1MUZA

Nmr structure of the tumor suppressor bin1: alternative splicing in melanoma and interaction with c-myc
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
81
Chain Sequence
GRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKKLEKCRGVFPENFTERVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myc box dependent interacting protein 1
publication title A structure-based model of the c-Myc/Bin1 protein interaction shows alternative splicing of Bin1 and c-Myc phosphorylation are key binding determinants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 12
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2002-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1muzA00
2VKNA 1GCQC 2JW4A 5EC7A 3I35A 1PNJA 2W0ZA 4LUDA 4RTUA 1M8MA 2ED0A 1RI9A 2DE0X 4HVWA 2L3PA 1TUCA 2SEMA 2EYWA 4J9FA 4JJDA 1Y57A 2KRMA 2M0YA 2VWFA 2JS2A 2BZ8A 5IXBA 2X3WD 2K7AA 2AKKA 3JV3A 4KRTA 2DF6A 3VS2A 1WLPB 1ZSGA 1ZBJA 2DL8A 1AEYA 1LCKA 3RNJA 3TVTA 1NEGA 2CDTA 1AVZC 1PRLC 1PWTA 2JMCA 3KFVA 2DBMA 3UA7A 1PRMC 2CSIA 4X1VA 2E5KA 2D8HA 3EHRA 1NEBA 1VA7A 2DL5A 2EQIA 1AWJA 4WCIA 5GJVB 3LH5A 1ZUKA 3VS3A 1X43A 3M0SA 5I11A 1ZUYA 2KXDA 3QWXX 3PVLA 1G2BA 2JS0A 1MUZA 2P4RA 1H3HA 4IIOA 1E7OA 1SRLA 3O5ZA 4RTVA 1EFNA 2YUPA 2DBKA 2F2WA 2DL4A 1UDLA 2HEQA 4F16A 5FW9A 2DILA 2K2MA 2RQRA 2JXBA 1M3CA 2DVJA 1A0NB 2L2PA 4HVUA 1UHCA 2FEIA 1X6GA 4J9HA 1QLYA 4E6RA 1VYUA 3M0PA 4Z88A 2DA9A 5GJWB 1WYXA 4OMMA 2ED1A 2GGRA 2JT4A 3I5RA 5FWCA 2RNAA 3VS5A 1K76A 1G83A 4HCKA 2EGCA 1YN8A 1QWFA 3TSWA 1PHTA 2CT3A 2FO0A 2IIMA 1OPKA 3PE0A 4HVVA 4Y92A 2ECZA 3UA6A 4Z89A 1UE9A 1WFWA 2DL7A 1JXOA 2JM8A 2GBQA 1TUDA 2DRKA 4M4ZA 5IXFA 1HD3A 2H8HA 4FSSA 4ORZA 1H92A 1SHGA 4GBQA 2CSQA 2KEAA 4OMLA 1AWXA 2DYBA 1MV3A 1JXMA 1BBZA 1KSWA 1X69A 1GRIA 4J9BA 1UGVA 1RLQC 4CC3A 1NLPC 2A28A 4HXJA 4AG2C 3UATA 1M30A 2FG0A 1T3LA 4LUEA 2EPDA 1BB9A 2EBPA 3SEMA 1X2QA 1M3AA 2ENMA 1WXBA 1V1CA 3R6NA 1JQQA 2PTKA 3H0FA 3VRZA 2J6KA 3H0IA 2G6FX 4RTWA 3EG2A 1SEMA 2SRCA 1S1NA 1U06A 4LNPA 2KYBA 2L3QA 1Y0MA 1M27C 3QWYA 4AFUC 1HSQA 2HCKA 2DX1A 2MIOA 2HDAA 3ULRB 2RN8A 1NLOC 2KR3A 1WIEA 1ZUUA 2RPNA 5HCKA 1OEBA 1CKAA 4AFSC 2OI3A 2K9GA 2CH4W 2DJQA 3NPFA 4JPBW 2RF0A 2MCNA 4Z8AA 2FPEA 1UFFA 1X6BA 1FYNA 4AG1C 1U3OA 2NWMA 1VYTA 2GNCA 3GBQA 1WA7A 1WXUA 2K6DA 2J06A 3ZL7C 4RTTA 1NYFA 3VS4A 1KIKA 1X27A 2DLPA 1ARKA 2EGAA 2ESWA 5ECAA 4ESRA 1UUEA 1GFCA 2EGEA 4AFZC 1X2KA 1HJDA 2RQUA 3M0QA 2VVKA 1T0JA 2K79A 1AZGB 4ZNXA 2LQNA 2LMJA 2J7IA 1CSKA 1QKWA 4JJBA 2AZVA 2HBWA 1QWEA 1YWOA 2K3BA 1ABOA 1GCPA 3VRYA 2KBTA 4RTYA 1K0SA 5IHNA 2KNBB 2YUQA 1YP5A 1GBRA 1YWPA 2RMOA 3EG3A 3H0HA 2JM9A 2AZSA 1JU5C 1AWOA 2NUZA 2KROA 1TG0A 1OPLA 2C0TA 1SHFA 2LZ6B 3C0CA 1VYVA 1B3QA 3TSZA 1E6GA 1IO6A 3REAB 1PKSA 1KJWA 2KYMA 2C0OA 3VS6A 2O2OA 1AOJA 3A98A 4IIMA 5IHIA 2QDLA 4JZ4A 1K0XA 1SSHA 1YNZA 2MOXA 2DL3A 3I9QA 1NG2A 3VS1A 2KT8A 2V1QA 4A63B 1WI7A 4RTZA 3SHWA 3PVQA 4J9EA 2X3XD 2CUBA 3U23A 5FWBA 3EHQA 2KRNA 3VS7A 2JTEA 2D1XA 4D8DA 2C0IA 2LJ3A 4QT7A 1RUWA 2A36A 2CH4A 1GFDA 2EW3A 2XMFA 2RQVA 1UG1A 2YSQA 3M0RA 1K1ZA 5IH2A 2KXCA 3EG1A 2EVRA 2LJ0A 2LP5A 4R0KA 3VS0A 4CC4B 2A37A 1MV0B 1I07A 2FPDA 2DNUA 1N5ZA 2YUOA 4JJCA 1YCSB 4J9IA 2F2XA 1AD5A 2BZYA 1UHFA 1SPKA 4F14A 3I5SA 1CKBA 1Z9ZA 2CREA 1NYGA 2D8JA 2GTJA 2HSPA 2L3SA 1M3BA 2CUDA 2OAWA 2BTTA 4RUGA 4CC2A 4J9CA 1QKXA 3NMZC 1UJ0A 4D8KA 1JO8A 5IHKA 2L0AA 2LQWA 2LX7A 2AKLA 1UTIA 3NGPA 3RBBB 1JEGA 1WX6A 3EG0A 1GCQA 1BK2A 5L23A 2I0NA 3FJ5A 3CQTA 3REBB 2D0NA 2ROTA 4RTXA 1SRMA 1RLPC 2FRYA 1WDXA 2FPFA 4K11A 1UECA 1W70A 2KRSA 2BZXA 5I22A 3EGUA 2KGTA 1W1FA 4J9GA 1Z9QA 4F17A 1ZX6A 2LJ1A 2OJ2A 2O9VA 3IQLA 2M51A 4EIKA 2EYYA 2J6FA 1GBQA 2YUNA 2DRMA 3NHNA 1K4US 4GLMA 1FMKA 1QCFA 1PKTA 1AWWA 1K9AA 2J05A 1ABQA 2YDLA 2W10A 3H41A 2F2VA 1XOVA 2LNHB 4JZ3A 1UJYA 1ZLMA 2O31A 3M0TA 4LN2A 2V1RA 1T0HA 3THKA 1I0CA 2GTOA 2DMOA 2RQTA 1E6HA 4OMPA 2B86A 2LCSA 4DEYA 2O88A 2EKHA 1AZEA 2GQIA 4AFQC 1W6XA 4DEXA 2AK5A 1J3TA 2ABLA 1B07A 1NM7A 2PZ1A 1OOTA 2KE9A 4OMNA 2PNIA 4OMOA 2EYZA 1H8KA 2EYXA 2ROLA 2KT1A 1OV3A 2RQWA 1BU1A 2FRWA 2J6OA 1WXTA 4LE9A 2O9SA 3M0UA 1I1JA 2JMAA 1GL5A 4OMQA 1U5SA 3UF4A 4CC7A 2A08A 4J9DA 2YT6A 2DM1A 1KFZA 1T3SA 2CT4A
chains in the Genus database with same CATH superfamily
1FX7A 1VUBA 3CCRQ 1PNJA 4RTUA 3OYEA 1M8MA 2L3PA 4M7DE 3ER0A 3I55A 2CZ1B 4IURA 2EYWA 1YHQT 2CP3A 2FZKB 4C8QB 4JJDA 4N0AC 3CD6A 1WHJA 2MK5A 2K57A 1KC8C 3HRSA 3A1PA 4NL2A 3CCVT 4PFPA 2CDTA 3TREA 1YHQA 3KFVA 4JS5A 3UA7A 2OTJT 2CSIA 2MI6A 3CCJT 2D8HA 1KQ1A 1QW1A 3M54A 2F69A 4WCIA 4EMGA 5GJVB 1ZUKA 3HRTA 5LJ5h 3QWXX 3TQ7P 2DFUA 4ELZC 1SRLA 2E3IA 2M16A 1HXDA 4JRPA 2ZPFB 2OTJA 2X4YA 3EGDA 2DBKA 3JCMd 3CCJA 3UPUA 1FXXA 4BI3A 4FYVB 4F16A 4PNOA 1IHWA 2LTOA 5CK9A 4PJMA 1M1KR 2YRCA 4M7AF 2L2PA 4HVUA 3CMEA 4BE1A 2YRVA 5A0LA 4J9HA 1QLYA 3CCET 2CZ0B 3L2UA 2OTLT 2DA9A 5GJWB 5GANe 3MEAA 5GAN2 4PJOG 2JT4A 3CCMT 1IRXA 3M58A 3VS5A 3BDLA 1K76A 1IXDA 4M78G 1PHTA 1X75C 1ZSZA 3L2RA 1KQSA 2FO0A 1K73U 2K2VA 2JNGA 4Y92A 1WPYA 1UE9A 4E7SA 1Q7YR 2XU8A 3OBWA 2IG0A 1H3ZA 4M4ZA 5IXFA 4A4GA 4BI4A 3CPWP 3JB9I 2V8IA 4ORZA 1H92A 1SHGA 1BI0A 2CP0A 3RR6A 2KEAA 1FMVA 2VGNA 4LD6A 1K9MU 3PGGA 5J3BA 3I56Q 1BBZA 8ATCB 4MDWA 3JCMg 3G71A 3X28B 4M75F 4HXJA 4AG2C 1VQ4Q 3UATA 2FG0A 2YLCA 1EIFA 4HT9A 4JUVA 3SEMA 4HCBA 2RB6A 2FZGB 3VRZA 4B9WA 3GPLA 2DZCA 4RTWA 2DIGA 1S1NA 1U06A 1D1CA 1D3BA 1Y0MA 2DXCA 3G1JA 4AFUC 5GAOp 1I4K1 3CBOA 1RACB 2HCKA 2HKQB 3OS2A 2HDAA 2HSEB 4QVDA 4ZGEB 1B34A 4HT8A 4RG2A 1R0CB 3GOXA 3LH0A 2GFAA 1ACMB 1RAHB 2CGHA 2K9GA 3NPFA 2DJQA 2A3LA 2EJFA 2MCNA 5LJ3j 5FROA 4P5NA 4AG1C 4JDSA 1U3OA 2NWMA 4J6YA 4MDXA 3QYGB 5GAMd 1WXUA 3E9GA 3CXCA 2J06A 1ZHIA 4PFOA 4RTTA 5LJ3d 4AMCA 1X27A 2DLPA 4C8QE 1ARKA 4MZPA 2ESWA 2RJDA 4OVAA 1UUEA 3V7SA 1GFCA 4EMKC 1HJDA 2RQUA 3G4ST 4XK8E 2J7IA 1CSKA 3MO8A 1OU8A 2AZVA 2CZ6B 2HBWA 2LCCA 1Q82R 3OS1A 3PT9A 1PD1A 3CPWA 4KULA 1GCPA 1VQNT 2KBTA 1G3SA 4RTYA 5IHNA 3ME9A 3JCMQ 1S72T 5FRNA 2KQWA 3BFMA 5FU6B 4M78C 4C92F 1SG5A 2QQ9A 2LDMA 1QVGA 3M5AA 5KH6A 2AZSA 2QA4Q 1JU5C 2JOYA 4AT1B 1TU0B 2C0TA 2LZ6B 5I2MA 4HCZA 4XU0A 1Q86U 1E6GA 4BUGA 3GNGA 2DTHA 2KYMA 3VS6A 2RHZA 5GAMg 2O2OA 2RJFA 3A98A 