE A;  2EQK A;  2YXY A;  1VIF A;  4F7U B;  2Y4Y A;  3QJ6 A;  1BU1 A;  4BDY A;  4L59 A;  1IHV A;  1QW1 A;  1G8X A;  2DEU A;  2YHT A;  3UT1 A;  3SWN A;  4BI4 A;  3MO8 A;  2QQA A;  1WHG A;  2LRQ A;  4Y28 E;  5GAN h;  5GAN 8;  4KH0 B;  4LUE A;  2DTI A;  1KQS S;  5GAM e;  1K8A U;  2EBP A;  1UGQ B;  3CD6 A;  1I07 A;  3CMA Q;  3OSS C;  5IXB A;  4M7D E;  3M0R A;  1IRE B;  1YWP A;  1AWX A;  3G6E T;  4GY5 A;  2X35 A;  1MMA A;  1ZLM A;  4OB1 B;  4VUB A;  1K76 A;  5A0D A;  2KNB B;  1VQM A;  3V7S A;  1Q95 G;  4PLI A;  5D6W A;  3MKD A;  2YUN A;  3FIF A;  1OPL A;  1ZBX A;  2B86 A;  5KH6 A;  1RLP C;  3EG9 A;  3PIP A;  2O9V A;  2DTH A;  2X51 A;  5GJV B;  3OBW A;  1KSW A;  2JXB A;  2VGM A;  1YHQ Q;  4HT9 A;  1PWT A;  3I55 Q;  1IZ6 A;  3C95 A;  3CPW A;  1RAB B;  2RH2 A;  3NMZ C;  5GAO q;  2ZPF B;  4J83 A;  5KYN A;  1OZ3 A;  2RJF A;  4EMG A;  2EW3 A;  1PSE A;  4ZN1 A;  4C8Q D;  5DY9 A;  2P0P A;  1UGS B;  5KCH A;  2KT1 A;  3EG3 A;  2PUK B;  1VQN A;  3VYG A;  2ZPI B;  3OY9 A;  3REB B;  1MMN A;  1PSF A;  4M78 D;  2XHC A;  3EH1 A;  3S6W A;  1W4S A;  3QYG B;  2E1H A;  3CD6 Q;  4J9G A;  4DOW A;  2VV5 A;  4N0A C;  2DE0 X;  3MP1 A;  3V8L A;  1OYX A;  3ER0 A;  5CR2 A;  2HSP A;  2ROL A;  2LJ0 A;  2RQU A;  2DL8 A;  3G1J A;  4WTO B;  3H8Z A;  3QPH A;  1ARK A;  2GFU A;  2MK5 A;  4O6J A;  3EG2 A;  4M7D F;  2JTE A;  2BE7 D;  2ZPH B;  1QP3 A;  5D6X A;  2AZV A;  2OX7 A;  1AZG B;  1ZSZ C;  4IUP A;  4M75 A;  3QBY A;  2E41 A;  3H41 A;  3OQ5 A;  2EJF A;  3RNJ A;  3G6E A;  4LD6 A;  2IVW A;  4C8Q C;  4A54 A;  3PFS A;  1K73 C;  1YP5 A;  3ASK A;  1M2O A;  1MV0 B;  2JOY A;  2FYK A;  1D1C A;  5J26 A;  2ZCF B;  2QDL A;  2LVM A;  2DVJ A;  3PTA A;  4FU6 A;  4Z8A A;  2HL3 A;  1E6G A;  1S1N A;  1SRM A;  2DXU A;  3KXT A;  2K3Y A;  1XOV A;  4KBM B;  4IKF A;  2KI7 A;  1Y71 A;  1GCP A;  4A63 B;  4FM4 B;  1SSH A;  2NUP A;  1HXD A;  3G71 T;  2RB6 A;  1WXB A;  2LP5 A;  4XTW A;  4FT4 A;  4JUV A;  4A4H A;  1ABO A;  1KQ1 A;  3PVQ A;  1QQJ A;  1KHI