1MV0B

Nmr structure of the tumor suppressor bin1: alternative splicing in melanoma and interaction with c-myc
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
81
Chain Sequence
b'GRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKKLEKCRGVFPENFTERVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myc proto-oncogene protein
molecule tags Endocytosis/exocytosis, transcription
source organism Homo sapiens
publication title A structure-based model of the c-Myc/Bin1 protein interaction shows alternative splicing of Bin1 and c-Myc phosphorylation are key binding determinants.
pubmed doi rcsb
total genus 12
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2002-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1mv0B00
1QCFA 2ESWA 1WXTA 4LUDA 1WX6A 2K3BA 4OMMA 2KR3A 1JQQA 2LX7A 3PVQA 2KE9A 4LNPA 2CT4A 1NEGA 2DX1A 3THKA 4A63B 2LJ1A 2VKNA 3M0TA 2JTEA 4HVWA 1PRMC 4AFUC 1XOVA 2DF6A 2E5KA 4GLMA 2YDLA 5IXBA 1VYUA 4M4ZA 1UDLA 1M30A 1Z9QA 3VS6A 1AWOA 1WXBA 1BU1A 2L2PA 4J9DA 3H41A 2LJ0A 4AG1C 1JXOA 2YUNA 4IIMA 2YUOA 1YP5A 1RLQC 2OAWA 3EG2A 4LUEA 2RQRA 1TUCA 2EYYA 1B07A 2FRWA 3I5SA 4ZNXA 2XMFA 2A36A 4HXJA 2JXBA 2DLPA 2CREA 2YUPA 1A0NB 3U23A 2EYZA 2X3WD 2LQNA 3REBB 2CDTA 4J9EA 1GRIA 1WFWA 5GJVB 1WLPB 2HSPA 4D8KA 1WXUA 2ED0A 1X6BA 1M3AA 1BK2A 4AFZC 3EG3A 1UJYA 2EVRA 1H3HA 1W1FA 2DL5A 2ABLA 2GTOA 2JT4A 3RNJA 1Y0MA 1H92A 1T3SA 2KT8A 2FPDA 1QLYA 5FWCA 2VVKA 2DL7A 3CQTA 2M0YA 2LNHB 4OMNA 1NM7A 2A37A 1WI7A 2BZ8A 2DVJA 5GJWB 1KFZA 1QKWA 1YWOA 3NHNA 2RPNA 3M0UA 1RLPC 2EQIA 1ZLMA 4EIKA 1FMKA 2J6FA 4LE9A 4CC4B 4JJDA 2DM1A 1X43A 1OPKA 3KFVA 1X2KA 1NYGA 1WA7A 3LH5A 2DBMA 4J9CA 1V1CA 1SPKA 1M27C 1IO6A 3NGPA 1AZGB 3ULRB 1K4US 4JZ4A 1Z9ZA 1UFFA 1S1NA 3QWXX 1U5SA 5IXFA 1UHCA 3EGUA 4HCKA 4RTYA 1I1JA 4RUGA 2D8HA 3RBBB 1PNJA 1UGVA 2KEAA 1HD3A 1GFCA 2ENMA 2EYXA 2DYBA 1ZUKA 2C0IA 2EKHA 3TSZA 4Y92A 2LQWA 2F2XA 2LMJA 1X27A 2FPEA 2O88A 1G83A 3H0IA 1U06A 2O9SA 2FG0A 4Z89A 2EW3A 2CUDA 4WCIA 2AK5A 2JS2A 4JPBW 2K7AA 1K9AA 5HCKA 2PZ1A 4DEXA 2KRSA 4CC3A 3EG0A 1SRMA 2DNUA 3TVTA 1CKBA 2HCKA 2V1QA 1K0XA 2J06A 4RTTA 1GCQA 1OEBA 2L3QA 1I0CA 1AWXA 2EBPA 4CC7A 4Z8AA 2KRMA 4FSSA 4JJCA 1AWJA 2LJ3A 1TG0A 2AZSA 2MIOA 2KXCA 2DL3A 1U3OA 2QDLA 2DL8A 1BB9A 1M3CA 2AZVA 1T3LA 1UG1A 3M0SA 4RTXA 5L23A 2EGEA 1HSQA 1N5ZA 1JXMA 2VWFA 4D8DA 4J9BA 3VS3A 2EYWA 1BBZA 3VS0A 1SSHA 1MV0B 4QT7A 3H0FA 1PWTA 3O5ZA 2FRYA 2JS0A 1KJWA 2DA9A 2X3XD 2H8HA 5IHNA 1CSKA 2GGRA 3I5RA 2SRCA 4J9FA 1UJ0A 4J9HA 2CSQA 3H0HA 4AFQC 4R0KA 2FEIA 1UE9A 4DEYA 1X2QA 1WIEA 1YNZA 3VS2A 4F14A 3UF4A 2V1RA 2W0ZA 3TSWA 3UA7A 3I35A 2KXDA 2B86A 1K76A 1TUDA 3UA6A 3A98A 1LCKA 2F2WA 3ZL7C 2EGAA 2KROA 1ZBJA 4HVVA 3VRYA 1AZEA 1NYFA 2BTTA 4J9GA 1NEBA 1W70A 3C0CA 2KGTA 2K9GA 3EHQA 1K1ZA 1KSWA 2GTJA 2RMOA 2RQVA 1GBRA 4RTUA 2ROTA 1AWWA 2DMOA 1GCQC 1PKTA 2J05A 3NMZC 2SEMA 1B3QA 4AFSC 1OV3A 4OMPA 1SHGA 4F16A 4IIOA 3M0PA 3I9QA 1ZUUA 2L3SA 2A28A 2ED1A 1JU5C 2O9VA 2LCSA 1H8KA 2PNIA 1AOJA 1PHTA 2CSIA 1T0HA 1NG2A 2C0OA 1UHFA 2D0NA 3VS1A 1ABOA 1T0JA 4JJBA 1K0SA 2YT6A 4OMOA 1QWEA 2KYBA 3UATA 4E6RA 1G2BA 1M3BA 1VYTA 3REAB 2J6OA 2CUBA 2F2VA 1UTIA 1NLOC 2JM8A 1J3TA 2GNCA 1SHFA 2DILA 1RUWA 2J7IA 1PRLC 4ESRA 1UUEA 1YWPA 1RI9A 2M51A 2MOXA 3EHRA 2K6DA 3QWYA 2KBTA 2DBKA 2BZYA 1GL5A 2JMAA 1YN8A 1M8MA 2DL4A 5I22A 1ABQA 1ZSGA 5IHKA 3VS4A 5FWBA 1YCSB 2FO0A 2OJ2A 3VS5A 2C0TA 3VS7A 2AKKA 4RTZA 4Z88A 2GBQA 2ROLA 4AG2C 3SHWA 3GBQA 1GFDA 1FYNA 2HEQA 4KRTA 1AD5A 1E7OA 2RQTA 2OI3A 2G6FX 2LZ6B 2HBWA 3EG1A 2RN8A 5I11A 2DRMA 2L3PA 3M0QA 2NWMA 2P4RA 1MUZA 4F17A 2J6KA 2O31A 2ECZA 2YUQA 2NUZA 2JW4A 1ARKA 4HVUA 2JM9A 2RF0A 2K79A 1JEGA 1MV3A 2GQIA 4JZ3A 2DE0X 3SEMA 4RTVA 2KRNA 1ZX6A 1SRLA 1X6GA 5EC7A 1EFNA 1E6GA 1VYVA 1X69A 2AKLA 2K2MA 2LP5A 3JV3A 1PKSA 1AVZC 4K11A 2YSQA 1Y57A 4ORZA 2W10A 5FW9A 2RQWA 3FJ5A 2KNBB 4RTWA 1WDXA 3R6NA 2EGCA 1GBQA 1GCPA 1AEYA 1WYXA 5IHIA 2KYMA 3PVLA 2CH4W 2A08A 2IIMA 2CH4A 2EPDA 1UECA 3IQLA 3M0RA 3PE0A 2PTKA 5IH2A 2O2OA 2I0NA 4OMLA 2JMCA 2FPFA 1JO8A 1NLPC 2D1XA 1OPLA 3NPFA 4GBQA 1HJDA 2KT1A 4CC2A 2RNAA 2RQUA 2MCNA 4X1VA 2D8JA 2DJQA 5ECAA 1SEMA 1I07A 4J9IA 1QKXA 1ZUYA 2L0AA 1OOTA 2CT3A 1W6XA 2HDAA 2DRKA 1QWFA 1KIKA 1CKAA 4LN2A 4OMQA 2BZXA 3VRZA 1VA7A 1E6HA
chains in the Genus database with same CATH superfamily
2E5QA 5FLXE 1Q86R 4DBHA 2VGMA 3G4SA 1HYOA 4M7DB 4BI8B 2KE9A 4LNPA 5KYXB 3GOXA 3OYMA 4ANJA 5CR2A 4A63B 4IUQA 2VKNA 2QA4A 1XOVA 3BFMA 3HRUA 4FSXA 4M4ZA 1UDLA 3CPWS 2QQAA 3VS6A 2QTXA 1BU1A 3A8GB 2L5QA 2GFAA 2RHXA 3HHTB 4AG1C 1JXOA 2GQVA 3BW1A 1YP5A 3OS1A 3LH0A 2RQRA 5CQYA 4PFPA 1R0CB 3CMAA 2A36A 4M7AA 2EYQA 1KQ2A 2DLPA 2DTHA 3J7AF 2YUPA 1A0NB 5DLOA 2EYZA 4IUUA 3C12A 3NFCA 2OTLT 3REBB 1OU9A 2A0FB 5KCHA 1C0MA 4FYXB 1B7TA 4LDWA 1M3AA 2AIRB 3M56A 2JJ9A 3EG3A 3TEEA 1ZA2B 1PSEA 2EVRA 1W1FA 1KD1C 1Y0MA 4M78E 2DKGA 4M7DA 2KT8A 3OW2S 1JB0E 1KD1R 3CCEA 4E7IA 2QYZA 3S3OA 4N4IA 4TVRA 4E7ZA 4M75B 2XD0A 2X51A 4MZMA 3JCMf 4EIKA 2QQBA 4LE9A 3JCMd 4R56A 2CYZB 5AYFA 3M54A 2RD1A 1Q7YR 2YRVA 1V1CA 3MHXA 3GP8A 1M27C 3VYGA 1YI2T 3N5BB 4Y91A 1AZGB 3ULRB 2FZGB 2XIDA 3MJXA 1Z9ZA 4DBQA 3FLGA 2ZAEA 4F7UB 4FL6A 4PL6A 4DOWA 1NZ9A 4ZGEB 1YHQT 2M9UA 3S6WA 1PNJA 1DJ7B 2FL7A 2DXBA 1GFCA 1PCXA 1MMDA 3CC7Q 2DYBA 1ZUKA 1XTDA 2E65A 4X9DA 3CCJA 3JCMg 4ELZC 2O9SA 1YITT 2FG0A 2CUDA 1TOVA 3CCMT 1X6OA 1WGSA 3JCMc 4JPBW 5CO7A 1K9AA 3CCLQ 3EGXA 1BKBA 2MMPA 2ZPIB 2HCKA 2J06A 2HBPA 1OEBA 2KY9A 3E19A 1UB4A 5GAOn 2Y4XA 4NL2A 1I0CA 1AWXA 2EBPA 4CC7A 4Z8AA 2KRMA 4KGVB 1VQOA 1AWJA 3OBYA 3HRTA 2QQ9A 1VQ6Q 2ZGWA 4LD6A 4DA4A 1MNDA 3I55A 1N8RU 2DL8A 1RAFB 2XHCA 2AZVA 1KQSS 3M0SA 1YFNA 5L23A 4KT0E 3CCRQ 4J83A 3EH2A 1N5ZA 3QDRB 1VQPT 1BI0A 1SSHA 4M78C 4VUBA 1KQSA 4HA8A 1TWBA 3H8ZA 2DA9A 2X3XD 2FZKB 1D09B 1CSKA 2GGRA 2YRDA 4HCBA 2LNVA 2IG0A 4R0KA 2FEIA 4PJOA 1UE9A 1TSFA 4DEYA 3EFRA 1YNZA 3A1PA 4C5IA 2V1RA 2HQXA 4B6MA 3I35A 1VQ6A 4L5GA 2OTJA 3A98A 2EGAA 1VQ9Q 2CS7A 3DLLA 4HVVA 2XG8D 2RK1A 4NS5A 4XTYA 1VQNA 2BTTA 1KD1U 1W70A 2M02A 1U1TA 3EHQA 2RMOA 4BI4A 2RJEA 2ROTA 4BUGA 2RJDA 2R5AA 4JJNK 3ER0A 4FYVB 4OB3B 1GCQC 