3MCAB 4IIMA 2DTOA 4C0DC 2DPPB 5KYNA 5LJ3g 2MOXA 2DL3A 1BI1A 3VS1A 3OYNA 3FJPA 1W2BS 1WI7A 3RERA 2CUBA 3U23A 3EHQA 2BKDN 3RIRA 3DKMA 5I21A 2C0IA 2LJ3A 3HSBA 1RUWA 1GFDA 3DB4A 1M90R 7AT1B 1UG1A 2X51A 5IH2A 3FRNA 2EVRA 1I81A 2LJ0A 2EQMA 4R0KA 3VS0A 3C4SA 1OX9A 2A37A 3QJ6A 2COZA 1VQ7T 4BE0A 2DNUA 3CC4T 1QP2A 1YCSB 1YIJT 4J9IA 1KK7A 3Q1JA 5CKHA 1VQ5A 4E7ZA 2CREA 2GTJA 3BW1A 5D7UA 2A0FB 1RAEB 4E7IA 4ZGJB 3OYJA 2CUDA 2L5QA 1QCOA 3FIFA 2V8KA 4BY6B 1RABB 5GANd 1VQ7A 2RI2A 1K73R 1KHCA 1JO8A 1WHGA 2LQWA 3LGFA 2PUKB 2Y90A 4JS4A 2QXFA 2I0NA 2ATCB 4CI0C 3CQTA 4M77F 3C95A 2Y4XA 4J8OA 3REBB 2D0NA 2FRYA 4J7IA 1WDXA 3E1SA 2HNIA 4N0AA 2E70A 3CC2Q 2PVDB 3ZFJA 3G6ET 3S3NA 1WZOA 3ZBDA 1K9MR 1Z9QA 3G7ZA 2LJ1A 2OJ2A 2KAFA 2M51A 3A5ZB 1YBYA 4OGCA 1VQKT 2J6FA 3P8BB 3S3MA 2LRQA 3OS0A 3DB3A 3NHNA 1FMKA 3WVEB 4MMKA 2J05A 4C5HA 2YDLA 2M1HA 4C8QA 4JZ3A 1UJYA 5GMKl 5HK3A 4FYWB 1D0YA 5GANg 3THKA 3H8ZA 2YHTA 2DMOA 3X20B 4DBFA 2QGGA 2CP7A 2LT4A 2LX9A 1V29B 1E6HA 4HKEA 4M7DB 2B86A 3V7CA 3LX7A 4M7AB 2ZPHB 2GQIA 2QTVA 5KYYB 5A0DA 2AK5A 2WSCE 3KXTA 1B07A 1NM7A 1M1GA 1OOTA 3P8HA 2BUDA 3OYDA 1RADB 2KVQG 1YJ9T 4C5GA 4JLGA 1N8RC 2YXYA 3EFSA 2FRWA 4FM4B 1I1JA 3E2UA 1GL5A 4CC7A 2B8AA 4XTWA 3JCMh 1NJIC 1I0CA 1T3SA 3OS5A 2CT4A 5CKDA 1GCQC 3I35A 4N4HA 3QKJA 2W0ZA 2ED0A 1FMWA 1TUCA 1VQ6Q 4GLKA 4L5GA 4E47A 3RDVA 2M0YA 2VWFA 4OGEA 2L8DA 2RI3A 2DEUA 3LLRA 2EIFA 4KRTA 3OW2S 2DF6A 2HQXA 3QXEB 4M75B 3CC7A 4C5IA 4PJOF 4KGVB 1K8AC 1PRLC 1PWTA 2JMCA 4M78F 1ZBXA 1JBMA 2E5KA 3EHRA 4C8QG 2HAXA 1NEBA 5FU7B 1KD1U 2MMPA 2Z0WA 1VQLQ 2EQIA 1AWJA 3C12A 2QASA 4J83A 1X6OA 3VS3A 3RMQA 3M0SA 4Z02A 1YJNQ 1MUZA 1TXQA 2P4RA 4XTYA 3RMSA 2X4WA 1E7OA 4F7UA 3O5ZA 2R57A 2EQJA 4E7HA 3S3OA 3QZ5B 1GXIE 1EFNA 2NUPB 2E1HA 4FU6A 4OF1A 3MP8A 2P84A 1G3YA 4BD3A 3LGLA 1A0NB 3BDUA 1QVPA 2FEIA 3SWNB 2Y4YA 1X6GA 1M5Q1 1N9RA 1VYUA 2K5LA 1IREB 4GY5A 1OZ3A 4OMMA 3I5RA 5FWCA 1R77A 1G83A 4RCBA 5LJ3e 4V2SA 3VUBA 1O75A 1QWFA 3TSWA 2CT3A 3CPFA 4FW1A 3AT1B 2DO3A 1OPKA 3CCUT 4HVVA 5HKCA 2MF2A 1TS9A 4Z89A 2JM8A 1WHMA 2O01E 5GAOn 5GMKi 1TUDA 3EG9B 3CCLQ 4C0ZA 4J5YA 3OYYA 1UB4A 4C92B 5GAMh 1YITA 4GBQA 2CSQA 9ATCB 1JJ2A 2ZGWA 1Q82U 1XNIA 4VUBA 1MV3A 3LW5E 2QG9B 1UGVA 2HZYA 1RLQC 4R56A 2MAMA 3EGXA 4IKFA 3CCQT 2A28A 4LUEA 3HFNA 2EPDA 1BB9A 2EQUA 2RHUA 3FB9A 2DKGA 3JCMX 1EX4A 4M7AE 3EFOB 2J6KA 4IUTA 3CMAA 3UT1A 4F7UG 1SSFA 3EG2A 1TTHB 3NTHA 2L3QA 5KYXA 3CCQA 1RAAB 5GAN8 3QWYA 4ZTFA 3BY7A 3I56T 1IGUA 1QVFS 2KR3A 2QGFB 4N4GA 4OB1B 1VQ4T 1OEBA 2NUTB 1CKAA 2E4HA 3JRZA 4AFSC 2QK0A 1VQ8Q 4C8QC 4JPBW 1MMGA 5GAN3 1PC0A 2HMAA 3TCJA 2KK4A 1VQOQ 1MGQA 2GNCA 3CCVA 2H3JA 3ZL7C 1M90U 3M59A 1NYFA 4NL3A 3RKXA 2EGEA 2ZAEA 3M0QA 2VVKA 2VASA 4LDVA 1I8FA 1Y96B 3DLMA 3M4GA 2LQNA 5GAN5 4M75E 4JJBA 1VQMQ 2HQHA 1VQ9T 1QWEA 2KDSA 1RAFB 4FL6A 1ZQ1A 2K3BA 4PJNA 1G5VA 3V8JA 1N27A 1FWZA 4M77B 4EMHA 5GAOm 1WNLA 4IUPA 3H0HA 1U1TA 1KC8U 2HL5C 1VQ9A 1AWOA 2NUZA 3CCEA 3I55Q 2OTLA 3TU4K 3CD6Q 2QI2A 3T9NA 3CCMA 4A53A 1PKSA 5CCAA 2ZPGB 1WQWA 2LT1A 5GANh 2C0OA 1AOJA 1VQPT 1SSHA 1G3TA 3I9QA 1XJWB 1YHQQ 2A7YA 1KD1R 2QQSA 2DAQA 4KH0B 5FWBA 2KRNA 2QEXT 2EJGA 3MP1A 2XDDA 2CH4A 3A8MB 4M7DD 2VC8A 1Y07A 4J6XA 3M0RA 4TVRA 1VQPA 3EG1A 4Y91A 2HD0A 5HK0A 1KQSS 1UGPB 3KUFA 2JZ2A 2DTIA 1I07A 5CO7A 6AT1B 2OTJQ 3CCJQ 4JJCA 2QEXA 4CRIA 1BIBA 2O4XB 4XTZA 4C92E 2RI5A 2NYSA 1Z9ZA 3X26B 3CMEQ 2D8JA 2P0PA 2HSPA 1M3BA 1C6VX 2XG8D 4DQ2A 1VIEA 2PQWA 2D6FA 2OAWA 2BTTA 4RUGA 1AT1B 4XU1A 1Q86C 5C6SA 3M57A 5HY6A 2E65A 4M7DA 3LYIA 1QQJA 3V8LA 2FL7A 2G3RA 2AKLA 2LX7A 3NGPA 3RBBB 3VU3C 3OYFA 3NTKA 5IT9E 1WX6A 1C0MA 1GCQA 5KYYA 5CQYA 5DY9A 1WHKA 5AYFA 4BDYA 5CR2A 1RLPC 4K11A 1Q81C 2KRSA 2BZXA 3LWHA 2L3RA 4PJOB 2KGTA 2M0OA 4J9GA 4F17A 1ZX6A 4M78B 1BYMA 2DIQA 4UC4A 1LOJA 3G71Q 4FYYB 1IB8A 2CZ7B 1D1AA 5KE3A 3G4SA 1LPLA 2PU9B 5CKBA 1PKTA 3J81E 5GMKm 1ABQA 3OSVA 4EDUA 2W10A 4X34A 4A54A 2F2VA 2RHXA 1IHVA 2GCXA 2LNHB 3CC2T 3M0TA 1VQNA 2CYZB 1T0HA 2XHCA 3CXCS 1S72A 4MZMA 4M75A 4OMPA 2QDYB 4DEYA 2O88A 1PCXA 1QMCA 1RL2A 4QVCA 5FU6C 1BI3A 5LJ5j 3HTRA 1R8OB 3MEUA 3OA6A 2RM4A 4PL6A 3EH2A 3CCST 2PNIA 4OMOA 2XDBA 1H8KA 1BKBA 2VXFA 4M77E 3A8HB 3L2ZA 5LJ5d 4XTUA 1UGRB 3CEYA 3M56A 4YTLA 5J39A 1NBEB 2J6OA 2F5KA 3M0UA 2JMAA 4M7DG 2KY9A 4OMQA 3A8LB 3HHTB 1N9SA 3EGDB 2A08A 4J9DA 1KFZA 1YJWT 5KCOA 2VKNA 2NUPA 1UGQB 2JW4A 5EC7A 2JJ9A 1QVGS 1PM3A 2PVOB 3CCSA 2DE0X 4HVWA 2SEMA 2XD0A 3SWNA 1I5LA 2JS2A 2BZ8A 3OW2P 3WVDB 5CAIA 3OMCA 4DBRA 2AKKA 4X9CA 2IPOB 1ZSZB 1YJWA 1ZSGA 1ZBJA 1TSFA 1AEYA 2KI7A 5I2SA 3CC4A 1KC8R 3TVTA 3JCMW 1NEGA 3A8OB 1YIJA 1D1BA 4C8QD 3JB9D 1PRMC 4A4FA 3OSSC 2LQ8A 2V8JA 1VA7A 2DL5A 3EG9A 2X4JA 5LJ5f 5LJ5g 1M2VA 2JN0A 3LH5A 4LDWA 3OYLA 4E7JA 2YLBA 5DLOA 2KXDA 3GF5A 3PVLA 2JS0A 1H3HA 4IIOA 4M75G 4C92A 4BY6C 2CP2A 1Y71A 3URGA 1M1KC 2YUPA 2FB7A 2F2WA 2DL4A 1UDLA 2HEQA 3N5BB 5FW9A 2DILA 2BIVA 1M3CA 2VGMA 3O8VA 1UHCA 3GP8A 3C94A 3G6EA 3M55A 3M0PA 2COYA 2QQAA 1X01A 2GGRA 4J6WA 2K4YA 1YJNT 1D3BB 4ME7A 1WQ7A 2EGCA 5IAYA 4DBHA 1Q7YC 1VQKA 2RK1A 4QQDA 4F7UF 3AHUA 1YI2T 2IIMA 3PE0A 5GAN7 1SKUB 4PJOE 2ECZA 4ELYC 3UA6A 1WFWA 1VQ5Q 2GBQA 4FYXB 4M78E 1WJRA 3D7SB 1BCOA 2DRKA 3OYKA 5FLXE 2XDPA 1HD3A 2RH2A 4ZTJA 4PK4A 2R5AA 3L2VA 1DJ7B 3OW2A 2P0QA 1HK9A 4II1A 1VQ7Q 1OZ2A 2CS7A 1YI2A 2OX7A 1AWXA 2DYBA 3VJPA 1JXMA 4FT4A 4M7DC 4JRKA 4EPCA 2IVWA 4CC3A 4M7AC 2LCLA 1YJ9A 1T3LA 2E41A 3MEWA 1IGQA 3FDRA 3RKWA 1Y96A 2EBPA 1X2QA 2X9HA 2ENMA 2M9UA 5KYWB 3CCLT 2F5TX 4C92G 3QPHA 3JCMb 1WGSA 5CQXA 2SRCA 4C5EA 3VYGA 2QTXA 5GAOq 1QVFP 1M27C 4M77A 1HSQA 5DLQE 2VV5A 2MIOA 3ULRB 4OB2B 4DA4A 3R6OA 1WIEA 3CCRT 2ZPBB 4WF2A 2RPNA 2OI3A 3JB9G 3LWIA 3RESA 2WACA 2X35A 2HBPA 4Z8AA 1X6BA 1KHIA 2D0QB 2DZ9A 4QW2A 1MMDA 4PLLA 2K6DA 4JJNK 3P8DA 3VKIA 2DVEA 4NS5A 2FYKA 4M75C 1KIKA 4LD9K 2EGAA 3MHXA 3JB9H 3H6ZA 3QJYA 5ECAA 1MNDA 1X2KA 1Q82C 8AT1B 2K79A 1AZGB 2LMJA 3JAME 2AHJB 1QKWA 1D0XA 5FU7C 1WJQA 4B6MA 4DOWA 3M9QA 1VQ8T 1NJIU 2GQVA 3GLXA 3VYHB 1ABOA 3VRYA 1VQOT 1BCMA 4A4EA 2X4XA 2YUQA 1YP5A 3GIBA 1GBRA 1YWPA 3EG3A 4QKUA 2VB6A 1NZ9A 2JM9A 3JSCA 2JTMA 2O4XA 4ZGDB 3F70A 2KROA 4OB3B 2OAUA 1VYVA 1B3QA 3SWNC 3TSZA 4PKCC 1VQMT 3NTIA 5CKEA 1IO6A 3WXMB 3REAB 1KJWA 1K8AU 