1MUZA

Nmr structure of the tumor suppressor bin1: alternative splicing in melanoma and interaction with c-myc
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
81
Chain Sequence
GRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKKLEKCRGVFPENFTERVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A structure-based model of the c-Myc/Bin1 protein interaction shows alternative splicing of Bin1 and c-Myc phosphorylation are key binding determinants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
molecule keywords Myc box dependent interacting protein 1
total genus 12
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2002-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1muzA00
1B3QA 2CH4W 3M0TA 1WI7A 2OJ2A 1HSQA 4J9CA 4J9GA 1X2QA 2JMCA 4QT7A 2I0NA 2CUDA 2F2VA 4CC4B 3M0PA 1JXMA 1TUCA 2JM8A 1AOJA 1Z9ZA 1QCFA 3H0IA 2M51A 1KJWA 3ZL7C 1SRLA 2YSQA 3EG2A 1I07A 5I11A 1W1FA 4GBQA 2EGEA 4A63B 4JPBW 1M30A 2JM9A 2VVKA 2EGCA 4HVWA 2RNAA 1W70A 4J9HA 1KFZA 1GBQA 1T3LA 2GGRA 1PKSA 1UJYA 1K76A 1ZUYA 1K4US 3VS1A 2VWFA 4HXJA 4LN2A 2F2WA 1OEBA 1M3BA 1G83A 2PNIA 2J6FA 4Z89A 1NYGA 2IIMA 2JW4A 4RTZA 1ZBJA 4X1VA 4RTVA 2K79A 4WCIA 1WX6A 2LJ0A 4CC3A 2DF6A 1E6GA 3KFVA 1WA7A 3NPFA 2RMOA 2DL8A 2V1QA 3EHRA 4RUGA 2RQVA 1K0SA 2L3QA 4F16A 3H0HA 1V1CA 1QWEA 2LQWA 1Y0MA 1JEGA 2RPNA 3H0FA 3VS5A 4AG2C 1HD3A 2QDLA 2SRCA 4JZ3A 3NHNA 4M4ZA 1AEYA 1PWTA 4RTTA 3NGPA 1UE9A 2CSQA 2DM1A 1UFFA 2A08A 1X69A 4JJCA 1AZGB 4ORZA 1AWXA 2D8JA 2EYYA 4AFZC 5IXFA 4LE9A 1UTIA 2K9GA 2LJ3A 1HJDA 4Z8AA 1EFNA 1UG1A 4AFUC 1B07A 2ED1A 3IQLA 1SPKA 3RBBB 1VA7A 2ABLA 1AD5A 2FPFA 1W6XA 2OI3A 2YT6A 2A28A 2KROA 3THKA 2AKKA 2KGTA 2HEQA 1YWOA 3EHQA 1FYNA 4DEXA 1QKWA 1GRIA 1ZUUA 2JXBA 2DL7A 3EG0A 2DRKA 2FO0A 1AWOA 2J6KA 5FWBA 1BK2A 1GCPA 3VS7A 2GNCA 2LQNA 2MOXA 2DA9A 3M0UA 2JT4A 2D0NA 1X6GA 2O2OA 2CT4A 1Z9QA 2J7IA 2AZVA 5L23A 2RN8A 2A36A 3LH5A 3U23A 2DMOA 1SHGA 2FG0A 3EG1A 5IHIA 1K0XA 3VS4A 1GCQA 1H8KA 2KRSA 3R6NA 1UDLA 4F14A 2EKHA 3UATA 1NLPC 2MCNA 2RQTA 1PHTA 1WXTA 2YUNA 1CKAA 2X3XD 3REBB 2DVJA 1NEBA 1KSWA 1OPKA 1VYTA 1S1NA 2EQIA 1NLOC 2B86A 2KT1A 2ROTA 2A37A 2X3WD 1JU5C 4OMPA 1YCSB 4Z88A 2DX1A 2ESWA 3VS0A 3VRYA 4RTWA 2ENMA 2BZ8A 1ABOA 4RTYA 2KYMA 5GJVB 4J9IA 1A0NB 2DBMA 4E6RA 2DL4A 1UHFA 1PRLC 1SSHA 2DE0X 1X2KA 1X27A 2K2MA 1H3HA 2FRWA 2CT3A 1YN8A 1SHFA 3EG3A 2KRNA 2GQIA 1AWWA 2J06A 2HCKA 1M3CA 4CC7A 2C0OA 4D8KA 4OMLA 3VS2A 1K9AA 2CSIA 2RQUA 5FWCA 4J9BA 2HSPA 2AZSA 2P4RA 1E6HA 2KXDA 1ZX6A 1U3OA 2V1RA 3I5SA 4IIMA 1RLPC 2LJ1A 3H41A 4HVUA 1WYXA 3O5ZA 1E7OA 1RUWA 1JQQA 2BZYA 2D1XA 1YP5A 2DRMA 2KR3A 2OAWA 2EYXA 1UGVA 2KEAA 1CSKA 2C0IA 4OMOA 1OOTA 4F17A 1OPLA 2YUOA 1BU1A 3I5RA 2L3PA 5IXBA 1T3SA 1UUEA 2EBPA 2DLPA 3GBQA 1QKXA 3M0SA 2CREA 3QWXX 2C0TA 5I22A 3EGUA 1Y57A 2LP5A 1U06A 2O9SA 1T0HA 2G6FX 2K7AA 2YUQA 2EYWA 3VS3A 2CH4A 1WLPB 1K1ZA 2BZXA 2J05A 5EC7A 1QWFA 2SEMA 1UHCA 1GL5A 1MUZA 1G2BA 2JS0A 3PVQA 3TVTA 4D8DA 1XOVA 2DJQA 1I0CA 1FMKA 3I35A 2DL5A 2EYZA 1M3AA 1PKTA 2KRMA 3M0QA 3UA6A 1LCKA 2NUZA 1NEGA 5IHKA 3REAB 4Y92A 2GBQA 1ZUKA 4DEYA 2PTKA 2XMFA 1BB9A 4IIOA 1ZSGA 5GJWB 4AFSC 3CQTA 1MV0B 2EPDA 1TG0A 4OMQA 2JTEA 4LUEA 2HBWA 4AFQC 3RNJA 1X6BA 1NM7A 1IO6A 2GTOA 2F2XA 5HCKA 4OMNA 4LNPA 1AZEA 3VRZA 2NWMA 2KXCA 2DYBA 2K3BA 4ESRA 2CUBA 1H92A 2LX7A 1I1JA 1YNZA 2ECZA 2YUPA 2CDTA 4RTXA 3SHWA 2KYBA 3JV3A 2HDAA 4LUDA 2L3SA 4ZNXA 1UECA 2LZ6B 2KE9A 2DNUA 2W0ZA 1SRMA 2EGAA 1WXUA 4RTUA 1VYVA 3PVLA 4GLMA 1M8MA 1BBZA 1NYFA 1WIEA 2MIOA 2O9VA 3C0CA 2DL3A 2D8HA 2W10A 1JXOA 1WDXA 3M0RA 4HVVA 1ARKA 5FW9A 3UF4A 4OMMA 1AWJA 1AVZC 2FPEA 2ED0A 1U5SA 1VYUA 2O31A 3PE0A 2J6OA 2JMAA 2BTTA 2FRYA 3ULRB 1TUDA 3VS6A 1UJ0A 1T0JA 1ZLMA 3QWYA 2LNHB 4KRTA 2DBKA 2DILA 2H8HA 1JO8A 4JJDA 1GBRA 1GFDA 1WFWA 2RF0A 2RQWA 3FJ5A 1PRMC 3NMZC 4AG1C 1J3TA 3SEMA 2ROLA 4EIKA 4HCKA 3A98A 4K11A 1NG2A 2L0AA 4J9EA 1ABQA 2RQRA 1RLQC 1QLYA 2LCSA 2EVRA 1OV3A 2AKLA 2FEIA 4R0KA 2KBTA 4J9DA 3UA7A 4J9FA 1YWPA 2EW3A 1MV3A 1CKBA 1SEMA 3TSZA 2GTJA 4JJBA 2E5KA 1GFCA 2KNBB 2PZ1A 1N5ZA 2O88A 2K6DA 2AK5A 3TSWA 5IH2A 1M27C 5IHNA 2FPDA 2LMJA 4FSSA 1RI9A 1GCQC 4JZ4A 1KIKA 1WXBA 2YDLA 2M0YA 3I9QA 5ECAA 2L2PA 2JS2A 2KT8A 4CC2A 1PNJA 1X43A 2VKNA
chains in the Genus database with same CATH superfamily
1B3QA 2CH4W 3M0TA 1EIFA 3GOXA 3CCVA 1G3TA 1R0BG 2CUDA 2F2VA 4CC4B 4QVCA 1JXMA 1IREB 3FRNA 2L89A 2Y4YA 1Z9ZA 1QCFA 4MDXA 2M51A 3JCMe 4PJLA 1D0XA 3FJPA 1I07A 5GANg 1W1FA 4XU2A 3X28B 4A63B 4RMOA 4FM4B 4HVWA 2GFAA 3HSBA 1W70A 3EFRA 1PKSA 2HKNA 2P0KA 1YIJA 3C94A 3QDFA 4M7DD 1N8RC 4QQ6A 2HL3A 3E2UA 4DA4A 4J83A 2QXFA 4O5VA 2RH2A 3OYGA 3CCJT 1RAEB 2ZCFB 2J6FA 2HSEB 1M4ZA 2IIMA 4ZTJA 1ZBJA 3L1AA 2LQ8A 2R5AA 2RO0A 2LJ0A 3NFCA 3URGA 4RUGA 1FWZA 1FMVA 2Z0WA 3X26B 4OVAA 2L3QA 3CCRT 4FYYB 3HFNA 1Q81R 2DPPB 3CBOA 1WQ7A 4XTYA 3JSCA 4ZN1A 3VS5A 2MI6A 1PD1A 4M78A 2ZZDA 3KUFA 4BE1A 3NHNA 5CKBA 1WHJA 5GAN2 3P8HA 3T9NA 3CCQQ 1PWTA 3EGXA 4RTTA 3QZ9B 2RJCA 2K2VA 1XQHA 2ZPEB 1UE9A 3CPWP 3BDLA 5IAYA 1VIFA 4JJCA 1AZGB 2CZ0B 2EAYA 3LWHA 4LE9A 1X6OA 3INZA 3RUXA 1U1SA 1Y96B 1HJDA 3OYMA 1Q7YC 2CP3A 3IQLA 3CCEA 2VXFA 1BCOA 2RHUA 2FPFA 1NZ9A 3RDVA 4PFOA 3G6EQ 1KQ1A 4M75F 3ZEHA 1Q7YU 4C8QF 4DBQA 3LGLA 3L2ZA 2D6FA 2DL7A 4E7IA 2V8JA 3P8DA 2LT1A 4JLGA 1OU9A 3UT1A 2GNCA 1QMCA 3M0UA 1SG5A 3S3MA 2CT4A 3FEOA 3CMEQ 1V76A 3U23A 4FW2A 1SHGA 3OYHA 3MO8A 3QYHB 1X01A 1VQ4T 4C8QE 2E6ZA 4AT1B 2KRSA 3R6NA 4V2SA 1VOMA 3UATA 3EAEA 2DZCA 3HL8A 1OX8A 3OYBA 1OQKA 4UC4A 4C8QG 4DBFA 2RD1A 5A0DA 4C0DB 4A4FA 2X3XD 3L2RA 2EQJA 1SKUB 2H3EB 3REBB 1OYXA 4M7AB 2QAZA 2KT1A 4XK8E 3A5ZB 4C5HA 4OB2B 4O6JA 2BZ8A 3RERA 5GJVB 3CPFA 3KXTA 2VC8A 3CMAA 3G71T 4J6YA 2MMPA 1LVKA 3UWNA 4E2FB 1JJ2A 1H3HA 2CT3A 1MNEA 5GMKj 1SHFA 4CI0C 2HBPA 5AYFA 1UEBA 4OMLA 4PJOD 4FL6A 3L2UA 5KE3A 1MMGA 3R6OA 3CCQT 1LPLA 2NUTB 3BE3A 1WYXA 3OBWA 3O5ZA 5C0MA 3CD6T 2D1XA 1YP5A 2DRMA 2KEAA 4PJMA 1CSKA 2YLCA 3OMCA 4OMOA 4XQ3A 4F17A 2DJZA 1ZA2B 2XU8A 2YUOA 3RMSA 5KYWA 5LJ5e 3CC7T 2PU9B 3M56A 2DXCA 1UUEA 3I55A 3OSSC 2EBPA 2DLPA 3GBQA 5CKDA 4OP0A 2NLUA 3LYIA 3QWXX 2DXUA 3M4YA 5I22A 5C6SA 1QVPA 2LP5A 1Y96A 4PJOB 5CK9A 4C8QA 2PVDB 3VS3A 5GAOp 3JRZA 4R56A 1WLPB 4XU0A 