1PKTA 4A4FA 4F04B 2DYIA 2PQWA 1OV3A 3E9FA 3G7ZA 1Q7YU 3M0PA 3I9QA 5D6YA 2E6ZA 3CCLA 4M7AE 1SF9A 3RESA 1JU5C 4RG2A 3RKXA 3X20B 2HQHA 4BE2A 4FYWB 1AOJA 5KYNA 1T0HA 1PSFA 4C92E 2C0OA 5LJ3g 4JJBA 4PJOE 1K0SA 2YT6A 5CQXA 2JZ2A 2KYBA 2X9HA 4C8QC 1G2BA 3REAB 3M58A 3CMEA 2F2VA 5FRMA 3LX7A 1VQPA 5L8RE 2JM8A 1EX4A 2EQKA 4N0AA 3OMCA 4XAXB 2M16A 1VQOT 3JB9I 1Q81C 1VQ8T 4LDVA 4XU2A 3CC2T 5A0DA 1UUEA 1I8FA 1NBEB 2BZYA 1GL5A 2JMAA 1YN8A 1M8MA 3HRSA 1Q81R 3X28B 3JB9D 5HK3A 3CC4Q 3ME9A 2OJ2A 1RAIB 4Z88A 4RTZA 4BD3A 1Y7XA 2GBQA 2YWWA 5GAN2 2LTOA 4M7AC 3CPWP 3JB9J 1M2OA 5GMKi 3HP9A 2XU8A 4A4KA 2CZ6B 2HBWA 3OW2A 2DRMA 3A8OB 3M0QA 3OYAA 1B34B 2P4RA 3OS0A 1BCOA 3KXTA 4Z02A 1QW1A 3CC2Q 4HVUA 2RF0A 2K79A 1MV3A 5GAMd 2DE0X 2QEXA 3OYEA 1LPLA 1BIBA 2QK0A 1E6GA 1VYVA 2AKLA 2K2MA 3M5AA 3CBOA 2DO3A 1QMCA 2PUKB 1RAEB 3H9NA 4ORZA 3L2WA 5CAIA 4M75C 3NTHA 1S72A 5FW9A 3CPWA 4E47A 1YJNA 2EGCA 4F7UE 4EMKC 4JLGA 1NE8A 1GBQA 1GCPA 2ZPHB 3HPWA 4E7LA 3QIIA 3M55A 3DB4A 1RI0A 2LDMA 2VYTA 2DETA 3PVLA 2IIMA 3I56T 2HQEA 4M78G 4JLIA 1UECA 3SDZA 3CCST 4A4HA 1O75A 5I2MA 1ZHIA 3RMQA 4JRPA 4LDUA 2O2OA 2JMCA 3WVEB 4XTVA 1KQ1A 2HSEB 3FJPA 2LT1A 4HCCA 2D1XA 3G71T 1HJDA 2KT1A 3TCJA 3OYIA 4DOVA 2D8JA 3INZA 4JRKA 1QKXA 4PJOC 5A0GA 4PKCC 2CT3A 4PNOA 5CKDA 1KIKA 1VQ7Q 1CKAA 1VQ4A 1XQHA 1QVFS 1S72Q 3RKYA 1SG5A 3WXMB 1M1GA 3CCVQ 5CKBA 1K8AR 2KI7A 4M7DE 2NUTA 2NUTB 3LWHA 4OP0A 2LX7A 3EG9B 5GANf 3META 1VQMQ 2LQKA 1M2VA 2E6NA 3V8KA 3CEYA 2QEXQ 3CPFA 4M77F 1OZ2A 3Q1JA 4AFUC 2X4XA 1MMGA 2RI5A 5IXBA 4FU6A 3URGA 2KAFA 2H3EB 3CCRT 1D0ZA 2QA4T 2XDBA 4DQ2A 1NPPA 3JCMW 1YJ9A 4ELYC 2V8IA 3EFOA 3CD6A 1PC0A 2R5MA 1K73R 4J9DA 4IIMA 2XICA 2OTJQ 2YLCA 3JCMh 3L2ZA 4P5NA 3EG2A 1Q81U 1K9MR 3GIBA 2HNIA 4KUDK 4J7IA 1K73C 2XMFA 1QCNA 2K4YA 4FM4B 1QP2A 1D1CA 2QTVA 3OQ5A 2X3WD 2A7YA 2ED0A 1X6BA 2HMAA 2MPXC 4C0ZA 1UJYA 1H3HA 1RL2A 2ABLA 4C0DC 4XTUA 1WJRA 3S3NA 4ZTJA 2FB7A 2EQMA 1NJIC 2LC4A 2M0YA 3X24B 3CXCS 1WHGA 4II1A 2XI9A 4FYYB 2DVJA 1Q7YC 4ZGDB 1VQ7T 2VC8A 3NHNA 3CBMA 1RLPC 1K8AC 2EQIA 1ZLMA 3BE3A 2J6FA 4CC4B 1KK7A 2O4XA 3CC4T 4OB1B 1VQ4T 2DERA 1X43A 1WA7A 1VQKT 2DBMA 4O6JA 4J9CA 4FW2A 2RK2A 2PVOB 5FU6B 1VQKA 2DXCA 5D7UA 2CZ0B 5D6XA 1IO6A 4XK8E 1IRXA 1K4US 2HKQB 2E41A 4KUIA 3QWXX 4KGZB 5IXFA 5LJ3f 1LVKA 2HKNA 3J81E 5CCAA 2DVEA 3HFNA 2CP2A 3G71A 4M7DC 1F1BB 2GFUA 2V8KA 1WZOA 3MPUB 2GF7A 5DY9A 3PNWC 2EKHA 3TSZA 2LQWA 2F2XA 3V7SA 2FPEA 1RAHB 2HL5C 4N0AC 2E4HA 4Z89A 1VQ8A 1QCOA 2AK5A 2JS2A 1YCYA 4A54A 3OYJA 4MDXA 2LVMA 4GY5A 4J6YA 3EG0A 3T9NA 2DNUA 2KDSA 3O8VA 4M78B 2V1QA 2VXEA 2NYSA 3E2UA 1IREB 4FCYA 4UC4A 4IUTA 1YI2A 2QAZA 3QHSA 1WHLA 3FRNA 3JB9G 3CCQQ 2KXCA 1U3OA 2NUPB 1BB9A 4PLLA 1M3CA 1PD1A 4R55A 3CCUA 4RTXA 3TQ7P 2OTJT 2FZCB 3P8BB 1HSQA 2O01E 5LJ5e 3NTIA 2VWFA 2LCCA 4J9BA 4PLIA 3VS3A 1M4ZA 1G5VA 2EYWA 5GANe 2JOYA 4OVAA 1MV0B 3HL8A 4QT7A 2M0OA 3OSSC 3EG9A 1KJWA 3TU4K 3UWNA 2H8HA 1FXXA 4HT9A 4MMKA 1YJNT 4J9HA 3PT9A 2CSQA 2X4YA 4C5GA 3NTKA 5DM7R 3V7CA 3VS2A 1D1AA 1VQNQ 3TSWA 3UA7A 1Q86U 1TXQA 4M77E 5FRNA 1JRIA 1ZBJA 3VRYA 1KHCA 1WHKA 2L89A 4PFZA 4M75A 1UGQB 2K9GA 3CC7T 1EZZB 5CK9A 4WTOB 2RQVA 1MMAA 1WQWA 4M78D 2MYSA 4JUVA 4BE1A 4CRIA 1YJNQ 3PFSA 5GAN6 3QDFA 1ZUUA 2L3SA 2A28A 1QVPA 2ED1A 3CXCA 2VUBA 2O9VA 2P84A 1OU8A 3H6ZA 4X9CA 2HZYA 4J6XA 4OB2B 4ATOA 3QUIA 2CSIA 4XTXA 5GAN5 2D0NA 2YLBA 4EPCA 1ABOA 3QXEB 1JJ2P 4OMOA 4M7AB 1M2VB 4MZTA 2J6OA 2CUBA 1UTIA 4J8OA 4EMKB 3CC2A 4RKUE 5C0MA 2ZPEB 3X25B 2GNCA 3UDCA 2X4WA 2DILA 3QKJA 4PJJA 1XJWB 6AT1B 1PRLC 4HCZA 3JB9F 5GAOl 2CP0A 2B8AA 3SB2A 2K6DA 2DBKA 3QG1A 4JRQA 3QPHA 5I22A 1ABQA 3JCMJ 4M7DG 4BACA 3AHUA 2KK4A 4PJNA 4OGCA 1YCSB 2FO0A 3VS5A 1AT1B 2AKKA 2GCXA 2IVWA 2MWPA 4KH0B 4JS5A 1LOJA 3SHWA 3GBQA 5KYXA 1IGUA 2HEQA 4KRTA 3QZ9B 2HD0A 4NL3A 2LZ6B 3EH1A 2EFIA 3SWNC 4M75F 2L3PA 2PVGB 2PVDB 1MUZA 2PUOB 3G71Q 2YUQA 4LD9K 2RO0A 4IKFA 2GQIA 3OYLA 5EG2A 2LQ8A 3CMET 3SEMA 4B9WA 4RTVA 2KRNA 5KYUB 1X6GA 2WACA 5CVIA 3ASKA 1EFNA 2E70A 3G4SQ 1Y96B 3OS5A 4XTZA 1AVZC 2OAUA 4KBMB 1Y57A 4M77C 2EWNA 4WF2A 1YITA 1I81A 4E7SA 5HKCA 2DXTA 4A4EA 5IN1A 1M1KR 1WDXA 3CCSA 5CIUA 4EDUA 1AEYA 2KYMA 4KGXB 5IT9E 2CH4W 2XK0A 3L1AA 2CH4A 5FU7B 1V76A 4C92G 1M8VA 5GANg 3ZFJA 1YHQA 3KBGA 2HL3A 5IH2A 1G8XA 1D3BA 3RR6A 2I0NA 4OMLA 1MMNA 2D6FA 3F70A 3NPFA 1K73U 4GBQA 4C5EA 3RUXA 2RQUA 4X1VA 2DJQA 1UEBA 4ZN1A 1OOTA 3JCMP 2HDAA 3S3MA 1I5OB 2CP7A 4LN2A 3EAEA 5CKHA 1VA7A 1QCFA 2PU9B 5GAOp 3OYYA 4LUDA 3CD6T 2F5TX 1WX6A 1Q82U 2KR3A 1V29B 1RAAB 1OZ3A 3PVQA 2RHYA 2G3RA 1BI2A 1WHMA 4A53A 1N8RR 2CT4A 4PFOA 3THKA 4J6WA 4M7AD 2DF6A 2ATCB 1LJOA 2CZ1B 2YDLA 1VYUA 1JBMA 1M30A 4PJOD 4PJLA 3JCMb 1ZSZA 1I4K1 2V8JA 3D7SB 4LDYA 3CCQA 1K9MC 3CCJQ 1IGQA 1W2BS 1MHNA 2L2PA 2MF2A 2R58A 2LJ0A 1ACMB 2YUNA 1M5Q1 2YUOA 3RERA 3X26B 1N27A 4LUEA 1TUCA 2EYYA 1B07A 2FRWA 4C92F 4ZNXA 3L42A 2ZPGB 4HXJA 2JXBA 1Y07A 2CREA 1WHHA 3U23A 2CDTA 3OYKA 1WFWA 4D8KA 1WXUA 1BK2A 5GMKh 2CP3A 3M4YA 1SSFA 2K3XA 1WJQA 4M78F 3PGGA 2GTOA 2JT4A 3RNJA 4Q5WA 1H92A 4A4GA 2I2LA 1FX7A 1QLYA 5HK0A 2DL7A 3CQTA 2RH2A 3MEAA 2LNHB 4OMNA 3OW2P 1M90U 2BZ8A 1KFZA 1IB8A 4JDSA 5LJ3e 1YWOA 2CGHA 3A8HB 5DLQE 1N9RA 4JJDA 1R0BG 2DM1A 1D1BA 2VXFA 4QW2A 1SPKA 2EQUA 2CKKA 1D0XA 3NGPA 3OYNA 4JZ4A 1S1NA 1TH7A 4QQ6A 4FIBA 5GAOm 2RI2A 1IHVA 4EMHA 1YIJQ 3OYDA 4HCKA 2RA2A 1I1JA 4M77G 3CCET 1YI2Q 2QEXT 3LLRA 4E7KA 2KEAA 1HD3A 2F69A 3P8HA 1OX9A 1UGRB 2A3LA 5KCOA 3VUZA 2K3YA 4Y92A 2QASA 2LMJA 1X27A 2DPPB 2O88A 1G83A 2DJZA 3QYGB 1U06A 3HTRA 4C92C 2VGNA 3A8MB 4WCIA 3JSCA 3CD6Q 5LJ5j 2K7AA 4OGEA 3M57A 3CMAQ 2KRSA 2ZPBB 4CC3A 3CCLT 2O4XB 1SRMA 4MDWA 3TVTA 1CKBA 2AT1B 1K0XA 1VIFA 1GCQA 1C1AA 2L3QA 1GXIE 3QZ5B 2COZA 2EKOA 3DLMA 1VOMA 3OYCA 5GAN4 2BE7D 4FSSA 1YIJA 4M7DD 3CCSQ 4RG8A 1PM3A 5FU6C 1WJSA 1U8RA 2EIFA 1M1FA 3HFOA 1G3YA 1TG0A 3CCVA 1R77A 1LNXA 1VQMA 3JCMX 1P92A 2QDLA 2DD5A 2P4TA 1Q82R 1T3LA 2P0QA 1UG1A 2JTFA 1R8OB 3CCMA 2E64A 5A0LA 2EQJA 2EGEA 3OA6A 4ZN3A 1JXMA 2QDYB 1BBZA 2E12A 2WSFE 3CCJT 3VS0A 3UPUA 3OMGA 1IZ6A 4RCBA 3HSBA 5D6WA 2JS0A 3I56A 1Y71A 1G3WA 1JJ2S 3GF5A 4M77A 4M77B 4N4GA 1N6AA 2BE9B 3CXCP 1X75C 2VB6A 