A;  4M75 G;  2CH4 W;  1NYG A;  4OGE A;  3M0T A;  3OYK A;  2LT1 A;  4X34 A;  1RAA B;  2DZ9 A;  4JDS A;  1JB0 E;  1N9R A;  2X4Y A;  3VS7 A;  3RIR A;  1OEB A;  3S3N A;  3M53 A;  3CCV A;  3J7A F;  1U1S A;  4LD9 K;  4HA8 A;  4PNO A;  2EQU A;  4ZTF A;  4AFZ C;  1OX8 A;  1EFN A;  2FB7 A;  3MP6 A;  5A0L A;  3QUI A;  2DVE A;  2VB6 A;  2EYQ A;  4M78 F;  3JB9 G;  1SEM A;  2JMC A;  2OI3 A;  1PNJ A;  3EAE A;  3QSU A;  3I9Q A;  3G6E Q;  3JRZ A;  5LJ3 d;  3ZEH A;  3OYN A;  4M77 A;  2L89 A;  3QKJ A;  4F14 A;  2RF0 A;  3URG A;  1BIA A;  2KRO A;  3JCM b;  1U5S A;  2QQR A;  1YBY A;  1D1A A;  2EWN A;  3MJX A;  5FW9 A;  3UPU A;  3SEM A;  2RHY A;  3O5Z A;  4C5E A;  3GLX A;  4PFO A;  3RBB B;  1VQ7 T;  4ZNX A;  4M7A E;  2OAW A;  2BZ8 A;  1QCO A;  2YUQ A;  5CAI A;  7AT1 B;  4JJB A;  5KYY B;  1F1B B;  3OYL A;  5CIU A;  3OYY A;  1GCQ A;  4M75 E;  4HVV A;  3M0Q A;  3M5A A;  2DAQ A;  1ZUU A;  3A8G B;  1W2B S;  1WNL A;  2KVQ G;  1N5Z A;  2CSI A;  2YRC A;  1Q86 R;  5GAO p;  2FL7 A;  1YN8 A;  1YJW A;  4P5N A;  2DRM A;  1N8R R;  1SSF A;  2LQN A;  3JCM X;  2K57 A;  4J6Y A;  4M77 G;  1Z9Z A;  2BTT A;  2K9G A;  1VYT A;  3C94 A;  2Y90 A;  3OYD A;  3T9N A;  4XQ3 A;  1AWO A;  2LCS A;  1WYX A;  4MZM A;  4OMP A;  5LJ3 e;  3JB9 J;  2V26 A;  1KG1 A;  2F5T X;  4J6W A;  1JXM A;  1MUZ A;  1K9A A;  4AFQ C;  4JRQ A;  1M1K R;  4AMC A;  3OS2 A;  3HKS A;  1GL5 A;  2XG8 D;  4BI8 B;  3JCM d;  1ZUK A;  1JJ2 S;  1WPY A;  1I0C A;  1SPK A;  4E6R A;  2XK0 A;  2NYS A;  1M1F A;  5GAN 5;  2KXC A;  3OYG A;  1FMV A;  2RK1 A;  2RQT A;  2NLU A;  2MOX A;  3HPW A;  3ME9 A;  1Q86 U;  5C0M A;  1TG0 A;  1N8R U;  2QGF B;  4DBF A;  3OYB A;  4XU2 A;  5LJ5 j;  2HQH A;  3TQ7 P;  2D6F A;  1OUL A;  1Y96 A;  4QT7 A;  3S3M A;  1BI3 A;  2DBM A;  4J7F A;  3BFM A;  5LJ5 d;  3CPF A;  1VIE A;  4Q5W A;  1M1K U;  1ZSZ B;  5HK0 A;  4M7A F;  2FZK B;  1ZBJ A;  2RJC A;  4PJO G;  1VQP A;  4E2F B;  3JCM e;  1WXU A;  4M77 E;  2M9U A;  2ZAE A;  5CCA A;  1VQ9 T;  1VQ6 T;  1ZA1 