2YHTA 1UHCA 2RHXA 1GL5A 1D0ZA 4BI3A 1G2BA 2JS0A 2X4YA 3TVTA 1I5LA 1BCMA 2DJQA 1I0CA 3CBMA 1RAGB 1UGSB 2HKQB 1K9MC 2LT4A 3UA6A 1LCKA 2Y90A 2VXEA 3I56A 2P0QA 2DXTA 1MMNA 2NUZA 3D7SB 3RKXA 3G4SA 2QQRA 5IHKA 4C92B 2DIGA 3OSVA 1VQ6T 3A1PA 2GBQA 1NBEB 5IT9E 1I4K1 2NUPA 1BB9A 1M1GA 3MP6A 4IIOA 1W2BA 4PNOA 1X43A 4XAXB 1IO6A 5FU6C 2NUTA 2BUDA 3OS0A 2KQWA 5FRNA 2NWMA 5FU7B 2ZAEA 2MWOA 1VQLQ 3HFOA 1YNZA 2ZPGB 2YUPA 4FCYA 4M77D 2KYBA 1RAHB 4ZNXA 3VV0A 4EMKB 2DNUA 2QTVA 2COWA 3OBYA 3OW2S 3EGDA 3PVLA 1BBZA 2XDDA 2OTJQ 2DL3A 3H9NA 3CC4Q 1D3BA 3A8MB 1JXOA 3FDRA 4HVVA 1ARKA 1LJOA 3UF4A 5LJ3f 1AWJA 2FPEA 3O8VA 1U5SA 2O31A 4CRIA 1JJ2S 1KD1C 4IKFA 3WVDB 2EIFA 1TUDA 2ZGWA 2FYKA 2DILA 1RABB 4ELYC 3LX7A 3ME9A 5LJ3d 1Q82C 4J7FA 1BI3A 1FXXA 1J3TA 4C8QC 3SEMA 3JCMd 2ROLA 3A98A 5I2MA 1FMWA 4J9EA 1NPRA 4M75G 4C0FA 1QLYA 5GAMh 2AKLA 3L2VA 4LDUA 3TQ7P 2LDMA 1MV3A 4M78F 1SEMA 1OI1A 4EPCA 1Q82R 3PNWC 2DKGA 1QP3A 1K9MU 2AK5A 3TSWA 4OGCA 2BE7D 2YRVA 4Y91A 2FPDA 4JS4A 1VQ7Q 2M0YA 3I9QA 1VQOQ 2E12A 3X25B 1C1AA 1Y71A 2LCLA 3G1JA 2E6NA 3HPWA 1WNLA 4ZGEB 1QVGS 3MKDA 4EMKA 1BYMA 2E64A 1QVFS 2DETA 1Q86C 3UDCA 1TUCA 2DTIA 2JM8A 1AOJA 4BUGA 1VQ8Q 3H0IA 2JJ9A 2RI3A 3QHSA 1MMDA 2P84A 1SRLA 2YSQA 5I11A 2ZPBB 4GBQA 5GAN4 2ZPHB 4JPBW 2QTXA 1M30A 2GQVA 2VVKA 1WJSA 3C4SA 4MDWA 2GGRA 4NL3A 1UJYA 1Y07A 1I5OB 3QXEB 1ZUYA 1KQSA 4NOYA 2QEXQ 2NUPB 3OS5A 3CCUA 1K73C 2F2WA 2OTJT 4F7UG 1JBMA 4PK4A 3PFSA 3V7CA 1G83A 2PVGB 4Z89A 1NYGA 4ELZC 2VV5A 4RTZA 2JVVA 3JCMQ 4JUVA 4X1VA 3QIIA 1IGUA 3PT9A 4QKUA 1YJWT 4CC3A 3KFVA 2RMOA 2QYZA 5HKCA 2EJGA 2Y4XA 2RQVA 1K0SA 2QQBA 4VUBA 4E7LA 5GANe 5DLOA 5CKHA 3H0HA 1KC8R 1V1CA 2LQWA 3EGDB 5CCAA 2RPNA 4ZGJB 3QKJA 1QVFP 4PFPA 3CCJQ 4M4ZA 4QVZA 4BI4A 1YHQT 1QVGP 2GF7A 3JB9J 2EQMA 1KHIA 2DM1A 3G4ST 1OX9A 2QA4T 4IURA 2K5FA 1OU8A 2D8JA 2KI7A 2EYYA 4M7DF 2M0OA 5IXFA 1KK7A 3AHUA 2E4HA 3GIBA 1RL2A 2CP6A 2K9GA 2LJ3A 4L6V5 1EFNA 5DY9A 1YI2Q 3RKWA 1VA7A 5GMKi 2C06A 2ZPIB 3OS1A 1YBYA 2NYSA 2AKKA 4XTVA 2HEQA 1YWOA 3E9FA 4M77C 5HK0A 1VQ6Q 4ME7A 1FYNA 1HK9A 3QJYA 1QKWA 4C0DC 1GRIA 3HRTA 2JXBA 4M78D 2EYQA 1YHQA 1XJWB 5FLXE 1IB8A 3FB9A 4M78E 2ZPFB 2DRKA 3QUIA 2J6KA 4E7SA 3V8LA 2VGNA 4FT4A 2MOXA 5GAN8 4JRKA 1B7TA 1WJQA 2AZVA 5L23A 2LRQA 1M1KR 1Q86R 2FG0A 1K73U 2LVMA 4C92E 1YJ9Q 3X24B 2E5QA 4M7DC 3VS4A 1GCQA 5D6XA 3H6ZA 1SSFA 4M7AA 1NLPC 3HP9A 5GANf 3LH0A 1KQSS 2RQTA 1S72Q 5HY6A 3LGFA 1WXTA 1M1FA 5FU6B 1CKAA 1VQ4A 2E10A 4A4HA 5LJ5f 1VYTA 1BI1A 1NLOC 3RKYA 5KCOA 1JU5C 1N6AA 1YCSB 4Z88A 4OMPA 2DX1A 2ESWA 3VRYA 1ABOA 4RTYA 2OAUA 2RJFA 1A0NB 4J9IA 4PJJA 5D6YA 2DBMA 4E6RA 4P5NA 3EGXB 1UHFA 1PRLC 1SSHA 3QBYA 4Z02A 5KYUB 4N0AA 1P92A 3PGGA 5KCHA 2EWNA 3PMIA 4JRIA 1X27A 2FRWA 4C92A 1M2VB 1ZSZA 1YITA 2HCKA 1M3CA 4CC7A 2QA4A 1KG1A 2RI2A 1VQ9A 4D8KA 2RQUA 3LW5E 5FWCA 2AZSA 2QG9B 2XICA 1ZX6A 3I5SA 1H641 1RLPC 2LJ1A 4HVUA 1JQQA 4E47A 2BZYA 2KR3A 4M78C 2DO3A 4OGEA 2C0IA 4J7IA 3EG9A 2DXBA 3CMEA 2R58A 1BU1A 4GLKA 2V8IA 1QW1A 1T3SA 4EMHA 1KC8C 4BE2A 2CREA 1MHNA 2AHJB 1BIBA 1U06A 4OMFB 3S6WA 2OTJA 2CH4A 2F69A 4M75B 3DB4A 5CQYA 3JCMb 4M7DB 3PIPA 3GF5A 4M75D 2KK4A 2XDBA 3PVQA 1H3ZA 3L2QA 4PL6A 2P0PA 1FMKA 3I35A 3OS2A 2DL5A 4WF2A 3MEWA 1PKTA 2KRMA 3GPLA 3M0QA 4XU3A 1N9RA 2XD0A 1VQ7A 1VQOA 1NEGA 4XTXA 3REAB 3J7AF 3EH2A 2COZA 4LDYA 1YI2A 2XKOC 2VGMA 2K3YA 2XMFA 3CC2Q 4OB3B 1MMAA 1ZSGA 1Q81U 1VQ6A 4OMQA 2DVEA 4LUEA 2HBWA 3SWNB 3PMTA 1KQSP 4A4KA 3CCSQ 5HCKA 5GAN5 2JOYA 4M7DE 2RJEA 1AZEA 3VRZA 2YLBA 3QPHA 3CC2A 3CBPA 1VQ5Q 2E70A 4C8QD 3CXCS 5CIUA 1MNDA 3S3NA 3RMQA 2RHYA 1ZBXA 4RTXA 5GAMf 4NS5A 2O01E 3TCJA 2XIDA 2BE9B 2VYTA 3JV3A 2HDAA 2L3SA 4Q5WA 5GANj 2KE9A 4M77E 1OZ3A 1WXUA 3TREA 1NYFA 3M9QA 2O9VA 1HYOA 4DQ2A 4XTUA 3M58A 3C95A 4J6XA 5FW9A 8AT1B 4OMMA 1AVZC 3ZBDA 4PLLA 1QCNA 1WHLA 2ED0A 4KUIA 1VYUA 2LX9A 2YWWA 2JMAA 3RR6A 2FRYA 2XI9A 1RADB 5CVIA 4M78G 2QEXT 1GXIE 1UGPB 1ZLMA 1IGQA 5GMKe 3QWYA 2LNHB 2O4XA 1M2VA 1ZSZB 2QI2A 2H8HA 1JO8A 4J8OA 2QDYB 1WFWA 2RF0A 4B6MA 2EJ9A 2JN0A 3FJ5A 1UB4A 4KGXB 1ABQA 1ZQ1A 2RQRA 2VB6A 2QASA 1K9MR 1KD1U 3OYJA 3MCAB 3QG1A 2COYA 4J9FA 2EW3A 3TSZA 2GTJA 4JJBA 1GFCA 1XNIA 2F5TX 2JUFA 2PZ1A 2RK2A 2O88A 1WHKA 4J5YA 1G3YA 4LDXA 2RM4A 4JZ4A 1WXBA 2YDLA 3VU3C 2PQWA 5FRMA 2L2PA 1JRIA 2KT8A 1PNJA 3OQ5A 1Q82U 3CPWA 3UA7A 2M1HA 1WI7A 4J9CA 4J9GA 3OYDA 5LJ5g 3M0PA 4FW1A 1K73R 4LD6A 3MP8A 4JJNK 1VQKT 3ZL7C 4FSXA 3EG2A 3JB9H 2EGEA 1IHVA 2JM9A 2B8AA 2RNAA 4J9HA 1KFZA 1GBQA 1OULA 1K76A 3EH1A 4F7UB 3S3OA 1VQNT 4A4EA 4HXJA 3JCMg 1D1AA 4LN2A 3G6ET 1ACMB 1OEBA 3OB9A 1KQ2A 1M3BA 4LDWA 3CXCP 1YITT 2PNIA 1V29B 3E19A 4KGZB 2JW4A 1KC8U 1TUGB 3HKSA 1WHHA 3M5AA 4M75C 4WCIA 2ATCB 4KULA 1WX6A 3BFMA 1E6GA 1M1KC 1M2OA 2V1QA 3HRUA 3CCMT 5HK3A 4F16A 2G3RA 5A0LA 4DOWA 2RI5A 1QWEA 1S72T 4ANJA 3BW1A 4EDUA 4PLIA 4OB1B 1Y0MA 5DLQE 3JB9I 4ZGDB 1JEGA 3H0FA 4AG2C 4DBHA 2QDLA 1B34B 1Q95G 2SRCA 3JCMJ 4JZ3A 1AEYA 2MWPA 1IZ6A 3FLGA 1VQOT 2QGFB 1M5Q1 5LJ3e 1UFFA 4F7UE 2A08A 1I8FA 4M7AC 3M53A 4ORZA 1AWXA 3X20B 3G6EA 4JLIA 3CMET 5KYXA 2O4XB 1YJNQ 2LTOA 2AIRB 4MZPA 1OZ2A 3VYHB 4AFUC 3TEEA 3I55T 1BI2A 2ED1A 2X4XA 1KHCA 3RBBB 4XTWA 2ABLA 1AD5A 1D1BA 2HD0A 3PTAA 2FZGB 2M16A 4XTZA 2FHDA 1W6XA 2KROA 2DTHA 3CMAT 4PJOG 2DZ9A 4FT2A 4Y28E 2QK0A 3LLRA 2HAXA 1BIAA 3EG0A 2VUBA 2FO0A 3JCMh 2WSCE 3OW2P 1VQ8A 3M59A 1BK2A 2KMTA 1GCPA 1TS9A 1X6GA 2QQAA 2O2OA 1UGRB 1Z9QA 3ER0A 4B9WA 3LH5A 4C92F 1HXDA 4RCCA 5LJ3j 2DMOA 4ATOA 3OYAA 1PSFA 5IHIA 8ATCB 2JNGA 4M77G 1ZSZC 1UDLA 4F14A 2IPOB 2EKHA 4E7HA 4C0GA 2E65A 4NL2A 4F7UA 3NTIA 1W2BP 3WVEB 4OB0B 2K3XA 3WXMB 3HTRA 1OPKA 4X34A 5GMKh 2HQHA 2B86A 2K5IA 2ROTA 5LJ5j 2A37A 4PJOE 4MZTA 2V26A 4N4GA 2CZ7B 1VIEA 3VS0A 3JCMf 4RG8A 4M7AE 1RI0A 1VQ8T 2KYMA 2LNVA 2DYIA 4M7AD 5KYYB 4M7DG 1X2KA 4LDVA 2K2MA 3EG3A 3L42A 2DEUA 2CSIA 3A8LB 4C92C 4PJOF 1O75A 4J9BA 4N4IA 2P4RA 4JS5A 9ATCB 4HA8A 4N0AC 3H8ZA 1U3OA 1VQPA 3I55Q 3H41A 1E7OA 1YIJQ 5CKFA 2M9UA 5GAOm 2OAWA 2EYXA 4L5GA 7AT1B 3CCSA 3JCMX 1YJNT 2FZCB 1OPLA 3DLMA 2L3PA 1IHWA 4C5GA 2E3IA 5A0GA 4F7UF 2RK1A 1NE8A 3SDZA 5KYUA 1G5VA 3A8HB 3JB9F 4KH0B 4AMCA 3EGUA 5CR2A 4EMKC 3SFMA 1YHQQ 2EYWA 1Y7XA 5KYXB 2E41A 3OYIA 2A0FB 2OTLA 2J05A 5EC7A 3G71Q 1MUZA 5CAIA 2MAMA 