3H0HA 4AFQC 4C8QE 5LJ5g 1UGSB 3L2VA 3L2RA 5LJ5f 4F14A 3UF4A 2W0ZA 3QJ6A 2B86A 1K76A 5LJ3d 5CKEA 3LGLA 2F2WA 3ZL7C 4HKEA 4E2FB 2KROA 1G3SA 2KQWA 1AZEA 1QQJA 4PJMA 1NYFA 4J9GA 1NEBA 1M1KU 1YJ9Q 3C0CA 1WQ7A 3FEOA 2E10A 4BY6C 3CCRA 1GBRA 5KYYB 4QVCA 4RTUA 4V2SA 1MGQA 2JVVA 4M77D 3MP8A 3M53A 3NMZC 2SEMA 1OQKA 1W4SA 4XU3A 4AFSC 4OMPA 4IIOA 2MAMA 4PJOG 4M7AF 3ZBDA 2KSSA 1BIAA 4D6WA 1PHTA 4BDYA 5GANj 1NG2A 2XDPA 1UHFA 3WVDB 1T0JA 4DBFA 1M3BA 1IHWA 2AHJB 3I55Q 1QP3A 2DD4A 3OSVA 1J3TA 5LJ5h 3L2QA 3DKMA 3EFOB 1RABB 1RI9A 2M51A 2JTMA 3MEVA 4ME7A 2KBTA 3JCMQ 1WHJA 2DL4A 1ZSGA 2DK3A 4IURA 3VS4A 5GAOr 2BUDA 2V26A 1VQ9A 1YJWA 2C0TA 3VS7A 3JRZA 2LCLA 1VQ5Q 2ROLA 4AG2C 1KQSP 1GFDA 1E7OA 5I2SA 2DIGA 2OI3A 2G6FX 3EG1A 2RN8A 4FT2A 5LJ3h 3QJYA 5I11A 1VQ7A 2JN0A 4BB7A 2J6KA 2O31A 3TREA 2ECZA 4L6V5 2NUZA 2JW4A 1AHJB 1ARKA 5GANd 2EJFA 1D0YA 2EJGA 3OYGA 4M78A 5LJ5d 3RKWA 1KC8U 5EC7A 3OBWA 3EGXB 3FB9A 3JCMV 1X69A 4B9XA 4XTWA 2LP5A 5GAN3 3JV3A 2WSEE 3KUFA 2YSQA 1RADB 4IUVA 1IXDA 2Y90A 2BIVA 2E3IA 3VU3C 3M9QA 1W2BP 2DIQA 2RQWA 1Q95G 4M75D 1FMWA 3R6NA 1VQ5A 1W2BA 3M59A 5IHIA 2X35A 2IPOB 5I21A 1QVGS 4MMLA 1VQ6T 3IQLA 3M0RA 4F7UA 1H641 3R6OA 3E1SA 3SD4A 2PTKA 1KHIA 5GMKe 2KVQG 1SKUB 3GLXA 4FT4A 3BY7A 2FPFA 1JO8A 2RJFA 1NLPC 5KYWB 4IUPA 4CC2A 3VV0A 2MCNA 1RACB 3MEUA 5ECAA 1SEMA 1I07A 1QVGA 4J9IA 3CBPA 1W6XA 2DRKA 1G3TA 4OMQA 2L8DA 2OTLQ 3VRZA 1YITQ 2ESWA 1WXTA 1VQ8Q 2LRQA 5J3BA 1VQOQ 5J39A 4C8QG 2K3BA 4OMMA 4J5YA 5C6SA 1JQQA 4F7UF 4EMKA 5KE2A 1VQLT 4KH1B 1C6VX 1Q86C 4N4HA 1OX8A 1NEGA 2RHUA 2DX1A 3RIRA 2LJ1A 1YHQQ 4HT8A 3M0TA 2JTEA 4HVWA 1PRMC 2E5KA 4OMFB 4GLMA 3PIOA 3OS2A 1Z9QA 3RMSA 3DB3A 5FU7C 1TS9A 1AWOA 3G6EQ 3A5ZB 4XQ3A 3JAME 1WXBA 3LW5E 4QQDA 5GMKl 3H41A 2LX9A 3G4ST 1RLQC 2OAWA 4BY6B 2JUFA 3EGDB 2QI2A 3I5SA 2FYKA 1O9SA 2FHDA 4LDXA 2R57A 2XDDA 1VQKQ 2X4JA 2LQNA 3VUBA 4J9EA 1GRIA 5GJVB 3AT1B 3FC3A 1WLPB 2HSPA 2RI3A 4JS4A 1VQ9T 2QQRA 1HXDA 3PIPA 5KYWA 1NJIR 4AFZC 3OYHA 2QGGA 3LYIA 2QQSA 2DL5A 2ZPFB 1T3SA 9ATCB 5KYUA 2FPDA 4XU0A 5FWCA 2VVKA 5KE3A 4BE0A 5M9OA 1ZSZC 1NM7A 2A37A 1WI7A 3CCUQ 2YRCA 5GJWB 1QKWA 4NOYA 4XU1A 2RPNA 3J80E 3M0UA 4X34A 3G1JA 3I55T 1FMKA 3VJPA 2VV5A 2NLUA 2RM4A 3QSUA 3KFVA 1OPKA 1X2KA 1VQPQ 1NYGA 3LH5A 4C92D 4QVZA 1N8RC 3VKIA 2DZCA 1OI1A 4E7HA 1VIEA 3UT1A 5GAN7 1UFFA 3JCMe 1U5SA 2ZCFB 1UHCA 1U1SA 2DTIA 3EGUA 4Y28E 4RTYA 4RUGA 2D8HA 3RBBB 1RAGB 2QG9B 3CCEQ 1UGVA 5GANh 1PD0A 4C5HA 2ENMA 2CP6A 1OULA 3C94A 2EYXA 3OYBA 1YJ9T 3CCQT 1PG5B 5IAYA 2C0IA 1M9SA 5LL6S 3MP6A 1VQ4Q 8AT1B 2XKOC 4M7AG 3MCAB 1YJWT 3PTAA 3H0IA 4YTLA 3VYHB 2K5IA 2H3JA 2EW3A 2M1HA 4RCCA 4C0FA 2HAXA 3CCMQ 2DAQA 2DTOA 2DEUA 3P8DA 1XNIA 5HCKA 5GAOq 2PZ1A 4DEXA 2RJCA 4F7UG 5GAMe 1VQLA 3A8LB 3ZEHA 4C8QB 1QVFA 3QO3A 5J26A 4QQGA 2DZ9A 4RTTA 1UGPB 2EAYA 1ZBXA 4ZGJB 2P0KA 4C8QA 4JJCA 2Y4YA 2BKDN 1VQ5T 2LJ3A 1M90C 2AZSA 1BI1A 2MIOA 4M75G 2DL3A 5GAMf 3GNGA 1QVGP 4JRIA 2EJ9A 4QKUA 1FMVA 3SWNB 5A2QE 1Y96A 1M90R 1YBYA 4AT1B 1BI3A 1NPRA 3I56Q 1BYMA 4D8DA 4C92A 3RDVA 1Q82C 3FDRA 3G6ET 3MKDA 3H0FA 1PWTA 3O5ZA 2FRYA 2F5KA 5IHNA 8ATCB 2OTLA 3I5RA 4BDZA 2SRCA 4J9FA 4FW1A 1UJ0A 5GMKm 1TTHB 1KC8R 3CMAT 1X2QA 4M7DF 1WIEA 2K5LA 2KXDA 1K9MU 1TUDA 3UA6A 3CCUT 4O5VA 2LT4A 2CZ7B 1LCKA 5GAMh 3EFSA 2E3HA 1OYXA 3M4GA 4QVDA 2E1HA 3BDUA 2KGTA 1K1ZA 1KSWA 2GTJA 2K5FA 1EIFA 2COWA 1AWWA 1I5LA 2DMOA 3MO8A 2YXYA 3JB9H 2J05A 1QVFP 1B3QA 3OB9A 1SHGA 4F16A 1WNLA 1MNEA 3V8JA 1KG1A 3QYHB 4GLKA 2LCSA 4C92B 5KH6A 1H8KA 2PNIA 2VASA 2C06A 3VS1A 3SWNA 1QWEA 1M1KC 2MWOA 2RHIA 3UATA 1ZA1B 4L59A 4E6RA 2RHZA 1VYTA 4PJOB 4BI3A 1NLOC 1NJIU 4ZTFA 1TU0B 2YHTA 4AMCA 1TUGB 1SHFA 1RUWA 2J7IA 5GAMg 3CC4A 5KYYA 4ESRA 2F1LA 1YWPA 1WPYA 2MOXA 1VQMT 1ZSZB 3EHRA 3CC7A 3QWYA 1VQLQ 2DEQA 5CKFA 3G6EA 4KULA 5IHKA 2QGFB 3QBYA 4OF1A 3SFMA 3BDLA 5AT1B 2P0PA 1KC8C 4LXCA 5FWBA 3C95A 5LJ3j 1HK9A 2K2VA 2KMTA 1D3BB 1FYNA 7AT1B 1AD5A 3CMEQ 2RQTA 1YJWQ 3L2UA 4EMGA 2NWMA 4F17A 2MI6A 2K57A 2DXUA 5GAMj 1B34A 3FIFA 2JM9A 1JEGA 4JZ3A 4DBRA 4E7JA 1ZX6A 1SRLA 1H3ZA 5GMKj 3HKSA 2COYA 3GNFB 3LGFA 2D9TA 5GAN8 1PKSA 1K8AU 4K11A 1ZQ1A 1X01A 2MK5A 2NUPA 2W10A 4MZPA 3OY9A 3E9GA 3V8LA 2QA4Q 4OB0B 3PMIA 3FJ5A 2KNBB 4PJOF 4RTWA 5FROA 4C0DB 3V7RA 2ZZDA 5HY6A 2CP5A 2FVUA 3EGDA 1YIJT 3MP1A 1WYXA 2Z0WA 4C0GA 2WSCE 2A08A 3LWIA 3GPLA 1N9SA 2EPDA 4M75E 4C8QF 4RMOA 3PE0A 2JNGA 1BCMA 4J7FA 2L3RA 2D0QB 2RB6A 1VUBA 4C8QD 4CI0C 3CCVT 3OYFA 1OPLA 1S72T 2OX7A 2RNAA 1FWZA 3PMTA 1ZUYA 2DFUA 2L0AA 2QXFA 1QWFA 3MEWA 3C4SA 1JJ2A 4PK4A 2BZXA 1VQNT 1E6HA
chains in the Genus database with same CATH topology
1QCFA 2ESWA 1WXTA 4LUDA 1WX6A 2K3BA 4OMMA 2KR3A 1JQQA 2LX7A 3PVQA 2KE9A 4LNPA 2CT4A 1NEGA 2DX1A 3THKA 4A63B 2LJ1A 2VKNA 3M0TA 2JTEA 4HVWA 1PRMC 4AFUC 1XOVA 2DF6A 2E5KA 4GLMA 2YDLA 5IXBA 1VYUA 4M4ZA 1UDLA 1M30A 1Z9QA 3VS6A 1AWOA 1WXBA 1BU1A 2L2PA 4J9DA 3H41A 2LJ0A 4AG1C 1JXOA 2YUNA 4IIMA 2YUOA 1YP5A 1RLQC 2OAWA 3EG2A 4LUEA 2RQRA 1TUCA 2EYYA 1B07A 2FRWA 3I5SA 4ZNXA 2XMFA 2A36A 4HXJA 2JXBA 2DLPA 2CREA 2YUPA 1A0NB 3U23A 2EYZA 2X3WD 2LQNA 3REBB 2CDTA 4J9EA 1GRIA 1WFWA 5GJVB 1WLPB 2HSPA 4D8KA 1WXUA 2ED0A 1X6BA 1M3AA 1BK2A 4AFZC 3EG3A 1UJYA 2EVRA 1H3HA 1W1FA 2DL5A 2ABLA 2GTOA 2JT4A 3RNJA 1Y0MA 1H92A 1T3SA 2KT8A 2FPDA 1QLYA 5FWCA 2VVKA 2DL7A 3CQTA 2M0YA 2LNHB 4OMNA 1NM7A 2A37A 1WI7A 2BZ8A 2DVJA 5GJWB 1KFZA 1QKWA 1YWOA 3NHNA 2RPNA 3M0UA 1RLPC 2EQIA 1ZLMA 4EIKA 1FMKA 2J6FA 4LE9A 4CC4B 4JJDA 2DM1A 1X43A 1OPKA 3KFVA 1X2KA 1NYGA 1WA7A 3LH5A 2DBMA 4J9CA 1V1CA 1SPKA 1M27C 1IO6A 3NGPA 1AZGB 3ULRB 1K4US 4JZ4A 1Z9ZA 1UFFA 1S1NA 3QWXX 1U5SA 5IXFA 1UHCA 3EGUA 4HCKA 4RTYA 1I1JA 4RUGA 2D8HA 3RBBB 1PNJA 1UGVA 2KEAA 1HD3A 1GFCA 2ENMA 2EYXA 2DYBA 1ZUKA 2C0IA 2EKHA 3TSZA 4Y92A 2LQWA 2F2XA 2LMJA 1X27A 2FPEA 2O88A 1G83A 3H0IA 1U06A 2O9SA 2FG0A 4Z89A 2EW3A 2CUDA 4WCIA 2AK5A 2JS2A 4JPBW 2K7AA 1K9AA 5HCKA 2PZ1A 4DEXA 2KRSA 4CC3A 3EG0A 1SRMA 2DNUA 3TVTA 1CKBA 2HCKA 2V1QA 1K0XA 2J06A 4RTTA 1GCQA 1OEBA 2L3QA 1I0CA 1AWXA 2EBPA 4CC7A 4Z8AA 2KRMA 4FSSA 4JJCA 1AWJA 2LJ3A 1TG0A 2AZSA 2MIOA 2KXCA 2DL3A 1U3OA 2QDLA 2DL8A 1BB9A 1M3CA 2AZVA 1T3LA 1UG1A 