1RAIB 3QYHB 4MMLA 5IHIA 3CC7Q 2DEQA 2P4TA 4M77G 2QDLA 4KUDK 3CCUA 3SD4A 1NG2A 5LJ3h 2E6NA 4LDUA 2I2LA 4A63B 2XIDA 4DOVA 1M90C 4J9EA 2DYIA 4DBQA 3JCMc 1BIAA 4E2FB 1RAGB 2L89A 4X9DA 4QT7A 3I55T 2A36A 2RO0A 3CD6T 2XMFA 2RQVA 2DD5A 2KXCA 5M9OA 3OYMA 4KUIA 4C92C 1MV0B 2AIRB 1M4ZA 2FPDA 1LJOA 1UGSB 3PIOA 2ZCFB 4XTVA 2F2XA 4KBMB 1SPKA 2LC4A 1CKBA 2QQBA 5LJ5e 1K73C 2JUFA 1V76A 5GAN6 1EZZB 3RUXA 2M02A 3OY9A 5CIUA 4OMFB 3NMZC 3JCMP 1JJ2S 5CVIA 2R58A 3M4YA 2MWPA 3JB9J 2L0AA 3I56A 5FRMA 2EWNA 2VUBA 1JEGA 1BK2A 5L23A 3FJ5A 1OULA 4KGXB 1VQ4A 1K9MC 4FT2A 1F1BB 4RTXA 4MZTA 1SRMA 3MJXA 2FPFA 3CMET 4LXCA 1QCNA 1OU9A 2EYQA 2MPXC 2HKNA 4A4HA 2WSFE 3GNFB 1YITQ 3OYHA 3CCUQ 2O9VA 2RK2A 4EIKA 2EYYA 2CP6A 3QO3A 4M7DF 3E9FA 2XKOC 1GBQA 4JRIA 2LNVA 2MWOA 2YUNA 3HP9A 1K4US 4GLMA 5C0MA 3S6WA 3H41A 3KBGA 2DETA 3CXCP 2DERA 2PUOB 2O31A 5D6WA 3CMAQ 4O6JA 3PTAA 2P0KA 1M1FA 2K3YA 2QQRA 4FW2A 2RQTA 4E7LA 2LCSA 1OX8A 2DXBA 3CCQQ 1W2BP 2EKHA 4M77C 3HFOA 1W6XA 3A8GB 4DEXA 4N4IA 3G71T 1J3TA 1U8RA 1LNXA 2ABLA 2PZ1A 4BB7A 1NPPA 4BI8B 2BE9B 3VV0A 2EYZA 3OYIA 2QA4T 2H3EB 1ZA2B 2EQKA 2K3XA 1D09B 2E3HA 2RQWA 4F7UB 3M53A 5L8RE 2K5FA 4M7AD 3CCVQ 3SFMA 1G3WA 4PLIA 1IZ6A 1QVGP 3JCMf 3UF4A 1N8RR 2YT6A 2LQKA 3CBMA 2WSEE 4KT0E 1KG1A 4LUDA 3JCMV 2QA4A 1RI9A 1XTDA 3E19A 2ZPIB 4C0GA 1NJIR 4J9FA 2RA2A 1Y57A 2KRMA 4JRQA 4PJLA 4KH1B 1PSEA 5IXBA 2X3WD 2K7AA 2BE7D 4L59A 3JV3A 5GMKj 5KYUB 3VS2A 1WLPB 2DL8A 1LCKA 3RNJA 2DXTA 2JTFA 4EMKB 1AVZC 2D9TA 4M7AA 2DBMA 4XTXA 3J7AF 1M2OA 4NOYA 1VQ9Q 4X1VA 3CCEQ 5GAMj 2OTLQ 3FLGA 2E5QA 4RKUE 1K8AR 1VIFA 4M75D 3CCMQ 1X43A 5I11A 1ZUYA 3VUZA 1G2BA 4QVZA 5IN1A 1HYOA 2FZCB 1ZA1B 3HPWA 4RTVA 4L6V5 3EGXB 3FC3A 3QDRB 3DLLA 1W2BA 3HKSA 1MMNA 3QG1A 2K2MA 2GFUA 2RQRA 2JXBA 4F04B 3X24B 2DVJA 3EFRA 4E6RA 5A0GA 4Z88A 1U1SA 5KE2A 1WYXA 5KYWA 1SF9A 2JVVA 2ED1A 3L2QA 1VQPQ 4PJOC 2RNAA 4C0DB 1PD0A 5KYXB 4IUQA 4HCKA 1YN8A 3OMGA 3TEEA 2YWWA 3QIIA 2QEXQ 5GAOl 1P92A 4LDXA 4FCYA 5D6XA 2DL7A 2QYZA 1JRIA 1JXOA 3L2WA 2PVGB 3MP6A 3EAEA 3CC2A 4ZN3A 2H8HA 5GAMf 4FSSA 4C8QF 3JB9F 1N6AA 5LJ3f 4A4KA 2FHDA 3CPWS 4OMLA 1OYXA 2C06A 1KSWA 1NE8A 1X69A 4LDYA 1GRIA 4J9BA 3OYCA 1Q81U 3META 3MKDA 4M7AG 4O5VA 1NLPC 2RJCA 1RI0A 4HA8A 1XQHA 1M30A 1M9SA 4BDZA 1M3AA 4C92D 1VQ5T 1WXBA 1V1CA 3R6NA 1JQQA 2PTKA 3H0FA 3L1AA 2LVMA 3CBPA 3H0IA 2G6FX 1SEMA 4LNPA 2KYBA 3RKYA 3OBYA 4FSXA 3BE3A 3MPUB 2DX1A 1YFNA 2RN8A 3G4SQ 1NLOC 4F7UE 1VOMA 5GANj 1H641 1ZUUA 5GAN4 5HCKA 3ZEHA 2CH4W 2RF0A 1VQ6T 5A2QE 1OQKA 2FPEA 4OP0A 1UFFA 3V8KA 1FYNA 1VQNQ 4BE2A 2DD4A 4JLIA 1VYTA 3GBQA 3QHSA 1WA7A 1S72Q 3OYBA 1ZSZC 3SB2A 3VS4A 2EJ9A 4ESRA 2ZZDA 4AFZC 4BACA 4RG8A 1M8VA 1Q95G 1T0JA 2EFIA 1VQ6A 4ZNXA 3OQ5A 5CKFA 5KCHA 4Q5WA 4ATOA 3PIPA 2R5MA 1WHLA 1TUGB 1JB0E 1YWOA 2F1LA 2XI9A 3OYGA 5EG2A 1VQLT 1AHJB 3EFOA 1K0SA 3QDFA 2KNBB 2NLUA 4RCCA 2RJEA 2E64A 2RMOA 5LL6S 2E10A 1D0ZA 2XICA 3CCSQ 3JCMJ 1B7TA 1B34B 3L42A 1TG0A 4WTOB 1OPLA 3C0CA 1SHFA 1VQLA 4FIBA 2NUTA 5DM7R 2RHYA 4D6WA 5GANf 1YJNA 4M77D 1KD1C 1YJWQ 3FEOA 3JCMe 3CC4Q 4JZ4A 1K0XA 5D6YA 2MYSA 1YNZA 4PFZA 2KT8A 3MEVA 2V1QA 1YIJQ 1MNEA 4RTZA 2E6ZA 4KGZB 3SHWA 3PVQA 4IUUA 2X3XD 4B9XA 3ASKA 1BI2A 3VS7A 2JTEA 2EAYA 2D1XA 4D8DA 2QAZA 3QSUA 1WHHA 2CP5A 4IUVA 1M1KU 1TWBA 2EW3A 1R0BG 2YSQA 1PSFA 1K1ZA 1W4SA 2LP5A 4XU2A 4CC4B 4J7FA 3OYAA 3CC7T 1N5ZA 2YUOA 3SDZA 3OB9A 1AD5A 2BZYA 4C0FA 1UHFA 4F14A 3QUIA 3UWNA 3I5SA 1KQ2A 3HRUA 2FVUA 1NYGA 2YRDA 1UEBA 2L3SA 3G6EQ 3CCLA 1PG5B 2COWA 2DXUA 1Q7YU 1YCYA 1JJ2P 2HL3A 1C1AA 2RD1A 4CC2A 1MHNA 4J9CA 4XAXB 1QKXA 1UJ0A 4ANJA 4D8KA 2GF7A 1G8XA 5IHKA 1VQKQ 1UTIA 3EG0A 1Q86R 3CCRA 2KMTA 1N8RU 1TH7A 3PMIA 2ROTA 3NFCA 3H9NA 5AT1B 2DJZA 1UECA 2VYTA 1W70A 5I22A 3EGUA 1NPRA 3PFSA 4QQGA 3V7RA 1W1FA 2VXEA 1YI2Q 1LVKA 3QBYA 3J80E 1Q81R 3IQLA 2HQEA 4Y28E 4E7KA 5GMKe 1MMAA 2ZPEB 2DRMA 1YJ9Q 1QCFA 1AWWA 2V26A 3QZ9B 4PJOD 1K9AA 2E12A 3X25B 1VQ8A 1XOVA 1Y7XA 4M78D 5GAMe 1O9SA 4OB0B 1ZLMA 4LN2A 4XU3A 2EKOA 2V1RA 2XK0A 1VQOA 2GTOA 3PNWC 5GAOr 5KYUA 4RMOA 4PJJA 2CKKA 4R55A 1YITT 3EH1A 2AT1B 4HCCA 1AZEA 4AFQC 4EMKA 5GMKh 1QVFA 1I5OB 4QQ6A 2K5IA 4XQ3A 1QP3A 2KE9A 3HL8A 1M2VB 3UDCA 1VQMA 4OMNA 3PMTA 2EYXA 2ROLA 2KT1A 2KSSA 1WJSA 1OV3A 1BU1A 2RHIA 4LE9A 1WXTA 2O9SA 4PJOA 4ZN1A 3CMAT 1KQSP 1U5SA 3INZA 2DK3A 1TOVA 4M78A 2DM1A 1OI1A 5J26A
chains in the Genus database with same CATH topology
2VKNA 1GCQC 2JW4A 5EC7A 3I35A 1PNJA 2W0ZA 4LUDA 4RTUA 1M8MA 2ED0A 1RI9A 2DE0X 4HVWA 2L3PA 1TUCA 2SEMA 2EYWA 4J9FA 4JJDA 1Y57A 2KRMA 2M0YA 2VWFA 2JS2A 2BZ8A 5IXBA 2X3WD 2K7AA 2AKKA 3JV3A 4KRTA 2DF6A 3VS2A 1WLPB 1ZSGA 1ZBJA 2DL8A 1AEYA 1LCKA 3RNJA 3TVTA 1NEGA 2CDTA 1AVZC 1PRLC 1PWTA 2JMCA 3KFVA 2DBMA 3UA7A 1PRMC 2CSIA 4X1VA 2E5KA 2D8HA 3EHRA 1NEBA 1VA7A 2DL5A 2EQIA 1AWJA 4WCIA 5GJVB 3LH5A 1ZUKA 3VS3A 1X43A 3M0SA 5I11A 1ZUYA 2KXDA 3QWXX 3PVLA 1G2BA 2JS0A 1MUZA 2P4RA 1H3HA 4IIOA 1E7OA 1SRLA 3O5ZA 4RTVA 1EFNA 2YUPA 2DBKA 2F2WA 2DL4A 1UDLA 2HEQA 4F16A 5FW9A 2DILA 2K2MA 2RQRA 2JXBA 1M3CA 2DVJA 1A0NB 2L2PA 4HVUA 1UHCA 2FEIA 1X6GA 4J9HA 1QLYA 4E6RA 1VYUA 3M0PA 4Z88A 2DA9A 5GJWB 1WYXA 4OMMA 2ED1A 2GGRA 2JT4A 3I5RA 5FWCA 2RNAA 3VS5A 1K76A 1G83A 4HCKA 2EGCA 1YN8A 1QWFA 3TSWA 1PHTA 2CT3A 2FO0A 2IIMA 1OPKA 3PE0A 4HVVA 4Y92A 2ECZA 3UA6A 4Z89A 1UE9A 1WFWA 2DL7A 1JXOA 2JM8A 2GBQA 1TUDA 2DRKA 4M4ZA 5IXFA 1HD3A 2H8HA 4FSSA 4ORZA 1H92A 1SHGA 4GBQA 2CSQA 2KEAA 4OMLA 1AWXA 2DYBA 1MV3A 1JXMA 1BBZA 1KSWA 1X69A 1GRIA 4J9BA 1UGVA 1RLQC 4CC3A 1NLPC 2A28A 4HXJA 4AG2C 3UATA 1M30A 2FG0A 1T3LA 4LUEA 2EPDA 1BB9A 2EBPA 3SEMA 1X2QA 1M3AA 2ENMA 1WXBA 1V1CA 3R6NA 1JQQA 2PTKA 3H0FA 3VRZA 2J6KA 3H0IA 2G6FX 4RTWA 3EG2A 1SEMA 2SRCA 1S1NA 1U06A 4LNPA 2KYBA 2L3QA 1Y0MA 1M27C 3QWYA 4AFUC 1HSQA 2HCKA 2DX1A 2MIOA 2HDAA 3ULRB 2RN8A 1NLOC 2KR3A 1WIEA 1ZUUA 2RPNA 5HCKA 1OEBA 1CKAA 4AFSC 2OI3A 2K9GA 2CH4W 2DJQA 3NPFA 4JPBW 2RF0A 2MCNA 4Z8AA 2FPEA 1UFFA 1X6BA 1FYNA 4AG1C 1U3OA 2NWMA 1VYTA 2GNCA 3GBQA 1WA7A 1WXUA 2K6DA 2J06A 3ZL7C 4RTTA 1NYFA 3VS4A 1KIKA 1X27A 2DLPA 1ARKA 2EGAA 2ESWA 5ECAA 4ESRA 1UUEA 1GFCA 2EGEA 4AFZC 1X2KA 1HJDA 2RQUA 3M0QA 2VVKA 1T0JA 2K79A 1AZGB 4ZNXA 2LQNA 2LMJA 2J7IA 1CSKA 1QKWA 4JJBA 2AZVA 2HBWA 1QWEA 1YWOA 2K3BA 