B;  4TVR A;  4J9D A;  3TCJ A;  1Q7Y R;  2CP0 A;  3G71 Q;  3EHQ A;  1X2K A;  2KYM A;  4N4I A;  4FIB A;  4KRT A;  2HBW A;  3JB9 H;  1G5V A;  1N6A A;  4A4E A;  1VQ5 T;  3VS5 A;  3JCM Q;  5FRM A;  4JS5 A;  2ZPG B;  2RHI A;  2X4X A;  3BDU A;  2I2L A;  2L8D A;  5GMK j;  1X2Q A;  3NTH A;  1YJ9 T;  4F7U F;  2JMA A;  2EJ9 A;  5HCK A;  1Q81 R;  4FL6 A;  4DBR A;  2CDT A;  2ED0 A;  4J9E A;  5LJ5 e;  2C0I A;  1HD3 A;  4QQD A;  4C0Z A;  2XDP A;  2OAU A;  1AWW A;  1QLY A;  5CKF A;  1MHN A;  1UG1 A;  2MAM A;  5CO7 A;  3SWN B;  5GAN j;  1W2B P;  2RA2 A;  1RAG B;  1BCO A;  2VKN A;  1C6V X;  1OOT A;  1Q7Y U;  3ZFJ A;  3LLR A;  1PRL C;  2CT4 A;  4EMK A;  3M0S A;  2EVR A;  3CME A;  4DEX A;  3QHS A;  2K2M A;  4PFP A;  4CC3 A;  3VYH B;  3EGX B;  2QYZ A;  3EGD A;  1D3B A;  1R77 A;  3TEE A;  3JCM P;  2K3B A;  1MMD A;  1IGU A;  4WCI A;  2PZ1 A;  4RUG A;  4PFZ A;  4ZGD B;  5AT1 B;  1NEG A;  2ROT A;  3BW1 A;  5FWC A;  4OB3 B;  1SHF A;  3Q1J A;  3HRS A;  1AD5 A;  4XTZ A;  5KYU A;  1VQ7 Q;  1JJ2 P;  3HFO A;  1Q81 U;  3PE0 A;  5IHI A;  2NUT B;  1UEB A;  3EG9 B;  1TH7 A;  2F1L A;  4M7D A;  4A4K A;  2RHU A;  1K0X A;  2AIR B;  4C92 D;  2KRS A;  3QII A;  2KYB A;  2HSE B;  1H92 A;  4IUU A;  5CKD A;  3H0I A;  1BBZ A;  3UA7 A;  3TSW A;  3RKW A;  3L2R A;  3EG0 A;  3RMQ A;  1VQ6 A;  1QMC A;  4PJL A;  2LQK A;  2RQV A;  2Z0W A;  1BI1 A;  2E6Z A;  1BI2 A;  2BIV A;  1WFW A;  2A08 A;  5KYX A;  2RM4 A;  4KT0 E;  1I5O B;  1VQ5 A;  4B9W A;  5GAN 3;  1X01 A;  4FW2 A;  1OU8 A;  4JS4 A;  4ATO A;  1U3O A;  3CMA A;  3A8L B;  1GFD A;  3HHT B;  3LWI A;  2X3W D;  2MF2 A;  1JRI A;  2H3E B;  1LOJ A;  3M55 A;  5CVI A;  4PJO C;  2RD1 A;  1YJ9 A;  3L1A A;  3L2W A;  4M7D G;  3L2V A;  3PMT A;  4RTU A;  2P0Q A;  3FC3 A;  3NHN A;  2E6N A;  2L3R A;  8AT1 B;  1BCM A;  4Z02 A;  5LL6 S;  4EDU A;  1RAC B;  1GRI A;  2VXF A;  1LPL A;  1O9S A;  2PUO B;  1JEG A;  2DA9 A;  5AYF A;  2V8K A;  2LDM A;  4C92 C;  1PKS A;  2HCK A;  4JZ3 A;  2LJ3 A;  1IHW A;  2CP5 