1MUZA

Nmr structure of the tumor suppressor bin1: alternative splicing in melanoma and interaction with c-myc
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
81
Chain Sequence
GRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKKLEKCRGVFPENFTERVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myc box dependent interacting protein 1
publication title A structure-based model of the c-Myc/Bin1 protein interaction shows alternative splicing of Bin1 and c-Myc phosphorylation are key binding determinants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 12
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2002-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1muzA00
4CC4B 1PKSA 2F2XA 2CH4A 4HVWA 1QWFA 4J9HA 1K4US 2GGRA 2BZXA 1AVZC 1I1JA 2ESWA 2DX1A 2FPFA 2HDAA 2DILA 2DNUA 2RQTA 1W70A 1ARKA 2OAWA 1KFZA 3H0HA 2EGCA 5I11A 2W0ZA 3NPFA 1WXTA 4RUGA 2C0IA 2L3SA 5IHNA 2KT1A 4M4ZA 3EG1A 1YNZA 1WXBA 1GFDA 2FRWA 1AZGB 2CT4A 2L2PA 2X3WD 4J9BA 4J9DA 1JXMA 1SEMA 2EPDA 1KJWA 1FYNA 2LP5A 1M3CA 1Y57A 3NGPA 4HVVA 1X69A 4AFSC 1GCQC 1WFWA 1X27A 1E7OA 1T3SA 1UE9A 2QDLA 3ZL7C 3M0RA 4RTXA 2V1RA 1PRMC 1M3AA 2EYXA 1V1CA 5IHIA 2RPNA 1WI7A 2L3PA 4HVUA 1E6HA 1SPKA 3H41A 1UG1A 3M0PA 5L23A 2EBPA 3GBQA 5IHKA 2D0NA 1GL5A 2DL3A 5IXFA 2EYZA 1NG2A 1CKBA 3UA6A 1AZEA 2EGAA 2RN8A 4JJCA 1PWTA 2J06A 3EGUA 1NM7A 2FEIA 3THKA 1TUDA 1PRLC 2ABLA 1ZX6A 4ZNXA 4F14A 2H8HA 1UJ0A 1T3LA 2DRMA 1X6BA 2DL8A 2AKKA 1ZUKA 4RTZA 1ABOA 1SRLA 4OMLA 1QLYA 1QWEA 3I9QA 2KYBA 3H0IA 2KRNA 1BB9A 2KEAA 3I5RA 5ECAA 1CSKA 2JTEA 2KYMA 3A98A 2KBTA 3O5ZA 4DEXA 3NMZC 2KNBB 1NEBA 2DJQA 1M27C 2JS2A 2ENMA 3UF4A 2KXDA 2EGEA 1GFCA 1X2KA 2J7IA 1KSWA 3ULRB 2GBQA 2D1XA 1U06A 1PHTA 3PVLA 1M8MA 1RLQC 1JO8A 2K6DA 1SHGA 2DBKA 1ZSGA 4Y92A 2M0YA 3REBB 2AK5A 3NHNA 4FSSA 1GBRA 2LJ1A 1Z9ZA 2YUPA 2IIMA 4RTUA 2ECZA 2JW4A 2RQRA 1OPLA 4WCIA 1LCKA 4X1VA 4IIMA 2CSIA 1QKWA 2EYWA 1I0CA 1OV3A 1WYXA 2RQUA 1K1ZA 1SRMA 2OJ2A 4OMQA 1EFNA 2RNAA 2JM8A 1NEGA 2DVJA 2LJ3A 1IO6A 2HEQA 2F2VA 1SSHA 1E6GA 1W6XA 1G2BA 2DE0X 3VS1A 1RI9A 2CREA 4LNPA 1GCQA 1UJYA 2KXCA 3QWYA 4RTYA 2AZVA 2KE9A 1H3HA 1OEBA 4LN2A 1M30A 4GBQA 2LCSA 4ORZA 4OMPA 3H0FA 1FMKA 4A63B 1QKXA 3JV3A 2PZ1A 4HXJA 1WXUA 2W10A 2KRSA 3EHRA 4OMMA 1K9AA 1RLPC 2KROA 3C0CA 2EQIA 3TSZA 4AFQC 4CC3A 4J9EA 2K9GA 1AOJA 1BK2A 2YT6A 2EVRA 1PNJA 2CT3A 5IXBA 1S1NA 1YCSB 4E6RA 4F16A 1MUZA 1YP5A 4F17A 5FWCA 4JZ4A 1WA7A 2BZYA 4KRTA 2ED0A 1SHFA 5GJWB 4AG1C 1UFFA 2PTKA 1H8KA 4K11A 2O88A 1T0JA 1VYVA 2CUDA 3SHWA 3FJ5A 1WLPB 2NUZA 5I22A 2E5KA 4JJDA 2B86A 2JS0A 1ZUUA 2A08A 3RNJA 4D8KA 2GTJA 4LUEA 4Z8AA 1G83A 2A37A 2BZ8A 2GQIA 3VS4A 2AZSA 2RMOA 2JMCA 3VS3A 2D8JA 2DRKA 3VRYA 1B3QA 4AFZC 2L3QA 2FO0A 2O9SA 3EHQA 5FWBA 1VA7A 2JXBA 2V1QA 2L0AA 2SEMA 2YUQA 2K3BA 1X2QA 3VS0A 1GRIA 4CC2A 1VYUA 1X43A 2EKHA 4HCKA 4QT7A 2G6FX 2GTOA 2O2OA 2DL5A 2YSQA 4J9GA 1AWOA 2LMJA 1OOTA 3EG2A 2K2MA 4Z88A 2CSQA 3QWXX 1MV0B 3EG0A 2A28A 4DEYA 1WDXA 3TSWA 1GBQA 1ABQA 2P4RA 2LJ0A 3SEMA 3I35A 1Y0MA 3LH5A 3TVTA 2XMFA 2VVKA 2LZ6B 1ZUYA 3R6NA 2FRYA 1WX6A 2JM9A 1MV3A 2KGTA 1KIKA 2HSPA 1RUWA 5GJVB 2MCNA 2KT8A 2VWFA 2LX7A 2EYYA 2YUOA 1U5SA 2OI3A 2LQNA 4JJBA 4J9IA 1NLOC 5EC7A 1ZBJA 3KFVA 1HJDA 4EIKA 1J3TA 3M0SA 2YDLA 5HCKA 2J6KA 1M3BA 3M0QA 1A0NB 1U3OA 2J6OA 1B07A 1X6GA 2LNHB 1H92A 1UHCA 2LQWA 2D8HA 1AWXA 4IIOA 2AKLA 2DA9A 2JMAA 2KRMA 2VKNA 4D8DA 2FG0A 2J6FA 4J9CA 2O9VA 2FPDA 2SRCA 2BTTA 4CC7A 2CDTA 1K0XA 2MIOA 2GNCA 2DMOA 1UUEA 1AWJA 3U23A 2HBWA 2C0OA 3PE0A 4LE9A 1JEGA 1TUCA 1AD5A 1JQQA 1JXOA 3UATA 2DM1A 2MOXA 4OMNA 1I07A 1YWPA 2ED1A 4RTWA 2RQWA 2JT4A 5IH2A 2ROLA 3VS6A 2EW3A 2O31A 1K76A 1UDLA 1YN8A 1ZLMA 2PNIA 2ROTA 4OMOA 4R0KA 2CUBA 2NWMA 2K79A 1VYTA 4GLMA 3EG3A 2FPEA 2X3XD 1NYGA 3VS5A 1GCPA 1AWWA 2I0NA 3VS2A 1WIEA 2DL4A 1UTIA 1PKTA 3IQLA 2RF0A 3VS7A 2A36A 1UECA 3CQTA 3UA7A 1N5ZA 3M0UA 4J9FA 3VRZA 1TG0A 2RQVA 2HCKA 4JPBW 5FW9A 3REAB 1Z9QA 3I5SA 1JU5C 1T0HA 1NYFA 2CH4W 1BU1A 1QCFA 2C0TA 3PVQA 1YWOA 1NLPC 1XOVA 2J05A 4LUDA 2DL7A 4JZ3A 1BBZA 1UGVA 2F2WA 2DF6A 3RBBB 4Z89A 2YUNA 2DBMA 1HD3A 4RTTA 1UHFA 2M51A 4RTVA 1K0SA 1W1FA 2DLPA 1OPKA 2DYBA 4AFUC 1HSQA 2KR3A 1AEYA 3M0TA 4AG2C 4ESRA 2K7AA 1CKAA
chains in the Genus database with same CATH superfamily
2DJZA 1HK9A 2F2XA 2O01E 4J9HA 2RJFA 3JSCA 4NOYA 4JDSA 2ZPFB 4HT9A 2FPFA 4KULA 1JB0E 4OGEA 5GAN4 2MK5A 1Q81U 2BIVA 1W4SA 5I11A 1YHQT 1UB4A 1VQLQ 3GP8A 1TSFA 3QDRB 2QEXQ 3V7RA 1WXBA 1GFDA 2X3WD 1IZ6A 4J9DA 4RMOA 1SEMA 3PIOA 2V8KA 5CQYA 1WFWA 2QDLA 3CCEA 3TCJA 2DEUA 1G8XA 1Q82R 2DVEA 1WI7A 2L3PA 3H41A 4LDXA 5L23A 1C6VX 2EBPA 5IHKA 2D0NA 3JCMX 2NUPB 2ZZDA 3OW2S 3JCMV 5A0LA 4MZTA 1AZEA 2J06A 4L5GA 3CXCS 3RESA 1PRLC 3D7SB 3META 5J3BA 4OB3B 1UJ0A 3CCET 3OYNA 4IUPA 1ZUKA 5CKEA 3CC7Q 4BDYA 4RTZA 1FMWA 1SRLA 4E7IA 4ZTFA 3I9QA 2KYMA 2KBTA 3PMIA 2ZPIB 2V8JA 2EGEA 3CCEQ 2J7IA 4M75C 4EMKC 3L2VA 3MP8A 3SWNA 2GBQA 4M75G 1U06A 1PHTA 4A4HA 3BFMA 1Q86C 1K9MU 3BDUA 1XQHA 1ZSGA 3CCVA 2GF7A 4PK4A 4M7DF 2AK5A 1GBRA 1M2OA 2E3IA 4C92B 3V8LA 2JW4A 3OYKA 1B34B 1FMVA 4XQ3A 1QCNA 4PJJA 4X1VA 2QASA 3ZEHA 2PU9B 2IVWA 5GANj 3LWHA 2RQUA 3MHXA 2OTJA 5KYYB 1EFNA 2RNAA 1NEGA 2DVJA 3V8JA 2LJ3A 3P8HA 4DBQA 2M9UA 1OI1A 2F2VA 3OYYA 2E70A 2HQEA 2CREA 4LNPA 2KXCA 1XJWB 3L1AA 1U8RA 3QUIA 4XTWA 4QVCA 4M7DA 1MMAA 2AHJB 3C95A 1OX8A 2AZVA 4FW2A 2H3EB 3EGDA 4LN2A 4GBQA 3OW2A 1RABB 4OMPA 4X34A 1D3BB 2OTJT 1QKXA 2HQHA 4QQGA 3CXCA 3JV3A 1OU9A 4HXJA 2KRSA 4OMMA 1K9AA 3OYLA 3QDFA 4AFQC 2R5AA 4C0FA 1AOJA 3DB3A 1BK2A 5GMKi 2OTLQ 1PNJA 2VYTA 3C12A 2CT3A 1S1NA 2BE7D 4XU3A 2AIRB 4F16A 2NUTA 3EG9B 5HK0A 4ELYC 2XU8A 2R58A 4F17A 2YWWA 5FWCA 2A3LA 3CPWS 1SHFA 2COYA 1UFFA 2PTKA 3GLXA 3CCRQ 2O88A 2K2VA 3X20B 5I22A 2HKQB 3E19A 4JJDA 3RMQA 2B86A 2JS0A 2RD1A 4FU6A 4WF2A 4LUEA 4Z8AA 1G83A 3JCMd 2GQIA 4KH0B 5D6XA 3VS4A 2AZSA 2JMCA 1X6OA 2JN0A 1R77A 3VRYA 1B3QA 4AFZC 4F7UA 2L3QA 1RI0A 3OW2P 4XU0A 4M75E 5GANd 2L0AA 1Y71A 2SEMA 2FYKA 5CKFA 4A4KA 2DEQA 2LDMA 3CXCP 4CC2A 3QYHB 1VYUA 2CZ6B 3CPFA 1X43A 3G71A 2CP0A 2QQSA 2G6FX 5KYUA 3I56A 3G6EA 2K2MA 1M90C 3A8MB 2CSQA 4PJMA 2XKOC 2RI2A 3HHTB 1WHLA 4DEYA 3FEOA 2X4WA 1OZ2A 3OYEA 1TOVA 3TVTA 3C94A 3GNFB 