3M0SA 4RTXA 5L23A 2EGEA 1HSQA 1N5ZA 1JXMA 2VWFA 4D8DA 4J9BA 3VS3A 2EYWA 1BBZA 3VS0A 1SSHA 1MV0B 4QT7A 3H0FA 1PWTA 3O5ZA 2FRYA 2JS0A 1KJWA 2DA9A 2X3XD 2H8HA 5IHNA 1CSKA 2GGRA 3I5RA 2SRCA 4J9FA 1UJ0A 4J9HA 2CSQA 3H0HA 4AFQC 4R0KA 2FEIA 1UE9A 4DEYA 1X2QA 1WIEA 1YNZA 3VS2A 4F14A 3UF4A 2V1RA 2W0ZA 3TSWA 3UA7A 3I35A 2KXDA 2B86A 1K76A 1TUDA 3UA6A 3A98A 1LCKA 2F2WA 3ZL7C 2EGAA 2KROA 1ZBJA 4HVVA 3VRYA 1AZEA 1NYFA 2BTTA 4J9GA 1NEBA 1W70A 3C0CA 2KGTA 2K9GA 3EHQA 1K1ZA 1KSWA 2GTJA 2RMOA 2RQVA 1GBRA 4RTUA 2ROTA 1AWWA 2DMOA 1GCQC 1PKTA 2J05A 3NMZC 2SEMA 1B3QA 4AFSC 1OV3A 4OMPA 1SHGA 4F16A 4IIOA 3M0PA 3I9QA 1ZUUA 2L3SA 2A28A 2ED1A 1JU5C 2O9VA 2LCSA 1H8KA 2PNIA 1AOJA 1PHTA 2CSIA 1T0HA 1NG2A 2C0OA 1UHFA 2D0NA 3VS1A 1ABOA 1T0JA 4JJBA 1K0SA 2YT6A 4OMOA 1QWEA 2KYBA 3UATA 4E6RA 1G2BA 1M3BA 1VYTA 3REAB 2J6OA 2CUBA 2F2VA 1UTIA 1NLOC 2JM8A 1J3TA 2GNCA 1SHFA 2DILA 1RUWA 2J7IA 1PRLC 4ESRA 1UUEA 1YWPA 1RI9A 2M51A 2MOXA 3EHRA 2K6DA 3QWYA 2KBTA 2DBKA 2BZYA 1GL5A 2JMAA 1YN8A 1M8MA 2DL4A 5I22A 1ABQA 1ZSGA 5IHKA 3VS4A 5FWBA 1YCSB 2FO0A 2OJ2A 3VS5A 2C0TA 3VS7A 2AKKA 4RTZA 4Z88A 2GBQA 2ROLA 4AG2C 3SHWA 3GBQA 1GFDA 1FYNA 2HEQA 4KRTA 1AD5A 1E7OA 2RQTA 2OI3A 2G6FX 2LZ6B 2HBWA 3EG1A 2RN8A 5I11A 2DRMA 2L3PA 3M0QA 2NWMA 2P4RA 1MUZA 4F17A 2J6KA 2O31A 2ECZA 2YUQA 2NUZA 2JW4A 1ARKA 4HVUA 2JM9A 2RF0A 2K79A 1JEGA 1MV3A 2GQIA 4JZ3A 2DE0X 3SEMA 4RTVA 2KRNA 1ZX6A 1SRLA 1X6GA 5EC7A 1EFNA 1E6GA 1VYVA 1X69A 2AKLA 2K2MA 2LP5A 3JV3A 1PKSA 1AVZC 4K11A 2YSQA 1Y57A 4ORZA 2W10A 5FW9A 2RQWA 3FJ5A 2KNBB 4RTWA 1WDXA 3R6NA 2EGCA 1GBQA 1GCPA 1AEYA 1WYXA 5IHIA 2KYMA 3PVLA 2CH4W 2A08A 2IIMA 2CH4A 2EPDA 1UECA 3IQLA 3M0RA 3PE0A 2PTKA 5IH2A 2O2OA 2I0NA 4OMLA 2JMCA 2FPFA 1JO8A 1NLPC 2D1XA 1OPLA 3NPFA 4GBQA 1HJDA 2KT1A 4CC2A 2RNAA 2RQUA 2MCNA 4X1VA 2D8JA 2DJQA 5ECAA 1SEMA 1I07A 4J9IA 1QKXA 1ZUYA 2L0AA 1OOTA 2CT3A 1W6XA 2HDAA 2DRKA 1QWFA 1KIKA 1CKAA 4LN2A 4OMQA 2BZXA 3VRZA 1VA7A 1E6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QCF A;  2ESW A;  1WXT A;  4LUD A;  1WX6 A;  2K3B A;  4OMM A;  2KR3 A;  1JQQ A;  2LX7 A;  3PVQ A;  2KE9 A;  4LNP A;  2CT4 A;  1NEG A;  2DX1 A;  3THK A;  4A63 B;  2LJ1 A;  2VKN A;  3M0T A;  2JTE A;  4HVW A;  1PRM C;  4AFU C;  1XOV A;  2DF6 A;  2E5K A;  4GLM A;  2YDL A;  5IXB A;  1VYU A;  4M4Z A;  1UDL A;  1M30 A;  1Z9Q A;  3VS6 A;  1AWO A;  1WXB A;  1BU1 A;  2L2P A;  4J9D A;  3H41 A;  2LJ0 A;  4AG1 C;  1JXO A;  2YUN A;  4IIM A;  2YUO A;  1YP5 A;  1RLQ C;  2OAW A;  3EG2 A;  4LUE A;  2RQR A;  1TUC A;  2EYY A;  1B07 A;  2FRW A;  3I5S A;  4ZNX A;  2XMF A;  2A36 A;  4HXJ A;  2JXB A;  2DLP A;  2CRE A;  2YUP A;  1A0N B;  3U23 A;  2EYZ A;  2X3W D;  2LQN A;  3REB B;  2CDT A;  4J9E A;  1GRI A;  1WFW A;  5GJV B;  1WLP B;  2HSP A;  4D8K A;  1WXU A;  2ED0 A;  1X6B A;  1M3A A;  1BK2 A;  4AFZ C;  3EG3 A;  1UJY A;  2EVR A;  1H3H A;  1W1F A;  2DL5 A;  2ABL A;  2GTO A;  2JT4 A;  3RNJ A;  1Y0M A;  1H92 A;  1T3S A;  2KT8 A;  2FPD A;  1QLY A;  5FWC A;  2VVK A;  2DL7 A;  3CQT A;  2M0Y A;  2LNH B;  4OMN A;  1NM7 A;  2A37 A;  1WI7 A;  2BZ8 A;  2DVJ A;  5GJW B;  1KFZ A;  1QKW A;  1YWO A;  3NHN A;  2RPN A;  3M0U A;  1RLP C;  2EQI A;  1ZLM A;  4EIK A;  1FMK A;  2J6F A;  4LE9 A;  4CC4 B;  4JJD A;  2DM1 A;  1X43 A;  1OPK A;  3KFV A;  1X2K A;  1NYG A;  1WA7 A;  3LH5 A;  2DBM A;  4J9C A;  1V1C A;  1SPK A;  1M27 C;  1IO6 A;  3NGP A;  1AZG B;  3ULR B;  1K4U S;  4JZ4 A;  1Z9Z A;  1UFF A;  1S1N A;  3QWX X;  1U5S A;  5IXF A;  1UHC A;  3EGU A;  4HCK A;  4RTY A;  1I1J A;  4RUG A;  2D8H A;  3RBB B;  1PNJ A;  1UGV A;  2KEA A;  1HD3 A;  1GFC A;  2ENM A;  2EYX A;  2DYB A;  1ZUK A;  2C0I A;  2EKH A;  3TSZ A;  4Y92 A;  2LQW A;  2F2X A;  2LMJ A;  1X27 A;  2FPE A;  2O88 A;  1G83 A;  3H0I A;  1U06 A;  2O9S A;  2FG0 A;  4Z89 A;  2EW3 A;  2CUD A;  4WCI A;  2AK5 A;  2JS2 A;  4JPB W;  2K7A A;  1K9A A;  5HCK A;  2PZ1 A;  4DEX A;  2KRS A;  4CC3 A;  3EG0 A;  1SRM A;  2DNU A;  3TVT A;  1CKB A;  2HCK A;  2V1Q A;  1K0X A;  2J06 A;  4RTT A;  1GCQ A;  1OEB A;  2L3Q A;  1I0C A;  1AWX A;  2EBP A;  4CC7 A;  4Z8A A;  2KRM A;  4FSS A;  4JJC A;  1AWJ A;  2LJ3 A;  1TG0 A;  2AZS A;  2MIO A;  2KXC A;  2DL3 A;  1U3O A;  2QDL A;  2DL8 A;  1BB9 A;  1M3C A;  2AZV A;  1T3L A;  1UG1 A;  3M0S A;  4RTX A;  5L23 A;  2EGE A;  1HSQ A;  1N5Z A;  1JXM A;  2VWF A;  4D8D A;  4J9B A;  3VS3 A;  2EYW A;  1BBZ A;  3VS0 A;  1SSH A;  1MV0 B;  4QT7 A;  3H0F A;  1PWT A;  3O5Z A;  2FRY A;  2JS0 A;  1KJW A;  2DA9 A;  2X3X D;  2H8H A;  5IHN A;  1CSK A;  2GGR A;  3I5R A;  2SRC A;  4J9F A;  1UJ0 A;  4J9H A;  2CSQ A;  3H0H A;  4AFQ C;  4R0K A;  2FEI A;  1UE9 A;  4DEY A;  1X2Q A;  1WIE A;  1YNZ A;  3VS2 A;  4F14 A;  3UF4 A;  2V1R A;  2W0Z A;  3TSW A;  3UA7 A;  3I35 A;  2KXD A;  2B86 A;  1K76 A;  1TUD A;  3UA6 A;  3A98 A;  1LCK A;  2F2W A;  3ZL7 C;  2EGA A;  2KRO A;  1ZBJ A;  4HVV A;  3VRY A;  1AZE A;  1NYF A;  2BTT A;  4J9G A;  1NEB A;  1W70 A;  3C0C A;  2KGT A;  2K9G A;  3EHQ A;  1K1Z A;  1KSW A;  2GTJ A;  2RMO A;  2RQV A;  1GBR A;  4RTU A;  2ROT A;  1AWW A;  2DMO A;  1GCQ C;  1PKT A;  2J05 A;  3NMZ C;  2SEM A;  1B3Q A;  4AFS C;  1OV3 A;  4OMP A;  1SHG A;  4F16 A;  4IIO A;  3M0P A;  3I9Q A;  1ZUU A;  2L3S A;  2A28 A;  2ED1 A;  1JU5 C;  2O9V A;  2LCS A;  1H8K A;  2PNI A;  1AOJ A;  1PHT A;  2CSI A;  1T0H A;  1NG2 A;  2C0O A;  1UHF A;  2D0N A;  3VS1 A;  1ABO A;  1T0J A;  4JJB A;  1K0S A;  2YT6 A;  4OMO A;  1QWE A;  2KYB A;  3UAT A;  4E6R A;  1G2B A;  1M3B A;  1VYT A;  3REA B;  2J6O A;  2CUB A;  2F2V A;  1UTI A;  1NLO C;  2JM8 A;  1J3T A;  2GNC A;  1SHF A;  2DIL A;  1RUW A;  2J7I A;  1PRL C;  4ESR A;  1UUE A;  1YWP A;  1RI9 A;  2M51 A;  2MOX A;  3EHR A;  2K6D A;  3QWY A;  2KBT A;  2DBK A;  2BZY A;  1GL5 A;  2JMA A;  1YN8 A;  1M8M A;  2DL4 A;  5I22 A;  1ABQ A;  1ZSG A;  5IHK A;  3VS4 A;  5FWB A;  1YCS B;  2FO0 A;  2OJ2 A;  3VS5 A;  2C0T A;  3VS7 A;  2AKK A;  4RTZ A;  4Z88 A;  2GBQ A;  2ROL A;  4AG2 C;  3SHW A;  3GBQ A;  1GFD A;  1FYN A;  2HEQ A;  4KRT A;  1AD5 A;  1E7O A;  2RQT A;  2OI3 A;  