1ABOA 1GCPA 3VRYA 2KBTA 4RTYA 1K0SA 5IHNA 2KNBB 2YUQA 1YP5A 1GBRA 1YWPA 2RMOA 3EG3A 3H0HA 2JM9A 2AZSA 1JU5C 1AWOA 2NUZA 2KROA 1TG0A 1OPLA 2C0TA 1SHFA 2LZ6B 3C0CA 1VYVA 1B3QA 3TSZA 1E6GA 1IO6A 3REAB 1PKSA 1KJWA 2KYMA 2C0OA 3VS6A 2O2OA 1AOJA 3A98A 4IIMA 5IHIA 2QDLA 4JZ4A 1K0XA 1SSHA 1YNZA 2MOXA 2DL3A 3I9QA 1NG2A 3VS1A 2KT8A 2V1QA 4A63B 1WI7A 4RTZA 3SHWA 3PVQA 4J9EA 2X3XD 2CUBA 3U23A 5FWBA 3EHQA 2KRNA 3VS7A 2JTEA 2D1XA 4D8DA 2C0IA 2LJ3A 4QT7A 1RUWA 2A36A 2CH4A 1GFDA 2EW3A 2XMFA 2RQVA 1UG1A 2YSQA 3M0RA 1K1ZA 5IH2A 2KXCA 3EG1A 2EVRA 2LJ0A 2LP5A 4R0KA 3VS0A 4CC4B 2A37A 1MV0B 1I07A 2FPDA 2DNUA 1N5ZA 2YUOA 4JJCA 1YCSB 4J9IA 2F2XA 1AD5A 2BZYA 1UHFA 1SPKA 4F14A 3I5SA 1CKBA 1Z9ZA 2CREA 1NYGA 2D8JA 2GTJA 2HSPA 2L3SA 1M3BA 2CUDA 2OAWA 2BTTA 4RUGA 4CC2A 4J9CA 1QKXA 3NMZC 1UJ0A 4D8KA 1JO8A 5IHKA 2L0AA 2LQWA 2LX7A 2AKLA 1UTIA 3NGPA 3RBBB 1JEGA 1WX6A 3EG0A 1GCQA 1BK2A 5L23A 2I0NA 3FJ5A 3CQTA 3REBB 2D0NA 2ROTA 4RTXA 1SRMA 1RLPC 2FRYA 1WDXA 2FPFA 4K11A 1UECA 1W70A 2KRSA 2BZXA 5I22A 3EGUA 2KGTA 1W1FA 4J9GA 1Z9QA 4F17A 1ZX6A 2LJ1A 2OJ2A 2O9VA 3IQLA 2M51A 4EIKA 2EYYA 2J6FA 1GBQA 2YUNA 2DRMA 3NHNA 1K4US 4GLMA 1FMKA 1QCFA 1PKTA 1AWWA 1K9AA 2J05A 1ABQA 2YDLA 2W10A 3H41A 2F2VA 1XOVA 2LNHB 4JZ3A 1UJYA 1ZLMA 2O31A 3M0TA 4LN2A 2V1RA 1T0HA 3THKA 1I0CA 2GTOA 2DMOA 2RQTA 1E6HA 4OMPA 2B86A 2LCSA 4DEYA 2O88A 2EKHA 1AZEA 2GQIA 4AFQC 1W6XA 4DEXA 2AK5A 1J3TA 2ABLA 1B07A 1NM7A 2PZ1A 1OOTA 2KE9A 4OMNA 2PNIA 4OMOA 2EYZA 1H8KA 2EYXA 2ROLA 2KT1A 1OV3A 2RQWA 1BU1A 2FRWA 2J6OA 1WXTA 4LE9A 2O9SA 3M0UA 1I1JA 2JMAA 1GL5A 4OMQA 1U5SA 3UF4A 4CC7A 2A08A 4J9DA 2YT6A 2DM1A 1KFZA 1T3SA 2CT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKN A;  1GCQ C;  2JW4 A;  5EC7 A;  3I35 A;  1PNJ A;  2W0Z A;  4LUD A;  4RTU A;  1M8M A;  2ED0 A;  1RI9 A;  2DE0 X;  4HVW A;  2L3P A;  1TUC A;  2SEM A;  2EYW A;  4J9F A;  4JJD A;  1Y57 A;  2KRM A;  2M0Y A;  2VWF A;  2JS2 A;  2BZ8 A;  5IXB A;  2X3W D;  2K7A A;  2AKK A;  3JV3 A;  4KRT A;  2DF6 A;  3VS2 A;  1WLP B;  1ZSG A;  1ZBJ A;  2DL8 A;  1AEY A;  1LCK A;  3RNJ A;  3TVT A;  1NEG A;  2CDT A;  1AVZ C;  1PRL C;  1PWT A;  2JMC A;  3KFV A;  2DBM A;  3UA7 A;  1PRM C;  2CSI A;  4X1V A;  2E5K A;  2D8H A;  3EHR A;  1NEB A;  1VA7 A;  2DL5 A;  2EQI A;  1AWJ A;  4WCI A;  5GJV B;  3LH5 A;  1ZUK A;  3VS3 A;  1X43 A;  3M0S A;  5I11 A;  1ZUY A;  2KXD A;  3QWX X;  3PVL A;  1G2B A;  2JS0 A;  1MUZ A;  2P4R A;  1H3H A;  4IIO A;  1E7O A;  1SRL A;  3O5Z A;  4RTV A;  1EFN A;  2YUP A;  2DBK A;  2F2W A;  2DL4 A;  1UDL A;  2HEQ A;  4F16 A;  5FW9 A;  2DIL A;  2K2M A;  2RQR A;  2JXB A;  1M3C A;  2DVJ A;  1A0N B;  2L2P A;  4HVU A;  1UHC A;  2FEI A;  1X6G A;  4J9H A;  1QLY A;  4E6R A;  1VYU A;  3M0P A;  4Z88 A;  2DA9 A;  5GJW B;  1WYX A;  4OMM A;  2ED1 A;  2GGR A;  2JT4 A;  3I5R A;  5FWC A;  2RNA A;  3VS5 A;  1K76 A;  1G83 A;  4HCK A;  2EGC A;  1YN8 A;  1QWF A;  3TSW A;  1PHT A;  2CT3 A;  2FO0 A;  2IIM A;  1OPK A;  3PE0 A;  4HVV A;  4Y92 A;  2ECZ A;  3UA6 A;  4Z89 A;  1UE9 A;  1WFW A;  2DL7 A;  1JXO A;  2JM8 A;  2GBQ A;  1TUD A;  2DRK A;  4M4Z A;  5IXF A;  1HD3 A;  2H8H A;  4FSS A;  4ORZ A;  1H92 A;  1SHG A;  4GBQ A;  2CSQ A;  2KEA A;  4OML A;  1AWX A;  2DYB A;  1MV3 A;  1JXM A;  1BBZ A;  1KSW A;  1X69 A;  1GRI A;  4J9B A;  1UGV A;  1RLQ C;  4CC3 A;  1NLP C;  2A28 A;  4HXJ A;  4AG2 C;  3UAT A;  1M30 A;  2FG0 A;  1T3L A;  4LUE A;  2EPD A;  1BB9 A;  2EBP A;  3SEM A;  1X2Q A;  1M3A A;  2ENM A;  1WXB A;  1V1C A;  3R6N A;  1JQQ A;  2PTK A;  3H0F A;  3VRZ A;  2J6K A;  3H0I A;  2G6F X;  4RTW A;  3EG2 A;  1SEM A;  2SRC A;  1S1N A;  1U06 A;  4LNP A;  2KYB A;  2L3Q A;  1Y0M A;  1M27 C;  3QWY A;  4AFU C;  1HSQ A;  2HCK A;  2DX1 A;  2MIO A;  2HDA A;  3ULR B;  2RN8 A;  1NLO C;  2KR3 A;  1WIE A;  1ZUU A;  2RPN A;  5HCK A;  1OEB A;  1CKA A;  4AFS C;  2OI3 A;  2K9G A;  2CH4 W;  2DJQ A;  3NPF A;  4JPB W;  2RF0 A;  2MCN A;  4Z8A A;  2FPE A;  1UFF A;  1X6B A;  1FYN A;  4AG1 C;  1U3O A;  2NWM A;  1VYT A;  2GNC A;  3GBQ A;  1WA7 A;  1WXU A;  2K6D A;  2J06 A;  3ZL7 C;  4RTT A;  1NYF A;  3VS4 A;  1KIK A;  1X27 A;  2DLP A;  1ARK A;  2EGA A;  2ESW A;  5ECA A;  4ESR A;  1UUE A;  1GFC A;  2EGE A;  4AFZ C;  1X2K A;  1HJD A;  2RQU A;  3M0Q A;  2VVK A;  1T0J A;  2K79 A;  1AZG B;  4ZNX A;  2LQN A;  2LMJ A;  2J7I A;  1CSK A;  1QKW A;  4JJB A;  2AZV A;  2HBW A;  1QWE A;  1YWO A;  2K3B A;  1ABO A;  1GCP A;  3VRY A;  2KBT A;  4RTY A;  1K0S A;  5IHN A;  2KNB B;  2YUQ A;  1YP5 A;  1GBR A;  1YWP A;  2RMO A;  3EG3 A;  3H0H A;  2JM9 A;  2AZS A;  1JU5 C;  1AWO A;  2NUZ A;  2KRO A;  1TG0 A;  1OPL A;  2C0T A;  1SHF A;  2LZ6 B;  3C0C A;  1VYV A;  1B3Q A;  3TSZ A;  1E6G A;  1IO6 A;  3REA B;  1PKS A;  1KJW A;  2KYM A;  2C0O A;  3VS6 A;  2O2O A;  1AOJ A;  3A98 A;  4IIM A;  5IHI A;  2QDL A;  4JZ4 A;  1K0X A;  1SSH A;  1YNZ A;  2MOX A;  2DL3 A;  3I9Q A;  1NG2 A;  3VS1 A;  2KT8 A;  2V1Q A;  4A63 B;  1WI7 A;  4RTZ A;  3SHW A;  3PVQ A;  4J9E A;  2X3X D;  2CUB A;  3U23 A;  5FWB A;  3EHQ A;  2KRN A;  3VS7 A;  2JTE A;  2D1X A;  4D8D A;  2C0I A;  2LJ3 A;  4QT7 A;  1RUW A;  2A36 A;  2CH4 A;  1GFD A;  2EW3 A;  2XMF A;  2RQV A;  1UG1 A;  2YSQ A;  3M0R A;  1K1Z A;  5IH2 A;  2KXC A;  3EG1 A;  2EVR A;  2LJ0 A;  2LP5 A;  4R0K A;  3VS0 A;  4CC4 B;  2A37 A;  1MV0 B;  1I07 A;  2FPD A;  2DNU A;  1N5Z A;  2YUO A;  4JJC A;  1YCS B;  4J9I A;  2F2X A;  1AD5 A;  2BZY A;  1UHF A;  1SPK A;  4F14 A;  3I5S A;  1CKB A;  1Z9Z A;  2CRE A;  1NYG A;  2D8J A;  2GTJ A;  2HSP A;  2L3S A;  1M3B A;  2CUD A;  2OAW A;  2BTT A;  4RUG A;  4CC2 A;  4J9C A;  1QKX A;  3NMZ C;  1UJ0 A;  4D8K A;  1JO8 A;  5IHK A;  2L0A A;  2LQW A;  2LX7 A;  2AKL A;  1UTI A;  3NGP A;  3RBB B;  1JEG A;  1WX6 A;  3EG0 A;  1GCQ A;  1BK2 A;  5L23 A;  2I0N A;  3FJ5 A;  3CQT A;  3REB B;  2D0N A;  2ROT A;  4RTX A;  1SRM A;  1RLP C;  2FRY A;  1WDX A;  2FPF A;  4K11 A;  1UEC A;  1W70 A;  2KRS A;  2BZX A;  5I22 A;  3EGU A;  2KGT A;  1W1F A;  4J9G A;  1Z9Q A;  4F17 A;  1ZX6 A;  2LJ1 A;  2OJ2 A;  2O9V A;  3IQL A;  2M51 A;  4EIK A;  2EYY A;  2J6F A;  1GBQ A;  2YUN A;  2DRM A;  3NHN A;  1K4U S;  4GLM A;  1FMK A;  1QCF A;  1PKT A;  1AWW A;  1K9A A;  2J05 A;  1ABQ A;  2YDL A;  2W10 A;  3H41 A;  2F2V A;  1XOV A;  2LNH B;  4JZ3 A;  1UJY A;  1ZLM A;  2O31 A;  3M0T A;  4LN2 A;  2V1R A;  1T0H A;  3THK A;  1I0C A;  2GTO A;  2DMO A;  2RQT A;  1E6H A;  4OMP A;  2B86 A;  2LCS A;  4DEY A;  2O88 A;  2EKH A;  1AZE A;  2GQI A;  4AFQ C;  1W6X A;  4DEX A;  2AK5 A;  1J3T A;  2ABL A;  1B07 A;  1NM7 A;  2PZ1 A;  1OOT A;  2KE9 A;  4OMN A;  2PNI A;  4OMO A;  2EYZ A;  1H8K A;  2EYX A;  2ROL A;  2KT1 A;  1OV3 A;  2RQW A;  1BU1 A;  2FRW A;  2J6O A;  1WXT A;  4LE9 A;  2O9S A;  3M0U A;  1I1J A;  2JMA A;  1GL5 A;  4OMQ A;  1U5S A;  3UF4 A;  4CC7 A;  2A08 A;  4J9D A;  2YT6 A;  2DM1 A;  1KFZ A;  1T3S A;  2CT4 A; 