A;  4MZP A;  4IUQ A;  2KAF A;  2E70 A;  2MYS A;  2WSE E;  4E7K A;  1QVG A;  1YIT T;  1RLQ C;  2YRV A;  2V1Q A;  4M78 A;  5J3B A;  1VQ9 Q;  1VQ6 Q;  1XQH A;  3PMI A;  3CCS T;  2K5L A;  3GPL A;  3R6N A;  4II1 A;  1ACM B;  4BD3 A;  1X27 A;  4LDY A;  4JLG A;  3RER A;  1HSQ A;  4PK4 A;  2EAY A;  5FLX E;  3EH2 A;  3UA6 A;  3FEO A;  3RR6 A;  2V1R A;  1VQ5 Q;  2LCL A;  4GBQ A;  1AWJ A;  4OP0 A;  2DXB A;  2DO3 A;  5J39 A;  1T0H A;  1WXT A;  4JRI A;  1KQS A;  4E7I A;  1YJ9 Q;  3TRE A;  3MEU A;  5GAN f;  2F2V A;  2EGA A;  3OYI A;  2J6O A;  1KC8 R;  2PVO B;  1AHJ B;  3FJ5 A;  4XTU A;  2GF7 A;  5GAO m;  1OI1 A;  1NLP C;  3SDZ A;  3VS1 A;  4J9H A;  5L8R E;  4PJM A;  2FEI A;  1H64 1;  1OQK A;  4FYW B;  3VUB A;  3VKI A;  2CH4 A;  4R56 A;  3F70 A;  2PVD B;  2BZY A;  2DRK A;  2RK2 A;  4J7I A;  1QKW A;  3OMC A;  2HKN A;  3TVT A;  4EPC A;  2XDB A;  3QJY A;  2SEM A;  1CKA A;  1H3Z A;  2PTK A;  1WJQ A;  4OB2 B;  3CCE T;  5GAO n;  1M8V A;  2CZ7 B;  1KC8 U;  3E2U A;  2CP7 A;  2K4Y A;  1PCX A;  2HZY A;  2D8J A;  2VAS A;  4CC7 A;  3GBQ A;  4OMQ A;  3OA6 A;  1QVF S;  2M02 A;  2VC8 A;  3A98 A;  1YIT A;  3FDR A;  3L2Z A;  3I56 T;  4C8Q E;  1VQ4 T;  2O4X A;  3C12 A;  2RJD A;  3FB9 A;  5KYW A;  2RI3 A;  1JBM A;  1QCF A;  2DL5 A;  2EKH A;  1VQO T;  2CUB A;  5DLO A;  5EC7 A;  2FPD A;  5GAM f;  2LT4 A;  5DLQ E;  2DMO A;  2VYT A;  4LE9 A;  2HL5 C;  4M78 E;  3O8V A;  3OW2 S;  4PL6 A;  4XAX B;  2RN8 A;  2PNI A;  5GAN 2;  1UB4 A;  4M7A A;  1QVG P;  2DD5 A;  1UFF A;  2K3X A;  1RL2 A;  2FPF A;  2OTL T;  1D0X A;  3MEV A;  2X3X D;  2GQI A;  3OBY A;  2KDS A;  1KD1 R;  3VS3 A;  4IUT A;  1M9S A;  5IHN A;  1YCY A;  1FYN A;  4MDX A;  1PG5 B;  2RHZ A;  5L23 A;  2ZPB B;  1X6G A;  4JJD A;  3RDV A;  2K5F A;  1JO8 A;  1M2V B;  4RTX A;  5GAN g;  3V7R A;  4PJO B;  1K9M R;  1PD1 A;  1OV3 A;  1Q82 C;  2JZ2 A;  1KQS P;  3PVL A;  3NGP A;  2IG0 A;  3CCU T;  3EGU A;  4F7U A;  4V2S A;  1B07 A;  4E7H A;  2CSQ A;  4M7A G;  1VOM A;  3OSV A;  2EKO