4FIBA 4D8DA 1KD1R 2E1HA 2QGGA 1JB0E 2F1LA 4PJOC 1N8RR 4A4GA 1YIJT 1M3AA 4HCBA 1B34A 2GCXA 3QZ5B 1VQKQ 1YJ9A 1D1CA 3P8BB 4C0ZA 2XK0A 3MEVA 1M90C 1TWBA 1YJNA 1O9SA 2LQKA 5GAN3 1VQMQ 5LL6S 4Y92A 2HNIA 5J26A 3CCEQ 3DLLA 2L8DA 1ZUKA 4DEYA 1FX7A 2PTKA 1Q7YR 2K4YA 2YRDA 2D9TA 2EQKA 5GJWB 1RAIB 3CQTA 1TXQA 2EPDA 1WHGA 4OF1A 2JTEA 2CYZB 4AFQC 2YRCA 4BD3A 1X6BA 1VQMA 4IUTA 1IXDA 1NM7A 1ZHIA 2YXYA 2GTOA 2X9HA 4OMNA 1DJ7B 2A7YA 1QVFA 4LNPA 5CQXA 2KXCA 2K3BA 2DIQA 4ESRA 5GAOl 2CUBA 2JTFA 1H92A 2LX7A 2QQ9A 4C5EA 2XHCA 2CDTA 1VQ9Q 2HZYA 4HT9A 5CO7A 4LUDA 1VQPT 3OYNA 2VASA 4BE0A 2LZ6B 3E9GA 3JCMc 2XDPA 2M02A 2EGAA 3CD6Q 1VYVA 4GLMA 1M8MA 1ZA1B 3ZFJA 4X9DA 4M7AF 3TU4K 5KYYA 2D8HA 2W10A 1VQLA 3CCET 2FVUA 3PE0A 2J6OA 3J80E 3M55A 2FZKB 4M75A 1YFNA 2MPXC 4M7DA 1VQ5T 3VS6A 1UJ0A 2CS7A 3DKMA 3CD6A 1YJWQ 3CEYA 4KRTA 5GANh 2CP2A 2DBKA 3CC4A 1NPPA 3DB3A 1VQMT 2AT1B 1PRMC 3NMZC 4WTOB 1K8AC 1N27A 5LJ5h 4HCKA 1NG2A 2L0AA 3CCLA 5FROA 1XTDA 3CMAQ 1RAAB 3VJPA 5J3BA 3QJ6A 2LCSA 2EVRA 1OV3A 2EQUA 1F1BB 2FEIA 3CPWS 2K57A 2KBTA 4YTLA 3MHXA 3QO3A 2HMAA 1U8RA 3FIFA 4A53A 4F04B 1QQJA 1VQLT 1VQ4Q 3OMGA 4C5IA 4PFZA 4BB7A 1NJIU 4X9CA 5IH2A 5IHNA 3MEAA 1VQPQ 2LMJA 4FSSA 1RI9A 1M90U 1VQ5A 1RAFB 2E3HA 4FYXB 5ECAA 1TTHB 1IRXA 2F5KA 5D7UA 4BDYA 2VKNA 4MMKA 3A8GB 2OJ2A 1HSQA 1X2QA 2JMCA 4QT7A 2I0NA 2RJDA 5AT1B 2WACA 5DM7R 4LXCA 4FU6A 1AT1B 1YITQ 3CCLT 2FB7A 1KJWA 2PUOB 1W2BS 1JJ2P 2KVQG 1YCYA 2EGCA 1VQ9T 3LWIA 1NJIC 1T3LA 1K4US 1D3BB 3VS1A 2V8KA 4BY6C 2VWFA 4KH1B 4M77B 3BDUA 5GAOn 1WZOA 4HKEA 2L3RA 4BACA 2X35A 4QW2A 4E7JA 1WJRA 5D6WA 3V8KA 1UGQB 4KBMB 4EMGA 1MGQA 4ZTFA 2KSSA 3I56Q 4RTVA 2K79A 4II1A 5CKEA 2DF6A 4IUQA 1WA7A 3NPFA 3EHRA 2DL8A 3CC4T 3CC7A 3VYGA 4LD9K 2OTLT 2RA2A 1BKBA 2DEQA 1M90R 1N9SA 1G8XA 2GFUA 2LCCA 1M8VA 4MZMA 1VUBA 4HCCA 3CCMA 1HD3A 2A3LA 4QQGA 5GAOr 3HRSA 1I81A 3NTHA 3CC7Q 5LJ3h 2CP0A 5KH6A 1C0MA 5A2QE 3NGPA 2CSQA 4IUVA 5I2SA 1X69A 5LJ3g 4N4HA 4JDSA 2RHIA 4AFZC 4E7ZA 3QYGB 3CCMQ 3OY9A 3VUZA 2JZ2A 1UTIA 2D0QB 3QSUA 4Z8AA 1UG1A 1B07A 4DBRA 1SPKA 5GAMe 3I56T 1VQ7T 5EG2A 4M75E 1WQWA 2OI3A 2YT6A 2BIVA 2QQSA 3CCRA 2A28A 3THKA 2KGTA 1TOVA 3EHQA 4DOVA 2RHZA 4DEXA 2EKOA 3EG9B 1ZUUA 2KY9A 4HCZA 3CCUT 3CCVQ 5M9OA 4BI8B 3MEUA 1M9SA 1AWOA 5FWBA 5IN1A 3G7ZA 1PM3A 3EFSA 4KGVB 3E1SA 2LQNA 3VS7A 3OYFA 2DA9A 2JT4A 2D0NA 1QP2A 4M78B 4RCBA 2J7IA 2RN8A 2A36A 3CCLQ 3EG1A 4PJNA 4JRQA 2BKDN 1K0XA 2CZ6B 3UPUA 4C92D 1PD0A 3JAME 1H8KA 1LNXA 2R57A 5GAN7 2MCNA 2CP5A 3KBGA 4HT8A 1PHTA 3V7RA 3PIOA 2YUNA 2I2LA 3GP8A 4QVDA 1R8OB 2DVJA 1NEBA 1KSWA 2OX7A 1PC0A 1S1NA 2EQIA 2OTLQ 2PVOB 2X3WD 4M77F 2JTMA 2XG8D 2K5LA 3M57A 3G71A 4RTWA 3SB2A 2ENMA 4PJOA 3CC2T 3JCMP 3BY7A 1PCXA 2DTOA 2DL4A 1VQNQ 5J39A 1R0CB 2EFIA 3V7SA 3VUBA 2DE0X 1VQKA 4KT0E 3OYYA 1SF9A 2PUKB 1YN8A 2H3JA 2KRNA 2GQIA 2P4TA 4C8QB 1AWWA 2J06A 2C0OA 5KYWB 5GAMg 3VS2A 1K9AA 2KAFA 3CCQA 2DK3A 1R77A 2KDSA 1K8AU 1VQNA 1D0YA 3VKIA 2HSPA 3OYLA 1AHJB 4MMLA 1E6HA 2KXDA 5GMKl 2V1RA 4RKUE 4IIMA 4IUPA 1RUWA 2QEXA 2QA4Q 1M1KU 1UGVA 4GY5A 1YJ9T 3L2WA 5GANd 3JB9G 1OOTA 3GNGA 2CGHA 3OA6A 3AT1B 3I5RA 2DERA 1YJWA 3M54A 5IXBA 3CCST 3OYCA 2CKKA 1QKXA 3M0SA 3NTKA 2EJFA 2C0TA 3META 1W4SA 2IVWA 3OW2A 1Y57A 3RIRA 2O9SA 1T0HA 2G6FX 2K7AA 2YUQA 3JB9D 1TH7A 1EX4A 2L5QA 1K1ZA 4IUUA 2BZXA 2MYSA 3M4GA 1QWFA 3EFOB 2SEMA 3MP1A 4QQDA 1XOVA 2EYZA 1TSFA 2DD5A 2IG0A 2X4WA 2CP7A 1WGSA 1NJIR 1K8AR 2MF2A 1PSEA 4M77A 3SWNC 5GAMj 1D09B 2X51A 4KUDK 4M7AG 3C12A 4FYVB 1LOJA 3SD4A 4AFSC 4BY6B 3QDRB 4RG2A 1MV0B 1TG0A 3RNJA 4D6WA 1WHMA 2F2XA 4A54A 1C6VX 4J6WA 2DYBA 1I1JA 2ECZA 3CXCA 5GMKm 1Q86U 3SHWA 3FC3A 4C92G 3A8OB 1UECA 3JCMW 2DFUA 2W0ZA 1SRMA 3OYEA 4RTUA 3HHTB 3J81E 1WIEA 2MIOA 3C0CA 4FYWB 4PKCC 1WDXA 3M0RA 1RACB 3ASKA 1X75C 3JCMV 4TVRA 1U1TA 2HL5C 2HQXA 5L8RE 5I21A 1S72A 1BI0A 3F70A 2BTTA 4JRPA 3ULRB 1T0JA 5GAOq 2DAQA 5FU7C 4B9XA 3OYKA 4JJDA 1GBRA 1GFDA 1YI2T 2RQWA 3CCUQ 3CCVT 1TU0B 1WPYA 2LC4A 4AG1C 4L59A 3EFOA 5GAN6 2FL7A 2WSFE 4EIKA 4K11A 5GAMd 3SWNA 1EZZB 5LJ5d 1RLQC 3RESA 3GLXA 2DD4A 1QVGA 2X4JA 1QCOA 1PG5B 5KE2A 4R0KA 2R5MA 5KYNA 4J9DA 4R55A 1YWPA 1N8RU 4E7KA 1CKBA 2MK5A 6AT1B 2E5KA 1Q81C 4XU1A 1G3WA 2KNBB 1N5ZA 2K6DA 3N5BB 2WSEE 4ZN3A 3Q1JA 3V8JA 1M27C 3GNFB 1GCQC 3CCRQ 1KIKA 4BDZA 2RB6A 1G3SA 3CCJA 2JS2A 2CZ1B 3MPUB 3G4SQ 4CC2A 3MJXA 2HQEA
chains in the Genus database with same CATH topology
1B3QA 2CH4W 3M0TA 1WI7A 2OJ2A 1HSQA 4J9CA 4J9GA 1X2QA 2JMCA 4QT7A 2I0NA 2CUDA 2F2VA 4CC4B 3M0PA 1JXMA 1TUCA 2JM8A 1AOJA 1Z9ZA 1QCFA 3H0IA 2M51A 1KJWA 3ZL7C 1SRLA 2YSQA 3EG2A 1I07A 5I11A 1W1FA 4GBQA 2EGEA 4A63B 4JPBW 1M30A 2JM9A 2VVKA 2EGCA 4HVWA 2RNAA 1W70A 4J9HA 1KFZA 1GBQA 1T3LA 2GGRA 1PKSA 1UJYA 1K76A 1ZUYA 1K4US 3VS1A 2VWFA 4HXJA 4LN2A 2F2WA 1OEBA 1M3BA 1G83A 2PNIA 2J6FA 4Z89A 1NYGA 2IIMA 2JW4A 4RTZA 1ZBJA 4X1VA 4RTVA 2K79A 4WCIA 1WX6A 2LJ0A 4CC3A 2DF6A 1E6GA 3KFVA 1WA7A 3NPFA 2RMOA 2DL8A 2V1QA 3EHRA 4RUGA 2RQVA 1K0SA 2L3QA 4F16A 3H0HA 1V1CA 1QWEA 2LQWA 1Y0MA 1JEGA 2RPNA 3H0FA 3VS5A 4AG2C 1HD3A 2QDLA 2SRCA 4JZ3A 3NHNA 4M4ZA 1AEYA 1PWTA 4RTTA 3NGPA 1UE9A 2CSQA 2DM1A 1UFFA 2A08A 1X69A 4JJCA 1AZGB 4ORZA 1AWXA 2D8JA 2EYYA 4AFZC 5IXFA 4LE9A 1UTIA 2K9GA 2LJ3A 1HJDA 4Z8AA 1EFNA 1UG1A 4AFUC 1B07A 2ED1A 3IQLA 1SPKA 3RBBB 1VA7A 2ABLA 1AD5A 2FPFA 1W6XA 2OI3A 2YT6A 2A28A 2KROA 3THKA 2AKKA 2KGTA 2HEQA 1YWOA 3EHQA 1FYNA 4DEXA 1QKWA 1GRIA 1ZUUA 2JXBA 2DL7A 3EG0A 2DRKA 2FO0A 1AWOA 2J6KA 5FWBA 1BK2A 1GCPA 3VS7A 2GNCA 2LQNA 2MOXA 2DA9A 3M0UA 2JT4A 2D0NA 1X6GA 2O2OA 2CT4A 1Z9QA 2J7IA 2AZVA 5L23A 2RN8A 2A36A 3LH5A 3U23A 2DMOA 1SHGA 2FG0A 3EG1A 5IHIA 1K0XA 3VS4A 1GCQA 1H8KA 2KRSA 3R6NA 1UDLA 4F14A 2EKHA 3UATA 1NLPC 2MCNA 2RQTA 1PHTA 1WXTA 2YUNA 1CKAA 2X3XD 3REBB 2DVJA 1NEBA 1KSWA 1OPKA 1VYTA 1S1NA 2EQIA 1NLOC 2B86A 2KT1A 2ROTA 2A37A 2X3WD 1JU5C 4OMPA 1YCSB 4Z88A 2DX1A 2ESWA 3VS0A 3VRYA 4RTWA 2ENMA 2BZ8A 1ABOA 4RTYA 2KYMA 5GJVB 4J9IA 1A0NB 2DBMA 4E6RA 2DL4A 1UHFA 1PRLC 1SSHA 2DE0X 1X2KA 1X27A 2K2MA 1H3HA 2FRWA 2CT3A 1YN8A 1SHFA 3EG3A 2KRNA 2GQIA 1AWWA 2J06A 2HCKA 1M3CA 4CC7A 2C0OA 4D8KA 4OMLA 3VS2A 1K9AA 2CSIA 2RQUA 5FWCA 4J9BA 2HSPA 2AZSA 2P4RA 1E6HA 2KXDA 1ZX6A 1U3OA 2V1RA 3I5SA 4IIMA 1RLPC 2LJ1A 