#chains in the Genus database with same CATH topology
 1FX7 A;  1VUB A;  3CCR Q;  1PNJ A;  4RTU A;  3OYE A;  1M8M A;  2L3P A;  4M7D E;  3ER0 A;  3I55 A;  2CZ1 B;  4IUR A;  2EYW A;  1YHQ T;  2CP3 A;  2FZK B;  4C8Q B;  4JJD A;  4N0A C;  3CD6 A;  1WHJ A;  2MK5 A;  2K57 A;  1KC8 C;  3HRS A;  3A1P A;  4NL2 A;  3CCV T;  4PFP A;  2CDT A;  3TRE A;  1YHQ A;  3KFV A;  4JS5 A;  3UA7 A;  2OTJ T;  2CSI A;  2MI6 A;  3CCJ T;  2D8H A;  1KQ1 A;  1QW1 A;  3M54 A;  2F69 A;  4WCI A;  4EMG A;  5GJV B;  1ZUK A;  3HRT A;  5LJ5 h;  3QWX X;  3TQ7 P;  2DFU A;  4ELZ C;  1SRL A;  2E3I A;  2M16 A;  1HXD A;  4JRP A;  2ZPF B;  2OTJ A;  2X4Y A;  3EGD A;  2DBK A;  3JCM d;  3CCJ A;  3UPU A;  1FXX A;  4BI3 A;  4FYV B;  4F16 A;  4PNO A;  1IHW A;  2LTO A;  5CK9 A;  4PJM A;  1M1K R;  2YRC A;  4M7A F;  2L2P A;  4HVU A;  3CME A;  4BE1 A;  2YRV A;  5A0L A;  4J9H A;  1QLY A;  3CCE T;  2CZ0 B;  3L2U A;  2OTL T;  2DA9 A;  5GJW B;  5GAN e;  3MEA A;  5GAN 2;  4PJO G;  2JT4 A;  3CCM T;  1IRX A;  3M58 A;  3VS5 A;  3BDL A;  1K76 A;  1IXD A;  4M78 G;  1PHT A;  1X75 C;  1ZSZ A;  3L2R A;  1KQS A;  2FO0 A;  1K73 U;  2K2V A;  2JNG A;  4Y92 A;  1WPY A;  1UE9 A;  4E7S A;  1Q7Y R;  2XU8 A;  3OBW A;  2IG0 A;  1H3Z A;  4M4Z A;  5IXF A;  4A4G A;  4BI4 A;  3CPW P;  3JB9 I;  2V8I A;  4ORZ A;  1H92 A;  1SHG A;  1BI0 A;  2CP0 A;  3RR6 A;  2KEA A;  1FMV A;  2VGN A;  4LD6 A;  1K9M U;  3PGG A;  5J3B A;  3I56 Q;  1BBZ A;  8ATC B;  4MDW A;  3JCM g;  3G71 A;  3X28 B;  4M75 F;  4HXJ A;  4AG2 C;  1VQ4 Q;  3UAT A;  2FG0 A;  2YLC A;  1EIF A;  4HT9 A;  4JUV A;  3SEM A;  4HCB A;  2RB6 A;  2FZG B;  3VRZ A;  4B9W A;  3GPL A;  2DZC A;  4RTW A;  2DIG A;  1S1N A;  1U06 A;  1D1C A;  1D3B A;  1Y0M A;  2DXC A;  3G1J A;  4AFU C;  5GAO p;  1I4K 1;  3CBO A;  1RAC B;  2HCK A;  2HKQ B;  3OS2 A;  2HDA A;  2HSE B;  4QVD A;  4ZGE B;  1B34 A;  4HT8 A;  4RG2 A;  1R0C B;  3GOX A;  3LH0 A;  2GFA A;  1ACM B;  1RAH B;  2CGH A;  2K9G A;  3NPF A;  2DJQ A;  2A3L A;  2EJF A;  2MCN A;  5LJ3 j;  5FRO A;  4P5N A;  4AG1 C;  4JDS A;  1U3O A;  2NWM A;  4J6Y A;  4MDX A;  3QYG B;  5GAM d;  1WXU A;  3E9G A;  3CXC A;  2J06 A;  1ZHI A;  4PFO A;  4RTT A;  5LJ3 d;  4AMC A;  1X27 A;  2DLP A;  4C8Q E;  1ARK A;  4MZP A;  2ESW A;  2RJD A;  4OVA A;  1UUE A;  3V7S A;  1GFC A;  4EMK C;  1HJD A;  2RQU A;  3G4S T;  4XK8 E;  2J7I A;  1CSK A;  3MO8 A;  1OU8 A;  2AZV A;  2CZ6 B;  2HBW A;  2LCC A;  1Q82 R;  3OS1 A;  3PT9 A;  1PD1 A;  3CPW A;  4KUL A;  1GCP A;  1VQN T;  2KBT A;  1G3S A;  4RTY A;  5IHN A;  3ME9 A;  3JCM Q;  1S72 T;  5FRN A;  2KQW A;  3BFM A;  5FU6 B;  4M78 C;  4C92 F;  1SG5 A;  2QQ9 A;  2LDM A;  1QVG A;  3M5A A;  5KH6 A;  2AZS A;  2QA4 Q;  1JU5 C;  2JOY A;  4AT1 B;  1TU0 B;  2C0T A;  2LZ6 B;  5I2M A;  4HCZ A;  4XU0 A;  1Q86 U;  1E6G A;  4BUG A;  3GNG A;  2DTH A;  2KYM A;  3VS6 A;  2RHZ A;  5GAM g;  2O2O A;  2RJF A;  3A98 A;  3MCA B;  4IIM A;  2DTO A;  4C0D C;  2DPP B;  5KYN A;  5LJ3 g;  2MOX A;  2DL3 A;  1BI1 A;  3VS1 A;  3OYN A;  3FJP A;  1W2B S;  1WI7 A;  3RER A;  2CUB A;  3U23 A;  3EHQ A;  2BKD N;  3RIR A;  3DKM A;  5I21 A;  2C0I A;  2LJ3 A;  3HSB A;  1RUW A;  1GFD A;  3DB4 A;  1M90 R;  7AT1 B;  1UG1 A;  2X51 A;  5IH2 A;  3FRN A;  2EVR A;  1I81 A;  2LJ0 A;  2EQM A;  4R0K A;  3VS0 A;  3C4S A;  1OX9 A;  2A37 A;  3QJ6 A;  2COZ A;  1VQ7 T;  4BE0 A;  2DNU A;  3CC4 T;  1QP2 A;  1YCS B;  1YIJ T;  4J9I A;  1KK7 A;  3Q1J A;  5CKH A;  1VQ5 A;  4E7Z A;  2CRE A;  2GTJ A;  3BW1 A;  5D7U A;  2A0F B;  1RAE B;  4E7I A;  4ZGJ B;  3OYJ A;  2CUD A;  2L5Q A;  1QCO A;  3FIF A;  2V8K A;  4BY6 B;  1RAB B;  5GAN d;  1VQ7 A;  2RI2 A;  1K73 R;  1KHC A;  1JO8 A;  1WHG A;  2LQW A;  3LGF A;  2PUK B;  2Y90 A;  4JS4 A;  2QXF A;  2I0N A;  2ATC B;  4CI0 C;  3CQT A;  4M77 F;  3C95 A;  2Y4X A;  4J8O A;  3REB B;  2D0N A;  2FRY A;  4J7I A;  1WDX A;  3E1S A;  2HNI A;  4N0A A;  2E70 A;  3CC2 Q;  2PVD B;  3ZFJ A;  3G6E T;  3S3N A;  1WZO A;  3ZBD A;  1K9M R;  1Z9Q A;  3G7Z A;  2LJ1 A;  2OJ2 A;  2KAF A;  2M51 A;  3A5Z B;  1YBY A;  4OGC A;  1VQK T;  2J6F A;  3P8B B;  3S3M A;  2LRQ A;  3OS0 A;  3DB3 A;  3NHN A;  1FMK A;  3WVE B;  4MMK A;  2J05 A;  4C5H A;  2YDL A;  2M1H A;  4C8Q A;  4JZ3 A;  1UJY A;  5GMK l;  5HK3 A;  4FYW B;  1D0Y A;  5GAN g;  3THK A;  3H8Z A;  2YHT A;  2DMO A;  3X20 B;  4DBF A;  2QGG A;  2CP7 A;  2LT4 A;  2LX9 A;  1V29 B;  1E6H A;  4HKE A;  4M7D B;  2B86 A;  3V7C A;  3LX7 A;  4M7A B;  2ZPH B;  2GQI A;  2QTV A;  5KYY B;  5A0D A;  2AK5 A;  2WSC E;  3KXT A;  1B07 A;  1NM7 A;  1M1G A;  1OOT A;  3P8H A;  2BUD A;  3OYD A;  1RAD B;  2KVQ G;  1YJ9 T;  4C5G A;  4JLG A;  1N8R C;  2YXY A;  3EFS A;  2FRW A;  4FM4 B;  1I1J A;  3E2U A;  1GL5 A;  4CC7 A;  2B8A A;  4XTW A;  3JCM h;  1NJI C;  1I0C A;  1T3S A;  3OS5 A;  2CT4 A;  5CKD A;  1GCQ C;  3I35 A;  4N4H A;  3QKJ A;  2W0Z A;  2ED0 A;  1FMW A;  1TUC A;  1VQ6 Q;  4GLK A;  4L5G A;  4E47 A;  3RDV A;  2M0Y A;  2VWF A;  4OGE A;  2L8D A;  2RI3 A;  2DEU A;  3LLR A;  2EIF A;  4KRT A;  3OW2 S;  2DF6 A;  2HQX A;  3QXE B;  4M75 B;  3CC7 A;  4C5I A;  4PJO F;  4KGV B;  1K8A C;  1PRL C;  1PWT A;  2JMC A;  4M78 F;  1ZBX A;  1JBM A;  2E5K A;  3EHR A;  4C8Q G;  2HAX A;  1NEB A;  5FU7 B;  1KD1 U;  2MMP A;  2Z0W A;  1VQL Q;  2EQI A;  1AWJ A;  3C12 A;  2QAS A;  4J83 A;  1X6O A;  3VS3 A;  3RMQ A;  3M0S A;  4Z02 A;  1YJN Q;  1MUZ A;  1TXQ A;  2P4R A;  4XTY A;  