2G6F X;  2LZ6 B;  2HBW A;  3EG1 A;  2RN8 A;  5I11 A;  2DRM A;  2L3P A;  3M0Q A;  2NWM A;  2P4R A;  1MUZ A;  4F17 A;  2J6K A;  2O31 A;  2ECZ A;  2YUQ A;  2NUZ A;  2JW4 A;  1ARK A;  4HVU A;  2JM9 A;  2RF0 A;  2K79 A;  1JEG A;  1MV3 A;  2GQI A;  4JZ3 A;  2DE0 X;  3SEM A;  4RTV A;  2KRN A;  1ZX6 A;  1SRL A;  1X6G A;  5EC7 A;  1EFN A;  1E6G A;  1VYV A;  1X69 A;  2AKL A;  2K2M A;  2LP5 A;  3JV3 A;  1PKS A;  1AVZ C;  4K11 A;  2YSQ A;  1Y57 A;  4ORZ A;  2W10 A;  5FW9 A;  2RQW A;  3FJ5 A;  2KNB B;  4RTW A;  1WDX A;  3R6N A;  2EGC A;  1GBQ A;  1GCP A;  1AEY A;  1WYX A;  5IHI A;  2KYM A;  3PVL A;  2CH4 W;  2A08 A;  2IIM A;  2CH4 A;  2EPD A;  1UEC A;  3IQL A;  3M0R A;  3PE0 A;  2PTK A;  5IH2 A;  2O2O A;  2I0N A;  4OML A;  2JMC A;  2FPF A;  1JO8 A;  1NLP C;  2D1X A;  1OPL A;  3NPF A;  4GBQ A;  1HJD A;  2KT1 A;  4CC2 A;  2RNA A;  2RQU A;  2MCN A;  4X1V A;  2D8J A;  2DJQ A;  5ECA A;  1SEM A;  1I07 A;  4J9I A;  1QKX A;  1ZUY A;  2L0A A;  1OOT A;  2CT3 A;  1W6X A;  2HDA A;  2DRK A;  1QWF A;  1KIK A;  1CKA A;  4LN2 A;  4OMQ A;  2BZX A;  3VRZ A;  1VA7 A;  1E6H A; 
#chains in the Genus database with same CATH topology
 2E5Q A;  5FLX E;  1Q86 R;  4DBH A;  2VGM A;  3G4S A;  1HYO A;  4M7D B;  4BI8 B;  2KE9 A;  4LNP A;  5KYX B;  3GOX A;  3OYM A;  4ANJ A;  5CR2 A;  4A63 B;  4IUQ A;  2VKN A;  2QA4 A;  1XOV A;  3BFM A;  3HRU A;  4FSX A;  4M4Z A;  1UDL A;  3CPW S;  2QQA A;  3VS6 A;  2QTX A;  1BU1 A;  3A8G B;  2L5Q A;  2GFA A;  2RHX A;  3HHT B;  4AG1 C;  1JXO A;  2GQV A;  3BW1 A;  1YP5 A;  3OS1 A;  3LH0 A;  2RQR A;  5CQY A;  4PFP A;  1R0C B;  3CMA A;  2A36 A;  4M7A A;  2EYQ A;  1KQ2 A;  2DLP A;  2DTH A;  3J7A F;  2YUP A;  1A0N B;  5DLO A;  2EYZ A;  4IUU A;  3C12 A;  3NFC A;  2OTL T;  3REB B;  1OU9 A;  2A0F B;  5KCH A;  1C0M A;  4FYX B;  1B7T A;  4LDW A;  1M3A A;  2AIR B;  3M56 A;  2JJ9 A;  3EG3 A;  3TEE A;  1ZA2 B;  1PSE A;  2EVR A;  1W1F A;  1KD1 C;  1Y0M A;  4M78 E;  2DKG A;  4M7D A;  2KT8 A;  3OW2 S;  1JB0 E;  1KD1 R;  3CCE A;  4E7I A;  2QYZ A;  3S3O A;  4N4I A;  4TVR A;  4E7Z A;  4M75 B;  2XD0 A;  2X51 A;  4MZM A;  3JCM f;  4EIK A;  2QQB A;  4LE9 A;  3JCM d;  4R56 A;  2CYZ B;  5AYF A;  3M54 A;  2RD1 A;  1Q7Y R;  2YRV A;  1V1C A;  3MHX A;  3GP8 A;  1M27 C;  3VYG A;  1YI2 T;  3N5B B;  4Y91 A;  1AZG B;  3ULR B;  2FZG B;  2XID A;  3MJX A;  1Z9Z A;  4DBQ A;  3FLG A;  2ZAE A;  4F7U B;  4FL6 A;  4PL6 A;  4DOW A;  1NZ9 A;  4ZGE B;  1YHQ T;  2M9U A;  3S6W A;  1PNJ A;  1DJ7 B;  2FL7 A;  2DXB A;  1GFC A;  1PCX A;  1MMD A;  3CC7 Q;  2DYB A;  1ZUK A;  1XTD A;  2E65 A;  4X9D A;  3CCJ A;  3JCM g;  4ELZ C;  2O9S A;  1YIT T;  2FG0 A;  2CUD A;  1TOV A;  3CCM T;  1X6O A;  1WGS A;  3JCM c;  4JPB W;  5CO7 A;  1K9A A;  3CCL Q;  3EGX A;  1BKB A;  2MMP A;  2ZPI B;  2HCK A;  2J06 A;  2HBP A;  1OEB A;  2KY9 A;  3E19 A;  1UB4 A;  5GAO n;  2Y4X A;  4NL2 A;  1I0C A;  1AWX A;  2EBP A;  4CC7 A;  4Z8A A;  2KRM A;  4KGV B;  1VQO A;  1AWJ A;  3OBY A;  3HRT A;  2QQ9 A;  1VQ6 Q;  2ZGW A;  4LD6 A;  4DA4 A;  1MND A;  3I55 A;  1N8R U;  2DL8 A;  1RAF B;  2XHC A;  2AZV A;  1KQS S;  3M0S A;  1YFN A;  5L23 A;  4KT0 E;  3CCR Q;  4J83 A;  3EH2 A;  1N5Z A;  3QDR B;  1VQP T;  1BI0 A;  1SSH A;  4M78 C;  4VUB A;  1KQS A;  4HA8 A;  1TWB A;  3H8Z A;  2DA9 A;  2X3X D;  2FZK B;  1D09 B;  1CSK A;  2GGR A;  2YRD A;  4HCB A;  2LNV A;  2IG0 A;  4R0K A;  2FEI A;  4PJO A;  1UE9 A;  1TSF A;  4DEY A;  3EFR A;  1YNZ A;  3A1P A;  4C5I A;  2V1R A;  2HQX A;  4B6M A;  3I35 A;  1VQ6 A;  4L5G A;  2OTJ A;  3A98 A;  2EGA A;  1VQ9 Q;  2CS7 A;  3DLL A;  4HVV A;  2XG8 D;  2RK1 A;  4NS5 A;  4XTY A;  1VQN A;  2BTT A;  1KD1 U;  1W70 A;  2M02 A;  1U1T A;  3EHQ A;  2RMO A;  4BI4 A;  2RJE A;  2ROT A;  4BUG A;  2RJD A;  2R5A A;  4JJN K;  3ER0 A;  4FYV B;  4OB3 B;  1GCQ C;  1PKT A;  4A4F A;  4F04 B;  2DYI A;  2PQW A;  1OV3 A;  3E9F A;  3G7Z A;  1Q7Y U;  3M0P A;  3I9Q A;  5D6Y A;  2E6Z A;  3CCL A;  4M7A E;  1SF9 A;  3RES A;  1JU5 C;  4RG2 A;  3RKX A;  3X20 B;  2HQH A;  4BE2 A;  4FYW B;  1AOJ A;  5KYN A;  1T0H A;  1PSF A;  4C92 E;  2C0O A;  5LJ3 g;  4JJB A;  4PJO E;  1K0S A;  2YT6 A;  5CQX A;  2JZ2 A;  2KYB A;  2X9H A;  4C8Q C;  1G2B A;  3REA B;  3M58 A;  3CME A;  2F2V A;  5FRM A;  3LX7 A;  1VQP A;  5L8R E;  2JM8 A;  1EX4 A;  2EQK A;  4N0A A;  3OMC A;  4XAX B;  2M16 A;  1VQO T;  3JB9 I;  1Q81 C;  1VQ8 T;  4LDV A;  4XU2 A;  3CC2 T;  5A0D A;  1UUE A;  1I8F A;  1NBE B;  2BZY A;  1GL5 A;  2JMA A;  1YN8 A;  1M8M A;  3HRS A;  1Q81 R;  3X28 B;  3JB9 D;  5HK3 A;  3CC4 Q;  3ME9 A;  2OJ2 A;  1RAI B;  4Z88 A;  4RTZ A;  4BD3 A;  1Y7X A;  2GBQ A;  2YWW A;  5GAN 2;  2LTO A;  4M7A C;  3CPW P;  3JB9 J;  1M2O A;  5GMK i;  3HP9 A;  2XU8 A;  4A4K A;  2CZ6 B;  2HBW A;  3OW2 A;  2DRM A;  3A8O B;  3M0Q A;  3OYA A;  1B34 B;  2P4R A;  3OS0 A;  1BCO A;  3KXT A;  4Z02 A;  1QW1 A;  3CC2 Q;  4HVU A;  2RF0 A;  2K79 A;  1MV3 A;  5GAM d;  2DE0 X;  2QEX A;  3OYE A;  1LPL A;  1BIB A;  2QK0 A;  1E6G A;  1VYV A;  2AKL A;  2K2M A;  3M5A A;  3CBO A;  2DO3 A;  1QMC A;  2PUK B;  1RAE B;  3H9N A;  4ORZ A;  3L2W A;  5CAI A;  4M75 C;  3NTH A;  1S72 A;  5FW9 A;  3CPW A;  4E47 A;  1YJN A;  2EGC A;  4F7U E;  4EMK C;  4JLG A;  1NE8 A;  1GBQ A;  1GCP A;  2ZPH B;  3HPW A;  4E7L A;  3QII A;  3M55 A;  3DB4 A;  1RI0 A;  2LDM A;  2VYT A;  2DET A;  3PVL A;  2IIM A;  3I56 T;  2HQE A;  4M78 G;  4JLI A;  1UEC A;  3SDZ A;  3CCS T;  4A4H A;  1O75 A;  5I2M A;  1ZHI A;  3RMQ A;  4JRP A;  4LDU A;  2O2O A;  2JMC A;  3WVE B;  4XTV A;  1KQ1 A;  2HSE B;  3FJP A;  2LT1 A;  4HCC A;  2D1X A;  3G71 T;  1HJD A;  2KT1 A;  3TCJ A;  3OYI A;  4DOV A;  2D8J A;  3INZ A;  4JRK A;  1QKX A;  4PJO C;  5A0G A;  4PKC C;  2CT3 A;  4PNO A;  5CKD A;  1KIK A;  1VQ7 Q;  1CKA A;  1VQ4 A;  1XQH A;  1QVF S;  1S72 Q;  3RKY A;  1SG5 A;  3WXM B;  1M1G A;  3CCV Q;  5CKB A;  1K8A R;  2KI7 A;  4M7D E;  2NUT A;  2NUT B;  3LWH A;  4OP0 A;  2LX7 A;  3EG9 B;  5GAN f;  3MET A;  1VQM Q;  2LQK A;  1M2V A;  2E6N A;  3V8K A;  3CEY A;  2QEX Q;  3CPF A;  4M77 