3H41A 4HVUA 1WYXA 3O5ZA 1E7OA 1RUWA 1JQQA 2BZYA 2D1XA 1YP5A 2DRMA 2KR3A 2OAWA 2EYXA 1UGVA 2KEAA 1CSKA 2C0IA 4OMOA 1OOTA 4F17A 1OPLA 2YUOA 1BU1A 3I5RA 2L3PA 5IXBA 1T3SA 1UUEA 2EBPA 2DLPA 3GBQA 1QKXA 3M0SA 2CREA 3QWXX 2C0TA 5I22A 3EGUA 1Y57A 2LP5A 1U06A 2O9SA 1T0HA 2G6FX 2K7AA 2YUQA 2EYWA 3VS3A 2CH4A 1WLPB 1K1ZA 2BZXA 2J05A 5EC7A 1QWFA 2SEMA 1UHCA 1GL5A 1MUZA 1G2BA 2JS0A 3PVQA 3TVTA 4D8DA 1XOVA 2DJQA 1I0CA 1FMKA 3I35A 2DL5A 2EYZA 1M3AA 1PKTA 2KRMA 3M0QA 3UA6A 1LCKA 2NUZA 1NEGA 5IHKA 3REAB 4Y92A 2GBQA 1ZUKA 4DEYA 2PTKA 2XMFA 1BB9A 4IIOA 1ZSGA 5GJWB 4AFSC 3CQTA 1MV0B 2EPDA 1TG0A 4OMQA 2JTEA 4LUEA 2HBWA 4AFQC 3RNJA 1X6BA 1NM7A 1IO6A 2GTOA 2F2XA 5HCKA 4OMNA 4LNPA 1AZEA 3VRZA 2NWMA 2KXCA 2DYBA 2K3BA 4ESRA 2CUBA 1H92A 2LX7A 1I1JA 1YNZA 2ECZA 2YUPA 2CDTA 4RTXA 3SHWA 2KYBA 3JV3A 2HDAA 4LUDA 2L3SA 4ZNXA 1UECA 2LZ6B 2KE9A 2DNUA 2W0ZA 1SRMA 2EGAA 1WXUA 4RTUA 1VYVA 3PVLA 4GLMA 1M8MA 1BBZA 1NYFA 1WIEA 2MIOA 2O9VA 3C0CA 2DL3A 2D8HA 2W10A 1JXOA 1WDXA 3M0RA 4HVVA 1ARKA 5FW9A 3UF4A 4OMMA 1AWJA 1AVZC 2FPEA 2ED0A 1U5SA 1VYUA 2O31A 3PE0A 2J6OA 2JMAA 2BTTA 2FRYA 3ULRB 1TUDA 3VS6A 1UJ0A 1T0JA 1ZLMA 3QWYA 2LNHB 4KRTA 2DBKA 2DILA 2H8HA 1JO8A 4JJDA 1GBRA 1GFDA 1WFWA 2RF0A 2RQWA 3FJ5A 1PRMC 3NMZC 4AG1C 1J3TA 3SEMA 2ROLA 4EIKA 4HCKA 3A98A 4K11A 1NG2A 2L0AA 4J9EA 1ABQA 2RQRA 1RLQC 1QLYA 2LCSA 2EVRA 1OV3A 2AKLA 2FEIA 4R0KA 2KBTA 4J9DA 3UA7A 4J9FA 1YWPA 2EW3A 1MV3A 1CKBA 1SEMA 3TSZA 2GTJA 4JJBA 2E5KA 1GFCA 2KNBB 2PZ1A 1N5ZA 2O88A 2K6DA 2AK5A 3TSWA 5IH2A 1M27C 5IHNA 2FPDA 2LMJA 4FSSA 1RI9A 1GCQC 4JZ4A 1KIKA 1WXBA 2YDLA 2M0YA 3I9QA 5ECAA 2L2PA 2JS2A 2KT8A 4CC2A 1PNJA 1X43A 2VKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B3Q A;  2CH4 W;  3M0T A;  1WI7 A;  2OJ2 A;  1HSQ A;  4J9C A;  4J9G A;  1X2Q A;  2JMC A;  4QT7 A;  2I0N A;  2CUD A;  2F2V A;  4CC4 B;  3M0P A;  1JXM A;  1TUC A;  2JM8 A;  1AOJ A;  1Z9Z A;  1QCF A;  3H0I A;  2M51 A;  1KJW A;  3ZL7 C;  1SRL A;  2YSQ A;  3EG2 A;  1I07 A;  5I11 A;  1W1F A;  4GBQ A;  2EGE A;  4A63 B;  4JPB W;  1M30 A;  2JM9 A;  2VVK A;  2EGC A;  4HVW A;  2RNA A;  1W70 A;  4J9H A;  1KFZ A;  1GBQ A;  1T3L A;  2GGR A;  1PKS A;  1UJY A;  1K76 A;  1ZUY A;  1K4U S;  3VS1 A;  2VWF A;  4HXJ A;  4LN2 A;  2F2W A;  1OEB A;  1M3B A;  1G83 A;  2PNI A;  2J6F A;  4Z89 A;  1NYG A;  2IIM A;  2JW4 A;  4RTZ A;  1ZBJ A;  4X1V A;  4RTV A;  2K79 A;  4WCI A;  1WX6 A;  2LJ0 A;  4CC3 A;  2DF6 A;  1E6G A;  3KFV A;  1WA7 A;  3NPF A;  2RMO A;  2DL8 A;  2V1Q A;  3EHR A;  4RUG A;  2RQV A;  1K0S A;  2L3Q A;  4F16 A;  3H0H A;  1V1C A;  1QWE A;  2LQW A;  1Y0M A;  1JEG A;  2RPN A;  3H0F A;  3VS5 A;  4AG2 C;  1HD3 A;  2QDL A;  2SRC A;  4JZ3 A;  3NHN A;  4M4Z A;  1AEY A;  1PWT A;  4RTT A;  3NGP A;  1UE9 A;  2CSQ A;  2DM1 A;  1UFF A;  2A08 A;  1X69 A;  4JJC A;  1AZG B;  4ORZ A;  1AWX A;  2D8J A;  2EYY A;  4AFZ C;  5IXF A;  4LE9 A;  1UTI A;  2K9G A;  2LJ3 A;  1HJD A;  4Z8A A;  1EFN A;  1UG1 A;  4AFU C;  1B07 A;  2ED1 A;  3IQL A;  1SPK A;  3RBB B;  1VA7 A;  2ABL A;  1AD5 A;  2FPF A;  1W6X A;  2OI3 A;  2YT6 A;  2A28 A;  2KRO A;  3THK A;  2AKK A;  2KGT A;  2HEQ A;  1YWO A;  3EHQ A;  1FYN A;  4DEX A;  1QKW A;  1GRI A;  1ZUU A;  2JXB A;  2DL7 A;  3EG0 A;  2DRK A;  2FO0 A;  1AWO A;  2J6K A;  5FWB A;  1BK2 A;  1GCP A;  3VS7 A;  2GNC A;  2LQN A;  2MOX A;  2DA9 A;  3M0U A;  2JT4 A;  2D0N A;  1X6G A;  2O2O A;  2CT4 A;  1Z9Q A;  2J7I A;  2AZV A;  5L23 A;  2RN8 A;  2A36 A;  3LH5 A;  3U23 A;  2DMO A;  1SHG A;  2FG0 A;  3EG1 A;  5IHI A;  1K0X A;  3VS4 A;  1GCQ A;  1H8K A;  2KRS A;  3R6N A;  1UDL A;  4F14 A;  2EKH A;  3UAT A;  1NLP C;  2MCN A;  2RQT A;  1PHT A;  1WXT A;  2YUN A;  1CKA A;  2X3X D;  3REB B;  2DVJ A;  1NEB A;  1KSW A;  1OPK A;  1VYT A;  1S1N A;  2EQI A;  1NLO C;  2B86 A;  2KT1 A;  2ROT A;  2A37 A;  2X3W D;  1JU5 C;  4OMP A;  1YCS B;  4Z88 A;  2DX1 A;  2ESW A;  3VS0 A;  3VRY A;  4RTW A;  2ENM A;  2BZ8 A;  1ABO A;  4RTY A;  2KYM A;  5GJV B;  4J9I A;  1A0N B;  2DBM A;  4E6R A;  2DL4 A;  1UHF A;  1PRL C;  1SSH A;  2DE0 X;  1X2K A;  1X27 A;  2K2M A;  1H3H A;  2FRW A;  2CT3 A;  1YN8 A;  1SHF A;  3EG3 A;  2KRN A;  2GQI A;  1AWW A;  2J06 A;  2HCK A;  1M3C A;  4CC7 A;  2C0O A;  4D8K A;  4OML A;  3VS2 A;  1K9A A;  2CSI A;  2RQU A;  5FWC A;  4J9B A;  2HSP A;  2AZS A;  2P4R A;  1E6H A;  2KXD A;  1ZX6 A;  1U3O A;  2V1R A;  3I5S A;  4IIM A;  1RLP C;  2LJ1 A;  3H41 A;  4HVU A;  1WYX A;  3O5Z A;  1E7O A;  1RUW A;  1JQQ A;  2BZY A;  2D1X A;  1YP5 A;  2DRM A;  2KR3 A;  2OAW A;  2EYX A;  1UGV A;  2KEA A;  1CSK A;  2C0I A;  4OMO A;  1OOT A;  4F17 A;  1OPL A;  2YUO A;  1BU1 A;  3I5R A;  2L3P A;  5IXB A;  1T3S A;  1UUE A;  2EBP A;  2DLP A;  3GBQ A;  1QKX A;  3M0S A;  2CRE A;  3QWX X;  2C0T A;  5I22 A;  3EGU A;  1Y57 A;  2LP5 A;  1U06 A;  2O9S A;  1T0H A;  2G6F X;  2K7A A;  2YUQ A;  2EYW A;  3VS3 A;  2CH4 A;  1WLP B;  1K1Z A;  2BZX A;  2J05 A;  5EC7 A;  1QWF A;  2SEM A;  1UHC A;  1GL5 A;  1MUZ A;  1G2B A;  2JS0 A;  3PVQ A;  3TVT A;  4D8D A;  1XOV A;  2DJQ A;  1I0C A;  1FMK A;  3I35 A;  2DL5 A;  2EYZ A;  1M3A A;  1PKT A;  2KRM A;  3M0Q A;  3UA6 A;  1LCK A;  2NUZ A;  1NEG A;  5IHK A;  3REA B;  4Y92 A;  2GBQ A;  1ZUK A;  4DEY A;  2PTK A;  2XMF A;  1BB9 A;  4IIO A;  1ZSG A;  5GJW B;  4AFS C;  3CQT A;  1MV0 B;  2EPD A;  1TG0 A;  4OMQ A;  2JTE A;  4LUE A;  2HBW A;  4AFQ C;  3RNJ A;  1X6B A;  1NM7 A;  1IO6 A;  2GTO A;  2F2X A;  5HCK A;  4OMN A;  4LNP A;  1AZE A;  3VRZ A;  2NWM A;  2KXC A;  2DYB A;  2K3B A;  4ESR A;  2CUB A;  1H92 A;  2LX7 A;  1I1J A;  1YNZ A;  2ECZ A;  2YUP A;  2CDT A;  4RTX A;  3SHW A;  2KYB A;  3JV3 A;  2HDA A;  4LUD A;  2L3S A;  4ZNX A;  1UEC A;  2LZ6 B;  2KE9 A;  2DNU A;  2W0Z A;  1SRM A;  2EGA A;  1WXU A;  4RTU A;  1VYV A;  3PVL A;  4GLM A;  1M8M A;  1BBZ A;  1NYF A;  1WIE A;  2MIO A;  2O9V A;  3C0C A;  2DL3 A;  2D8H A;  2W10 A;  1JXO A;  1WDX A;  3M0R A;  4HVV A;  1ARK A;  5FW9 A;  3UF4 A;  4OMM A;  1AWJ A;  1AVZ C;  2FPE A;  2ED0 A;  1U5S A;  1VYU A;  2O31 A;  3PE0 A;  2J6O A;  2JMA A;  2BTT A;  2FRY A;  3ULR B;  1TUD A;  3VS6 A;  1UJ0 A;  1T0J A;  1ZLM A;  3QWY A;  2LNH B;  4KRT A;  2DBK A;  2DIL A;  2H8H A;  1JO8 A;  4JJD A;  1GBR A;  1GFD A;  1WFW A;  2RF0 A;  2RQW A;  3FJ5 A;  1PRM C;  3NMZ C;  4AG1 C;  1J3T A;  3SEM A;  2ROL A;  4EIK A;  4HCK A;  3A98 A;  4K11 A;  1NG2 A;  2L0A A;  4J9E A;  1ABQ A;  2RQR A;  1RLQ C;  1QLY A;  2LCS A;  2EVR A;  1OV3 A;  2AKL A;  2FEI A;  4R0K A;  2KBT A;  4J9D A;  3UA7 A;  4J9F A;  1YWP A;  2EW3 A;  1MV3 A;  1CKB A;  1SEM A;  3TSZ A;  2GTJ A;  4JJB A;  2E5K A;  1GFC A;  2KNB B;  2PZ1 A;  1N5Z A;  2O88 A;  2K6D A;  2AK5 A;  3TSW A;  5IH2 A;  1M27 C;  5IHN A;  2FPD A;  2LMJ A;  4FSS A;  1RI9 A;  1GCQ C;  4JZ4 A;  1KIK A;  1WXB A;  2YDL A;  2M0Y A;  3I9Q A;  5ECA A;  2L2P A;  2JS2 A;  2KT8 A;  4CC2 A;  1PNJ A;  1X43 A;  2VKN A; 