A;  1YJN T;  4OMM A;  3UF4 A;  4L6V 5;  1EX4 A;  1BYM A;  5FU7 C;  4HT8 A;  3LGF A;  3CXC S;  4NL3 A;  1YIT Q;  1PKT A;  1KD1 U;  1T3S A;  1MND A;  4Z89 A;  4C92 B;  3SWN C;  3CCS Q;  4C5H A;  2ENM A;  4C8Q F;  4FYX B;  2EQI A;  2MIO A;  3QDR B;  5IAY A;  2YUP A;  2AHJ B;  2HBP A;  3CCM T;  2F5K A;  5KCO A;  4NOY A;  3EG1 A;  1K9M U;  4HKE A;  1K8A C;  1M3B A;  2V8J A;  5LJ3 j;  5I2M A;  4FYV B;  5GAO l;  1WDX A;  2HMA A;  1MV3 A;  1TUG B;  1IRX A;  2DD4 A;  2D0N A;  1TUD A;  4ANJ A;  2DX1 A;  2HQX A;  3M58 A;  3AT1 B;  2A28 A;  4DOV A;  5FRN A;  4DBH A;  3V8J A;  2L3P A;  4KGV B;  1NM7 A;  1PM3 A;  5GAM g;  2R5M A;  3P8H A;  1NE8 A;  1R0B G;  2L2P A;  2D1X A;  4JJC A;  1WHM A;  4F17 A;  1Y0M A;  2K6D A;  4M75 D; 
#chains in the Genus database with same CATH homology
 1Y57 A;  2J6K A;  2W10 A;  5IH2 A;  1JXO A;  1J3T A;  4IIO A;  1T3L A;  3M0P A;  2FRY A;  2A36 A;  2KRM A;  2A37 A;  4OMO A;  3ZL7 C;  3NPF A;  4OMN A;  2JMA A;  5HCK A;  3UAT A;  1UDL A;  2KEA A;  2IIM A;  2H8H A;  4M4Z A;  4HVU A;  2CDT A;  2ED0 A;  4J9E A;  2EYW A;  4J9C A;  2C0I A;  1HD3 A;  4AG2 C;  4Y92 A;  1AWW A;  1QLY A;  5I22 A;  1UG1 A;  2K7A A;  2W0Z A;  1UGV A;  5ECA A;  2ABL A;  2F2X A;  1M27 C;  2J06 A;  1W1F A;  2CRE A;  2DBK A;  2VKN A;  1OOT A;  1UHC A;  1PRL C;  2CT4 A;  3M0S A;  2EVR A;  1BU1 A;  3IQL A;  4DEX A;  1ZSG A;  2K2M A;  2XMF A;  4CC3 A;  1Z9Q A;  1LCK A;  2CT3 A;  2VWF A;  2K3B A;  4D8K A;  4DEY A;  3I5S A;  1W70 A;  1NEB A;  4WCI A;  4K11 A;  2PZ1 A;  4LUE A;  2KGT A;  4RUG A;  2EBP A;  1YCS B;  1NEG A;  2ROT A;  1I07 A;  2AK5 A;  2DL3 A;  1V1C A;  5FWC A;  1SHF A;  1AD5 A;  2KT8 A;  1GFC A;  1G83 A;  5IXB A;  3M0R A;  3PE0 A;  5IHI A;  1YWP A;  1E7O A;  1AWX A;  1K1Z A;  1ZLM A;  1K0X A;  2ECZ A;  1K76 A;  2KNB B;  1U06 A;  2NWM A;  2KRS A;  1PHT A;  2KYB A;  1H92 A;  1NG2 A;  2DM1 A;  2DIL A;  3H0I A;  1K0S A;  1BBZ A;  3UA7 A;  3TSW A;  2YUN A;  3EG0 A;  1OPL A;  2B86 A;  1RLP C;  2O9V