F;  1OZ2 A;  3Q1J A;  4AFU C;  2X4X A;  1MMG A;  2RI5 A;  5IXB A;  4FU6 A;  3URG A;  2KAF A;  2H3E B;  3CCR T;  1D0Z A;  2QA4 T;  2XDB A;  4DQ2 A;  1NPP A;  3JCM W;  1YJ9 A;  4ELY C;  2V8I A;  3EFO A;  3CD6 A;  1PC0 A;  2R5M A;  1K73 R;  4J9D A;  4IIM A;  2XIC A;  2OTJ Q;  2YLC A;  3JCM h;  3L2Z A;  4P5N A;  3EG2 A;  1Q81 U;  1K9M R;  3GIB A;  2HNI A;  4KUD K;  4J7I A;  1K73 C;  2XMF A;  1QCN A;  2K4Y A;  4FM4 B;  1QP2 A;  1D1C A;  2QTV A;  3OQ5 A;  2X3W D;  2A7Y A;  2ED0 A;  1X6B A;  2HMA A;  2MPX C;  4C0Z A;  1UJY A;  1H3H A;  1RL2 A;  2ABL A;  4C0D C;  4XTU A;  1WJR A;  3S3N A;  4ZTJ A;  2FB7 A;  2EQM A;  1NJI C;  2LC4 A;  2M0Y A;  3X24 B;  3CXC S;  1WHG A;  4II1 A;  2XI9 A;  4FYY B;  2DVJ A;  1Q7Y C;  4ZGD B;  1VQ7 T;  2VC8 A;  3NHN A;  3CBM A;  1RLP C;  1K8A C;  2EQI A;  1ZLM A;  3BE3 A;  2J6F A;  4CC4 B;  1KK7 A;  2O4X A;  3CC4 T;  4OB1 B;  1VQ4 T;  2DER A;  1X43 A;  1WA7 A;  1VQK T;  2DBM A;  4O6J A;  4J9C A;  4FW2 A;  2RK2 A;  2PVO B;  5FU6 B;  1VQK A;  2DXC A;  5D7U A;  2CZ0 B;  5D6X A;  1IO6 A;  4XK8 E;  1IRX A;  1K4U S;  2HKQ B;  2E41 A;  4KUI A;  3QWX X;  4KGZ B;  5IXF A;  5LJ3 f;  1LVK A;  2HKN A;  3J81 E;  5CCA A;  2DVE A;  3HFN A;  2CP2 A;  3G71 A;  4M7D C;  1F1B B;  2GFU A;  2V8K A;  1WZO A;  3MPU B;  2GF7 A;  5DY9 A;  3PNW C;  2EKH A;  3TSZ A;  2LQW A;  2F2X A;  3V7S A;  2FPE A;  1RAH B;  2HL5 C;  4N0A C;  2E4H A;  4Z89 A;  1VQ8 A;  1QCO A;  2AK5 A;  2JS2 A;  1YCY A;  4A54 A;  3OYJ A;  4MDX A;  2LVM A;  4GY5 A;  4J6Y A;  3EG0 A;  3T9N A;  2DNU A;  2KDS A;  3O8V A;  4M78 B;  2V1Q A;  2VXE A;  2NYS A;  3E2U A;  1IRE B;  4FCY A;  4UC4 A;  4IUT A;  1YI2 A;  2QAZ A;  3QHS A;  1WHL A;  3FRN A;  3JB9 G;  3CCQ Q;  2KXC A;  1U3O A;  2NUP B;  1BB9 A;  4PLL A;  1M3C A;  1PD1 A;  4R55 A;  3CCU A;  4RTX A;  3TQ7 P;  2OTJ T;  2FZC B;  3P8B B;  1HSQ A;  2O01 E;  5LJ5 e;  3NTI A;  2VWF A;  2LCC A;  4J9B A;  4PLI A;  3VS3 A;  1M4Z A;  1G5V A;  2EYW A;  5GAN e;  2JOY A;  4OVA A;  1MV0 B;  3HL8 A;  4QT7 A;  2M0O A;  3OSS C;  3EG9 A;  1KJW A;  3TU4 K;  3UWN A;  2H8H A;  1FXX A;  4HT9 A;  4MMK A;  1YJN T;  4J9H A;  3PT9 A;  2CSQ A;  2X4Y A;  4C5G A;  3NTK A;  5DM7 R;  3V7C A;  3VS2 A;  1D1A A;  1VQN Q;  3TSW A;  3UA7 A;  1Q86 U;  1TXQ A;  4M77 E;  5FRN A;  1JRI A;  1ZBJ A;  3VRY A;  1KHC A;  1WHK A;  2L89 A;  4PFZ A;  4M75 A;  1UGQ B;  2K9G A;  3CC7 T;  1EZZ B;  5CK9 A;  4WTO B;  2RQV A;  1MMA A;  1WQW A;  4M78 D;  2MYS A;  4JUV A;  4BE1 A;  4CRI A;  1YJN Q;  3PFS A;  5GAN 6;  3QDF A;  1ZUU A;  2L3S A;  2A28 A;  1QVP A;  2ED1 A;  3CXC A;  2VUB A;  2O9V A;  2P84 A;  1OU8 A;  3H6Z A;  4X9C A;  2HZY A;  4J6X A;  4OB2 B;  4ATO A;  3QUI A;  2CSI A;  4XTX A;  5GAN 5;  2D0N A;  2YLB A;  4EPC A;  1ABO A;  3QXE B;  1JJ2 P;  4OMO A;  4M7A B;  1M2V B;  4MZT A;  2J6O A;  2CUB A;  1UTI A;  4J8O A;  4EMK B;  3CC2 A;  4RKU E;  5C0M A;  2ZPE B;  3X25 B;  2GNC A;  3UDC A;  2X4W A;  2DIL A;  3QKJ A;  4PJJ A;  1XJW B;  6AT1 B;  1PRL C;  4HCZ A;  3JB9 F;  5GAO l;  2CP0 A;  2B8A A;  3SB2 A;  2K6D A;  2DBK A;  3QG1 A;  4JRQ A;  3QPH A;  5I22 A;  1ABQ A;  3JCM J;  4M7D G;  4BAC A;  3AHU A;  2KK4 A;  4PJN A;  4OGC A;  1YCS B;  2FO0 A;  3VS5 A;  1AT1 B;  2AKK A;  2GCX A;  2IVW A;  2MWP A;  4KH0 B;  4JS5 A;  1LOJ A;  3SHW A;  3GBQ A;  5KYX A;  1IGU A;  2HEQ A;  4KRT A;  3QZ9 B;  2HD0 A;  4NL3 A;  2LZ6 B;  3EH1 A;  2EFI A;  3SWN C;  4M75 F;  2L3P A;  2PVG B;  2PVD B;  1MUZ A;  2PUO B;  3G71 Q;  2YUQ A;  4LD9 K;  2RO0 A;  4IKF A;  2GQI A;  3OYL A;  5EG2 A;  2LQ8 A;  3CME T;  3SEM A;  4B9W A;  4RTV A;  2KRN A;  5KYU B;  1X6G A;  2WAC A;  5CVI A;  3ASK A;  1EFN A;  2E70 A;  3G4S Q;  1Y96 B;  3OS5 A;  4XTZ A;  1AVZ C;  2OAU A;  4KBM B;  1Y57 A;  4M77 C;  2EWN A;  4WF2 A;  1YIT A;  1I81 A;  4E7S A;  5HKC A;  2DXT A;  4A4E A;  5IN1 A;  1M1K R;  1WDX A;  3CCS A;  5CIU A;  4EDU A;  1AEY A;  2KYM A;  4KGX B;  5IT9 E;  2CH4 W;  2XK0 A;  3L1A A;  2CH4 A;  5FU7 B;  1V76 A;  4C92 G;  1M8V A;  5GAN g;  3ZFJ A;  1YHQ A;  3KBG A;  2HL3 A;  5IH2 A;  1G8X A;  1D3B A;  3RR6 A;  2I0N A;  4OML A;  1MMN A;  2D6F A;  3F70 A;  3NPF A;  1K73 U;  4GBQ A;  4C5E A;  3RUX A;  2RQU A;  4X1V A;  2DJQ A;  1UEB A;  4ZN1 A;  1OOT A;  3JCM P;  2HDA A;  3S3M A;  1I5O B;  2CP7 A;  4LN2 A;  3EAE A;  5CKH A;  1VA7 A;  1QCF A;  2PU9 B;  5GAO p;  3OYY A;  4LUD A;  3CD6 T;  2F5T X;  1WX6 A;  1Q82 U;  2KR3 A;  1V29 B;  1RAA B;  1OZ3 A;  3PVQ A;  2RHY A;  2G3R A;  1BI2 A;  1WHM A;  4A53 A;  1N8R R;  2CT4 A;  4PFO A;  3THK A;  4J6W A;  4M7A D;  2DF6 A;  2ATC B;  1LJO A;  2CZ1 B;  2YDL A;  1VYU A;  1JBM A;  1M30 A;  4PJO D;  4PJL A;  3JCM b;  1ZSZ A;  1I4K 1;  2V8J A;  3D7S B;  4LDY A;  3CCQ A;  1K9M C;  3CCJ Q;  1IGQ A;  1W2B S;  1MHN A;  2L2P A;  2MF2 A;  2R58 A;  2LJ0 A;  1ACM B;  2YUN A;  1M5Q 1;  2YUO A;  3RER A;  3X26 B;  1N27 A;  4LUE A;  1TUC A;  2EYY A;  1B07 A;  2FRW A;  4C92 F;  4ZNX A;  3L42 A;  2ZPG B;  4HXJ A;  2JXB A;  1Y07 A;  2CRE A;  1WHH A;  3U23 A;  2CDT A;  3OYK A;  1WFW A;  4D8K A;  1WXU A;  1BK2 A;  5GMK h;  2CP3 A;  3M4Y A;  1SSF A;  2K3X A;  1WJQ A;  4M78 F;  3PGG A;  2GTO A;  2JT4 A;  3RNJ A;  4Q5W A;  1H92 A;  4A4G A;  2I2L A;  1FX7 A;  1QLY A;  5HK0 A;  2DL7 A;  3CQT A;  2RH2 A;  3MEA A;  2LNH B;  4OMN A;  3OW2 P;  1M90 U;  2BZ8 A;  1KFZ A;  1IB8 A;  4JDS A;  5LJ3 e;  1YWO A;  2CGH A;  3A8H B;  5DLQ E;  1N9R A;  4JJD A;  1R0B G;  2DM1 A;  1D1B A;  2VXF A;  4QW2 A;  1SPK A;  2EQU A;  2CKK A;  1D0X A;  3NGP A;  3OYN A;  4JZ4 A;  1S1N A;  1TH7 A;  4QQ6 A;  4FIB A;  5GAO m;  2RI2 A;  1IHV A;  4EMH A;  1YIJ Q;  3OYD A;  4HCK A;  2RA2 A;  1I1J A;  4M77 G;  3CCE T;  1YI2 Q;  2QEX T;  3LLR A;  4E7K A;  2KEA A;  1HD3 A;  2F69 A;  3P8H A;  1OX9 A;  1UGR B;  2A3L A;  5KCO A;  3VUZ A;  2K3Y A;  4Y92 A;  2QAS A;  2LMJ A;  1X27 A;  2DPP B;  2O88 A;  1G83 A;  2DJZ A;  3QYG B;  1U06 A;  3HTR A;  4C92 C;  2VGN A;  3A8M B;  4WCI A;  3JSC A;  3CD6 Q;  5LJ5 j;  2K7A A;  4OGE A;  3M57 A;  3CMA Q;  2KRS A;  2ZPB B;  4CC3 