1ZUYA 5LJ3g 1HYOA 2HSEB 3G71T 1KIKA 1JJ2A 1LNXA 4L59A 5KE3A 4FM4B 5C6SA 4M78B 1BCMA 3I56T 4C0GA 2KT8A 3F70A 5LJ5d 1KG1A 2LX7A 4D6WA 4PLLA 2OI3A 5CIUA 1VQNQ 4J9IA 4KGXB 1NLOC 5GMKm 3VUZA 4BY6C 2JNGA 4B9WA 4IKFA 2LX9A 4EIKA 3HSBA 5FRNA 5AT1B 1J3TA 3JCMQ 1AHJB 2J6KA 3M0QA 4ZN3A 3I56Q 3NFCA 2ZPEB 3CD6A 2J6OA 1M9SA 4BUGA 2LNVA 4IUTA 1QVGS 4M75F 1K73R 1WZOA 2LQWA 4M77F 2AKLA 2EAYA 4P5NA 2FG0A 1ZQ1A 4N4HA 2DD5A 4J9CA 2FPDA 3OYMA 1RACB 2KK4A 2FL7A 4ZN1A 2VXFA 2K5LA 2EQJA 4OB1B 2OX7A 3OYGA 1JEGA 3CD6T 2RHUA 2DM1A 1TXQA 3OMGA 5GAOm 3EGXA 5FU6C 1Q7YU 2M1HA 1JJ2P 1PD1A 1SSFA 4OMNA 1B7TA 1QP2A 2ED1A 4RTWA 3NTHA 2JJ9A 1IGUA 2EW3A 4M77A 5GAOq 2ZGWA 5KCHA 5I21A 4VUBA 2DTOA 2XIDA 1ZLMA 3CD6Q 1D1AA 2PNIA 3CCMA 2VGNA 4KUIA 4EPCA 1Q82C 5GAMg 1NJIR 3CCQA 1G3YA 4PJOA 2D6FA 2PUOB 3VV0A 2CZ1B 1KC8U 1VQMA 4FYWB 4RG8A 3RIRA 3OS2A 4XU1A 4PFZA 1K9MR 4RCCA 3BW1A 1UECA 3CQTA 3UA7A 1N5ZA 3CCMT 1YCYA 3QZ9B 3CCSA 1LOJA 3MEVA 5KH6A 1TG0A 3VUBA 4M7DD 3A8LB 3LGLA 4J83A 1RL2A 1NYFA 1R0CB 1BU1A 5LL6S 2R57A 3OS0A 4JS4A 5FLXE 2DERA 3PVQA 1VQMT 4C5IA 4C5GA 4B9XA 1QVGA 2DL7A 2E4HA 3MEWA 4BI8B 2XDBA 5EG2A 4GY5A 2DIGA 2DF6A 3JRZA 3SWNC 3CCMQ 3RDVA 2RI5A 2YUNA 2DBMA 1QVPA 3OYDA 4RTVA 3CCST 1K0SA 1W1FA 1KD1R 1UEBA 3OYIA 2QA4Q 3DB4A 3M0TA 1TH7A 1IRXA 1Y96B 5J26A 2NUPA 5KYXA 1G3WA 5HK3A 3MKDA 1N8RR 3OYFA 4F04B 1AVZC 1WHKA 2HDAA 2DNUA 1U1SA 3S6WA 1PM3A 2OAWA 9ATCB 1ZA2B 2EGCA 3CCSQ 3CC4A 3NPFA 4C92F 2COZA 1VQ4A 1C1AA 2L3SA 5IHNA 4M4ZA 3EG1A 3QIIA 2V26A 2FRWA 1AZGB 2D9TA 2EPDA 1NZ9A 2LP5A 3NGPA 4HVVA 1X69A 3SFMA 1X27A 3A8HB 1E7OA 1UE9A 4DBRA 4PFOA 4M7DC 1WHGA 1G3TA 6AT1B 3M54A 1QVGP 4M7DG 4E7HA 2QG9B 5IHIA 4C0DC 1SPKA 3A8OB 3CC4T 3M0PA 5GAN5 5CK9A 4JRPA 4FL6A 1NG2A 1CKBA 4E7KA 1SKUB 4JJCA 1PWTA 3L2ZA 4C92A 1NM7A 5GAN2 1B34A 1TUDA 2YLBA 2ABLA 3FRNA 4F14A 3HFNA 2H8HA 2DRMA 2AKKA 4CI0C 2EQKA 3G4SA 1BIAA 4OMLA 4Y28E 1QLYA 4QKUA 3H0IA 2KRNA 3CEYA 4V2SA 1BB9A 2BE9B 3M55A 5KYYA 5ECAA 2LCLA 4LDWA 1ZSZB 2DJQA 4C8QF 2JS2A 1D0YA 3LGFA 2ATCB 2LC4A 3OBYA 1GFCA 3OYJA 1WPYA 1KSWA 2D1XA 1TWBA 1V29B 5L8RE 1M8MA 1JO8A 3G4ST 3JB9I 2K6DA 2RHXA 3A1PA 1VQ6Q 1YI2A 2DBKA 2M0YA 1QW1A 2K3YA 1VQ8A 1D3BA 4II1A 1Z9ZA 2IIMA 2ECZA 2RHZA 3M58A 1OPLA 3JCMb 2FVUA 4IUVA 4L6V5 2YRCA 1QKWA 4QQ6A 3WVEB 1OV3A 1WYXA 4C8QA 1K1ZA 3BY7A 1K8AR 1F1BB 2OJ2A 4FW1A 3EG9A 2GCXA 2JM8A 4B6MA 1IO6A 1P92A 2DTHA 2HEQA 1VQ8T 1E6GA 1W6XA 4JRKA 1G2BA 3VS1A 5LJ5g 1IXDA 1GCQA 4JUVA 3I55Q 4N0AA 2ZCFB 2RI3A 3BE3A 5KYWA 4M75D 1YJNA 4A4GA 1LVKA 5KYNA 2LCSA 2E1HA 2M16A 4M77D 3M56A 4HT8A 1D0ZA 3FJPA 3CMEA 3LLRA 2PZ1A 4EDUA 4M7DE 3OB9A 2RM4A 4IURA 2EQIA 2QDYB 1YHQQ 3JB9J 5CO7A 3ME9A 4XTVA 5IXBA 1QCOA 3HFOA 3PMTA 1M8VA 3J7AF 1VQ5A 2QTXA 1YJNT 1YP5A 5D6WA 1WHMA 1K73C 2LT4A 3CMET 4BACA 2ED0A 4J8OA 1BI0A 5GAMf 3FJ5A 1WLPB 2RO0A 3GIBA 2P0QA 2RK2A 4FT2A 1KC8R 4J5YA 1YJNQ 2A37A 1IHVA 5KCOA 3E1SA 4JRIA 2DZ9A 2HD0A 2DRKA 4M78A 3CMEQ 4OF1A 3RKYA 3M4YA 1JBMA 2E65A 2XDPA 3NTKA 2QGFB 3GPLA 2YUQA 1ZA1B 4LDVA 3X25B 1X2QA 4M77C 2CP7A 1Q86U 4M77G 2GTOA 2YSQA 2O2OA 3P8DA 1MV0B 3EG0A 5CR2A 2RK1A 3FC3A 4PJOC 1JRIA 3TSWA 4A4FA 1NJIC 4JJNK 1NE8A 2LJ0A 3SEMA 5GAN7 1M1FA 1RAHB 1VQKA 5GAOn 2QTVA 3JB9H 1UGRB 2E41A 1WX6A 1MV3A 2KGTA 2KQWA 5CVIA 3T9NA 4OVAA 2HSPA 2EJ9A 2I2LA 3OS1A 5GAOr 2K5IA 3CCVT 1I8FA 2EYYA 2YRVA 4MZPA 2F1LA 2EQUA 3CCJA 5EC7A 1FXXA 3KFVA 2MWPA 1KQ2A 3ZBDA 5DLQE 3UT1A 7AT1B 5GAN8 5HCKA 1VQKT 1PSEA 2BUDA 3RERA 3KXTA 4KBMB 3HRSA 1TUGB 3CCVQ 1YJ9A 1LJOA 5GAOp 1X6GA 1JJ2S 2LNHB 4C92D 1UHCA 4LD9K 4IIOA 2KVQG 1YJWA 2VC8A 1KD1C 3CCJT 3L2RA 4F7UF 3EH2A 4CC7A 2MIOA 4M7AB 1N8RC 2PVDB 2XHCA 4HKEA 2OTJQ 2DMOA 1UUEA 1AWJA 3OSSC 3U23A 4BD3A 2HBWA 4LE9A 1U1TA 1TUCA 3ASKA 1JQQA 1JXOA 1YJ9T 2WSCE 2MF2A 1YJWT 4CRIA 1I07A 3CCJQ 3VU3C 2EJGA 2RQWA 2ROLA 2F5TX 1K76A 3CBPA 2GFUA 1YN8A 5GAN3 5A0GA 2H3JA 1YJ9Q 1RAAB 4OMOA 4WTOB 3QZ5B 3NTIA 1YJWQ 2QI2A 3QXEB 2RH2A 4M77E 3SD4A 2FPEA 1NYGA 3VS5A 1UGSB 1MMDA 5I2SA 2L89A 3DLLA 4C8QD 2I0NA 3VS2A 3S3MA 1M90U 4C92C 1Y96A 3N5BB 1YITA 1PKTA 2FB7A 4C92G 4EMHA 4PJOE 5DY9A 1D0XA 1Y7XA 3OA6A 2CYZB 3H9NA 1RAGB 1OULA 1SF9A 4OB0B 1M4ZA 1Z9QA 3I5SA 3LX7A 1T0HA 1BCOA 4BE0A 2CH4W 2E3HA 4TVRA 2RJEA 1S72A 1NLPC 1XOVA 2LCCA 3G6ET 2DPPB 1UGVA 2F2WA 1YITT 3V8KA 2JZ2A 4JLGA 3UPUA 1EZZB 1HD3A 2RJCA 3E9GA 2P0KA 2DLPA 2DYBA 1Q81R 4AFUC 3C4SA 1HSQA 2KR3A 3G71Q 2B8AA 4AG2C 1WQWA 4ESRA 2K7AA 4CC4B 1PKSA 1QWFA 2GGRA 1XNIA 3G6EQ 1S72T 2CP2A 3V7SA 1VQ9A 5CKDA 2DAQA 1ARKA 5GAMh 1KFZA 1KHIA 2FZCB 4C8QC 4O5VA 1WXTA 1K8AC 4C8QG 2KT1A 4MMLA 2CT4A 4PJOF 1S72Q 1M2VB 1YBYA 1ZSZA 2E64A 4AFSC 2ZPGB 4M78D 1GCQC 3JAME 1QVFA 1T3SA 4N0AC 1V76A 2Z0WA 1R0BG 8AT1B 2JVVA 1VQ9T 4RTXA 2V1RA 1PRMC 2RHIA 2XICA 4XTYA 3X28B 2RPNA 2PVOB 4HVUA 1I5LA 1E6HA 3FB9A 3M5AA 2X4YA 2XDDA 2LQ8A 2RN8A 3J81E 4XTUA 3M53A 3EGUA 2YHTA 1RAIB 1VQ9Q 4ZNXA 3OSVA 4M7DB 3JCMW 2DL8A 1N27A 1M5Q1 1KQSS 4E7ZA 4RCBA 3Q1JA 2HL5C 4C0DB 1QWEA 4C92E 5DLOA 2KEAA 5GAMe 3I5RA 1CSKA 3A98A 1DJ7B 4DEXA 2FZKB 3J80E 1NEBA 1M27C 1N9SA 1PD0A 1BI1A 2KXDA 2NYSA 1WHHA 2WSFE 4QQDA 3ULRB 4XTZA 1QVFP 3CCQT 1ZBXA 3PNWC 1SHGA 3OYHA 2KI7A 2JOYA 4M78C 2VUBA 4Y92A 2ZPBB 1TTHB 1G5VA 1UGQB 4FSSA 4M78G 4RTUA 1WJQA 3PGGA 3M59A 2RQRA 1NPPA 4WCIA 1LCKA 4IIMA 2CSIA 3JCMc 2EYWA 3CCQQ 2WACA 5CAIA 1I0CA 1ZHIA 2DXUA 1SRMA 4OMQA 3OBWA 2O4XB 1VQMQ 5GAN6 2K57A 3QJ6A 4KT0E 5CKBA 1NBEB 3S3NA 4HCZA 1RI9A 4C8QE 1UJYA 1VQPA 4QVDA 4XU2A 1H3HA 1OEBA 4HA8A 5LJ3j 3H0FA 3CBMA 4FIBA 4A63B 2K3XA 4A53A 3ER0A 3CMAA 3TU4K 1KK7A 4KGZB 3LW5E 2K5FA 2DZCA 1H3ZA 4J9EA 1KQSA 2YT6A 2HBPA 4PLIA 1VQPT 1VIFA 1YCSB 3M57A 4E6RA 4QW2A 1VQ4T 2R5MA 2VASA 5D6YA 4KRTA 3S3OA 3CMAT 1M1GA 1H8KA 4K11A 1T0JA 1VYVA 2CUDA 3CC2A 3SHWA 1LPLA 2NUZA 3HP9A 1YIJA 2A08A 4N4IA 3CC4Q 1VQ4Q 2Y4XA 2XD0A 2QYZA 1WHJA 3A5ZB 4JRQA 3AHUA 3JB9F 1BI2A 1VQ7A 3VS3A 2D8JA 2EFIA 3JCMg 3CMAQ 2PUKB 3DLMA 2FO0A 3EHQA 4AMCA 4M7AF 2JXBA 2IG0A 2VGMA 2KSSA 5D7UA 3VS0A 1GRIA 4A54A 5GANg 2X4JA 2EKHA 4HCKA 5IN1A 2FHDA 4QT7A 1AWOA 4M78E 1YIJT 5LJ3f 3EG2A 5HY6A 1KQSP 1M1KU 3QWXX 2A28A 4XAXB 4F7UG 1VQ7T 1WDXA 3MEUA 1X01A 1ABQA 3GOXA 3I35A 2EIFA 4C5HA 3M9QA 1D1BA 1Y0MA 3LH5A 5GMKl 5GAMj 4M75B 2XMFA 4EMKB 2QEXA 3EFOB 2HL3A 