#chains in the Genus database with same CATH topology
 1B3Q A;  2CH4 W;  3M0T A;  1EIF A;  3GOX A;  3CCV A;  1G3T A;  1R0B G;  2CUD A;  2F2V A;  4CC4 B;  4QVC A;  1JXM A;  1IRE B;  3FRN A;  2L89 A;  2Y4Y A;  1Z9Z A;  1QCF A;  4MDX A;  2M51 A;  3JCM e;  4PJL A;  1D0X A;  3FJP A;  1I07 A;  5GAN g;  1W1F A;  4XU2 A;  3X28 B;  4A63 B;  4RMO A;  4FM4 B;  4HVW A;  2GFA A;  3HSB A;  1W70 A;  3EFR A;  1PKS A;  2HKN A;  2P0K A;  1YIJ A;  3C94 A;  3QDF A;  4M7D D;  1N8R C;  4QQ6 A;  2HL3 A;  3E2U A;  4DA4 A;  4J83 A;  2QXF A;  4O5V A;  2RH2 A;  3OYG A;  3CCJ T;  1RAE B;  2ZCF B;  2J6F A;  2HSE B;  1M4Z A;  2IIM A;  4ZTJ A;  1ZBJ A;  3L1A A;  2LQ8 A;  2R5A A;  2RO0 A;  2LJ0 A;  3NFC A;  3URG A;  4RUG A;  1FWZ A;  1FMV A;  2Z0W A;  3X26 B;  4OVA A;  2L3Q A;  3CCR T;  4FYY B;  3HFN A;  1Q81 R;  2DPP B;  3CBO A;  1WQ7 A;  4XTY A;  3JSC A;  4ZN1 A;  3VS5 A;  2MI6 A;  1PD1 A;  4M78 A;  2ZZD A;  3KUF A;  4BE1 A;  3NHN A;  5CKB A;  1WHJ A;  5GAN 2;  3P8H A;  3T9N A;  3CCQ Q;  1PWT A;  3EGX A;  4RTT A;  3QZ9 B;  2RJC A;  2K2V A;  1XQH A;  2ZPE B;  1UE9 A;  3CPW P;  3BDL A;  5IAY A;  1VIF A;  4JJC A;  1AZG B;  2CZ0 B;  2EAY A;  3LWH A;  4LE9 A;  1X6O A;  3INZ A;  3RUX A;  1U1S A;  1Y96 B;  1HJD A;  3OYM A;  1Q7Y C;  2CP3 A;  3IQL A;  3CCE A;  2VXF A;  1BCO A;  2RHU A;  2FPF A;  1NZ9 A;  3RDV A;  4PFO A;  3G6E Q;  1KQ1 A;  4M75 F;  3ZEH A;  1Q7Y U;  4C8Q F;  4DBQ A;  3LGL A;  3L2Z A;  2D6F A;  2DL7 A;  4E7I A;  2V8J A;  3P8D A;  2LT1 A;  4JLG A;  1OU9 A;  3UT1 A;  2GNC A;  1QMC A;  3M0U A;  1SG5 A;  3S3M A;  2CT4 A;  3FEO A;  3CME Q;  1V76 A;  3U23 A;  4FW2 A;  1SHG A;  3OYH A;  3MO8 A;  3QYH B;  1X01 A;  1VQ4 T;  4C8Q E;  2E6Z A;  4AT1 B;  2KRS A;  3R6N A;  4V2S A;  1VOM A;  3UAT A;  3EAE A;  2DZC A;  3HL8 A;  1OX8 A;  3OYB A;  1OQK A;  4UC4 A;  4C8Q G;  4DBF A;  2RD1 A;  5A0D A;  4C0D B;  4A4F A;  2X3X D;  3L2R A;  2EQJ A;  1SKU B;  2H3E B;  3REB B;  1OYX A;  4M7A B;  2QAZ A;  2KT1 A;  4XK8 E;  3A5Z B;  4C5H A;  4OB2 B;  4O6J A;  2BZ8 A;  3RER A;  5GJV B;  3CPF A;  3KXT A;  2VC8 A;  3CMA A;  3G71 T;  4J6Y A;  2MMP A;  1LVK A;  3UWN A;  4E2F B;  1JJ2 A;  1H3H A;  2CT3 A;  1MNE A;  5GMK j;  1SHF A;  4CI0 C;  2HBP A;  5AYF A;  1UEB A;  4OML A;  4PJO D;  4FL6 A;  3L2U A;  5KE3 A;  1MMG A;  3R6O A;  3CCQ T;  1LPL A;  2NUT B;  3BE3 A;  1WYX A;  3OBW A;  3O5Z A;  5C0M A;  3CD6 T;  2D1X A;  1YP5 A;  2DRM A;  2KEA A;  4PJM A;  1CSK A;  2YLC A;  3OMC A;  4OMO A;  4XQ3 A;  4F17 A;  2DJZ A;  1ZA2 B;  2XU8 A;  2YUO A;  3RMS A;  5KYW A;  5LJ5 e;  3CC7 T;  2PU9 B;  3M56 A;  2DXC A;  1UUE A;  3I55 A;  3OSS C;  2EBP A;  2DLP A;  3GBQ A;  5CKD A;  4OP0 A;  2NLU A;  3LYI A;  3QWX X;  2DXU A;  3M4Y A;  5I22 A;  5C6S A;  1QVP A;  2LP5 A;  1Y96 A;  4PJO B;  5CK9 A;  4C8Q A;  2PVD B;  3VS3 A;  5GAO p;  3JRZ A;  4R56 A;  1WLP B;  4XU0 A;  2YHT A;  1UHC A;  2RHX A;  1GL5 A;  1D0Z A;  4BI3 A;  1G2B A;  2JS0 A;  2X4Y A;  3TVT A;  1I5L A;  1BCM A;  2DJQ A;  1I0C A;  3CBM A;  1RAG B;  1UGS B;  2HKQ B;  1K9M C;  2LT4 A;  3UA6 A;  1LCK A;  2Y90 A;  2VXE A;  3I56 A;  2P0Q A;  2DXT A;  1MMN A;  2NUZ A;  3D7S B;  3RKX A;  3G4S A;  2QQR A;  5IHK A;  4C92 B;  2DIG A;  3OSV A;  1VQ6 T;  3A1P A;  2GBQ A;  1NBE B;  5IT9 E;  1I4K 1;  2NUP A;  1BB9 A;  1M1G A;  3MP6 A;  4IIO A;  1W2B A;  4PNO A;  1X43 A;  4XAX B;  1IO6 A;  5FU6 C;  2NUT A;  2BUD A;  3OS0 A;  2KQW A;  5FRN A;  2NWM A;  5FU7 B;  2ZAE A;  2MWO A;  1VQL Q;  3HFO A;  1YNZ A;  2ZPG B;  2YUP A;  4FCY A;  4M77 D;  2KYB A;  1RAH B;  4ZNX A;  3VV0 A;  4EMK B;  2DNU A;  2QTV A;  2COW A;  3OBY A;  3OW2 S;  3EGD A;  3PVL A;  1BBZ A;  2XDD A;  2OTJ Q;  2DL3 A;  3H9N A;  3CC4 Q;  1D3B A;  3A8M B;  1JXO A;  3FDR A;  4HVV A;  1ARK A;  1LJO A;  3UF4 A;  5LJ3 f;  1AWJ A;  2FPE A;  3O8V A;  1U5S A;  2O31 A;  4CRI A;  1JJ2 S;  1KD1 C;  4IKF A;  3WVD B;  2EIF A;  1TUD A;  2ZGW A;  2FYK A;  2DIL A;  1RAB B;  4ELY C;  3LX7 A;  3ME9 A;  5LJ3 d;  1Q82 C;  4J7F A;  1BI3 A;  1FXX A;  1J3T A;  4C8Q C;  3SEM A;  3JCM d;  2ROL A;  3A98 A;  5I2M A;  1FMW A;  4J9E A;  1NPR A;  4M75 G;  4C0F A;  1QLY A;  5GAM h;  2AKL A;  3L2V A;  4LDU A;  3TQ7 P;  2LDM A;  1MV3 A;  4M78 F;  1SEM A;  1OI1 A;  4EPC A;  1Q82 R;  3PNW C;  2DKG A;  1QP3 A;  1K9M U;  2AK5 A;  3TSW A;  4OGC A;  2BE7 D;  2YRV A;  4Y91 A;  2FPD A;  4JS4 A;  1VQ7 Q;  2M0Y A;  3I9Q A;  1VQO Q;  2E12 A;  3X25 B;  1C1A A;  1Y71 A;  2LCL A;  3G1J A;  2E6N A;  3HPW A;  1WNL A;  4ZGE B;  1QVG S;  3MKD A;  4EMK A;  1BYM A;  2E64 A;  1QVF S;  2DET A;  1Q86 C;  3UDC A;  1TUC A;  2DTI A;  2JM8 A;  1AOJ A;  4BUG A;  1VQ8 Q;  3H0I A;  2JJ9 A;  2RI3 A;  3QHS A;  1MMD A;  2P84 A;  1SRL A;  2YSQ A;  5I11 A;  2ZPB B;  4GBQ A;  5GAN 4;  2ZPH B;  4JPB W;  2QTX A;  1M30 A;  2GQV A;  2VVK A;  1WJS A;  3C4S A;  4MDW A;  2GGR A;  4NL3 A;  1UJY A;  1Y07 A;  1I5O B;  3QXE B;  1ZUY A;  1KQS A;  4NOY A;  2QEX Q;  2NUP B;  3OS5 A;  3CCU A;  1K73 C;  2F2W A;  2OTJ T;  4F7U G;  1JBM A;  4PK4 A;  3PFS A;  3V7C A;  1G83 A;  2PVG B;  4Z89 A;  1NYG A;  4ELZ C;  2VV5 A;  4RTZ A;  2JVV A;  3JCM Q;  4JUV A;  4X1V A;  3QII A;  1IGU A;  3PT9 A;  4QKU A;  1YJW T;  4CC3 A;  3KFV A;  2RMO A;  2QYZ A;  5HKC A;  2EJG A;  2Y4X A;  2RQV A;  1K0S A;  2QQB A;  4VUB A;  4E7L A;  5GAN e;  5DLO A;  5CKH A;  3H0H A;  1KC8 R;  1V1C A;  2LQW A;  3EGD B;  