A;  3CCL T;  2O4X B;  1SRM A;  4MDW A;  3TVT A;  1CKB A;  2AT1 B;  1K0X A;  1VIF A;  1GCQ A;  1C1A A;  2L3Q A;  1GXI E;  3QZ5 B;  2COZ A;  2EKO A;  3DLM A;  1VOM A;  3OYC A;  5GAN 4;  2BE7 D;  4FSS A;  1YIJ A;  4M7D D;  3CCS Q;  4RG8 A;  1PM3 A;  5FU6 C;  1WJS A;  1U8R A;  2EIF A;  1M1F A;  3HFO A;  1G3Y A;  1TG0 A;  3CCV A;  1R77 A;  1LNX A;  1VQM A;  3JCM X;  1P92 A;  2QDL A;  2DD5 A;  2P4T A;  1Q82 R;  1T3L A;  2P0Q A;  1UG1 A;  2JTF A;  1R8O B;  3CCM A;  2E64 A;  5A0L A;  2EQJ A;  2EGE A;  3OA6 A;  4ZN3 A;  1JXM A;  2QDY B;  1BBZ A;  2E12 A;  2WSF E;  3CCJ T;  3VS0 A;  3UPU A;  3OMG A;  1IZ6 A;  4RCB A;  3HSB A;  5D6W A;  2JS0 A;  3I56 A;  1Y71 A;  1G3W A;  1JJ2 S;  3GF5 A;  4M77 A;  4M77 B;  4N4G A;  1N6A A;  2BE9 B;  3CXC P;  1X75 C;  2VB6 A;  3H0H A;  4AFQ C;  4C8Q E;  5LJ5 g;  1UGS B;  3L2V A;  3L2R A;  5LJ5 f;  4F14 A;  3UF4 A;  2W0Z A;  3QJ6 A;  2B86 A;  1K76 A;  5LJ3 d;  5CKE A;  3LGL A;  2F2W A;  3ZL7 C;  4HKE A;  4E2F B;  2KRO A;  1G3S A;  2KQW A;  1AZE A;  1QQJ A;  4PJM A;  1NYF A;  4J9G A;  1NEB A;  1M1K U;  1YJ9 Q;  3C0C A;  1WQ7 A;  3FEO A;  2E10 A;  4BY6 C;  3CCR A;  1GBR A;  5KYY B;  4QVC A;  4RTU A;  4V2S A;  1MGQ A;  2JVV A;  4M77 D;  3MP8 A;  3M53 A;  3NMZ C;  2SEM A;  1OQK A;  1W4S A;  4XU3 A;  4AFS C;  4OMP A;  4IIO A;  2MAM A;  4PJO G;  4M7A F;  3ZBD A;  2KSS A;  1BIA A;  4D6W A;  1PHT A;  4BDY A;  5GAN j;  1NG2 A;  2XDP A;  1UHF A;  3WVD B;  1T0J A;  4DBF A;  1M3B A;  1IHW A;  2AHJ B;  3I55 Q;  1QP3 A;  2DD4 A;  3OSV A;  1J3T A;  5LJ5 h;  3L2Q A;  3DKM A;  3EFO B;  1RAB B;  1RI9 A;  2M51 A;  2JTM A;  3MEV A;  4ME7 A;  2KBT A;  3JCM Q;  1WHJ A;  2DL4 A;  1ZSG A;  2DK3 A;  4IUR A;  3VS4 A;  5GAO r;  2BUD A;  2V26 A;  1VQ9 A;  1YJW A;  2C0T A;  3VS7 A;  3JRZ A;  2LCL A;  1VQ5 Q;  2ROL A;  4AG2 C;  1KQS P;  1GFD A;  1E7O A;  5I2S A;  2DIG A;  2OI3 A;  2G6F X;  3EG1 A;  2RN8 A;  4FT2 A;  5LJ3 h;  3QJY A;  5I11 A;  1VQ7 A;  2JN0 A;  4BB7 A;  2J6K A;  2O31 A;  3TRE A;  2ECZ A;  4L6V 5;  2NUZ A;  2JW4 A;  1AHJ B;  1ARK A;  5GAN d;  2EJF A;  1D0Y A;  2EJG A;  3OYG A;  4M78 A;  5LJ5 d;  3RKW A;  1KC8 U;  5EC7 A;  3OBW A;  3EGX B;  3FB9 A;  3JCM V;  1X69 A;  4B9X A;  4XTW A;  2LP5 A;  5GAN 3;  3JV3 A;  2WSE E;  3KUF A;  2YSQ A;  1RAD B;  4IUV A;  1IXD A;  2Y90 A;  2BIV A;  2E3I A;  3VU3 C;  3M9Q A;  1W2B P;  2DIQ A;  2RQW A;  1Q95 G;  4M75 D;  1FMW A;  3R6N A;  1VQ5 A;  1W2B A;  3M59 A;  5IHI A;  2X35 A;  2IPO B;  5I21 A;  1QVG S;  4MML A;  1VQ6 T;  3IQL A;  3M0R A;  4F7U A;  1H64 1;  3R6O A;  3E1S A;  3SD4 A;  2PTK A;  1KHI A;  5GMK e;  2KVQ G;  1SKU B;  3GLX A;  4FT4 A;  3BY7 A;  2FPF A;  1JO8 A;  2RJF A;  1NLP C;  5KYW B;  4IUP A;  4CC2 A;  3VV0 A;  2MCN A;  1RAC B;  3MEU A;  5ECA A;  1SEM A;  1I07 A;  1QVG A;  4J9I A;  3CBP A;  1W6X A;  2DRK A;  1G3T A;  4OMQ A;  2L8D A;  2OTL Q;  3VRZ A;  1YIT Q;  2ESW A;  1WXT A;  1VQ8 Q;  2LRQ A;  5J3B A;  1VQO Q;  5J39 A;  4C8Q G;  2K3B A;  4OMM A;  4J5Y A;  5C6S A;  1JQQ A;  4F7U F;  4EMK A;  5KE2 A;  1VQL T;  4KH1 B;  1C6V X;  1Q86 C;  4N4H A;  1OX8 A;  1NEG A;  2RHU A;  2DX1 A;  3RIR A;  2LJ1 A;  1YHQ Q;  4HT8 A;  3M0T A;  2JTE A;  4HVW A;  1PRM C;  2E5K A;  4OMF B;  4GLM A;  3PIO A;  3OS2 A;  1Z9Q A;  3RMS A;  3DB3 A;  5FU7 C;  1TS9 A;  1AWO A;  3G6E Q;  3A5Z B;  4XQ3 A;  3JAM E;  1WXB A;  3LW5 E;  4QQD A;  5GMK l;  3H41 A;  2LX9 A;  3G4S T;  1RLQ C;  2OAW A;  4BY6 B;  2JUF A;  3EGD B;  2QI2 A;  3I5S A;  2FYK A;  1O9S A;  2FHD A;  4LDX A;  2R57 A;  2XDD A;  1VQK Q;  2X4J A;  2LQN A;  3VUB A;  4J9E A;  1GRI A;  5GJV B;  3AT1 B;  3FC3 A;  1WLP B;  2HSP A;  2RI3 A;  4JS4 A;  1VQ9 T;  2QQR A;  1HXD A;  3PIP A;  5KYW A;  1NJI R;  4AFZ C;  3OYH A;  2QGG A;  3LYI A;  2QQS A;  2DL5 A;  2ZPF B;  1T3S A;  9ATC B;  5KYU A;  2FPD A;  4XU0 A;  5FWC A;  2VVK A;  5KE3 A;  4BE0 A;  5M9O A;  1ZSZ C;  1NM7 A;  2A37 A;  1WI7 A;  3CCU Q;  2YRC A;  5GJW B;  1QKW A;  4NOY A;  4XU1 A;  2RPN A;  3J80 E;  3M0U A;  4X34 A;  3G1J A;  3I55 T;  1FMK A;  3VJP A;  2VV5 A;  2NLU A;  2RM4 A;  3QSU A;  3KFV A;  1OPK A;  1X2K A;  1VQP Q;  1NYG A;  3LH5 A;  4C92 D;  4QVZ A;  1N8R C;  3VKI A;  2DZC A;  1OI1 A;  4E7H A;  1VIE A;  3UT1 A;  5GAN 7;  1UFF A;  3JCM e;  1U5S A;  2ZCF B;  1UHC A;  1U1S A;  2DTI A;  3EGU A;  4Y28 E;  4RTY A;  4RUG A;  2D8H A;  3RBB B;  1RAG B;  2QG9 B;  3CCE Q;  1UGV A;  5GAN h;  1PD0 A;  4C5H A;  2ENM A;  2CP6 A;  1OUL A;  3C94 A;  2EYX A;  3OYB A;  1YJ9 T;  3CCQ T;  1PG5 B;  5IAY A;  2C0I A;  1M9S A;  5LL6 S;  3MP6 A;  1VQ4 Q;  8AT1 B;  2XKO C;  4M7A G;  3MCA B;  1YJW T;  3PTA A;  3H0I A;  4YTL A;  3VYH B;  2K5I A;  2H3J A;  2EW3 A;  2M1H A;  4RCC A;  4C0F A;  2HAX A;  3CCM Q;  2DAQ A;  2DTO A;  2DEU A;  3P8D A;  1XNI A;  5HCK A;  5GAO q;  2PZ1 A;  4DEX A;  2RJC A;  4F7U G;  5GAM e;  1VQL A;  3A8L B;  3ZEH A;  4C8Q B;  1QVF A;  3QO3 A;  5J26 A;  4QQG A;  2DZ9 A;  4RTT A;  1UGP B;  2EAY A;  1ZBX A;  4ZGJ B;  2P0K A;  4C8Q A;  4JJC A;  2Y4Y A;  2BKD N;  1VQ5 T;  2LJ3 A;  1M90 C;  2AZS A;  1BI1 A;  2MIO A;  4M75 G;  2DL3 A;  5GAM f;  3GNG A;  1QVG P;  4JRI A;  2EJ9 A;  4QKU A;  1FMV A;  3SWN B;  5A2Q E;  1Y96 A;  1M90 R;  1YBY A;  4AT1 B;  1BI3 A;  1NPR A;  3I56 Q;  1BYM A;  4D8D A;  4C92 A;  3RDV A;  1Q82 C;  3FDR A;  3G6E T;  3MKD A;  3H0F A;  1PWT A;  3O5Z A;  2FRY A;  2F5K A;  5IHN A;  8ATC B;  2OTL A;  3I5R A;  4BDZ A;  2SRC A;  4J9F A;  4FW1 A;  1UJ0 A;  5GMK m;  1TTH B;  1KC8 R;  3CMA T;  1X2Q A;  4M7D F;  1WIE A;  2K5L A;  2KXD A;  1K9M U;  1TUD A;  3UA6 A;  3CCU T;  4O5V A;  2LT4 A;  2CZ7 B;  1LCK A;  5GAM h;  3EFS A;  2E3H A;  1OYX A;  3M4G A;  4QVD A;  2E1H A;  3BDU A;  2KGT A;  1K1Z A;  1KSW A;  2GTJ A;  2K5F A;  1EIF A;  2COW A;  1AWW A;  1I5L A;  2DMO A;  3MO8 A;  2YXY A;  3JB9 H;  2J05 A;  1QVF P;  1B3Q A;  3OB9 A;  1SHG A;  4F16 A;  1WNL A;  1MNE A;  3V8J A;  1KG1 A;  3QYH B;  4GLK A;  2LCS A;  4C92 B;  5KH6 A;  1H8K A;  2PNI A;  2VAS A;  2C06 A;  3VS1 A;  3SWN A;  1QWE A;  1M1K C;  2MWO