3G1JA 4M77B 5CQXA 3G4SQ 1YIJQ 1RAFB 3QBYA 2DYIA 2FRYA 4M7AA 4DOWA 3LWIA 2GQVA 3G7ZA 4FYVB 3MP1A 5GJVB 2MCNA 1YI2T 2VWFA 1VQ7Q 4QVZA 2CP3A 1U5SA 2E6ZA 2YUOA 3LH0A 3O8VA 2LQNA 2QAZA 2EQMA 1ZBJA 1HJDA 2MYSA 2K4YA 3L2QA 2OAUA 5GMKj 3FIFA 3M0SA 2YDLA 2QXFA 2QEXT 1PC0A 1KQ1A 1YI2Q 1U3OA 2HMAA 1XTDA 3MP6A 1VQ8Q 1H92A 2DA9A 2KRMA 1N6AA 3CC7A 4PNOA 5GAOl 2CP5A 2O9VA 2EJFA 4PJOD 1YFNA 2SRCA 1Q81C 3E9FA 4M78F 5FU7C 1D09B 3PT9A 1Q7YR 4OMFB 2CDTA 1RAEB 1IHWA 2CZ0B 2P84A 3EAEA 1K73U 2L8DA 3BDLA 2C0OA 2DKGA 2JTFA 3PE0A 3HRUA 4IUUA 1AD5A 1N9RA 2MOXA 4FCYA 3OY9A 3MCAB 1IB8A 3CC7T 5IH2A 3VS6A 2O31A 1ZSZC 5KYXB 4MDWA 1UDLA 3LYIA 2MMPA 1VQ5T 4DOVA 5CCAA 3OYCA 5GAMd 3OMCA 2RB6A 4R0KA 2HKNA 2NWMA 2K79A 1VYTA 1QMCA 3MJXA 2X3XD 4JLIA 2DFUA 1GCPA 2F69A 1FX7A 1H641 1WIEA 4F7UE 3TQ7P 1VQ5Q 4HCCA 2BKDN 1ACMB 1NJIU 3VS7A 1BI3A 4KH1B 2A36A 4J9FA 4PJOG 5J39A 4XK8E 2DETA 4E2FB 2DO3A 5FW9A 2EWNA 2C0TA 1K9MC 1YWOA 4LUDA 4C0ZA 1M2VA 4JZ3A 2CZ7B 1BBZA 4GLKA 4FSXA 1R8OB 5IAYA 2OTLA 3DKMA 4RTTA 2MAMA 1UHFA 2FZGB 4FYYB 4BE1A 3FDRA 4J6WA 1OPKA 3TREA 3SDZA 4OB2B 4HVWA 2CH4A 2COWA 1K4US 2BZXA 1Y07A 1I1JA 2ESWA 2DX1A 2DILA 3CCRA 4A4EA 2RQTA 1W70A 3L2WA 1KD1U 3H0HA 2LTOA 3CCUA 5A2QE 2W0ZA 2OTLT 4NL2A 4RUGA 2C0IA 3CCLA 3GF5A 4BY6B 1N8RU 1YNZA 3HKSA 1VQKQ 2L2PA 4J9BA 4ZGDB 1JXMA 2RA2A 2NLUA 3L42A 1KJWA 1FYNA 1M3CA 1Y57A 2EYQA 4E7LA 3KUFA 3ZL7C 4ME7A 4EMGA 3M0RA 3URGA 2WSEE 2YRDA 3CCRT 3X26B 5LJ5j 1NPRA 4YTLA 1VQOA 1M3AA 3QHSA 2EYXA 1V1CA 4C8QB 5HKCA 1UG1A 3CCUT 3OYAA 1OU8A 5LJ3h 2QQRA 5KE2A 3GBQA 3VYHB 1GL5A 2DL3A 3CCLT 2P4TA 5IXFA 2EYZA 4MMKA 3UA6A 2EGAA 2Y90A 2DXCA 2C06A 4KUDK 3JCMf 2FEIA 2LQKA 3HTRA 3THKA 1MHNA 1ZX6A 1D1CA 1W2BS 1QVFS 1T3LA 1X6BA 4O6JA 2VXEA 4BI3A 5KYWB 5GANf 1IREB 3JB9D 1ABOA 1I81A 5FU6B 2VV5A 3VKIA 3CCUQ 1VQOT 2D0QB 4E47A 1WJSA 4BE2A 2KYBA 3CCLQ 5FROA 3HL8A 2EKOA 2HZYA 4M7AD 2O4XA 2JTEA 3O5ZA 4N4GA 3NMZC 2KNBB 4J6XA 3HRTA 4Q5WA 1VQNA 2ENMA 3UF4A 1M1KR 4C5EA 1AT1B 1X2KA 2RHYA 1VQOQ 2QQAA 1OQKA 3CBOA 2KMTA 3PVLA 1RLQC 1BYMA 1RADB 1TU0B 3REBB 3NHNA 2PQWA 2LJ1A 1PCXA 2YUPA 3QYGB 4Y91A 3UWNA 5LJ3e 1VQNT 5LJ5f 3AT1B 4R56A 4IUQA 4LD6A 3PFSA 4PKCC 3V7CA 3KBGA 2Y4YA 3QJYA 3GNGA 1YITQ 1SSHA 2DE0X 3EFRA 2X4XA 3SWNB 3QWYA 3JB9G 1UGPB 2LT1A 1K8AU 3OQ5A 4RTYA 4M7AC 2KE9A 4DQ2A 2VB6A 2DD4A 3JCMJ 1M30A 4M7AG 2M0OA 3RKWA 4ORZA 4PL6A 2DIQA 4BI4A 4R55A 1FMKA 1FWZA 3CPWA 3VJPA 3JCMP 2DXBA 3OS5A 1WXUA 2QQBA 2W10A 3EHRA 1W2BA 1RLPC 2KROA 3C0CA 3TSZA 4CC3A 4J7IA 1HXDA 2K9GA 1QQJA 1OYXA 2EVRA 1EIFA 5GMKh 4ELZC 2KAFA 3SB2A 4MZMA 1GXIE 3EFSA 1MUZA 4UC4A 4JZ4A 1WA7A 2DXTA 2E5QA 2BZYA 5A0DA 2M02A 2QGGA 2CKKA 5GJWB 4AG1C 1Q95G 2YXYA 1Q82U 2QQ9A 2E5KA 1Q7YC 5AYFA 4OGCA 4M75A 1ZUUA 4EMKA 3RR6A 1O75A 2ZPHB 3RNJA 3EFOA 3EGDB 4D8KA 2GTJA 3R6OA 2BZ8A 4X9CA 1OZ3A 3MPUB 2X35A 3EH1A 2RMOA 3QKJA 1Q86R 4RKUE 3QO3A 2CGHA 2O9SA 5FWBA 1VA7A 2V1QA 1I4K1 3CPWP 2K3BA 1MNDA 4E7SA 8ATCB 2QA4A 1MGQA 1I5OB 1O9SA 2MI6A 1W2BP 1KC8C 2NUTB 4J9GA 2DL5A 5DM7R 2LMJA 3UDCA 1OOTA 2YLCA 1C0MA 4ZGJB 1WQ7A 2LVMA 2E6NA 4LDYA 4Z88A 1PSFA 4PJLA 5GMKe 4DA4A 2MWOA 3RUXA 1GBQA 2V8IA 3OYBA 1WJRA 2P4RA 3PTAA 1BKBA 3H8ZA 3L2UA 5C0MA 4JS5A 2VVKA 1G3SA 4MDXA 2LZ6B 2QA4T 1WGSA 3R6NA 4NS5A 2JM9A 2KY9A 3QSUA 2A7YA 1RUWA 4ZGEB 4ATOA 2E12A 1MMGA 4F7UB 4KGVB 3QPHA 2KDSA 2DTIA 1TS9A 4JJBA 4M7AE 2L3RA 4Z02A 5KYUB 4NL3A 1WNLA 1M3BA 3FLGA 1SG5A 1A0NB 1OX9A 3JCMh 2LRQA 4RG2A 5CKHA 1B07A 2D8HA 1AWXA 2JMAA 2VKNA 4D8DA 2J6FA 5GANh 1EX4A 2X51A 4J6YA 2E10A 3TEEA 2L5QA 5I2MA 2BTTA 1K0XA 2CS7A 2GNCA 4HCBA 2JTMA 3ZFJA 4X9DA 5M9OA 3A8GB 2X9HA 3PIPA 2RJDA 4BB7A 3QG1A 3UATA 4ANJA 2MPXC 2GFAA 3RMSA 5IT9E 3INZA 1YWPA 4FYXB 1QP3A 1VQPQ 1VQ6A 1MNEA 2JT4A 4OP0A 5FU7B 2G3RA 4FT4A 5FRMA 3RKXA 4DBHA 1BIBA 2A0FB 2F5KA 1M90R 2PVGB 1KHCA 2ROTA 4ZTJA 2CUBA 5LJ5h 4GLMA 3EG3A 2JUFA 2XG8D 3JCMe 3CC2T 2XK0A 4XTXA 1AWWA 2DK3A 1IGQA 2CP6A 3WXMB 1VQ6T 4PJNA 2DL4A 3E2UA 1UTIA 1VIEA 2IPOB 3HPWA 4BDZA 5GANe 3M4GA 3IQLA 4PFPA 2RF0A 3I55A 2AT1B 4J7FA 3EGXB 4LXCA 3M0UA 1VUBA 3VRZA 3VYGA 2RQVA 2HCKA 2ZAEA 4JPBW 3MO8A 1VQLA 3CC2Q 3REAB 5LJ3d 1JU5C 3H6ZA 3WVDB 2XI9A 1QCFA 2J05A 1MMNA 1M1KC 4LDUA 2QK0A 1PG5B 3RBBB 1VOMA 1YHQA 4PJOB 4AT1B 3P8BB 4Z89A 3I55T 1X75C 2P0PA 2M51A 2HAXA 3MEAA 4DBFA 2HNIA 1VQLT 3X24B 1AEYA 5LJ5e 2HQXA 1CKAA 4E7JA
chains in the Genus database with same CATH topology
4CC4B 1PKSA 2F2XA 2CH4A 4HVWA 1QWFA 4J9HA 1K4US 2GGRA 2BZXA 1AVZC 1I1JA 2ESWA 2DX1A 2FPFA 2HDAA 2DILA 2DNUA 2RQTA 1W70A 1ARKA 2OAWA 1KFZA 3H0HA 2EGCA 5I11A 2W0ZA 3NPFA 1WXTA 4RUGA 2C0IA 2L3SA 5IHNA 2KT1A 4M4ZA 3EG1A 1YNZA 1WXBA 1GFDA 2FRWA 1AZGB 2CT4A 2L2PA 2X3WD 4J9BA 4J9DA 1JXMA 1SEMA 2EPDA 1KJWA 1FYNA 2LP5A 1M3CA 1Y57A 3NGPA 4HVVA 1X69A 4AFSC 1GCQC 1WFWA 1X27A 1E7OA 1T3SA 1UE9A 2QDLA 3ZL7C 3M0RA 4RTXA 2V1RA 1PRMC 1M3AA 2EYXA 1V1CA 5IHIA 2RPNA 1WI7A 2L3PA 4HVUA 1E6HA 1SPKA 3H41A 1UG1A 3M0PA 5L23A 2EBPA 3GBQA 5IHKA 2D0NA 1GL5A 2DL3A 5IXFA 2EYZA 1NG2A 1CKBA 3UA6A 1AZEA 2EGAA 2RN8A 4JJCA 1PWTA 2J06A 3EGUA 1NM7A 2FEIA 3THKA 1TUDA 1PRLC 2ABLA 1ZX6A 4ZNXA 4F14A 2H8HA 1UJ0A 1T3LA 2DRMA 1X6BA 2DL8A 2AKKA 1ZUKA 4RTZA 1ABOA 1SRLA 4OMLA 1QLYA 1QWEA 3I9QA 2KYBA 3H0IA 2KRNA 1BB9A 2KEAA 3I5RA 5ECAA 1CSKA 2JTEA 2KYMA 3A98A 2KBTA 3O5ZA 4DEXA 3NMZC 2KNBB 1NEBA 2DJQA 1M27C 2JS2A 2ENMA 3UF4A 2KXDA 2EGEA 1GFCA 1X2KA 2J7IA 1KSWA 3ULRB 2GBQA 2D1XA 1U06A 1PHTA 3PVLA 1M8MA 1RLQC 1JO8A 2K6DA 1SHGA 2DBKA 1ZSGA 4Y92A 2M0YA 3REBB 2AK5A 3NHNA 4FSSA 1GBRA 2LJ1A 1Z9ZA 2YUPA 2IIMA 4RTUA 2ECZA 2JW4A 2RQRA 1OPLA 4WCIA 1LCKA 4X1VA 4IIMA 2CSIA 1QKWA 2EYWA 1I0CA 1OV3A 1WYXA 2RQUA 1K1ZA 1SRMA 2OJ2A 4OMQA 1EFNA 2RNAA 2JM8A 1NEGA 2DVJA 2LJ3A 1IO6A 2HEQA 2F2VA 1SSHA 1E6GA 1W6XA 1G2BA 2DE0X 3VS1A 1RI9A 2CREA 4LNPA 1GCQA 1UJYA 2KXCA 3QWYA 4RTYA 2AZVA 2KE9A 1H3HA 1OEBA 4LN2A 1M30A 4GBQA 2LCSA 4ORZA 4OMPA 3H0FA 1FMKA 4A63B 1QKXA 3JV3A 2PZ1A 4HXJA 1WXUA 2W10A 2KRSA 3EHRA 4OMMA 1K9AA 1RLPC 2KROA 3C0CA 2EQIA 3TSZA 4AFQC 4CC3A 4J9EA 2K9GA 1AOJA 1BK2A 2YT6A 2EVRA 1PNJA 2CT3A 5IXBA 1S1NA 1YCSB 4E6RA 4F16A 1MUZA 1YP5A 4F17A 5FWCA 4JZ4A 1WA7A 2BZYA 4KRTA 2ED0A 1SHFA 5GJWB 4AG1C 1UFFA 2PTKA 1H8KA 4K11A 2O88A 1T0JA 1VYVA 2CUDA 3SHWA 3FJ5A 