A;  5GJV B;  2RQV A;  1KSW A;  2JXB A;  1UEC A;  1PWT A;  2AZS A;  1M3A A;  2DJQ A;  4RTV A;  1HJD A;  1UHF A;  3CQT A;  1WFW A;  2A08 A;  4RTW A;  3NMZ C;  2EW3 A;  2M51 A;  2JT4 A;  5IHK A;  1M8M A;  1U3O A;  1GFD A;  2X3W D;  1JQQ A;  4IIM A;  2KT1 A;  2L0A A;  3EG3 A;  2FO0 A;  1X69 A;  1AEY A;  4RTU A;  2KRN A;  3NHN A;  3REB B;  2GTO A;  1BB9 A;  2DL4 A;  1H8K A;  4RTT A;  1NYF A;  1WIE A;  1GRI A;  2ED1 A;  2YUO A;  3VS6 A;  1I1J A;  1JEG A;  3H0F A;  2DA9 A;  4J9G A;  3LH5 A;  2DE0 X;  1FMK A;  2O9S A;  1T0J A;  1TUC A;  1BK2 A;  3THK A;  3VRY A;  2HSP A;  1PKS A;  2ROL A;  2HCK A;  2LJ0 A;  2RQU A;  4JZ3 A;  2JS2 A;  2DL8 A;  2EPD A;  2LJ3 A;  2JM8 A;  1NLO C;  2OJ2 A;  1ARK A;  2DNU A;  1RUW A;  2ESW A;  3VS2 A;  3JV3 A;  3EG2 A;  1SHG A;  1WA7 A;  3ULR B;  2JTE A;  4EIK A;  1RLQ C;  2V1Q A;  2AZV A;  4J9B A;  1AZG B;  1AZE A;  3H41 A;  1KJW A;  2D8H A;  3SHW A;  3R6N A;  1WX6 A;  3RNJ A;  2DL7 A;  1X27 A;  4ESR A;  2EGC A;  4HXJ A;  1HSQ A;  1YP5 A;  2SRC A;  1YWO A;  1VYU A;  2I0N A;  2AKK A;  3UA6 A;  1MV0 B;  2JS0 A;  2V1R A;  4LUD A;  2VVK A;  2QDL A;  2RQR A;  2YDL A;  4GBQ A;  1AWJ A;  2DVJ A;  4J9I A;  1T0H A;  1WXT A;  4Z8A A;  1G2B A;  1GCQ C;  1E6G A;  1S1N A;  1B3Q A;  4JPB W;  1SRM A;  2EGE A;  1UUE A;  2JW4 A;  2KXD A;  1SRL A;  3REA B;  1XOV A;  2EYZ A;  2F2V A;  2EGA A;  4F16 A;  1GCP A;  4A63 B;  2J6O A;  2JM9 A;  2FG0 A;  1SSH A;  3FJ5 A;  1RI9 A;  1WXB A;  2LP5 A;  1WI7 A;  1ABO A;  3PVQ A;  3QWX X;  2CH4 W;  1NLP C;  2E5K A;  3VS1 A;  1NYG A;  4HCK A;  4J9H A;  3M0T A;  2FEI A;  4Z88 A;  2DLP A;  3VS7 A;  4LN2 A;  2O88 A;  2GGR A;  1OEB A;  2CH4 A;  2BZY A;  2DRK A;  1QKW A;  4RTY A;  4AFS C;  2EYY A;  3TVT A;  2K79 A;  4AFZ C;  1GBQ A;  2SEM A;  1EFN A;  4D8D A;  2HEQ A;  1UE9 A;  2C0T A;  3C0C A;  1CKA A;  2DF6 A;  3VS4 A;  2GTJ A;  2FRW A;  2PTK A;  2RMO A;  1SEM A;  4JZ4 A;  2JMC A;  2OI3 A;  1CSK A;  1PNJ A;  2F2W A;  1YNZ A;  3I9Q A;  5FWB A;  2D8J