5CCA A;  2RPN A;  4ZGJ B;  3QKJ A;  1QVF P;  4PFP A;  3CCJ Q;  4M4Z A;  4QVZ A;  4BI4 A;  1YHQ T;  1QVG P;  2GF7 A;  3JB9 J;  2EQM A;  1KHI A;  2DM1 A;  3G4S T;  1OX9 A;  2QA4 T;  4IUR A;  2K5F A;  1OU8 A;  2D8J A;  2KI7 A;  2EYY A;  4M7D F;  2M0O A;  5IXF A;  1KK7 A;  3AHU A;  2E4H A;  3GIB A;  1RL2 A;  2CP6 A;  2K9G A;  2LJ3 A;  4L6V 5;  1EFN A;  5DY9 A;  1YI2 Q;  3RKW A;  1VA7 A;  5GMK i;  2C06 A;  2ZPI B;  3OS1 A;  1YBY A;  2NYS A;  2AKK A;  4XTV A;  2HEQ A;  1YWO A;  3E9F A;  4M77 C;  5HK0 A;  1VQ6 Q;  4ME7 A;  1FYN A;  1HK9 A;  3QJY A;  1QKW A;  4C0D C;  1GRI A;  3HRT A;  2JXB A;  4M78 D;  2EYQ A;  1YHQ A;  1XJW B;  5FLX E;  1IB8 A;  3FB9 A;  4M78 E;  2ZPF B;  2DRK A;  3QUI A;  2J6K A;  4E7S A;  3V8L A;  2VGN A;  4FT4 A;  2MOX A;  5GAN 8;  4JRK A;  1B7T A;  1WJQ A;  2AZV A;  5L23 A;  2LRQ A;  1M1K R;  1Q86 R;  2FG0 A;  1K73 U;  2LVM A;  4C92 E;  1YJ9 Q;  3X24 B;  2E5Q A;  4M7D C;  3VS4 A;  1GCQ A;  5D6X A;  3H6Z A;  1SSF A;  4M7A A;  1NLP C;  3HP9 A;  5GAN f;  3LH0 A;  1KQS S;  2RQT A;  1S72 Q;  5HY6 A;  3LGF A;  1WXT A;  1M1F A;  5FU6 B;  1CKA A;  1VQ4 A;  2E10 A;  4A4H A;  5LJ5 f;  1VYT A;  1BI1 A;  1NLO C;  3RKY A;  5KCO A;  1JU5 C;  1N6A A;  1YCS B;  4Z88 A;  4OMP A;  2DX1 A;  2ESW A;  3VRY A;  1ABO A;  4RTY A;  2OAU A;  2RJF A;  1A0N B;  4J9I A;  4PJJ A;  5D6Y A;  2DBM A;  4E6R A;  4P5N A;  3EGX B;  1UHF A;  1PRL C;  1SSH A;  3QBY A;  4Z02 A;  5KYU B;  4N0A A;  1P92 A;  3PGG A;  5KCH A;  2EWN A;  3PMI A;  4JRI A;  1X27 A;  2FRW A;  4C92 A;  1M2V B;  1ZSZ A;  1YIT A;  2HCK A;  1M3C A;  4CC7 A;  2QA4 A;  1KG1 A;  2RI2 A;  1VQ9 A;  4D8K A;  2RQU A;  3LW5 E;  5FWC A;  2AZS A;  2QG9 B;  2XIC A;  1ZX6 A;  3I5S A;  1H64 1;  1RLP C;  2LJ1 A;  4HVU A;  1JQQ A;  4E47 A;  2BZY A;  2KR3 A;  4M78 C;  2DO3 A;  4OGE A;  2C0I A;  4J7I A;  3EG9 A;  2DXB A;  3CME A;  2R58 A;  1BU1 A;  4GLK A;  2V8I A;  1QW1 A;  1T3S A;  4EMH A;  1KC8 C;  4BE2 A;  2CRE A;  1MHN A;  2AHJ B;  1BIB A;  1U06 A;  4OMF B;  3S6W A;  2OTJ A;  2CH4 A;  2F69 A;  4M75 B;  3DB4 A;  5CQY A;  3JCM b;  4M7D B;  3PIP A;  3GF5 A;  4M75 D;  2KK4 A;  2XDB A;  3PVQ A;  1H3Z A;  3L2Q A;  4PL6 A;  2P0P A;  1FMK A;  3I35 A;  3OS2 A;  2DL5 A;  4WF2 A;  3MEW A;  1PKT A;  2KRM A;  3GPL A;  3M0Q A;  4XU3 A;  1N9R A;  2XD0 A;  1VQ7 A;  1VQO A;  1NEG A;  4XTX A;  3REA B;  3J7A F;  3EH2 A;  2COZ A;  4LDY A;  1YI2 A;  2XKO C;  2VGM A;  2K3Y A;  2XMF A;  3CC2 Q;  4OB3 B;  1MMA A;  1ZSG A;  1Q81 U;  1VQ6 A;  4OMQ A;  2DVE A;  4LUE A;  2HBW A;  3SWN B;  3PMT A;  1KQS P;  4A4K A;  3CCS Q;  5HCK A;  5GAN 5;  2JOY A;  4M7D E;  2RJE A;  1AZE A;  3VRZ A;  2YLB A;  3QPH A;  3CC2 A;  3CBP A;  1VQ5 Q;  2E70 A;  4C8Q D;  3CXC S;  5CIU A;  1MND A;  3S3N A;  3RMQ A;  2RHY A;  1ZBX A;  4RTX A;  5GAM f;  4NS5 A;  2O01 E;  3TCJ A;  2XID A;  2BE9 B;  2VYT A;  3JV3 A;  2HDA A;  2L3S A;  4Q5W A;  5GAN j;  2KE9 A;  4M77 E;  1OZ3 A;  1WXU A;  3TRE A;  1NYF A;  3M9Q A;  2O9V A;  1HYO A;  4DQ2 A;  4XTU A;  3M58 A;  3C95 A;  4J6X A;  5FW9 A;  8AT1 B;  4OMM A;  1AVZ C;  3ZBD A;  4PLL A;  1QCN A;  1WHL A;  2ED0 A;  4KUI A;  1VYU A;  2LX9 A;  2YWW A;  2JMA A;  3RR6 A;  2FRY A;  2XI9 A;  1RAD B;  5CVI A;  4M78 G;  2QEX T;  1GXI E;  1UGP B;  1ZLM A;  1IGQ A;  5GMK e;  3QWY A;  2LNH B;  2O4X A;  1M2V A;  1ZSZ B;  2QI2 A;  2H8H A;  1JO8 A;  4J8O A;  2QDY B;  1WFW A;  2RF0 A;  4B6M A;  2EJ9 A;  2JN0 A;  3FJ5 A;  1UB4 A;  4KGX B;  1ABQ A;  1ZQ1 A;  2RQR A;  2VB6 A;  2QAS A;  1K9M R;  1KD1 U;  3OYJ A;  3MCA B;  3QG1 A;  2COY A;  4J9F A;  2EW3 A;  3TSZ A;  2GTJ A;  4JJB A;  1GFC A;  1XNI A;  2F5T X;  2JUF A;  2PZ1 A;  2RK2 A;  2O88 A;  1WHK A;  4J5Y A;  1G3Y A;  4LDX A;  2RM4 A;  4JZ4 A;  1WXB A;  2YDL A;  3VU3 C;  2PQW A;  5FRM A;  2L2P A;  1JRI A;  2KT8 A;  1PNJ A;  3OQ5 A;  1Q82 U;  3CPW A;  3UA7 A;  2M1H A;  1WI7 A;  4J9C A;  4J9G A;  3OYD A;  5LJ5 g;  3M0P A;  4FW1 A;  1K73 R;  4LD6 A;  3MP8 A;  4JJN K;  1VQK T;  3ZL7 C;  4FSX A;  3EG2 A;  3JB9 H;  2EGE A;  1IHV A;  2JM9 A;  2B8A A;  2RNA A;  4J9H A;  1KFZ A;  1GBQ A;  1OUL A;  1K76 A;  3EH1 A;  4F7U B;  3S3O A;  1VQN T;  4A4E A;  4HXJ A;  3JCM g;  1D1A A;  4LN2 A;  3G6E T;  1ACM B;  1OEB A;  3OB9 A;  1KQ2 A;  1M3B A;  4LDW A;  3CXC P;  1YIT T;  2PNI A;  1V29 B;  3E19 A;  4KGZ B;  2JW4 A;  1KC8 U;  1TUG B;  3HKS A;  1WHH A;  3M5A A;  4M75 C;  4WCI A;  2ATC B;  4KUL A;  1WX6 A;  3BFM A;  1E6G A;  1M1K C;  1M2O A;  2V1Q A;  3HRU A;  3CCM T;  5HK3 A;  4F16 A;  2G3R A;  5A0L A;  4DOW A;  2RI5 A;  1QWE A;  1S72 T;  4ANJ A;  3BW1 A;  4EDU A;  4PLI A;  4OB1 B;  1Y0M A;  5DLQ E;  3JB9 I;  4ZGD B;  1JEG A;  3H0F A;  4AG2 C;  4DBH A;  2QDL A;  1B34 B;  1Q95 G;  2SRC A;  3JCM J;  4JZ3 A;  1AEY A;  2MWP A;  1IZ6 A;  3FLG A;  1VQO T;  2QGF B;  1M5Q 1;  5LJ3 e;  1UFF A;  4F7U E;  2A08 A;  1I8F A;  4M7A C;  3M53 A;  4ORZ A;  1AWX A;  3X20 B;  3G6E A;  4JLI A;  3CME T;  5KYX A;  2O4X B;  1YJN Q;  2LTO A;  2AIR B;  4MZP A;  1OZ2 A;  3VYH B;  4AFU C;  3TEE A;  3I55 T;  1BI2 A;  2ED1 A;  2X4X A;  1KHC A;  3RBB B;  4XTW A;  2ABL A;  1AD5 A;  1D1B A;  2HD0 A;  3PTA A;  2FZG B;  2M16 A;  4XTZ A;  2FHD A;  1W6X A;  2KRO A;  2DTH A;  3CMA T;  4PJO G;  2DZ9 A;  4FT2 A;  4Y28 E;  2QK0 A;  3LLR A;  2HAX A;  1BIA A;  3EG0 A;  2VUB A;  2FO0 A;  3JCM h;  2WSC E;  3OW2 P;  1VQ8 A;  3M59 A;  1BK2 A;  2KMT A;  1GCP A;  1TS9 A;  1X6G A;  2QQA A;  2O2O A;  1UGR B;  1Z9Q A;  3ER0 A;  4B9W A;  3LH5 A;  4C92 F;  1HXD A;  4RCC A;  5LJ3 j;  2DMO A;  4ATO A;  3OYA A;  1PSF A;  5IHI A;  8ATC B;  2JNG A;  4M77 G;  1ZSZ C;  1UDL A;  4F14 A;  2IPO B;  2EKH A;  4E7H A;  4C0G A;  2E65 A;  4NL2 A;  4F7U A;  3NTI A;  1W2B P;  3WVE B;  4OB0 B;  2K3X A;  3WXM B;  3HTR A;  1OPK A;  4X34 A;  5GMK h;  2HQH A;  2B86 A;  2K5I A;  2ROT A;  5LJ5 j;  2A37 A;  4PJO E;  4MZT A;  2V26 A;  4N4G A;  2CZ7 B;  1VIE A;  3VS0 A;  3JCM f;  4RG8 A;  4M7A E;  1RI0 A;  1VQ8 T;  2KYM A;  2LNV A;  2DYI A;  4M7A D;  5KYY B;  4M7D G;  1X2K A;  4LDV A;  2K2M A;  3EG3 A;  3L42 A;  2DEU A;  2CSI A;  3A8L B;  4C92 C;  4PJO F;  1O75 A;  4J9B A;  