3RMS A;  2X4W A;  1E7O A;  4F7U A;  3O5Z A;  2R57 A;  2EQJ A;  4E7H A;  3S3O A;  3QZ5 B;  1GXI E;  1EFN A;  2NUP B;  2E1H A;  4FU6 A;  4OF1 A;  3MP8 A;  2P84 A;  1G3Y A;  4BD3 A;  3LGL A;  1A0N B;  3BDU A;  1QVP A;  2FEI A;  3SWN B;  2Y4Y A;  1X6G A;  1M5Q 1;  1N9R A;  1VYU A;  2K5L A;  1IRE B;  4GY5 A;  1OZ3 A;  4OMM A;  3I5R A;  5FWC A;  1R77 A;  1G83 A;  4RCB A;  5LJ3 e;  4V2S A;  3VUB A;  1O75 A;  1QWF A;  3TSW A;  2CT3 A;  3CPF A;  4FW1 A;  3AT1 B;  2DO3 A;  1OPK A;  3CCU T;  4HVV A;  5HKC A;  2MF2 A;  1TS9 A;  4Z89 A;  2JM8 A;  1WHM A;  2O01 E;  5GAO n;  5GMK i;  1TUD A;  3EG9 B;  3CCL Q;  4C0Z A;  4J5Y A;  3OYY A;  1UB4 A;  4C92 B;  5GAM h;  1YIT A;  4GBQ A;  2CSQ A;  9ATC B;  1JJ2 A;  2ZGW A;  1Q82 U;  1XNI A;  4VUB A;  1MV3 A;  3LW5 E;  2QG9 B;  1UGV A;  2HZY A;  1RLQ C;  4R56 A;  2MAM A;  3EGX A;  4IKF A;  3CCQ T;  2A28 A;  4LUE A;  3HFN A;  2EPD A;  1BB9 A;  2EQU A;  2RHU A;  3FB9 A;  2DKG A;  3JCM X;  1EX4 A;  4M7A E;  3EFO B;  2J6K A;  4IUT A;  3CMA A;  3UT1 A;  4F7U G;  1SSF A;  3EG2 A;  1TTH B;  3NTH A;  2L3Q A;  5KYX A;  3CCQ A;  1RAA B;  5GAN 8;  3QWY A;  4ZTF A;  3BY7 A;  3I56 T;  1IGU A;  1QVF S;  2KR3 A;  2QGF B;  4N4G A;  4OB1 B;  1VQ4 T;  1OEB A;  2NUT B;  1CKA A;  2E4H A;  3JRZ A;  4AFS C;  2QK0 A;  1VQ8 Q;  4C8Q C;  4JPB W;  1MMG A;  5GAN 3;  1PC0 A;  2HMA A;  3TCJ A;  2KK4 A;  1VQO Q;  1MGQ A;  2GNC A;  3CCV A;  2H3J A;  3ZL7 C;  1M90 U;  3M59 A;  1NYF A;  4NL3 A;  3RKX A;  2EGE A;  2ZAE A;  3M0Q A;  2VVK A;  2VAS A;  4LDV A;  1I8F A;  1Y96 B;  3DLM A;  3M4G A;  2LQN A;  5GAN 5;  4M75 E;  4JJB A;  1VQM Q;  2HQH A;  1VQ9 T;  1QWE A;  2KDS A;  1RAF B;  4FL6 A;  1ZQ1 A;  2K3B A;  4PJN A;  1G5V A;  3V8J A;  1N27 A;  1FWZ A;  4M77 B;  4EMH A;  5GAO m;  1WNL A;  4IUP A;  3H0H A;  1U1T A;  1KC8 U;  2HL5 C;  1VQ9 A;  1AWO A;  2NUZ A;  3CCE A;  3I55 Q;  2OTL A;  3TU4 K;  3CD6 Q;  2QI2 A;  3T9N A;  3CCM A;  4A53 A;  1PKS A;  5CCA A;  2ZPG B;  1WQW A;  2LT1 A;  5GAN h;  2C0O A;  1AOJ A;  1VQP T;  1SSH A;  1G3T A;  3I9Q A;  1XJW B;  1YHQ Q;  2A7Y A;  1KD1 R;  2QQS A;  2DAQ A;  4KH0 B;  5FWB A;  2KRN A;  2QEX T;  2EJG A;  3MP1 A;  2XDD A;  2CH4 A;  3A8M B;  4M7D D;  2VC8 A;  1Y07 A;  4J6X A;  3M0R A;  4TVR A;  1VQP A;  3EG1 A;  4Y91 A;  2HD0 A;  5HK0 A;  1KQS S;  1UGP B;  3KUF A;  2JZ2 A;  2DTI A;  1I07 A;  5CO7 A;  6AT1 B;  2OTJ Q;  3CCJ Q;  4JJC A;  2QEX A;  4CRI A;  1BIB A;  2O4X B;  4XTZ A;  4C92 E;  2RI5 A;  2NYS A;  1Z9Z A;  3X26 B;  3CME Q;  2D8J A;  2P0P A;  2HSP A;  1M3B A;  1C6V X;  2XG8 D;  4DQ2 A;  1VIE A;  2PQW A;  2D6F A;  2OAW A;  2BTT A;  4RUG A;  1AT1 B;  4XU1 A;  1Q86 C;  5C6S A;  3M57 A;  5HY6 A;  2E65 A;  4M7D A;  3LYI A;  1QQJ A;  3V8L A;  2FL7 A;  2G3R A;  2AKL A;  2LX7 A;  3NGP A;  3RBB B;  3VU3 C;  3OYF A;  3NTK A;  5IT9 E;  1WX6 A;  1C0M A;  1GCQ A;  5KYY A;  5CQY A;  5DY9 A;  1WHK A;  5AYF A;  4BDY A;  5CR2 A;  1RLP C;  4K11 A;  1Q81 C;  2KRS A;  2BZX A;  3LWH A;  2L3R A;  4PJO B;  2KGT A;  2M0O A;  4J9G A;  4F17 A;  1ZX6 A;  4M78 B;  1BYM A;  2DIQ A;  4UC4 A;  1LOJ A;  3G71 Q;  4FYY B;  1IB8 A;  2CZ7 B;  1D1A A;  5KE3 A;  3G4S A;  1LPL A;  2PU9 B;  5CKB A;  1PKT A;  3J81 E;  5GMK m;  1ABQ A;  3OSV A;  4EDU A;  2W10 A;  4X34 A;  4A54 A;  2F2V A;  2RHX A;  1IHV A;  2GCX A;  2LNH B;  3CC2 T;  3M0T A;  1VQN A;  2CYZ B;  1T0H A;  2XHC A;  3CXC S;  1S72 A;  4MZM A;  4M75 A;  4OMP A;  2QDY B;  4DEY A;  2O88 A;  1PCX A;  1QMC A;  1RL2 A;  4QVC A;  5FU6 C;  1BI3 A;  5LJ5 j;  3HTR A;  1R8O B;  3MEU A;  3OA6 A;  2RM4 A;  4PL6 A;  3EH2 A;  3CCS T;  2PNI A;  4OMO A;  2XDB A;  1H8K A;  1BKB A;  2VXF A;  4M77 E;  3A8H B;  3L2Z A;  5LJ5 d;  4XTU A;  1UGR B;  3CEY A;  3M56 A;  4YTL A;  5J39 A;  1NBE B;  2J6O A;  2F5K A;  3M0U A;  2JMA A;  4M7D G;  2KY9 A;  4OMQ A;  3A8L B;  3HHT B;  1N9S A;  3EGD B;  2A08 A;  4J9D A;  1KFZ A;  1YJW T;  5KCO A;  2VKN A;  2NUP A;  1UGQ B;  2JW4 A;  5EC7 A;  2JJ9 A;  1QVG S;  1PM3 A;  2PVO B;  3CCS A;  2DE0 X;  4HVW A;  2SEM A;  2XD0 A;  3SWN A;  1I5L A;  2JS2 A;  2BZ8 A;  3OW2 P;  3WVD B;  5CAI A;  3OMC A;  4DBR A;  2AKK A;  4X9C A;  2IPO B;  1ZSZ B;  1YJW A;  1ZSG A;  1ZBJ A;  1TSF A;  1AEY A;  2KI7 A;  5I2S A;  3CC4 A;  1KC8 R;  3TVT A;  3JCM W;  1NEG A;  3A8O B;  1YIJ A;  1D1B A;  4C8Q D;  3JB9 D;  1PRM C;  4A4F A;  3OSS C;  2LQ8 A;  2V8J A;  1VA7 A;  2DL5 A;  3EG9 A;  2X4J A;  5LJ5 f;  5LJ5 g;  1M2V A;  2JN0 A;  3LH5 A;  4LDW A;  3OYL A;  4E7J A;  2YLB A;  5DLO A;  2KXD A;  3GF5 A;  3PVL A;  2JS0 A;  1H3H A;  4IIO A;  4M75 G;  4C92 A;  4BY6 C;  2CP2 A;  1Y71 A;  3URG A;  1M1K C;  2YUP A;  2FB7 A;  2F2W A;  2DL4 A;  1UDL A;  2HEQ A;  3N5B B;  5FW9 A;  2DIL A;  2BIV A;  1M3C A;  2VGM A;  3O8V A;  1UHC A;  3GP8 A;  3C94 A;  3G6E A;  3M55 A;  3M0P A;  2COY A;  2QQA A;  1X01 A;  2GGR A;  4J6W A;  2K4Y A;  1YJN T;  1D3B B;  4ME7 A;  1WQ7 A;  2EGC A;  5IAY A;  4DBH A;  1Q7Y C;  1VQK A;  2RK1 A;  4QQD A;  4F7U F;  3AHU A;  1YI2 T;  2IIM A;  3PE0 A;  5GAN 7;  1SKU B;  4PJO E;  2ECZ A;  4ELY C;  3UA6 A;  1WFW A;  1VQ5 Q;  2GBQ A;  4FYX B;  4M78 E;  1WJR A;  3D7S B;  1BCO A;  2DRK A;  3OYK A;  5FLX E;  2XDP A;  1HD3 A;  2RH2 A;  4ZTJ A;  4PK4 A;  2R5A A;  3L2V A;  1DJ7 B;  3OW2 A;  2P0Q A;  1HK9 A;  4II1 A;  1VQ7 Q;  1OZ2 A;  2CS7 A;  1YI2 A;  2OX7 A;  1AWX A;  2DYB A;  3VJP A;  1JXM A;  4FT4 A;  4M7D C;  4JRK A;  4EPC A;  2IVW A;  4CC3 A;  4M7A C;  2LCL A;  1YJ9 A;  1T3L A;  2E41 A;  3MEW A;  1IGQ A;  3FDR A;  3RKW A;  1Y96 A;  2EBP A;  1X2Q A;  2X9H A;  2ENM A;  2M9U A;  5KYW B;  3CCL T;  2F5T X;  4C92 G;  3QPH A;  3JCM b;  1WGS A;  5CQX A;  2SRC A;  4C5E A;  3VYG A;  2QTX A;  5GAO q;  1QVF P;  1M27 C;  4M77 A;  1HSQ A;  5DLQ E;  2VV5 A;  2MIO A;  3ULR B;  4OB2 B;  4DA4 A;  3R6O A;  1WIE A;  3CCR T;  2ZPB B;  4WF2 A;  2RPN A;  2OI3 A;  3JB9 G;  3LWI A;  3RES A;  2WAC A;  2X35 A;  2HBP A;  4Z8A A;  1X6B A;  1KHI A;  2D0Q B;  2DZ9 A;  4QW2 A;  1MMD A;  4PLL A;  2K6D A;  4JJN K;  3P8D A;  3VKI A;  2DVE A;  4NS5 A;  2FYK A;  4M75 C;  1KIK A;  4LD9 K;  2EGA A;  3MHX A;  3JB9 H;  3H6Z