1WLPB 2NUZA 5I22A 2E5KA 4JJDA 2B86A 2JS0A 1ZUUA 2A08A 3RNJA 4D8KA 2GTJA 4LUEA 4Z8AA 1G83A 2A37A 2BZ8A 2GQIA 3VS4A 2AZSA 2RMOA 2JMCA 3VS3A 2D8JA 2DRKA 3VRYA 1B3QA 4AFZC 2L3QA 2FO0A 2O9SA 3EHQA 5FWBA 1VA7A 2JXBA 2V1QA 2L0AA 2SEMA 2YUQA 2K3BA 1X2QA 3VS0A 1GRIA 4CC2A 1VYUA 1X43A 2EKHA 4HCKA 4QT7A 2G6FX 2GTOA 2O2OA 2DL5A 2YSQA 4J9GA 1AWOA 2LMJA 1OOTA 3EG2A 2K2MA 4Z88A 2CSQA 3QWXX 1MV0B 3EG0A 2A28A 4DEYA 1WDXA 3TSWA 1GBQA 1ABQA 2P4RA 2LJ0A 3SEMA 3I35A 1Y0MA 3LH5A 3TVTA 2XMFA 2VVKA 2LZ6B 1ZUYA 3R6NA 2FRYA 1WX6A 2JM9A 1MV3A 2KGTA 1KIKA 2HSPA 1RUWA 5GJVB 2MCNA 2KT8A 2VWFA 2LX7A 2EYYA 2YUOA 1U5SA 2OI3A 2LQNA 4JJBA 4J9IA 1NLOC 5EC7A 1ZBJA 3KFVA 1HJDA 4EIKA 1J3TA 3M0SA 2YDLA 5HCKA 2J6KA 1M3BA 3M0QA 1A0NB 1U3OA 2J6OA 1B07A 1X6GA 2LNHB 1H92A 1UHCA 2LQWA 2D8HA 1AWXA 4IIOA 2AKLA 2DA9A 2JMAA 2KRMA 2VKNA 4D8DA 2FG0A 2J6FA 4J9CA 2O9VA 2FPDA 2SRCA 2BTTA 4CC7A 2CDTA 1K0XA 2MIOA 2GNCA 2DMOA 1UUEA 1AWJA 3U23A 2HBWA 2C0OA 3PE0A 4LE9A 1JEGA 1TUCA 1AD5A 1JQQA 1JXOA 3UATA 2DM1A 2MOXA 4OMNA 1I07A 1YWPA 2ED1A 4RTWA 2RQWA 2JT4A 5IH2A 2ROLA 3VS6A 2EW3A 2O31A 1K76A 1UDLA 1YN8A 1ZLMA 2PNIA 2ROTA 4OMOA 4R0KA 2CUBA 2NWMA 2K79A 1VYTA 4GLMA 3EG3A 2FPEA 2X3XD 1NYGA 3VS5A 1GCPA 1AWWA 2I0NA 3VS2A 1WIEA 2DL4A 1UTIA 1PKTA 3IQLA 2RF0A 3VS7A 2A36A 1UECA 3CQTA 3UA7A 1N5ZA 3M0UA 4J9FA 3VRZA 1TG0A 2RQVA 2HCKA 4JPBW 5FW9A 3REAB 1Z9QA 3I5SA 1JU5C 1T0HA 1NYFA 2CH4W 1BU1A 1QCFA 2C0TA 3PVQA 1YWOA 1NLPC 1XOVA 2J05A 4LUDA 2DL7A 4JZ3A 1BBZA 1UGVA 2F2WA 2DF6A 3RBBB 4Z89A 2YUNA 2DBMA 1HD3A 4RTTA 1UHFA 2M51A 4RTVA 1K0SA 1W1FA 2DLPA 1OPKA 2DYBA 4AFUC 1HSQA 2KR3A 1AEYA 3M0TA 4AG2C 4ESRA 2K7AA 1CKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CC4 B;  1PKS A;  2F2X A;  2CH4 A;  4HVW A;  1QWF A;  4J9H A;  1K4U S;  2GGR A;  2BZX A;  1AVZ C;  1I1J A;  2ESW A;  2DX1 A;  2FPF A;  2HDA A;  2DIL A;  2DNU A;  2RQT A;  1W70 A;  1ARK A;  2OAW A;  1KFZ A;  3H0H A;  2EGC A;  5I11 A;  2W0Z A;  3NPF A;  1WXT A;  4RUG A;  2C0I A;  2L3S A;  5IHN A;  2KT1 A;  4M4Z A;  3EG1 A;  1YNZ A;  1WXB A;  1GFD A;  2FRW A;  1AZG B;  2CT4 A;  2L2P A;  2X3W D;  4J9B A;  4J9D A;  1JXM A;  1SEM A;  2EPD A;  1KJW A;  1FYN A;  2LP5 A;  1M3C A;  1Y57 A;  3NGP A;  4HVV A;  1X69 A;  4AFS C;  1GCQ C;  1WFW A;  1X27 A;  1E7O A;  1T3S A;  1UE9 A;  2QDL A;  3ZL7 C;  3M0R A;  4RTX A;  2V1R A;  1PRM C;  1M3A A;  2EYX A;  1V1C A;  5IHI A;  2RPN A;  1WI7 A;  2L3P A;  4HVU A;  1E6H A;  1SPK A;  3H41 A;  1UG1 A;  3M0P A;  5L23 A;  2EBP A;  3GBQ A;  5IHK A;  2D0N A;  1GL5 A;  2DL3 A;  5IXF A;  2EYZ A;  1NG2 A;  1CKB A;  3UA6 A;  1AZE A;  2EGA A;  2RN8 A;  4JJC A;  1PWT A;  2J06 A;  3EGU A;  1NM7 A;  2FEI A;  3THK A;  1TUD A;  1PRL C;  2ABL A;  1ZX6 A;  4ZNX A;  4F14 A;  2H8H A;  1UJ0 A;  1T3L A;  2DRM A;  1X6B A;  2DL8 A;  2AKK A;  1ZUK A;  4RTZ A;  1ABO A;  1SRL A;  4OML A;  1QLY A;  1QWE A;  3I9Q A;  2KYB A;  3H0I A;  2KRN A;  1BB9 A;  2KEA A;  3I5R A;  5ECA A;  1CSK A;  2JTE A;  2KYM A;  3A98 A;  2KBT A;  3O5Z A;  4DEX A;  3NMZ C;  2KNB B;  1NEB A;  2DJQ A;  1M27 C;  2JS2 A;  2ENM A;  3UF4 A;  2KXD A;  2EGE A;  1GFC A;  1X2K A;  2J7I A;  1KSW A;  3ULR B;  2GBQ A;  2D1X A;  1U06 A;  1PHT A;  3PVL A;  1M8M A;  1RLQ C;  1JO8 A;  2K6D A;  1SHG A;  2DBK A;  1ZSG A;  4Y92 A;  2M0Y A;  3REB B;  2AK5 A;  3NHN A;  4FSS A;  1GBR A;  2LJ1 A;  1Z9Z A;  2YUP A;  2IIM A;  4RTU A;  2ECZ A;  2JW4 A;  2RQR A;  1OPL A;  4WCI A;  1LCK A;  4X1V A;  4IIM A;  2CSI A;  1QKW A;  2EYW A;  1I0C A;  1OV3 A;  1WYX A;  2RQU A;  1K1Z A;  1SRM A;  2OJ2 A;  4OMQ A;  1EFN A;  2RNA A;  2JM8 A;  1NEG A;  2DVJ A;  2LJ3 A;  1IO6 A;  2HEQ A;  2F2V A;  1SSH A;  1E6G A;  1W6X A;  1G2B A;  2DE0 X;  3VS1 A;  1RI9 A;  2CRE A;  4LNP A;  1GCQ A;  1UJY A;  2KXC A;  3QWY A;  4RTY A;  2AZV A;  2KE9 A;  1H3H A;  1OEB A;  4LN2 A;  1M30 A;  4GBQ A;  2LCS A;  4ORZ A;  4OMP A;  3H0F A;  1FMK A;  4A63 B;  1QKX A;  3JV3 A;  2PZ1 A;  4HXJ A;  1WXU A;  2W10 A;  2KRS A;  3EHR A;  4OMM A;  1K9A A;  1RLP C;  2KRO A;  3C0C A;  2EQI A;  3TSZ A;  4AFQ C;  4CC3 A;  4J9E A;  2K9G A;  1AOJ A;  1BK2 A;  2YT6 A;  2EVR A;  1PNJ A;  2CT3 A;  5IXB A;  1S1N A;  1YCS B;  4E6R A;  4F16 A;  1MUZ A;  1YP5 A;  4F17 A;  5FWC A;  4JZ4 A;  1WA7 A;  2BZY A;  4KRT A;  2ED0 A;  1SHF A;  5GJW B;  4AG1 C;  1UFF A;  2PTK A;  1H8K A;  4K11 A;  2O88 A;  1T0J A;  1VYV A;  2CUD A;  3SHW A;  3FJ5 A;  1WLP B;  2NUZ A;  5I22 A;  2E5K A;  4JJD A;  2B86 A;  2JS0 A;  1ZUU A;  2A08 A;  3RNJ A;  4D8K A;  2GTJ A;  4LUE A;  4Z8A A;  1G83 A;  2A37 A;  2BZ8 A;  2GQI A;  3VS4 A;  2AZS A;  2RMO A;  2JMC A;  3VS3 A;  2D8J A;  2DRK A;  3VRY A;  1B3Q A;  4AFZ C;  2L3Q A;  2FO0 A;  2O9S A;  3EHQ A;  5FWB A;  1VA7 A;  2JXB A;  2V1Q A;  2L0A A;  2SEM A;  2YUQ A;  2K3B A;  1X2Q A;  3VS0 A;  1GRI A;  4CC2 A;  1VYU A;  1X43 A;  2EKH A;  4HCK A;  4QT7 A;  2G6F X;  2GTO A;  2O2O A;  2DL5 A;  2YSQ A;  4J9G A;  1AWO A;  2LMJ A;  1OOT A;  3EG2 A;  2K2M A;  4Z88 A;  2CSQ A;  3QWX X;  1MV0 B;  3EG0 A;  2A28 A;  4DEY A;  1WDX A;  3TSW A;  1GBQ A;  1ABQ A;  2P4R A;  2LJ0 A;  3SEM A;  3I35 A;  1Y0M A;  3LH5 A;  3TVT A;  2XMF A;  2VVK A;  2LZ6 B;  1ZUY A;  3R6N A;  2FRY A;  1WX6 A;  2JM9 A;  1MV3 A;  2KGT A;  1KIK A;  2HSP A;  1RUW A;  5GJV B;  2MCN A;  2KT8 A;  2VWF A;  2LX7 A;  2EYY A;  2YUO A;  1U5S A;  2OI3 A;  2LQN A;  4JJB A;  4J9I A;  1NLO C;  5EC7 A;  1ZBJ A;  3KFV A;  1HJD A;  4EIK A;  1J3T A;  3M0S A;  2YDL A;  5HCK A;  2J6K A;  1M3B A;  3M0Q A;  1A0N B;  1U3O A;  2J6O A;  1B07 A;  1X6G A;  2LNH B;  1H92 A;  1UHC A;  2LQW A;  2D8H A;  1AWX A;  4IIO A;  2AKL A;  2DA9 A;  2JMA A;  2KRM A;  2VKN A;  4D8D A;  2FG0 A;  2J6F A;  4J9C A;  2O9V A;  2FPD A;  2SRC A;  2BTT A;  4CC7 A;  2CDT A;  1K0X A;  2MIO A;  2GNC A;  2DMO A;  1UUE A;  1AWJ A;  3U23 A;  2HBW A;  2C0O A;  3PE0 A;  4LE9 A;  1JEG A;  1TUC A;  1AD5 A;  1JQQ A;  1JXO A;  3UAT A;  2DM1 A;  2MOX A;  4OMN A;  1I07 A;  1YWP A;  2ED1 A;  4RTW A;  2RQW A;  2JT4 A;  5IH2 A;  2ROL A;  3VS6 A;  2EW3 A;  2O31 A;  1K76 A;  1UDL A;  1YN8 A;  1ZLM A;  2PNI A;  2ROT A;  4OMO A;  4R0K A;  2CUB A;  2NWM A;  2K79 A;  1VYT A;  4GLM A;  3EG3 A;  2FPE A;  2X3X D;  1NYG A;  3VS5 A;  1GCP A;  1AWW A;  2I0N A;  3VS2 A;  1WIE A;  2DL4 A;  1UTI A;  1PKT A;  3IQL A;  2RF0 A;  3VS7 A;  2A36 A;  1UEC A;  3CQT A;  3UA7 A;  1N5Z A;  3M0U A;  4J9F A;  3VRZ A;  1TG0 A;  2RQV A;  2HCK A;  4JPB W;  5FW9 A;  3REA B;  1Z9Q A;  3I5S A;  1JU5 C;  1T0H A;  1NYF A;  2CH4 W;  1BU1 A;  1QCF A;  2C0T A;  3PVQ A;  1YWO A;  1NLP C;  1XOV A;  2J05 A;  4LUD A;  2DL7 A;  4JZ3 A;  1BBZ A;  1UGV A;  2F2W A;  2DF6 A;  3RBB B;  4Z89 A;  2YUN A;  2DBM A;  1HD3 A;  4RTT A;  1UHF A;  2M51 A;  4RTV A;  1K0S A;  1W1F A;  2DLP A;  1OPK A;  2DYB A;  4AFU C;  1HSQ A;  2KR3 A;  1AEY A;  3M0T A;  4AG2 C;  4ESR A;  2K7A A;  1CKA A; 