4N4I A;  2P4R A;  4JS5 A;  9ATC B;  4HA8 A;  4N0A C;  3H8Z A;  1U3O A;  1VQP A;  3I55 Q;  3H41 A;  1E7O A;  1YIJ Q;  5CKF A;  2M9U A;  5GAO m;  2OAW A;  2EYX A;  4L5G A;  7AT1 B;  3CCS A;  3JCM X;  1YJN T;  2FZC B;  1OPL A;  3DLM A;  2L3P A;  1IHW A;  4C5G A;  2E3I A;  5A0G A;  4F7U F;  2RK1 A;  1NE8 A;  3SDZ A;  5KYU A;  1G5V A;  3A8H B;  3JB9 F;  4KH0 B;  4AMC A;  3EGU A;  5CR2 A;  4EMK C;  3SFM A;  1YHQ Q;  2EYW A;  1Y7X A;  5KYX B;  2E41 A;  3OYI A;  2A0F B;  2OTL A;  2J05 A;  5EC7 A;  3G71 Q;  1MUZ A;  5CAI A;  2MAM A;  4FIB A;  4D8D A;  1KD1 R;  2E1H A;  2QGG A;  1JB0 E;  2F1L A;  4PJO C;  1N8R R;  4A4G A;  1YIJ T;  1M3A A;  4HCB A;  1B34 A;  2GCX A;  3QZ5 B;  1VQK Q;  1YJ9 A;  1D1C A;  3P8B B;  4C0Z A;  2XK0 A;  3MEV A;  1M90 C;  1TWB A;  1YJN A;  1O9S A;  2LQK A;  5GAN 3;  1VQM Q;  5LL6 S;  4Y92 A;  2HNI A;  5J26 A;  3CCE Q;  3DLL A;  2L8D A;  1ZUK A;  4DEY A;  1FX7 A;  2PTK A;  1Q7Y R;  2K4Y A;  2YRD A;  2D9T A;  2EQK A;  5GJW B;  1RAI B;  3CQT A;  1TXQ A;  2EPD A;  1WHG A;  4OF1 A;  2JTE A;  2CYZ B;  4AFQ C;  2YRC A;  4BD3 A;  1X6B A;  1VQM A;  4IUT A;  1IXD A;  1NM7 A;  1ZHI A;  2YXY A;  2GTO A;  2X9H A;  4OMN A;  1DJ7 B;  2A7Y A;  1QVF A;  4LNP A;  5CQX A;  2KXC A;  2K3B A;  2DIQ A;  4ESR A;  5GAO l;  2CUB A;  2JTF A;  1H92 A;  2LX7 A;  2QQ9 A;  4C5E A;  2XHC A;  2CDT A;  1VQ9 Q;  2HZY A;  4HT9 A;  5CO7 A;  4LUD A;  1VQP T;  3OYN A;  2VAS A;  4BE0 A;  2LZ6 B;  3E9G A;  3JCM c;  2XDP A;  2M02 A;  2EGA A;  3CD6 Q;  1VYV A;  4GLM A;  1M8M A;  1ZA1 B;  3ZFJ A;  4X9D A;  4M7A F;  3TU4 K;  5KYY A;  2D8H A;  2W10 A;  1VQL A;  3CCE T;  2FVU A;  3PE0 A;  2J6O A;  3J80 E;  3M55 A;  2FZK B;  4M75 A;  1YFN A;  2MPX C;  4M7D A;  1VQ5 T;  3VS6 A;  1UJ0 A;  2CS7 A;  3DKM A;  3CD6 A;  1YJW Q;  3CEY A;  4KRT A;  5GAN h;  2CP2 A;  2DBK A;  3CC4 A;  1NPP A;  3DB3 A;  1VQM T;  2AT1 B;  1PRM C;  3NMZ C;  4WTO B;  1K8A C;  1N27 A;  5LJ5 h;  4HCK A;  1NG2 A;  2L0A A;  3CCL A;  5FRO A;  1XTD A;  3CMA Q;  1RAA B;  3VJP A;  5J3B A;  3QJ6 A;  2LCS A;  2EVR A;  1OV3 A;  2EQU A;  1F1B B;  2FEI A;  3CPW S;  2K57 A;  2KBT A;  4YTL A;  3MHX A;  3QO3 A;  2HMA A;  1U8R A;  3FIF A;  4A53 A;  4F04 B;  1QQJ A;  1VQL T;  1VQ4 Q;  3OMG A;  4C5I A;  4PFZ A;  4BB7 A;  1NJI U;  4X9C A;  5IH2 A;  5IHN A;  3MEA A;  1VQP Q;  2LMJ A;  4FSS A;  1RI9 A;  1M90 U;  1VQ5 A;  1RAF B;  2E3H A;  4FYX B;  5ECA A;  1TTH B;  1IRX A;  2F5K A;  5D7U A;  4BDY A;  2VKN A;  4MMK A;  3A8G B;  2OJ2 A;  1HSQ A;  1X2Q A;  2JMC A;  4QT7 A;  2I0N A;  2RJD A;  5AT1 B;  2WAC A;  5DM7 R;  4LXC A;  4FU6 A;  1AT1 B;  1YIT Q;  3CCL T;  2FB7 A;  1KJW A;  2PUO B;  1W2B S;  1JJ2 P;  2KVQ G;  1YCY A;  2EGC A;  1VQ9 T;  3LWI A;  1NJI C;  1T3L A;  1K4U S;  1D3B B;  3VS1 A;  2V8K A;  4BY6 C;  2VWF A;  4KH1 B;  4M77 B;  3BDU A;  5GAO n;  1WZO A;  4HKE A;  2L3R A;  4BAC A;  2X35 A;  4QW2 A;  4E7J A;  1WJR A;  5D6W A;  3V8K A;  1UGQ B;  4KBM B;  4EMG A;  1MGQ A;  4ZTF A;  2KSS A;  3I56 Q;  4RTV A;  2K79 A;  4II1 A;  5CKE A;  2DF6 A;  4IUQ A;  1WA7 A;  3NPF A;  3EHR A;  2DL8 A;  3CC4 T;  3CC7 A;  3VYG A;  4LD9 K;  2OTL T;  2RA2 A;  1BKB A;  2DEQ A;  1M90 R;  1N9S A;  1G8X A;  2GFU A;  2LCC A;  1M8V A;  4MZM A;  1VUB A;  4HCC A;  3CCM A;  1HD3 A;  2A3L A;  4QQG A;  5GAO r;  3HRS A;  1I81 A;  3NTH A;  3CC7 Q;  5LJ3 h;  2CP0 A;  5KH6 A;  1C0M A;  5A2Q E;  3NGP A;  2CSQ A;  4IUV A;  5I2S A;  1X69 A;  5LJ3 g;  4N4H A;  4JDS A;  2RHI A;  4AFZ C;  4E7Z A;  3QYG B;  3CCM Q;  3OY9 A;  3VUZ A;  2JZ2 A;  1UTI A;  2D0Q B;  3QSU A;  4Z8A A;  1UG1 A;  1B07 A;  4DBR A;  1SPK A;  5GAM e;  3I56 T;  1VQ7 T;  5EG2 A;  4M75 E;  1WQW A;  2OI3 A;  2YT6 A;  2BIV A;  2QQS A;  3CCR A;  2A28 A;  3THK A;  2KGT A;  1TOV A;  3EHQ A;  4DOV A;  2RHZ A;  4DEX A;  2EKO A;  3EG9 B;  1ZUU A;  2KY9 A;  4HCZ A;  3CCU T;  3CCV Q;  5M9O A;  4BI8 B;  3MEU A;  1M9S A;  1AWO A;  5FWB A;  5IN1 A;  3G7Z A;  1PM3 A;  3EFS A;  4KGV B;  3E1S A;  2LQN A;  3VS7 A;  3OYF A;  2DA9 A;  2JT4 A;  2D0N A;  1QP2 A;  4M78 B;  4RCB A;  2J7I A;  2RN8 A;  2A36 A;  3CCL Q;  3EG1 A;  4PJN A;  4JRQ A;  2BKD N;  1K0X A;  2CZ6 B;  3UPU A;  4C92 D;  1PD0 A;  3JAM E;  1H8K A;  1LNX A;  2R57 A;  5GAN 7;  2MCN A;  2CP5 A;  3KBG A;  4HT8 A;  1PHT A;  3V7R A;  3PIO A;  2YUN A;  2I2L A;  3GP8 A;  4QVD A;  1R8O B;  2DVJ A;  1NEB A;  1KSW A;  2OX7 A;  1PC0 A;  1S1N A;  2EQI A;  2OTL Q;  2PVO B;  2X3W D;  4M77 F;  2JTM A;  2XG8 D;  2K5L A;  3M57 A;  3G71 A;  4RTW A;  3SB2 A;  2ENM A;  4PJO A;  3CC2 T;  3JCM P;  3BY7 A;  1PCX A;  2DTO A;  2DL4 A;  1VQN Q;  5J39 A;  1R0C B;  2EFI A;  3V7S A;  3VUB A;  2DE0 X;  1VQK A;  4KT0 E;  3OYY A;  1SF9 A;  2PUK B;  1YN8 A;  2H3J A;  2KRN A;  2GQI A;  2P4T A;  4C8Q B;  1AWW A;  2J06 A;  2C0O A;  5KYW B;  5GAM g;  3VS2 A;  1K9A A;  2KAF A;  3CCQ A;  2DK3 A;  1R77 A;  2KDS A;  1K8A U;  1VQN A;  1D0Y A;  3VKI A;  2HSP A;  3OYL A;  1AHJ B;  4MML A;  1E6H A;  2KXD A;  5GMK l;  2V1R A;  4RKU E;  4IIM A;  4IUP A;  1RUW A;  2QEX A;  2QA4 Q;  1M1K U;  1UGV A;  4GY5 A;  1YJ9 T;  3L2W A;  5GAN d;  3JB9 G;  1OOT A;  3GNG A;  2CGH A;  3OA6 A;  3AT1 B;  3I5R A;  2DER A;  1YJW A;  3M54 A;  5IXB A;  3CCS T;  3OYC A;  2CKK A;  1QKX A;  3M0S A;  3NTK A;  2EJF A;  2C0T A;  3MET A;  1W4S A;  2IVW A;  3OW2 A;  1Y57 A;  3RIR A;  2O9S A;  1T0H A;  2G6F X;  2K7A A;  2YUQ A;  3JB9 D;  1TH7 A;  1EX4 A;  2L5Q A;  1K1Z A;  4IUU A;  2BZX A;  2MYS A;  3M4G A;  1QWF A;  3EFO B;  2SEM A;  3MP1 A;  4QQD A;  1XOV A;  2EYZ A;  1TSF A;  2DD5 A;  2IG0 A;  2X4W A;  2CP7 A;  1WGS A;  1NJI R;  1K8A R;  2MF2 A;  1PSE A;  4M77 A;  3SWN C;  5GAM j;  1D09 B;  2X51 A;  4KUD K;  4M7A G;  3C12 A;  4FYV B;  1LOJ A;  3SD4 A;  4AFS C;  4BY6 B;  3QDR B;  4RG2 A;  1MV0 B;  1TG0 A;  3RNJ A;  4D6W A;  1WHM A;  2F2X A;  4A54 A;  1C6V X;  4J6W A;  2DYB A;  1I1J A;  2ECZ A;  3CXC A;  5GMK m;  1Q86 U;  3SHW A;  3FC3 A;  4C92 G;  3A8O B;  1UEC A;  3JCM W;  2DFU A;  2W0Z A;  1SRM A;  3OYE A;  4RTU A;  3HHT B;  3J81 E;  1WIE A;  2MIO A;  3C0C A;  4FYW B;  4PKC C;  1WDX A;  3M0R A;  1RAC B;  3ASK A;  1X75 C;  3JCM V;  4TVR A;  1U1T A;  2HL5 C;  2HQX A;  5L8R E;  5I21 A;  1S72 A;  1BI0 A;  3F70 A;  2BTT A;  4JRP A;  3ULR B;  1T0J A;  5GAO q;  2DAQ A;  5FU7 C;  4B9X A;  3OYK A;  4JJD A;  1GBR A;  1GFD A;  1YI2 T;  2RQW A;  3CCU Q;  3CCV T;  1TU0 B;  1WPY A;  2LC4 A;  4AG1 C;  4L59 A;  3EFO A;  5GAN 6;  2FL7 A;  2WSF E;  4EIK A;  4K11 A;  5GAM d;  3SWN A;  1EZZ B;  5LJ5 d;  1RLQ C;  3RES A;  3GLX A;  2DD4 A;  1QVG A;  2X4J A;  1QCO A;  1PG5 B;  5KE2 A;  4R0K A;  2R5M A;  5KYN A;  4J9D A;  4R55 A;  1YWP A;  1N8R U;  4E7K A;  1CKB A;  2MK5 A;  6AT1 B;  2E5K A;  1Q81 C;  4XU1 A;  1G3W A;  2KNB B;  1N5Z A;  2K6D A;  3N5B B;  2WSE E;  4ZN3 A;  3Q1J A;  3V8J A;  1M27 C;  3GNF B;  1GCQ C;  3CCR Q;  1KIK A;  4BDZ A;  2RB6 A;  1G3S A;  3CCJ A;  2JS2 A;  2CZ1 B;  3MPU B;  3G4S Q;  4CC2 A;  3MJX A;  2HQE A; 