A;  3QJY A;  5ECA A;  1MND A;  1X2K A;  1Q82 C;  8AT1 B;  2K79 A;  1AZG B;  2LMJ A;  3JAM E;  2AHJ B;  1QKW A;  1D0X A;  5FU7 C;  1WJQ A;  4B6M A;  4DOW A;  3M9Q A;  1VQ8 T;  1NJI U;  2GQV A;  3GLX A;  3VYH B;  1ABO A;  3VRY A;  1VQO T;  1BCM A;  4A4E A;  2X4X A;  2YUQ A;  1YP5 A;  3GIB A;  1GBR A;  1YWP A;  3EG3 A;  4QKU A;  2VB6 A;  1NZ9 A;  2JM9 A;  3JSC A;  2JTM A;  2O4X A;  4ZGD B;  3F70 A;  2KRO A;  4OB3 B;  2OAU A;  1VYV A;  1B3Q A;  3SWN C;  3TSZ A;  4PKC C;  1VQM T;  3NTI A;  5CKE A;  1IO6 A;  3WXM B;  3REA B;  1KJW A;  1K8A U;  1RAI B;  3QYH B;  4MML A;  5IHI A;  3CC7 Q;  2DEQ A;  2P4T A;  4M77 G;  2QDL A;  4KUD K;  3CCU A;  3SD4 A;  1NG2 A;  5LJ3 h;  2E6N A;  4LDU A;  2I2L A;  4A63 B;  2XID A;  4DOV A;  1M90 C;  4J9E A;  2DYI A;  4DBQ A;  3JCM c;  1BIA A;  4E2F B;  1RAG B;  2L89 A;  4X9D A;  4QT7 A;  3I55 T;  2A36 A;  2RO0 A;  3CD6 T;  2XMF A;  2RQV A;  2DD5 A;  2KXC A;  5M9O A;  3OYM A;  4KUI A;  4C92 C;  1MV0 B;  2AIR B;  1M4Z A;  2FPD A;  1LJO A;  1UGS B;  3PIO A;  2ZCF B;  4XTV A;  2F2X A;  4KBM B;  1SPK A;  2LC4 A;  1CKB A;  2QQB A;  5LJ5 e;  1K73 C;  2JUF A;  1V76 A;  5GAN 6;  1EZZ B;  3RUX A;  2M02 A;  3OY9 A;  5CIU A;  4OMF B;  3NMZ C;  3JCM P;  1JJ2 S;  5CVI A;  2R58 A;  3M4Y A;  2MWP A;  3JB9 J;  2L0A A;  3I56 A;  5FRM A;  2EWN A;  2VUB A;  1JEG A;  1BK2 A;  5L23 A;  3FJ5 A;  1OUL A;  4KGX B;  1VQ4 A;  1K9M C;  4FT2 A;  1F1B B;  4RTX A;  4MZT A;  1SRM A;  3MJX A;  2FPF A;  3CME T;  4LXC A;  1QCN A;  1OU9 A;  2EYQ A;  2MPX C;  2HKN A;  4A4H A;  2WSF E;  3GNF B;  1YIT Q;  3OYH A;  3CCU Q;  2O9V A;  2RK2 A;  4EIK A;  2EYY A;  2CP6 A;  3QO3 A;  4M7D F;  3E9F A;  2XKO C;  1GBQ A;  4JRI A;  2LNV A;  2MWO A;  2YUN A;  3HP9 A;  1K4U S;  4GLM A;  5C0M A;  3S6W A;  3H41 A;  3KBG A;  2DET A;  3CXC P;  2DER A;  2PUO B;  2O31 A;  5D6W A;  3CMA Q;  4O6J A;  3PTA A;  2P0K A;  1M1F A;  2K3Y A;  2QQR A;  4FW2 A;  2RQT A;  4E7L A;  2LCS A;  1OX8 A;  2DXB A;  3CCQ Q;  1W2B P;  2EKH A;  4M77 C;  3HFO A;  1W6X A;  3A8G B;  4DEX A;  4N4I A;  3G71 T;  1J3T A;  1U8R A;  1LNX A;  2ABL A;  2PZ1 A;  4BB7 A;  1NPP A;  4BI8 B;  2BE9 B;  3VV0 A;  2EYZ A;  3OYI A;  2QA4 T;  2H3E B;  1ZA2 B;  2EQK A;  2K3X A;  1D09 B;  2E3H A;  2RQW A;  4F7U B;  3M53 A;  5L8R E;  2K5F A;  4M7A D;  3CCV Q;  3SFM A;  1G3W A;  4PLI A;  1IZ6 A;  1QVG P;  3JCM f;  3UF4 A;  1N8R R;  2YT6 A;  2LQK A;  3CBM A;  2WSE E;  4KT0 E;  1KG1 A;  4LUD A;  3JCM V;  2QA4 A;  1RI9 A;  1XTD A;  3E19 A;  2ZPI B;  4C0G A;  1NJI R;  4J9F A;  2RA2 A;  1Y57 A;  2KRM A;  4JRQ A;  4PJL A;  4KH1 B;  1PSE A;  5IXB A;  2X3W D;  2K7A A;  2BE7 D;  4L59 A;  3JV3 A;  5GMK j;  5KYU B;  3VS2 A;  1WLP B;  2DL8 A;  1LCK A;  3RNJ A;  2DXT A;  2JTF A;  4EMK B;  1AVZ C;  2D9T A;  4M7A A;  2DBM A;  4XTX A;  3J7A F;  1M2O A;  4NOY A;  1VQ9 Q;  4X1V A;  3CCE Q;  5GAM j;  2OTL Q;  3FLG A;  2E5Q A;  4RKU E;  1K8A R;  1VIF A;  4M75 D;  3CCM Q;  1X43 A;  5I11 A;  1ZUY A;  3VUZ A;  1G2B A;  4QVZ A;  5IN1 A;  1HYO A;  2FZC B;  1ZA1 B;  3HPW A;  4RTV A;  4L6V 5;  3EGX B;  3FC3 A;  3QDR B;  3DLL A;  1W2B A;  3HKS A;  1MMN A;  3QG1 A;  2K2M A;  2GFU A;  2RQR A;  2JXB A;  4F04 B;  3X24 B;  2DVJ A;  3EFR A;  4E6R A;  5A0G A;  4Z88 A;  1U1S A;  5KE2 A;  1WYX A;  5KYW A;  1SF9 A;  2JVV A;  2ED1 A;  3L2Q A;  1VQP Q;  4PJO C;  2RNA A;  4C0D B;  1PD0 A;  5KYX B;  4IUQ A;  4HCK A;  1YN8 A;  3OMG A;  3TEE A;  2YWW A;  3QII A;  2QEX Q;  5GAO l;  1P92 A;  4LDX A;  4FCY A;  5D6X A;  2DL7 A;  2QYZ A;  1JRI A;  1JXO A;  3L2W A;  2PVG B;  3MP6 A;  3EAE A;  3CC2 A;  4ZN3 A;  2H8H A;  5GAM f;  4FSS A;  4C8Q F;  3JB9 F;  1N6A A;  5LJ3 f;  4A4K A;  2FHD A;  3CPW S;  4OML A;  1OYX A;  2C06 A;  1KSW A;  1NE8 A;  1X69 A;  4LDY A;  1GRI A;  4J9B A;  3OYC A;  1Q81 U;  3MET A;  3MKD A;  4M7A G;  4O5V A;  1NLP C;  2RJC A;  1RI0 A;  4HA8 A;  1XQH A;  1M30 A;  1M9S A;  4BDZ A;  1M3A A;  4C92 D;  1VQ5 T;  1WXB A;  1V1C A;  3R6N A;  1JQQ A;  2PTK A;  3H0F A;  3L1A A;  2LVM A;  3CBP A;  3H0I A;  2G6F X;  1SEM A;  4LNP A;  2KYB A;  3RKY A;  3OBY A;  4FSX A;  3BE3 A;  3MPU B;  2DX1 A;  1YFN A;  2RN8 A;  3G4S Q;  1NLO C;  4F7U E;  1VOM A;  5GAN j;  1H64 1;  1ZUU A;  5GAN 4;  5HCK A;  3ZEH A;  2CH4 W;  2RF0 A;  1VQ6 T;  5A2Q E;  1OQK A;  2FPE A;  4OP0 A;  1UFF A;  3V8K A;  1FYN A;  1VQN Q;  4BE2 A;  2DD4 A;  4JLI A;  1VYT A;  3GBQ A;  3QHS A;  1WA7 A;  1S72 Q;  3OYB A;  1ZSZ C;  3SB2 A;  3VS4 A;  2EJ9 A;  4ESR A;  2ZZD A;  4AFZ C;  4BAC A;  4RG8 A;  1M8V A;  1Q95 G;  1T0J A;  2EFI A;  1VQ6 A;  4ZNX A;  3OQ5 A;  5CKF A;  5KCH A;  4Q5W A;  4ATO A;  3PIP A;  2R5M A;  1WHL A;  1TUG B;  1JB0 E;  1YWO A;  2F1L A;  2XI9 A;  3OYG A;  5EG2 A;  1VQL T;  1AHJ B;  3EFO A;  1K0S A;  3QDF A;  2KNB B;  2NLU A;  4RCC A;  2RJE A;  2E64 A;  2RMO A;  5LL6 S;  2E10 A;  1D0Z A;  2XIC A;  3CCS Q;  3JCM J;  1B7T A;  1B34 B;  3L42 A;  1TG0 A;  4WTO B;  1OPL A;  3C0C A;  1SHF A;  1VQL A;  4FIB A;  2NUT A;  5DM7 R;  2RHY A;  4D6W A;  5GAN f;  1YJN A;  4M77 D;  1KD1 C;  1YJW Q;  3FEO A;  3JCM e;  3CC4 Q;  4JZ4 A;  1K0X A;  5D6Y A;  2MYS A;  1YNZ A;  4PFZ A;  2KT8 A;  3MEV A;  2V1Q A;  1YIJ Q;  1MNE A;  4RTZ A;  2E6Z A;  4KGZ B;  3SHW A;  3PVQ A;  4IUU A;  2X3X D;  4B9X A;  3ASK A;  1BI2 A;  3VS7 A;  2JTE A;  2EAY A;  2D1X A;  4D8D A;  2QAZ A;  3QSU A;  1WHH A;  2CP5 A;  4IUV A;  1M1K U;  1TWB A;  2EW3 A;  1R0B G;  2YSQ A;  1PSF A;  1K1Z A;  1W4S A;  2LP5 A;  4XU2 A;  4CC4 B;  4J7F A;  3OYA A;  3CC7 T;  1N5Z A;  2YUO A;  3SDZ A;  3OB9 A;  1AD5 A;  2BZY A;  4C0F A;  1UHF A;  4F14 A;  3QUI A;  3UWN A;  3I5S A;  1KQ2 A;  3HRU A;  2FVU A;  1NYG A;  2YRD A;  1UEB A;  2L3S A;  3G6E Q;  3CCL A;  1PG5 B;  2COW A;  2DXU A;  1Q7Y U;  1YCY A;  1JJ2 P;  2HL3 A;  1C1A A;  2RD1 A;  4CC2 A;  1MHN A;  4J9C A;  4XAX B;  1QKX A;  1UJ0 A;  4ANJ A;  4D8K A;  2GF7 A;  1G8X A;  5IHK A;  1VQK Q;  1UTI A;  3EG0 A;  1Q86 R;  3CCR A;  2KMT A;  1N8R U;  1TH7 A;  3PMI A;  2ROT A;  3NFC A;  3H9N A;  5AT1 B;  2DJZ A;  1UEC A;  2VYT A;  1W70 A;  5I22 A;  3EGU A;  1NPR A;  3PFS A;  4QQG A;  3V7R A;  1W1F A;  2VXE A;  1YI2 Q;  1LVK A;  3QBY A;  3J80 E;  1Q81 R;  3IQL A;  2HQE A;  4Y28 E;  4E7K A;  5GMK e;  1MMA A;  2ZPE B;  2DRM A;  1YJ9 Q;  1QCF A;  1AWW A;  2V26 A;  3QZ9 B;  4PJO D;  1K9A A;  2E12 A;  3X25 B;  1VQ8 A;  1XOV A;  1Y7X A;  4M78 D;  5GAM e;  1O9S A;  4OB0 B;  1ZLM A;  4LN2 A;  4XU3 A;  2EKO A;  2V1R A;  2XK0 A;  1VQO A;  2GTO A;  3PNW C;  5GAO r;  5KYU A;  4RMO A;  4PJJ A;  2CKK A;  4R55 A;  1YIT T;  3EH1 A;  2AT1 B;  4HCC A;  1AZE A;  4AFQ C;  4EMK A;  5GMK h;  1QVF A;  1I5O B;  4QQ6 A;  2K5I A;  4XQ3 A;  1QP3 A;  2KE9 A;  3HL8 A;  1M2V B;  3UDC A;  1VQM A;  4OMN A;  3PMT A;  2EYX A;  2ROL A;  2KT1 A;  2KSS A;  1WJS A;  1OV3 A;  1BU1 A;  2RHI A;  4LE9 A;  1WXT A;  2O9S A;  4PJO A;  4ZN1 A;  3CMA T;  1KQS P;  1U5S A;  3INZ A;  2DK3 A;  1TOV A;  4M78 A;  2DM1 A;  1OI1 A;  5J26 A; 