A;  2G6F X;  1ABQ A;  1VYV A;  2LZ6 B;  4CC7 A;  2C0O A;  3GBQ A;  4OMQ A;  1UJY A;  3A98 A;  3EHR A;  4F14 A;  2RF0 A;  2YSQ A;  2L3S A;  2M0Y A;  2KRO A;  1U5S A;  2RPN A;  1QCF A;  2LQW A;  2DL5 A;  2EKH A;  1E6H A;  4ORZ A;  2BZX A;  5FW9 A;  2CUB A;  2J05 A;  5EC7 A;  3SEM A;  2FPD A;  3O5Z A;  3RBB B;  1ZUY A;  4ZNX A;  1GBR A;  2HDA A;  2OAW A;  2BZ8 A;  2DMO A;  2RNA A;  4LE9 A;  2YUQ A;  1QWF A;  4JJB A;  1WLP B;  2RN8 A;  2PNI A;  4RTZ A;  1M3C A;  2AKL A;  1GCQ A;  1UFF A;  2DYB A;  4HVV A;  3KFV A;  3M0Q A;  1ZUU A;  1H3H A;  2FPF A;  2X3X D;  1N5Z A;  2LJ1 A;  2CSI A;  2GQI A;  2GNC A;  3VS3 A;  3QWY A;  5IHN A;  4AFU C;  1YN8 A;  1FYN A;  2DRM A;  4LNP A;  2LQN A;  1JU5 C;  2J7I A;  5L23 A;  2CUD A;  1Z9Z A;  1X6B A;  2BTT A;  2K9G A;  1VYT A;  1X6G A;  2NUZ A;  4JJD A;  1AWO A;  4J9F A;  2LCS A;  1PRM C;  1WYX A;  3I5R A;  4OMP A;  4RTX A;  1JO8 A;  4CC4 B;  1JXM A;  1MUZ A;  2J6F A;  1K9A A;  4AFQ C;  2KR3 A;  2KE9 A;  1KFZ A;  1OV3 A;  2LMJ A;  2RQW A;  3PVL A;  1CKB A;  5GJW B;  3NGP A;  1GL5 A;  1ZUK A;  1AVZ C;  3H0H A;  3EGU A;  4GLM A;  1I0C A;  1OPK A;  1SPK A;  4E6R A;  1B07 A;  4HVW A;  2CSQ A;  2YT6 A;  2MCN A;  3M0U A;  2KXC A;  4FSS A;  4OMM A;  3UF4 A;  4AG1 C;  1UTI A;  2RQT A;  2GBQ A;  1A0N B;  1PKT A;  2MOX A;  1T3S A;  4CC2 A;  4Z89 A;  1TG0 A;  5I11 A;  1QWE A;  4R0K A;  2ENM A;  1ZX6 A;  2EQI A;  2MIO A;  2YUP A;  2O2O A;  3VS0 A;  2LX7 A;  4QT7 A;  2DBM A;  3EG1 A;  2EYX A;  1AOJ A;  1VA7 A;  3I35 A;  1M3B A;  1W6X A;  2P4R A;  2KBT A;  1WDX A;  3TSZ A;  1MV3 A;  1ZBJ A;  2D0N A;  1TUD A;  1WXU A;  2L3Q A;  2DX1 A;  3VRZ A;  4J9D A;  1KIK A;  2FPE A;  1UJ0 A;  1X43 A;  2O31 A;  2A28 A;  3EHQ A;  1X2K A;  2L3P A;  1K4U S;  1IO6 A;  2KYM A;  5IXF A;  1NM7 A;  1QKX A;  1M30 A;  4KRT A;  2HBW A;  3U23 A;  2L2P A;  2D1X A;  3VS5 A;  4JJC A;  4F17 A;  1Y0M A;  2K6D A;  4OML A;  2LNH B;  4X1V A;  1X2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...