#chains in the Genus database with same CATH topology
 2DJZ A;  1HK9 A;  2F2X A;  2O01 E;  4J9H A;  2RJF A;  3JSC A;  4NOY A;  4JDS A;  2ZPF B;  4HT9 A;  2FPF A;  4KUL A;  1JB0 E;  4OGE A;  5GAN 4;  2MK5 A;  1Q81 U;  2BIV A;  1W4S A;  5I11 A;  1YHQ T;  1UB4 A;  1VQL Q;  3GP8 A;  1TSF A;  3QDR B;  2QEX Q;  3V7R A;  1WXB A;  1GFD A;  2X3W D;  1IZ6 A;  4J9D A;  4RMO A;  1SEM A;  3PIO A;  2V8K A;  5CQY A;  1WFW A;  2QDL A;  3CCE A;  3TCJ A;  2DEU A;  1G8X A;  1Q82 R;  2DVE A;  1WI7 A;  2L3P A;  3H41 A;  4LDX A;  5L23 A;  1C6V X;  2EBP A;  5IHK A;  2D0N A;  3JCM X;  2NUP B;  2ZZD A;  3OW2 S;  3JCM V;  5A0L A;  4MZT A;  1AZE A;  2J06 A;  4L5G A;  3CXC S;  3RES A;  1PRL C;  3D7S B;  3MET A;  5J3B A;  4OB3 B;  1UJ0 A;  3CCE T;  3OYN A;  4IUP A;  1ZUK A;  5CKE A;  3CC7 Q;  4BDY A;  4RTZ A;  1FMW A;  1SRL A;  4E7I A;  4ZTF A;  3I9Q A;  2KYM A;  2KBT A;  3PMI A;  2ZPI B;  2V8J A;  2EGE A;  3CCE Q;  2J7I A;  4M75 C;  4EMK C;  3L2V A;  3MP8 A;  3SWN A;  2GBQ A;  4M75 G;  1U06 A;  1PHT A;  4A4H A;  3BFM A;  1Q86 C;  1K9M U;  3BDU A;  1XQH A;  1ZSG A;  3CCV A;  2GF7 A;  4PK4 A;  4M7D F;  2AK5 A;  1GBR A;  1M2O A;  2E3I A;  4C92 B;  3V8L A;  2JW4 A;  3OYK A;  1B34 B;  1FMV A;  4XQ3 A;  1QCN A;  4PJJ A;  4X1V A;  2QAS A;  3ZEH A;  2PU9 B;  2IVW A;  5GAN j;  3LWH A;  2RQU A;  3MHX A;  2OTJ A;  5KYY B;  1EFN A;  2RNA A;  1NEG A;  2DVJ A;  3V8J A;  2LJ3 A;  3P8H A;  4DBQ A;  2M9U A;  1OI1 A;  2F2V A;  3OYY A;  2E70 A;  2HQE A;  2CRE A;  4LNP A;  2KXC A;  1XJW B;  3L1A A;  1U8R A;  3QUI A;  4XTW A;  4QVC A;  4M7D A;  1MMA A;  2AHJ B;  3C95 A;  1OX8 A;  2AZV A;  4FW2 A;  2H3E B;  3EGD A;  4LN2 A;  4GBQ A;  3OW2 A;  1RAB B;  4OMP A;  4X34 A;  1D3B B;  2OTJ T;  1QKX A;  2HQH A;  4QQG A;  3CXC A;  3JV3 A;  1OU9 A;  4HXJ A;  2KRS A;  4OMM A;  1K9A A;  3OYL A;  3QDF A;  4AFQ C;  2R5A A;  4C0F A;  1AOJ A;  3DB3 A;  1BK2 A;  5GMK i;  2OTL Q;  1PNJ A;  2VYT A;  3C12 A;  2CT3 A;  1S1N A;  2BE7 D;  4XU3 A;  2AIR B;  4F16 A;  2NUT A;  3EG9 B;  5HK0 A;  4ELY C;  2XU8 A;  2R58 A;  4F17 A;  2YWW A;  5FWC A;  2A3L A;  3CPW S;  1SHF A;  2COY A;  1UFF A;  2PTK A;  3GLX A;  3CCR Q;  2O88 A;  2K2V A;  3X20 B;  5I22 A;  2HKQ B;  3E19 A;  4JJD A;  3RMQ A;  2B86 A;  2JS0 A;  2RD1 A;  4FU6 A;  4WF2 A;  4LUE A;  4Z8A A;  1G83 A;  3JCM d;  2GQI A;  4KH0 B;  5D6X A;  3VS4 A;  2AZS A;  2JMC A;  1X6O A;  2JN0 A;  1R77 A;  3VRY A;  1B3Q A;  4AFZ C;  4F7U A;  2L3Q A;  1RI0 A;  3OW2 P;  4XU0 A;  4M75 E;  5GAN d;  2L0A A;  1Y71 A;  2SEM A;  2FYK A;  5CKF A;  4A4K A;  2DEQ A;  2LDM A;  3CXC P;  4CC2 A;  3QYH B;  1VYU A;  2CZ6 B;  3CPF A;  1X43 A;  3G71 A;  2CP0 A;  2QQS A;  2G6F X;  5KYU A;  3I56 A;  3G6E A;  2K2M A;  1M90 C;  3A8M B;  2CSQ A;  4PJM A;  2XKO C;  2RI2 A;  3HHT B;  1WHL A;  4DEY A;  3FEO A;  2X4W A;  1OZ2 A;  3OYE A;  1TOV A;  3TVT A;  3C94 A;  3GNF B;  1ZUY A;  5LJ3 g;  1HYO A;  2HSE B;  3G71 T;  1KIK A;  1JJ2 A;  1LNX A;  4L59 A;  5KE3 A;  4FM4 B;  5C6S A;  4M78 B;  1BCM A;  3I56 T;  4C0G A;  2KT8 A;  3F70 A;  5LJ5 d;  1KG1 A;  2LX7 A;  4D6W A;  4PLL A;  2OI3 A;  5CIU A;  1VQN Q;  4J9I A;  4KGX B;  1NLO C;  5GMK m;  3VUZ A;  4BY6 C;  2JNG A;  4B9W A;  4IKF A;  2LX9 A;  4EIK A;  3HSB A;  5FRN A;  5AT1 B;  1J3T A;  3JCM Q;  1AHJ B;  2J6K A;  3M0Q A;  4ZN3 A;  3I56 Q;  3NFC A;  2ZPE B;  3CD6 A;  2J6O A;  1M9S A;  4BUG A;  2LNV A;  4IUT A;  1QVG S;  4M75 F;  1K73 R;  1WZO A;  2LQW A;  4M77 F;  2AKL A;  2EAY A;  4P5N A;  2FG0 A;  1ZQ1 A;  4N4H A;  2DD5 A;  4J9C A;  2FPD A;  3OYM A;  1RAC B;  2KK4 A;  2FL7 A;  4ZN1 A;  2VXF A;  2K5L A;  2EQJ A;  4OB1 B;  2OX7 A;  3OYG A;  1JEG A;  3CD6 T;  2RHU A;  2DM1 A;  1TXQ A;  3OMG A;  5GAO m;  3EGX A;  5FU6 C;  1Q7Y U;  2M1H A;  1JJ2 P;  1PD1 A;  1SSF A;  4OMN A;  1B7T A;  1QP2 A;  2ED1 A;  4RTW A;  3NTH A;  2JJ9 A;  1IGU A;  2EW3 A;  4M77 A;  5GAO q;  2ZGW A;  5KCH A;  5I21 A;  4VUB A;  2DTO A;  2XID A;  1ZLM A;  3CD6 Q;  1D1A A;  2PNI A;  3CCM A;  2VGN A;  4KUI A;  4EPC A;  1Q82 C;  5GAM g;  1NJI R;  3CCQ A;  1G3Y A;  4PJO A;  2D6F A;  2PUO B;  3VV0 A;  2CZ1 B;  1KC8 U;  1VQM A;  4FYW B;  4RG8 A;  3RIR A;  3OS2 A;  4XU1 A;  4PFZ A;  1K9M R;  4RCC A;  3BW1 A;  1UEC A;  3CQT A;  3UA7 A;  1N5Z A;  3CCM T;  1YCY A;  3QZ9 B;  3CCS A;  1LOJ A;  3MEV A;  5KH6 A;  1TG0 A;  3VUB A;  4M7D D;  3A8L B;  3LGL A;  4J83 A;  1RL2 A;  1NYF A;  1R0C B;  1BU1 A;  5LL6 S;  2R57 A;  3OS0 A;  4JS4 A;  5FLX E;  2DER A;  3PVQ A;  1VQM T;  4C5I A;  4C5G A;  4B9X A;  1QVG A;  2DL7 A;  2E4H A;  3MEW A;  4BI8 B;  2XDB A;  5EG2 A;  4GY5 A;  2DIG A;  2DF6 A;  3JRZ A;  3SWN C;  3CCM Q;  3RDV A;  2RI5 A;  2YUN A;  2DBM A;  1QVP A;  3OYD A;  4RTV A;  3CCS T;  1K0S A;  1W1F A;  1KD1 R;  1UEB A;  3OYI A;  2QA4 Q;  3DB4 A;  3M0T A;  1TH7 A;  1IRX A;  1Y96 B;  5J26 A;  2NUP A;  5KYX A;  1G3W A;  5HK3 A;  3MKD A;  1N8R R;  3OYF A;  4F04 B;  1AVZ C;  1WHK A;  2HDA A;  2DNU A;  1U1S A;  3S6W A;  1PM3 A;  2OAW A;  9ATC B;  1ZA2 B;  2EGC A;  3CCS Q;  3CC4 A;  3NPF A;  4C92 F;  2COZ A;  1VQ4 A;  1C1A A;  2L3S A;  5IHN A;  4M4Z A;  3EG1 A;  3QII A;  2V26 A;  2FRW A;  1AZG B;  2D9T A;  2EPD A;  1NZ9 A;  2LP5 A;  3NGP A;  4HVV A;  1X69 A;  3SFM A;  1X27 A;  3A8H B;  1E7O A;  1UE9 A;  4DBR A;  4PFO A;  4M7D C;  1WHG A;  1G3T A;  6AT1 B;  3M54 A;  1QVG P;  4M7D G;  4E7H A;  2QG9 B;  5IHI