#chains in the Genus database with same CATH homology
 1B3Q A;  2CH4 W;  3M0T A;  1WI7 A;  2OJ2 A;  1HSQ A;  4J9C A;  4J9G A;  1X2Q A;  2JMC A;  4QT7 A;  2I0N A;  2CUD A;  2F2V A;  4CC4 B;  3M0P A;  1JXM A;  1TUC A;  2JM8 A;  1AOJ A;  1Z9Z A;  1QCF A;  3H0I A;  2M51 A;  1KJW A;  3ZL7 C;  1SRL A;  2YSQ A;  3EG2 A;  1I07 A;  5I11 A;  1W1F A;  4GBQ A;  2EGE A;  4A63 B;  4JPB W;  1M30 A;  2JM9 A;  2VVK A;  2EGC A;  4HVW A;  2RNA A;  1W70 A;  4J9H A;  1KFZ A;  1GBQ A;  1T3L A;  2GGR A;  1PKS A;  1UJY A;  1K76 A;  1ZUY A;  1K4U S;  3VS1 A;  2VWF A;  4HXJ A;  4LN2 A;  2F2W A;  1OEB A;  1M3B A;  1G83 A;  2PNI A;  2J6F A;  4Z89 A;  1NYG A;  2IIM A;  2JW4 A;  4RTZ A;  1ZBJ A;  4X1V A;  4RTV A;  2K79 A;  4WCI A;  1WX6 A;  2LJ0 A;  4CC3 A;  2DF6 A;  1E6G A;  3KFV A;  1WA7 A;  3NPF A;  2RMO A;  2DL8 A;  2V1Q A;  3EHR A;  4RUG A;  2RQV A;  1K0S A;  2L3Q A;  4F16 A;  3H0H A;  1V1C A;  1QWE A;  2LQW A;  1Y0M A;  1JEG A;  2RPN A;  3H0F A;  3VS5 A;  4AG2 C;  1HD3 A;  2QDL A;  2SRC A;  4JZ3 A;  3NHN A;  4M4Z A;  1AEY A;  1PWT A;  4RTT A;  3NGP A;  1UE9 A;  2CSQ A;  2DM1 A;  1UFF A;  2A08 A;  1X69 A;  4JJC A;  1AZG B;  4ORZ A;  1AWX A;  2D8J A;  2EYY A;  4AFZ C;  5IXF A;  4LE9 A;  1UTI A;  2K9G A;  2LJ3 A;  1HJD A;  4Z8A A;  1EFN A;  1UG1 A;  4AFU C;  1B07 A;  2ED1 A;  3IQL A;  1SPK A;  3RBB B;  1VA7 A;  2ABL A;  1AD5 A;  2FPF A;  1W6X A;  2OI3 A;  2YT6 A;  2A28 A;  2KRO A;  3THK A;  2AKK A;  2KGT A;  2HEQ A;  1YWO A;  3EHQ A;  1FYN A;  4DEX A;  1QKW A;  1GRI A;  1ZUU A;  2JXB A;  2DL7 A;  3EG0 A;  2DRK A;  2FO0 A;  1AWO A;  2J6K A;  5FWB A;  1BK2 A;  1GCP A;  3VS7 A;  2GNC A;  2LQN A;  2MOX A;  2DA9 A;  3M0U A;  2JT4 A;  2D0N A;  1X6G A;  2O2O A;  2CT4 A;  1Z9Q A;  2J7I A;  2AZV A;  5L23 A;  2RN8 A;  2A36 A;  3LH5 A;  3U23 A;  2DMO A;  1SHG A;  2FG0 A;  3EG1 A;  5IHI A;  1K0X A;  3VS4 A;  1GCQ A;  1H8K A;  2KRS A;  3R6N A;  1UDL A;  4F14 A;  2EKH A;  3UAT A;  1NLP C;  2MCN A;  2RQT A;  1PHT A;  1WXT A;  2YUN A;  1CKA A;  2X3X D;  3REB B;  2DVJ A;  1NEB A;  1KSW A;  1OPK A;  1VYT A;  1S1N A;  2EQI A;  1NLO C;  2B86 A;  2KT1 A;  2ROT A;  2A37 A;  2X3W D;  1JU5 C;  4OMP A;  1YCS B;  4Z88 A;  2DX1 A;  2ESW A;  3VS0 A;  3VRY A;  4RTW A;  2ENM A;  2BZ8 A;  1ABO A;  4RTY A;  2KYM A;  5GJV B;  4J9I A;  1A0N B;  2DBM A;  4E6R A;  2DL4 A;  1UHF A;  1PRL C;  1SSH A;  2DE0 X;  1X2K A;  1X27 A;  2K2M A;  1H3H A;  2FRW A;  2CT3 A;  1YN8 A;  1SHF A;  3EG3 A;  2KRN A;  2GQI A;  1AWW A;  2J06 A;  2HCK A;  1M3C A;  4CC7 A;  2C0O A;  4D8K A;  4OML A;  3VS2 A;  1K9A A;  2CSI A;  2RQU A;  5FWC A;  4J9B A;  2HSP A;  2AZS A;  2P4R A;  1E6H A;  2KXD A;  1ZX6 A;  1U3O A;  2V1R A;  3I5S A;  4IIM A;  1RLP C;  2LJ1 A;  3H41 A;  4HVU A;  1WYX A;  3O5Z A;  1E7O A;  1RUW A;  1JQQ A;  2BZY A;  2D1X A;  1YP5 A;  2DRM A;  2KR3 A;  2OAW A;  2EYX A;  1UGV A;  2KEA A;  1CSK A;  2C0I A;  4OMO A;  1OOT A;  4F17 A;  1OPL A;  2YUO A;  1BU1 A;  3I5R A;  2L3P A;  5IXB A;  1T3S A;  1UUE A;  2EBP A;  2DLP A;  3GBQ A;  1QKX A;  3M0S A;  2CRE A;  3QWX X;  2C0T A;  5I22 A;  3EGU A;  1Y57 A;  2LP5 A;  1U06 A;  2O9S A;  1T0H A;  2G6F X;  2K7A A;  2YUQ A;  2EYW A;  3VS3 A;  2CH4 A;  1WLP B;  1K1Z A;  2BZX A;  2J05 A;  5EC7 A;  1QWF A;  2SEM A;  1UHC A;  1GL5 A;  1MUZ A;  1G2B A;  2JS0 A;  3PVQ A;  3TVT A;  4D8D A;  1XOV A;  2DJQ A;  1I0C A;  1FMK A;  3I35 A;  2DL5 A;  2EYZ A;  1M3A A;  1PKT A;  2KRM A;  3M0Q A;  3UA6 A;  1LCK A;  2NUZ A;  1NEG A;  5IHK A;  3REA B;  4Y92 A;  2GBQ A;  1ZUK A;  4DEY A;  2PTK A;  2XMF A;  1BB9 A;  4IIO A;  1ZSG A;  5GJW B;  4AFS C;  3CQT A;  1MV0 B;  2EPD A;  1TG0 A;  4OMQ A;  2JTE A;  4LUE A;  2HBW A;  4AFQ C;  3RNJ A;  1X6B A;  1NM7 A;  1IO6 A;  2GTO A;  2F2X A;  5HCK A;  4OMN A;  4LNP A;  1AZE A;  3VRZ A;  2NWM A;  2KXC A;  2DYB A;  2K3B A;  4ESR A;  2CUB A;  1H92 A;  2LX7 A;  1I1J A;  1YNZ A;  2ECZ A;  2YUP A;  2CDT A;  4RTX A;  3SHW A;  2KYB A;  3JV3 A;  2HDA A;  4LUD A;  2L3S A;  4ZNX A;  1UEC A;  2LZ6 B;  2KE9 A;  2DNU A;  2W0Z A;  1SRM A;  2EGA A;  1WXU A;  4RTU A;  1VYV A;  3PVL A;  4GLM A;  1M8M A;  1BBZ A;  1NYF A;  1WIE A;  2MIO A;  2O9V A;  3C0C A;  2DL3 A;  2D8H A;  2W10 A;  1JXO A;  1WDX A;  3M0R A;  4HVV A;  1ARK A;  5FW9 A;  3UF4 A;  4OMM A;  1AWJ A;  1AVZ C;  2FPE A;  2ED0 A;  1U5S A;  1VYU A;  2O31 A;  3PE0 A;  2J6O A;  2JMA A;  2BTT A;  2FRY A;  3ULR B;  1TUD A;  3VS6 A;  1UJ0 A;  1T0J A;  1ZLM A;  3QWY A;  2LNH B;  4KRT A;  2DBK A;  2DIL A;  2H8H A;  1JO8 A;  4JJD A;  1GBR A;  1GFD A;  1WFW A;  2RF0 A;  2RQW A;  3FJ5 A;  1PRM C;  3NMZ C;  4AG1 C;  1J3T A;  3SEM A;  2ROL A;  4EIK A;  4HCK A;  3A98 A;  4K11 A;  1NG2 A;  2L0A A;  4J9E A;  1ABQ A;  2RQR A;  1RLQ C;  1QLY A;  2LCS A;  2EVR A;  1OV3 A;  2AKL A;  2FEI A;  4R0K A;  2KBT A;  4J9D A;  3UA7 A;  4J9F A;  1YWP A;  2EW3 A;  1MV3 A;  1CKB A;  1SEM A;  3TSZ A;  2GTJ A;  4JJB A;  2E5K A;  1GFC A;  2KNB B;  2PZ1 A;  1N5Z A;  2O88 A;  2K6D A;  2AK5 A;  3TSW A;  5IH2 A;  1M27 C;  5IHN A;  2FPD A;  2LMJ A;  4FSS A;  1RI9 A;  1GCQ C;  4JZ4 A;  1KIK A;  1WXB A;  2YDL A;  2M0Y A;  3I9Q A;  5ECA A;  2L2P A;  2JS2 A;  2KT8 A;  4CC2 A;  1PNJ A;  1X43 A;  2VKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...