#chains in the Genus database with same CATH homology
 2VKN A;  1GCQ C;  2JW4 A;  5EC7 A;  3I35 A;  1PNJ A;  2W0Z A;  4LUD A;  4RTU A;  1M8M A;  2ED0 A;  1RI9 A;  2DE0 X;  4HVW A;  2L3P A;  1TUC A;  2SEM A;  2EYW A;  4J9F A;  4JJD A;  1Y57 A;  2KRM A;  2M0Y A;  2VWF A;  2JS2 A;  2BZ8 A;  5IXB A;  2X3W D;  2K7A A;  2AKK A;  3JV3 A;  4KRT A;  2DF6 A;  3VS2 A;  1WLP B;  1ZSG A;  1ZBJ A;  2DL8 A;  1AEY A;  1LCK A;  3RNJ A;  3TVT A;  1NEG A;  2CDT A;  1AVZ C;  1PRL C;  1PWT A;  2JMC A;  3KFV A;  2DBM A;  3UA7 A;  1PRM C;  2CSI A;  4X1V A;  2E5K A;  2D8H A;  3EHR A;  1NEB A;  1VA7 A;  2DL5 A;  2EQI A;  1AWJ A;  4WCI A;  5GJV B;  3LH5 A;  1ZUK A;  3VS3 A;  1X43 A;  3M0S A;  5I11 A;  1ZUY A;  2KXD A;  3QWX X;  3PVL A;  1G2B A;  2JS0 A;  1MUZ A;  2P4R A;  1H3H A;  4IIO A;  1E7O A;  1SRL A;  3O5Z A;  4RTV A;  1EFN A;  2YUP A;  2DBK A;  2F2W A;  2DL4 A;  1UDL A;  2HEQ A;  4F16 A;  5FW9 A;  2DIL A;  2K2M A;  2RQR A;  2JXB A;  1M3C A;  2DVJ A;  1A0N B;  2L2P A;  4HVU A;  1UHC A;  2FEI A;  1X6G A;  4J9H A;  1QLY A;  4E6R A;  1VYU A;  3M0P A;  4Z88 A;  2DA9 A;  5GJW B;  1WYX A;  4OMM A;  2ED1 A;  2GGR A;  2JT4 A;  3I5R A;  5FWC A;  2RNA A;  3VS5 A;  1K76 A;  1G83 A;  4HCK A;  2EGC A;  1YN8 A;  1QWF A;  3TSW A;  1PHT A;  2CT3 A;  2FO0 A;  2IIM A;  1OPK A;  3PE0 A;  4HVV A;  4Y92 A;  2ECZ A;  3UA6 A;  4Z89 A;  1UE9 A;  1WFW A;  2DL7 A;  1JXO A;  2JM8 A;  2GBQ A;  1TUD A;  2DRK A;  4M4Z A;  5IXF A;  1HD3 A;  2H8H A;  4FSS A;  4ORZ A;  1H92 A;  1SHG A;  4GBQ A;  2CSQ A;  2KEA A;  4OML A;  1AWX A;  2DYB A;  1MV3 A;  1JXM A;  1BBZ A;  1KSW A;  1X69 A;  1GRI A;  4J9B A;  1UGV A;  1RLQ C;  4CC3 A;  1NLP C;  2A28 A;  4HXJ A;  4AG2 C;  3UAT A;  1M30 A;  2FG0 A;  1T3L A;  4LUE A;  2EPD A;  1BB9 A;  2EBP A;  3SEM A;  1X2Q A;  1M3A A;  2ENM A;  1WXB A;  1V1C A;  3R6N A;  1JQQ A;  2PTK A;  3H0F A;  3VRZ A;  2J6K A;  3H0I A;  2G6F X;  4RTW A;  3EG2 A;  1SEM A;  2SRC A;  1S1N A;  1U06 A;  4LNP A;  2KYB A;  2L3Q A;  1Y0M A;  1M27 C;  3QWY A;  4AFU C;  1HSQ A;  2HCK A;  2DX1 A;  2MIO A;  2HDA A;  3ULR B;  2RN8 A;  1NLO C;  2KR3 A;  1WIE A;  1ZUU A;  2RPN A;  5HCK A;  1OEB A;  1CKA A;  4AFS C;  2OI3 A;  2K9G A;  2CH4 W;  2DJQ A;  3NPF A;  4JPB W;  2RF0 A;  2MCN A;  4Z8A A;  2FPE A;  1UFF A;  1X6B A;  1FYN A;  4AG1 C;  1U3O A;  2NWM A;  1VYT A;  2GNC A;  3GBQ A;  1WA7 A;  1WXU A;  2K6D A;  2J06 A;  3ZL7 C;  4RTT A;  1NYF A;  3VS4 A;  1KIK A;  1X27 A;  2DLP A;  1ARK A;  2EGA A;  2ESW A;  5ECA A;  4ESR A;  1UUE A;  1GFC A;  2EGE A;  4AFZ C;  1X2K A;  1HJD A;  2RQU A;  3M0Q A;  2VVK A;  1T0J A;  2K79 A;  1AZG B;  4ZNX A;  2LQN A;  2LMJ A;  2J7I A;  1CSK A;  1QKW A;  4JJB A;  2AZV A;  2HBW A;  1QWE A;  1YWO A;  2K3B A;  1ABO A;  1GCP A;  3VRY A;  2KBT A;  4RTY A;  1K0S A;  5IHN A;  2KNB B;  2YUQ A;  1YP5 A;  1GBR A;  1YWP A;  2RMO A;  3EG3 A;  3H0H A;  2JM9 A;  2AZS A;  1JU5 C;  1AWO A;  2NUZ A;  2KRO A;  1TG0 A;  1OPL A;  2C0T A;  1SHF A;  2LZ6 B;  3C0C A;  1VYV A;  1B3Q A;  3TSZ A;  1E6G A;  1IO6 A;  3REA B;  1PKS A;  1KJW A;  2KYM A;  2C0O A;  3VS6 A;  2O2O A;  1AOJ A;  3A98 A;  4IIM A;  5IHI A;  2QDL A;  4JZ4 A;  1K0X A;  1SSH A;  1YNZ A;  2MOX A;  2DL3 A;  3I9Q A;  1NG2 A;  3VS1 A;  2KT8 A;  2V1Q A;  4A63 B;  1WI7 A;  4RTZ A;  3SHW A;  3PVQ A;  4J9E A;  2X3X D;  2CUB A;  3U23 A;  5FWB A;  3EHQ A;  2KRN A;  3VS7 A;  2JTE A;  2D1X A;  4D8D A;  2C0I A;  2LJ3 A;  4QT7 A;  1RUW A;  2A36 A;  2CH4 A;  1GFD A;  2EW3 A;  2XMF A;  2RQV A;  1UG1 A;  2YSQ A;  3M0R A;  1K1Z A;  5IH2 A;  2KXC A;  3EG1 A;  2EVR A;  2LJ0 A;  2LP5 A;  4R0K A;  3VS0 A;  4CC4 B;  2A37 A;  1MV0 B;  1I07 A;  2FPD A;  2DNU A;  1N5Z A;  2YUO A;  4JJC A;  1YCS B;  4J9I A;  2F2X A;  1AD5 A;  2BZY A;  1UHF A;  1SPK A;  4F14 A;  3I5S A;  1CKB A;  1Z9Z A;  2CRE A;  1NYG A;  2D8J A;  2GTJ A;  2HSP A;  2L3S A;  1M3B A;  2CUD A;  2OAW A;  2BTT A;  4RUG A;  4CC2 A;  4J9C A;  1QKX A;  3NMZ C;  1UJ0 A;  4D8K A;  1JO8 A;  5IHK A;  2L0A A;  2LQW A;  2LX7 A;  2AKL A;  1UTI A;  3NGP A;  3RBB B;  1JEG A;  1WX6 A;  3EG0 A;  1GCQ A;  1BK2 A;  5L23 A;  2I0N A;  3FJ5 A;  3CQT A;  3REB B;  2D0N A;  2ROT A;  4RTX A;  1SRM A;  1RLP C;  2FRY A;  1WDX A;  2FPF A;  4K11 A;  1UEC A;  1W70 A;  2KRS A;  2BZX A;  5I22 A;  3EGU A;  2KGT A;  1W1F A;  4J9G A;  1Z9Q A;  4F17 A;  1ZX6 A;  2LJ1 A;  2OJ2 A;  2O9V A;  3IQL A;  2M51 A;  4EIK A;  2EYY A;  2J6F A;  1GBQ A;  2YUN A;  2DRM A;  3NHN A;  1K4U S;  4GLM A;  1FMK A;  1QCF A;  1PKT A;  1AWW A;  1K9A A;  2J05 A;  1ABQ A;  2YDL A;  2W10 A;  3H41 A;  2F2V A;  1XOV A;  2LNH B;  4JZ3 A;  1UJY A;  1ZLM A;  2O31 A;  3M0T A;  4LN2 A;  2V1R A;  1T0H A;  3THK A;  1I0C A;  2GTO A;  2DMO A;  2RQT A;  1E6H A;  4OMP A;  2B86 A;  2LCS A;  4DEY A;  2O88 A;  2EKH A;  1AZE A;  2GQI A;  4AFQ C;  1W6X A;  4DEX A;  2AK5 A;  1J3T A;  2ABL A;  1B07 A;  1NM7 A;  2PZ1 A;  1OOT A;  2KE9 A;  4OMN A;  2PNI A;  4OMO A;  2EYZ A;  1H8K A;  2EYX A;  2ROL A;  2KT1 A;  1OV3 A;  2RQW A;  1BU1 A;  2FRW A;  2J6O A;  1WXT A;  4LE9 A;  2O9S A;  3M0U A;  1I1J A;  2JMA A;  1GL5 A;  4OMQ A;  1U5S A;  3UF4 A;  4CC7 A;  2A08 A;  4J9D A;  2YT6 A;  2DM1 A;  1KFZ A;  1T3S A;  2CT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...