A;  4C0D C;  1SPK A;  3A8O B;  3CC4 T;  3M0P A;  5GAN 5;  5CK9 A;  4JRP A;  4FL6 A;  1NG2 A;  1CKB A;  4E7K A;  1SKU B;  4JJC A;  1PWT A;  3L2Z A;  4C92 A;  1NM7 A;  5GAN 2;  1B34 A;  1TUD A;  2YLB A;  2ABL A;  3FRN A;  4F14 A;  3HFN A;  2H8H A;  2DRM A;  2AKK A;  4CI0 C;  2EQK A;  3G4S A;  1BIA A;  4OML A;  4Y28 E;  1QLY A;  4QKU A;  3H0I A;  2KRN A;  3CEY A;  4V2S A;  1BB9 A;  2BE9 B;  3M55 A;  5KYY A;  5ECA A;  2LCL A;  4LDW A;  1ZSZ B;  2DJQ A;  4C8Q F;  2JS2 A;  1D0Y A;  3LGF A;  2ATC B;  2LC4 A;  3OBY A;  1GFC A;  3OYJ A;  1WPY A;  1KSW A;  2D1X A;  1TWB A;  1V29 B;  5L8R E;  1M8M A;  1JO8 A;  3G4S T;  3JB9 I;  2K6D A;  2RHX A;  3A1P A;  1VQ6 Q;  1YI2 A;  2DBK A;  2M0Y A;  1QW1 A;  2K3Y A;  1VQ8 A;  1D3B A;  4II1 A;  1Z9Z A;  2IIM A;  2ECZ A;  2RHZ A;  3M58 A;  1OPL A;  3JCM b;  2FVU A;  4IUV A;  4L6V 5;  2YRC A;  1QKW A;  4QQ6 A;  3WVE B;  1OV3 A;  1WYX A;  4C8Q A;  1K1Z A;  3BY7 A;  1K8A R;  1F1B B;  2OJ2 A;  4FW1 A;  3EG9 A;  2GCX A;  2JM8 A;  4B6M A;  1IO6 A;  1P92 A;  2DTH A;  2HEQ A;  1VQ8 T;  1E6G A;  1W6X A;  4JRK A;  1G2B A;  3VS1 A;  5LJ5 g;  1IXD A;  1GCQ A;  4JUV A;  3I55 Q;  4N0A A;  2ZCF B;  2RI3 A;  3BE3 A;  5KYW A;  4M75 D;  1YJN A;  4A4G A;  1LVK A;  5KYN A;  2LCS A;  2E1H A;  2M16 A;  4M77 D;  3M56 A;  4HT8 A;  1D0Z A;  3FJP A;  3CME A;  3LLR A;  2PZ1 A;  4EDU A;  4M7D E;  3OB9 A;  2RM4 A;  4IUR A;  2EQI A;  2QDY B;  1YHQ Q;  3JB9 J;  5CO7 A;  3ME9 A;  4XTV A;  5IXB A;  1QCO A;  3HFO A;  3PMT A;  1M8V A;  3J7A F;  1VQ5 A;  2QTX A;  1YJN T;  1YP5 A;  5D6W A;  1WHM A;  1K73 C;  2LT4 A;  3CME T;  4BAC A;  2ED0 A;  4J8O A;  1BI0 A;  5GAM f;  3FJ5 A;  1WLP B;  2RO0 A;  3GIB A;  2P0Q A;  2RK2 A;  4FT2 A;  1KC8 R;  4J5Y A;  1YJN Q;  2A37 A;  1IHV A;  5KCO A;  3E1S A;  4JRI A;  2DZ9 A;  2HD0 A;  2DRK A;  4M78 A;  3CME Q;  4OF1 A;  3RKY A;  3M4Y A;  1JBM A;  2E65 A;  2XDP A;  3NTK A;  2QGF B;  3GPL A;  2YUQ A;  1ZA1 B;  4LDV A;  3X25 B;  1X2Q A;  4M77 C;  2CP7 A;  1Q86 U;  4M77 G;  2GTO A;  2YSQ A;  2O2O A;  3P8D A;  1MV0 B;  3EG0 A;  5CR2 A;  2RK1 A;  3FC3 A;  4PJO C;  1JRI A;  3TSW A;  4A4F A;  1NJI C;  4JJN K;  1NE8 A;  2LJ0 A;  3SEM A;  5GAN 7;  1M1F A;  1RAH B;  1VQK A;  5GAO n;  2QTV A;  3JB9 H;  1UGR B;  2E41 A;  1WX6 A;  1MV3 A;  2KGT A;  2KQW A;  5CVI A;  3T9N A;  4OVA A;  2HSP A;  2EJ9 A;  2I2L A;  3OS1 A;  5GAO r;  2K5I A;  3CCV T;  1I8F A;  2EYY A;  2YRV A;  4MZP A;  2F1L A;  2EQU A;  3CCJ A;  5EC7 A;  1FXX A;  3KFV A;  2MWP A;  1KQ2 A;  3ZBD A;  5DLQ E;  3UT1 A;  7AT1 B;  5GAN 8;  5HCK A;  1VQK T;  1PSE A;  2BUD A;  3RER A;  3KXT A;  4KBM B;  3HRS A;  1TUG B;  3CCV Q;  1YJ9 A;  1LJO A;  5GAO p;  1X6G A;  1JJ2 S;  2LNH B;  4C92 D;  1UHC A;  4LD9 K;  4IIO A;  2KVQ G;  1YJW A;  2VC8 A;  1KD1 C;  3CCJ T;  3L2R A;  4F7U F;  3EH2 A;  4CC7 A;  2MIO A;  4M7A B;  1N8R C;  2PVD B;  2XHC A;  4HKE A;  2OTJ Q;  2DMO A;  1UUE A;  1AWJ A;  3OSS C;  3U23 A;  4BD3 A;  2HBW A;  4LE9 A;  1U1T A;  1TUC A;  3ASK A;  1JQQ A;  1JXO A;  1YJ9 T;  2WSC E;  2MF2 A;  1YJW T;  4CRI A;  1I07 A;  3CCJ Q;  3VU3 C;  2EJG A;  2RQW A;  2ROL A;  2F5T X;  1K76 A;  3CBP A;  2GFU A;  1YN8 A;  5GAN 3;  5A0G A;  2H3J A;  1YJ9 Q;  1RAA B;  4OMO A;  4WTO B;  3QZ5 B;  3NTI A;  1YJW Q;  2QI2 A;  3QXE B;  2RH2 A;  4M77 E;  3SD4 A;  2FPE A;  1NYG A;  3VS5 A;  1UGS B;  1MMD A;  5I2S A;  2L89 A;  3DLL A;  4C8Q D;  2I0N A;  3VS2 A;  3S3M A;  1M90 U;  4C92 C;  1Y96 A;  3N5B B;  1YIT A;  1PKT A;  2FB7 A;  4C92 G;  4EMH A;  4PJO E;  5DY9 A;  1D0X A;  1Y7X A;  3OA6 A;  2CYZ B;  3H9N A;  1RAG B;  1OUL A;  1SF9 A;  4OB0 B;  1M4Z A;  1Z9Q A;  3I5S A;  3LX7 A;  1T0H A;  1BCO A;  4BE0 A;  2CH4 W;  2E3H A;  4TVR A;  2RJE A;  1S72 A;  1NLP C;  1XOV A;  2LCC A;  3G6E T;  2DPP B;  1UGV A;  2F2W A;  1YIT T;  3V8K A;  2JZ2 A;  4JLG A;  3UPU A;  1EZZ B;  1HD3 A;  2RJC A;  3E9G A;  2P0K A;  2DLP A;  2DYB A;  1Q81 R;  4AFU C;  3C4S A;  1HSQ A;  2KR3 A;  3G71 Q;  2B8A A;  4AG2 C;  1WQW A;  4ESR A;  2K7A A;  4CC4 B;  1PKS A;  1QWF A;  2GGR A;  1XNI A;  3G6E Q;  1S72 T;  2CP2 A;  3V7S A;  1VQ9 A;  5CKD A;  2DAQ A;  1ARK A;  5GAM h;  1KFZ A;  1KHI A;  2FZC B;  4C8Q C;  4O5V A;  1WXT A;  1K8A C;  4C8Q G;  2KT1 A;  4MML A;  2CT4 A;  4PJO F;  1S72 Q;  1M2V B;  1YBY A;  1ZSZ A;  2E64 A;  4AFS C;  2ZPG B;  4M78 D;  1GCQ C;  3JAM E;  1QVF A;  1T3S A;  4N0A C;  1V76 A;  2Z0W A;  1R0B G;  8AT1 B;  2JVV A;  1VQ9 T;  4RTX A;  2V1R A;  1PRM C;  2RHI A;  2XIC A;  4XTY A;  3X28 B;  2RPN A;  2PVO B;  4HVU A;  1I5L A;  1E6H A;  3FB9 A;  3M5A A;  2X4Y A;  2XDD A;  2LQ8 A;  2RN8 A;  3J81 E;  4XTU A;  3M53 A;  3EGU A;  2YHT A;  1RAI B;  1VQ9 Q;  4ZNX A;  3OSV A;  4M7D B;  3JCM W;  2DL8 A;  1N27 A;  1M5Q 1;  1KQS S;  4E7Z A;  4RCB A;  3Q1J A;  2HL5 C;  4C0D B;  1QWE A;  4C92 E;  5DLO A;  2KEA A;  5GAM e;  3I5R A;  1CSK A;  3A98 A;  1DJ7 B;  4DEX A;  2FZK B;  3J80 E;  1NEB A;  1M27 C;  1N9S A;  1PD0 A;  1BI1 A;  2KXD A;  2NYS A;  1WHH A;  2WSF E;  4QQD A;  3ULR B;  4XTZ A;  1QVF P;  3CCQ T;  1ZBX A;  3PNW C;  1SHG A;  3OYH A;  2KI7 A;  2JOY A;  4M78 C;  2VUB A;  4Y92 A;  2ZPB B;  1TTH B;  1G5V A;  1UGQ B;  4FSS A;  4M78 G;  4RTU A;  1WJQ A;  3PGG A;  3M59 A;  2RQR A;  1NPP A;  4WCI A;  1LCK A;  4IIM A;  2CSI A;  3JCM c;  2EYW A;  3CCQ Q;  2WAC A;  5CAI A;  1I0C A;  1ZHI A;  2DXU A;  1SRM A;  4OMQ A;  3OBW A;  2O4X B;  1VQM Q;  5GAN 6;  2K57 A;  3QJ6 A;  4KT0 E;  5CKB A;  1NBE B;  3S3N A;  4HCZ A;  1RI9 A;  4C8Q E;  1UJY A;  1VQP A;  4QVD A;  4XU2 A;  1H3H A;  1OEB A;  4HA8 A;  5LJ3 j;  3H0F A;  3CBM A;  4FIB A;  4A63 B;  2K3X A;  4A53 A;  3ER0 A;  3CMA A;  3TU4 K;  1KK7 A;  4KGZ B;  3LW5 E;  2K5F A;  2DZC A;  1H3Z A;  4J9E A;  1KQS A;  2YT6 A;  2HBP A;  4PLI A;  1VQP T;  1VIF A;  1YCS B;  3M57 A;  4E6R A;  4QW2 A;  1VQ4 T;  2R5M A;  2VAS A;  5D6Y A;  4KRT A;  3S3O A;  3CMA T;  1M1G A;  1H8K A;  4K11 A;  1T0J A;  1VYV A;  2CUD A;  3CC2 A;  3SHW A;  1LPL A;  2NUZ A;  3HP9 A;  1YIJ A;  2A08 A;  4N4I A;  3CC4 Q;  1VQ4 Q;  2Y4X A;  2XD0 A;  2QYZ A;  1WHJ A;  3A5Z B;  4JRQ A;  3AHU A;  3JB9 F;  1BI2 A;  1VQ7 A;  3VS3 A;  2D8J A;  2EFI A;  3JCM g;  3CMA Q;  2PUK B;  3DLM A;  2FO0 A;  3EHQ A;  4AMC A;  4M7A F;  2JXB A;  2IG0 A;  2VGM A;  2KSS A;  5D7U A;  3VS0 A;  1GRI A;  4A54 A;  5GAN g;  2X4J A;  2EKH A;  4HCK A;  5IN1 A;  2FHD A;  4QT7 A;  1AWO A;  4M78 E;  1YIJ T;  5LJ3 f;  3EG2 A;  5HY6 A;  1KQS P;  1M1K U;  3QWX X;  2A28 A;  4XAX B;  4F7U G;  1VQ7 T;  1WDX A;  3MEU A;  1X01 A;  1ABQ A;  3GOX A;  3I35 A;  2EIF A;  4C5H A;  3M9Q A;  1D1B A;  1Y0M A;  3LH5 A;  5GMK l;  5GAM j;  4M75 B;  2XMF A;  4EMK B;  2QEX A;  3EFO B;  2HL3 A;  3G1J A;  4M77 B;  5CQX A;  3G4S Q;  1YIJ Q;  1RAF B;  3QBY A;  2DYI A;  2FRY A;  4M7A A;  4DOW A;  3LWI A;  2GQV A;  3G7Z A;  4FYV B;  3MP1 A;  5GJV B;  2MCN A;  1YI2 T;  2VWF A;  1VQ7 Q;  4QVZ A;  2CP3 A;  1U5S A;  2E6Z A;  2YUO A;  3LH0 A;  3O8V A;  2LQN A;  2QAZ A;  2EQM A;  1ZBJ A;  1HJD A;  2MYS A;  2K4Y A;  3L2Q A;  2OAU A;  5GMK j;  3FIF A;  3M0S A;  2YDL A;  2QXF A;  2QEX T;  1PC0 A;  1KQ1 A;  1YI2 Q;  1U3O A;  2HMA A;  1XTD A;  3MP6 A;  1VQ8 Q;  1H92 A;  2DA9 A;  2KRM A;  1N6A A;  3CC7 A;  4PNO A;  5GAO l;  2CP5 A;  2O9V A;  2EJF A;  4PJO D;  1YFN A;  2SRC A;  1Q81 C;  3E9F A;  4M78 F;  5FU7 C;  1D09 B;  3PT9 A;  1Q7Y R;  4OMF B;  2CDT A;  1RAE B;  1IHW A;  2CZ0 B;  2P84 A;  3EAE A;  1K73 U;  2L8D A;  3BDL A;  2C0O A;  2DKG A;  2JTF A;  3PE0 A;  3HRU A;  4IUU A;  1AD5 A;  1N9R A;  2MOX A;  4FCY A;  3OY9 A;  3MCA B;  1IB8 A;  3CC7 T;  5IH2 A;  3VS6 A;  2O31 A;  1ZSZ C;  5KYX B;  4MDW A;  1UDL A;  3LYI A;  2MMP A;  1VQ5 T;  4DOV A;  5CCA A;  3OYC A;  5GAM d;  3OMC A;  2RB6 A;  4R0K A;  2HKN A;  2NWM A;  2K79 A;  1VYT A;  1QMC A;  3MJX A;  2X3X D;  4JLI A;  2DFU A;  1GCP A;  2F69 A;  1FX7 A;  1H64 1;  1WIE A;  4F7U E;  3TQ7 P;  1VQ5 Q;  4HCC A;  2BKD N;  1ACM B;  1NJI U;  3VS7 A;  1BI3 A;  4KH1 B;  2A36 A;  4J9F A;  4PJO G;  5J39 A;  4XK8 E;  2DET A;  4E2F B;  2DO3 A;  5FW9 A;  2EWN A;  2C0T A;  1K9M C;  1YWO A;  4LUD A;  4C0Z A;  1M2V A;  4JZ3 A;  2CZ7 B;  1BBZ A;  4GLK A;  4FSX A;  1R8O B;  5IAY A;  2OTL A;  3DKM A;  4RTT A;  2MAM A;  1UHF A;  2FZG B;  4FYY B;  4BE1 A;  3FDR A;  4J6W A;  1OPK A;  3TRE A;  3SDZ A;  4OB2 B;  4HVW A;  2CH4 A;  2COW A;  1K4U S;  2BZX A;  1Y07 A;  1I1J A;  2ESW A;  2DX1 A;  2DIL A;  3CCR A;  4A4E A;  2RQT A;  1W70 A;  3L2W A;  1KD1 U;  3H0H A;  2LTO A;  3CCU A;  5A2Q E;  2W0Z A;  2OTL T;  4NL2 A;  4RUG A;  2C0I A;  3CCL A;  3GF5 A;  4BY6 B;  1N8R U;  1YNZ A;  3HKS A;  1VQK Q;  2L2P A;  4J9B A;  4ZGD B;  1JXM A;  2RA2 A;  2NLU A;  3L42 A;  1KJW A;  1FYN A;  1M3C A;  1Y57 A;  2EYQ A;  4E7L A;  3KUF A;  3ZL7 C;  4ME7 A;  4EMG A;  3M0R A;  3URG A;  2WSE E;  2YRD A;  3CCR T;  3X26 B;  5LJ5 j;  1NPR A;  4YTL A;  1VQO A;  1M3A A;  3QHS A;  2EYX A;  1V1C A;  4C8Q B;  5HKC A;  1UG1 A;  3CCU T;  3OYA A;  1OU8 A;  5LJ3 h;  2QQR A;  5KE2 A;  3GBQ A;  3VYH B;  1GL5 A;  2DL3 A;  3CCL T;  2P4T A;  5IXF A;  2EYZ A;  4MMK A;  3UA6 A;  2EGA A;  2Y90 A;  2DXC A;  2C06 A;  4KUD K;  3JCM f;  2FEI A;  2LQK A;  3HTR A;  3THK A;  1MHN A;  1ZX6 A;  1D1C A;  1W2B S;  1QVF S;  1T3L A;  1X6B A;  4O6J A;  2VXE A;  4BI3 A;  5KYW B;  5GAN f;  1IRE B;  3JB9 D;  1ABO A;  1I81 A;  5FU6 B;  2VV5 A;  3VKI A;  3CCU Q;  1VQO T;  2D0Q B;  4E47 A;  1WJS A;  4BE2 A;  2KYB A;  3CCL Q;  5FRO A;  3HL8 A;  2EKO A;  2HZY A;  4M7A D;  2O4X A;  2JTE A;  3O5Z A;  4N4G A;  3NMZ C;  2KNB B;  4J6X A;  3HRT A;  4Q5W A;  1VQN A;  2ENM A;  3UF4 A;  1M1K R;  4C5E A;  1AT1 B;  1X2K A;  2RHY A;  1VQO Q;  2QQA A;  1OQK A;  3CBO A;  2KMT A;  3PVL A;  1RLQ C;  1BYM A;  1RAD B;  1TU0 B;  3REB B;  3NHN A;  2PQW A;  2LJ1 A;  1PCX A;  2YUP A;  3QYG B;  4Y91 A;  3UWN A;  5LJ3 e;  1VQN T;  5LJ5 f;  3AT1 B;  4R56 A;  4IUQ A;  4LD6 A;  3PFS A;  4PKC C;  3V7C A;  3KBG A;  2Y4Y A;  3QJY A;  3GNG A;  1YIT Q;  1SSH A;  2DE0 X;  3EFR A;  2X4X A;  3SWN B;  3QWY A;  3JB9 G;  1UGP B;  2LT1 A;  1K8A U;  3OQ5 A;  4RTY A;  4M7A C;  2KE9 A;  4DQ2 A;  2VB6 A;  2DD4 A;  3JCM J;  1M30 A;  4M7A G;  2M0O A;  3RKW A;  4ORZ A;  4PL6 A;  2DIQ A;  4BI4 A;  4R55 A;  1FMK A;  1FWZ A;  3CPW A;  3VJP A;  3JCM P;  2DXB A;  3OS5 A;  1WXU A;  2QQB A;  2W10 A;  3EHR A;  1W2B A;  1RLP C;  2KRO A;  3C0C A;  3TSZ A;  4CC3 A;  4J7I A;  1HXD A;  2K9G A;  1QQJ A;  1OYX A;  2EVR A;  1EIF A;  5GMK h;  4ELZ C;  2KAF A;  3SB2 A;  4MZM A;  1GXI E;  3EFS A;  1MUZ A;  4UC4 A;  4JZ4 A;  1WA7 A;  2DXT A;  2E5Q A;  2BZY A;  5A0D A;  2M02 A;  2QGG A;  2CKK A;  5GJW B;  4AG1 C;  1Q95 G;  2YXY A;  1Q82 U;  2QQ9 A;  2E5K A;  1Q7Y C;  5AYF A;  4OGC A;  4M75 A;  1ZUU A;  4EMK A;  3RR6 A;  1O75 A;  2ZPH B;  3RNJ A;  3EFO A;  3EGD B;  4D8K A;  2GTJ A;  3R6O A;  2BZ8 A;  4X9C A;  1OZ3 A;  3MPU B;  2X35 A;  3EH1 A;  2RMO A;  3QKJ A;  1Q86 R;  4RKU E;  3QO3 A;  2CGH A;  2O9S A;  5FWB A;  1VA7 A;  2V1Q A;  1I4K 1;  3CPW P;  2K3B A;  1MND A;  4E7S A;  8ATC B;  2QA4 A;  1MGQ A;  1I5O B;  1O9S A;  2MI6 A;  1W2B P;  1KC8 C;  2NUT B;  4J9G A;  2DL5 A;  5DM7 R;  2LMJ A;  3UDC A;  1OOT A;  2YLC A;  1C0M A;  4ZGJ B;  1WQ7 A;  2LVM A;  2E6N A;  4LDY A;  4Z88 A;  1PSF A;  4PJL A;  5GMK e;  4DA4 A;  2MWO A;  3RUX A;  1GBQ A;  2V8I A;  3OYB A;  1WJR A;  2P4R A;  3PTA A;  1BKB A;  3H8Z A;  3L2U A;  5C0M A;  4JS5 A;  2VVK A;  1G3S A;  4MDX A;  2LZ6 B;  2QA4 T;  1WGS A;  3R6N A;  4NS5 A;  2JM9 A;  2KY9 A;  3QSU A;  2A7Y A;  1RUW A;  4ZGE B;  4ATO A;  2E12 A;  1MMG A;  4F7U B;  4KGV B;  3QPH A;  2KDS A;  2DTI A;  1TS9 A;  4JJB A;  4M7A E;  2L3R A;  4Z02 A;  5KYU B;  4NL3 A;  1WNL A;  1M3B A;  3FLG A;  1SG5 A;  1A0N B;  1OX9 A;  3JCM h;  2LRQ A;  4RG2 A;  5CKH A;  1B07 A;  2D8H A;  1AWX A;  2JMA A;  2VKN A;  4D8D A;  2J6F A;  5GAN h;  1EX4 A;  2X51 A;  4J6Y A;  2E10 A;  3TEE A;  2L5Q A;  5I2M A;  2BTT A;  1K0X A;  2CS7 A;  2GNC A;  4HCB A;  2JTM A;  3ZFJ A;  4X9D A;  5M9O A;  3A8G B;  2X9H A;  3PIP A;  2RJD A;  4BB7 A;  3QG1 A;  3UAT A;  4ANJ A;  2MPX C;  2GFA A;  3RMS A;  5IT9 E;  3INZ A;  1YWP A;  4FYX B;  1QP3 A;  1VQP Q;  1VQ6 A;  1MNE A;  2JT4 A;  4OP0 A;  5FU7 B;  2G3R A;  4FT4 A;  5FRM A;  3RKX A;  4DBH A;  1BIB A;  2A0F B;  2F5K A;  1M90 R;  2PVG B;  1KHC A;  2ROT A;  4ZTJ A;  2CUB A;  5LJ5 h;  4GLM A;  3EG3 A;  2JUF A;  2XG8 D;  3JCM e;  3CC2 T;  2XK0 A;  4XTX A;  1AWW A;  2DK3 A;  1IGQ A;  2CP6 A;  3WXM B;  1VQ6 T;  4PJN A;  2DL4 A;  3E2U A;  1UTI A;  1VIE A;  2IPO B;  3HPW A;  4BDZ A;  5GAN e;  3M4G A;  3IQL A;  4PFP A;  2RF0 A;  3I55 A;  2AT1 B;  4J7F A;  3EGX B;  4LXC A;  3M0U A;  1VUB A;  3VRZ A;  3VYG A;  2RQV A;  2HCK A;  2ZAE A;  4JPB W;  3MO8 A;  1VQL A;  3CC2 Q;  3REA B;  5LJ3 d;  1JU5 C;  3H6Z A;  3WVD B;  2XI9 A;  1QCF A;  2J05 A;  1MMN A;  1M1K C;  4LDU A;  2QK0 A;  1PG5 B;  3RBB B;  1VOM A;  1YHQ A;  4PJO B;  4AT1 B;  3P8B B;  4Z89 A;  3I55 T;  1X75 C;  2P0P A;  2M51 A;  2HAX A;  3MEA A;  4DBF A;  2HNI A;  1VQL T;  3X24 B;  1AEY A;  5LJ5 e;  2HQX A;  1CKA A;  4E7J A; 
#chains in the Genus database with same CATH homology
 4CC4 B;  1PKS A;  2F2X A;  2CH4 A;  4HVW A;  1QWF A;  4J9H A;  1K4U S;  2GGR A;  2BZX A;  1AVZ C;  1I1J A;  2ESW A;  2DX1 A;  2FPF A;  2HDA A;  2DIL A;  2DNU A;  2RQT A;  1W70 A;  1ARK A;  2OAW A;  1KFZ A;  3H0H A;  2EGC A;  5I11 A;  2W0Z A;  3NPF A;  1WXT A;  4RUG A;  2C0I A;  2L3S A;  5IHN A;  2KT1 A;  4M4Z A;  3EG1 A;  1YNZ A;  1WXB A;  1GFD A;  2FRW A;  1AZG B;  2CT4 A;  2L2P A;  2X3W D;  4J9B A;  4J9D A;  1JXM A;  1SEM A;  2EPD A;  1KJW A;  1FYN A;  2LP5 A;  1M3C A;  1Y57 A;  3NGP A;  4HVV A;  1X69 A;  4AFS C;  1GCQ C;  1WFW A;  1X27 A;  1E7O A;  1T3S A;  1UE9 A;  2QDL A;  3ZL7 C;  3M0R A;  4RTX A;  2V1R A;  1PRM C;  1M3A A;  2EYX A;  1V1C A;  5IHI A;  2RPN A;  1WI7 A;  2L3P A;  4HVU A;  1E6H A;  1SPK A;  3H41 A;  1UG1 A;  3M0P A;  5L23 A;  2EBP A;  3GBQ A;  5IHK A;  2D0N A;  1GL5 A;  2DL3 A;  5IXF A;  2EYZ A;  1NG2 A;  1CKB A;  3UA6 A;  1AZE A;  2EGA A;  2RN8 A;  4JJC A;  1PWT A;  2J06 A;  3EGU A;  1NM7 A;  2FEI A;  3THK A;  1TUD A;  1PRL C;  2ABL A;  1ZX6 A;  4ZNX A;  4F14 A;  2H8H A;  1UJ0 A;  1T3L A;  2DRM A;  1X6B A;  2DL8 A;  2AKK A;  1ZUK A;  4RTZ A;  1ABO A;  1SRL A;  4OML A;  1QLY A;  1QWE A;  3I9Q A;  2KYB A;  3H0I A;  2KRN A;  1BB9 A;  2KEA A;  3I5R A;  5ECA A;  1CSK A;  2JTE A;  2KYM A;  3A98 A;  2KBT A;  3O5Z A;  4DEX A;  3NMZ C;  2KNB B;  1NEB A;  2DJQ A;  1M27 C;  2JS2 A;  2ENM A;  3UF4 A;  2KXD A;  2EGE A;  1GFC A;  1X2K A;  2J7I A;  1KSW A;  3ULR B;  2GBQ A;  2D1X A;  1U06 A;  1PHT A;  3PVL A;  1M8M A;  1RLQ C;  1JO8 A;  2K6D A;  1SHG A;  2DBK A;  1ZSG A;  4Y92 A;  2M0Y A;  3REB B;  2AK5 A;  3NHN A;  4FSS A;  1GBR A;  2LJ1 A;  1Z9Z A;  2YUP A;  2IIM A;  4RTU A;  2ECZ A;  2JW4 A;  2RQR A;  1OPL A;  4WCI A;  1LCK A;  4X1V A;  4IIM A;  2CSI A;  1QKW A;  2EYW A;  1I0C A;  1OV3 A;  1WYX A;  2RQU A;  1K1Z A;  1SRM A;  2OJ2 A;  4OMQ A;  1EFN A;  2RNA A;  2JM8 A;  1NEG A;  2DVJ A;  2LJ3 A;  1IO6 A;  2HEQ A;  2F2V A;  1SSH A;  1E6G A;  1W6X A;  1G2B A;  2DE0 X;  3VS1 A;  1RI9 A;  2CRE A;  4LNP A;  1GCQ A;  1UJY A;  2KXC A;  3QWY A;  4RTY A;  2AZV A;  2KE9 A;  1H3H A;  1OEB A;  4LN2 A;  1M30 A;  4GBQ A;  2LCS A;  4ORZ A;  4OMP A;  3H0F A;  1FMK A;  4A63 B;  1QKX A;  3JV3 A;  2PZ1 A;  4HXJ A;  1WXU A;  2W10 A;  2KRS A;  3EHR A;  4OMM A;  1K9A A;  1RLP C;  2KRO A;  3C0C A;  2EQI A;  3TSZ A;  4AFQ C;  4CC3 A;  4J9E A;  2K9G A;  1AOJ A;  1BK2 A;  2YT6 A;  2EVR A;  1PNJ A;  2CT3 A;  5IXB A;  1S1N A;  1YCS B;  4E6R A;  4F16 A;  1MUZ A;  1YP5 A;  4F17 A;  5FWC A;  4JZ4 A;  1WA7 A;  2BZY A;  4KRT A;  2ED0 A;  1SHF A;  5GJW B;  4AG1 C;  1UFF A;  2PTK A;  1H8K A;  4K11 A;  2O88 A;  1T0J A;  1VYV A;  2CUD A;  3SHW A;  3FJ5 A;  1WLP B;  2NUZ A;  5I22 A;  2E5K A;  4JJD A;  2B86 A;  2JS0 A;  1ZUU A;  2A08 A;  3RNJ A;  4D8K A;  2GTJ A;  4LUE A;  4Z8A A;  1G83 A;  2A37 A;  2BZ8 A;  2GQI A;  3VS4 A;  2AZS A;  2RMO A;  2JMC A;  3VS3 A;  2D8J A;  2DRK A;  3VRY A;  1B3Q A;  4AFZ C;  2L3Q A;  2FO0 A;  2O9S A;  3EHQ A;  5FWB A;  1VA7 A;  2JXB A;  2V1Q A;  2L0A A;  2SEM A;  2YUQ A;  2K3B A;  1X2Q A;  3VS0 A;  1GRI A;  4CC2 A;  1VYU A;  1X43 A;  2EKH A;  4HCK A;  4QT7 A;  2G6F X;  2GTO A;  2O2O A;  2DL5 A;  2YSQ A;  4J9G A;  1AWO A;  2LMJ A;  1OOT A;  3EG2 A;  2K2M A;  4Z88 A;  2CSQ A;  3QWX X;  1MV0 B;  3EG0 A;  2A28 A;  4DEY A;  1WDX A;  3TSW A;  1GBQ A;  1ABQ A;  2P4R A;  2LJ0 A;  3SEM A;  3I35 A;  1Y0M A;  3LH5 A;  3TVT A;  2XMF A;  2VVK A;  2LZ6 B;  1ZUY A;  3R6N A;  2FRY A;  1WX6 A;  2JM9 A;  1MV3 A;  2KGT A;  1KIK A;  2HSP A;  1RUW A;  5GJV B;  2MCN A;  2KT8 A;  2VWF A;  2LX7 A;  2EYY A;  2YUO A;  1U5S A;  2OI3 A;  2LQN A;  4JJB A;  4J9I A;  1NLO C;  5EC7 A;  1ZBJ A;  3KFV A;  1HJD A;  4EIK A;  1J3T A;  3M0S A;  2YDL A;  5HCK A;  2J6K A;  1M3B A;  3M0Q A;  1A0N B;  1U3O A;  2J6O A;  1B07 A;  1X6G A;  2LNH B;  1H92 A;  1UHC A;  2LQW A;  2D8H A;  1AWX A;  4IIO A;  2AKL A;  2DA9 A;  2JMA A;  2KRM A;  2VKN A;  4D8D A;  2FG0 A;  2J6F A;  4J9C A;  2O9V A;  2FPD A;  2SRC A;  2BTT A;  4CC7 A;  2CDT A;  1K0X A;  2MIO A;  2GNC A;  2DMO A;  1UUE A;  1AWJ A;  3U23 A;  2HBW A;  2C0O A;  3PE0 A;  4LE9 A;  1JEG A;  1TUC A;  1AD5 A;  1JQQ A;  1JXO A;  3UAT A;  2DM1 A;  2MOX A;  4OMN A;  1I07 A;  1YWP A;  2ED1 A;  4RTW A;  2RQW A;  2JT4 A;  5IH2 A;  2ROL A;  3VS6 A;  2EW3 A;  2O31 A;  1K76 A;  1UDL A;  1YN8 A;  1ZLM A;  2PNI A;  2ROT A;  4OMO A;  4R0K A;  2CUB A;  2NWM A;  2K79 A;  1VYT A;  4GLM A;  3EG3 A;  2FPE A;  2X3X D;  1NYG A;  3VS5 A;  1GCP A;  1AWW A;  2I0N A;  3VS2 A;  1WIE A;  2DL4 A;  1UTI A;  1PKT A;  3IQL A;  2RF0 A;  3VS7 A;  2A36 A;  1UEC A;  3CQT A;  3UA7 A;  1N5Z A;  3M0U A;  4J9F A;  3VRZ A;  1TG0 A;  2RQV A;  2HCK A;  4JPB W;  5FW9 A;  3REA B;  1Z9Q A;  3I5S A;  1JU5 C;  1T0H A;  1NYF A;  2CH4 W;  1BU1 A;  1QCF A;  2C0T A;  3PVQ A;  1YWO A;  1NLP C;  1XOV A;  2J05 A;  4LUD A;  2DL7 A;  4JZ3 A;  1BBZ A;  1UGV A;  2F2W A;  2DF6 A;  3RBB B;  4Z89 A;  2YUN A;  2DBM A;  1HD3 A;  4RTT A;  1UHF A;  2M51 A;  4RTV A;  1K0S A;  1W1F A;  2DLP A;  1OPK A;  2DYB A;  4AFU C;  1HSQ A;  2KR3 A;  1AEY A;  3M0T A;  4AG2 C;  4ESR A;  2K7A A;  1CKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...