A;  2RHI A;  3UAT A;  1ZA1 B;  4L59 A;  4E6R A;  2RHZ A;  1VYT A;  4PJO B;  4BI3 A;  1NLO C;  1NJI U;  4ZTF A;  1TU0 B;  2YHT A;  4AMC A;  1TUG B;  1SHF A;  1RUW A;  2J7I A;  5GAM g;  3CC4 A;  5KYY A;  4ESR A;  2F1L A;  1YWP A;  1WPY A;  2MOX A;  1VQM T;  1ZSZ B;  3EHR A;  3CC7 A;  3QWY A;  1VQL Q;  2DEQ A;  5CKF A;  3G6E A;  4KUL A;  5IHK A;  2QGF B;  3QBY A;  4OF1 A;  3SFM A;  3BDL A;  5AT1 B;  2P0P A;  1KC8 C;  4LXC A;  5FWB A;  3C95 A;  5LJ3 j;  1HK9 A;  2K2V A;  2KMT A;  1D3B B;  1FYN A;  7AT1 B;  1AD5 A;  3CME Q;  2RQT A;  1YJW Q;  3L2U A;  4EMG A;  2NWM A;  4F17 A;  2MI6 A;  2K57 A;  2DXU A;  5GAM j;  1B34 A;  3FIF A;  2JM9 A;  1JEG A;  4JZ3 A;  4DBR A;  4E7J A;  1ZX6 A;  1SRL A;  1H3Z A;  5GMK j;  3HKS A;  2COY A;  3GNF B;  3LGF A;  2D9T A;  5GAN 8;  1PKS A;  1K8A U;  4K11 A;  1ZQ1 A;  1X01 A;  2MK5 A;  2NUP A;  2W10 A;  4MZP A;  3OY9 A;  3E9G A;  3V8L A;  2QA4 Q;  4OB0 B;  3PMI A;  3FJ5 A;  2KNB B;  4PJO F;  4RTW A;  5FRO A;  4C0D B;  3V7R A;  2ZZD A;  5HY6 A;  2CP5 A;  2FVU A;  3EGD A;  1YIJ T;  3MP1 A;  1WYX A;  2Z0W A;  4C0G A;  2WSC E;  2A08 A;  3LWI A;  3GPL A;  1N9S A;  2EPD A;  4M75 E;  4C8Q F;  4RMO A;  3PE0 A;  2JNG A;  1BCM A;  4J7F A;  2L3R A;  2D0Q B;  2RB6 A;  1VUB A;  4C8Q D;  4CI0 C;  3CCV T;  3OYF A;  1OPL A;  1S72 T;  2OX7 A;  2RNA A;  1FWZ A;  3PMT A;  1ZUY A;  2DFU A;  2L0A A;  2QXF A;  1QWF A;  3MEW A;  3C4S A;  1JJ2 A;  4PK4 A;  2BZX A;  1VQN T;  1E6H A; 
#chains in the Genus database with same CATH homology
 1QCF A;  2ESW A;  1WXT A;  4LUD A;  1WX6 A;  2K3B A;  4OMM A;  2KR3 A;  1JQQ A;  2LX7 A;  3PVQ A;  2KE9 A;  4LNP A;  2CT4 A;  1NEG A;  2DX1 A;  3THK A;  4A63 B;  2LJ1 A;  2VKN A;  3M0T A;  2JTE A;  4HVW A;  1PRM C;  4AFU C;  1XOV A;  2DF6 A;  2E5K A;  4GLM A;  2YDL A;  5IXB A;  1VYU A;  4M4Z A;  1UDL A;  1M30 A;  1Z9Q A;  3VS6 A;  1AWO A;  1WXB A;  1BU1 A;  2L2P A;  4J9D A;  3H41 A;  2LJ0 A;  4AG1 C;  1JXO A;  2YUN A;  4IIM A;  2YUO A;  1YP5 A;  1RLQ C;  2OAW A;  3EG2 A;  4LUE A;  2RQR A;  1TUC A;  2EYY A;  1B07 A;  2FRW A;  3I5S A;  4ZNX A;  2XMF A;  2A36 A;  4HXJ A;  2JXB A;  2DLP A;  2CRE A;  2YUP A;  1A0N B;  3U23 A;  2EYZ A;  2X3W D;  2LQN A;  3REB B;  2CDT A;  4J9E A;  1GRI A;  1WFW A;  5GJV B;  1WLP B;  2HSP A;  4D8K A;  1WXU A;  2ED0 A;  1X6B A;  1M3A A;  1BK2 A;  4AFZ C;  3EG3 A;  1UJY A;  2EVR A;  1H3H A;  1W1F A;  2DL5 A;  2ABL A;  2GTO A;  2JT4 A;  3RNJ A;  1Y0M A;  1H92 A;  1T3S A;  2KT8 A;  2FPD A;  1QLY A;  5FWC A;  2VVK A;  2DL7 A;  3CQT A;  2M0Y A;  2LNH B;  4OMN A;  1NM7 A;  2A37 A;  1WI7 A;  2BZ8 A;  2DVJ A;  5GJW B;  1KFZ A;  1QKW A;  1YWO A;  3NHN A;  2RPN A;  3M0U A;  1RLP C;  2EQI A;  1ZLM A;  4EIK A;  1FMK A;  2J6F A;  4LE9 A;  4CC4 B;  4JJD A;  2DM1 A;  1X43 A;  1OPK A;  3KFV A;  1X2K A;  1NYG A;  1WA7 A;  3LH5 A;  2DBM A;  4J9C A;  1V1C A;  1SPK A;  1M27 C;  1IO6 A;  3NGP A;  1AZG B;  3ULR B;  1K4U S;  4JZ4 A;  1Z9Z A;  1UFF A;  1S1N A;  3QWX X;  1U5S A;  5IXF A;  1UHC A;  3EGU A;  4HCK A;  4RTY A;  1I1J A;  4RUG A;  2D8H A;  3RBB B;  1PNJ A;  1UGV A;  2KEA A;  1HD3 A;  1GFC A;  2ENM A;  2EYX A;  2DYB A;  1ZUK A;  2C0I A;  2EKH A;  3TSZ A;  4Y92 A;  2LQW A;  2F2X A;  2LMJ A;  1X27 A;  2FPE A;  2O88 A;  1G83 A;  3H0I A;  1U06 A;  2O9S A;  2FG0 A;  4Z89 A;  2EW3 A;  2CUD A;  4WCI A;  2AK5 A;  2JS2 A;  4JPB W;  2K7A A;  1K9A A;  5HCK A;  2PZ1 A;  4DEX A;  2KRS A;  4CC3 A;  3EG0 A;  1SRM A;  2DNU A;  3TVT A;  1CKB A;  2HCK A;  2V1Q A;  1K0X A;  2J06 A;  4RTT A;  1GCQ A;  1OEB A;  2L3Q A;  1I0C A;  1AWX A;  2EBP A;  4CC7 A;  4Z8A A;  2KRM A;  4FSS A;  4JJC A;  1AWJ A;  2LJ3 A;  1TG0 A;  2AZS A;  2MIO A;  2KXC A;  2DL3 A;  1U3O A;  2QDL A;  2DL8 A;  1BB9 A;  1M3C A;  2AZV A;  1T3L A;  1UG1 A;  3M0S A;  4RTX A;  5L23 A;  2EGE A;  1HSQ A;  1N5Z A;  1JXM A;  2VWF A;  4D8D A;  4J9B A;  3VS3 A;  2EYW A;  1BBZ A;  3VS0 A;  1SSH A;  1MV0 B;  4QT7 A;  3H0F A;  1PWT A;  3O5Z A;  2FRY A;  2JS0 A;  1KJW A;  2DA9 A;  2X3X D;  2H8H A;  5IHN A;  1CSK A;  2GGR A;  3I5R A;  2SRC A;  4J9F A;  1UJ0 A;  4J9H A;  2CSQ A;  3H0H A;  4AFQ C;  4R0K A;  2FEI A;  1UE9 A;  4DEY A;  1X2Q A;  1WIE A;  1YNZ A;  3VS2 A;  4F14 A;  3UF4 A;  2V1R A;  2W0Z A;  3TSW A;  3UA7 A;  3I35 A;  2KXD A;  2B86 A;  1K76 A;  1TUD A;  3UA6 A;  3A98 A;  1LCK A;  2F2W A;  3ZL7 C;  2EGA A;  2KRO A;  1ZBJ A;  4HVV A;  3VRY A;  1AZE A;  1NYF A;  2BTT A;  4J9G A;  1NEB A;  1W70 A;  3C0C A;  2KGT A;  2K9G A;  3EHQ A;  1K1Z A;  1KSW A;  2GTJ A;  2RMO A;  2RQV A;  1GBR A;  4RTU A;  2ROT A;  1AWW A;  2DMO A;  1GCQ C;  1PKT A;  2J05 A;  3NMZ C;  2SEM A;  1B3Q A;  4AFS C;  1OV3 A;  4OMP A;  1SHG A;  4F16 A;  4IIO A;  3M0P A;  3I9Q A;  1ZUU A;  2L3S A;  2A28 A;  2ED1 A;  1JU5 C;  2O9V A;  2LCS A;  1H8K A;  2PNI A;  1AOJ A;  1PHT A;  2CSI A;  1T0H A;  1NG2 A;  2C0O A;  1UHF A;  2D0N A;  3VS1 A;  1ABO A;  1T0J A;  4JJB A;  1K0S A;  2YT6 A;  4OMO A;  1QWE A;  2KYB A;  3UAT A;  4E6R A;  1G2B A;  1M3B A;  1VYT A;  3REA B;  2J6O A;  2CUB A;  2F2V A;  1UTI A;  1NLO C;  2JM8 A;  1J3T A;  2GNC A;  1SHF A;  2DIL A;  1RUW A;  2J7I A;  1PRL C;  4ESR A;  1UUE A;  1YWP A;  1RI9 A;  2M51 A;  2MOX A;  3EHR A;  2K6D A;  3QWY A;  2KBT A;  2DBK A;  2BZY A;  1GL5 A;  2JMA A;  1YN8 A;  1M8M A;  2DL4 A;  5I22 A;  1ABQ A;  1ZSG A;  5IHK A;  3VS4 A;  5FWB A;  1YCS B;  2FO0 A;  2OJ2 A;  3VS5 A;  2C0T A;  3VS7 A;  2AKK A;  4RTZ A;  4Z88 A;  2GBQ A;  2ROL A;  4AG2 C;  3SHW A;  3GBQ A;  1GFD A;  1FYN A;  2HEQ A;  4KRT A;  1AD5 A;  1E7O A;  2RQT A;  2OI3 A;  2G6F X;  2LZ6 B;  2HBW A;  3EG1 A;  2RN8 A;  5I11 A;  2DRM A;  2L3P A;  3M0Q A;  2NWM A;  2P4R A;  1MUZ A;  4F17 A;  2J6K A;  2O31 A;  2ECZ A;  2YUQ A;  2NUZ A;  2JW4 A;  1ARK A;  4HVU A;  2JM9 A;  2RF0 A;  2K79 A;  1JEG A;  1MV3 A;  2GQI A;  4JZ3 A;  2DE0 X;  3SEM A;  4RTV A;  2KRN A;  1ZX6 A;  1SRL A;  1X6G A;  5EC7 A;  1EFN A;  1E6G A;  1VYV A;  1X69 A;  2AKL A;  2K2M A;  2LP5 A;  3JV3 A;  1PKS A;  1AVZ C;  4K11 A;  2YSQ A;  1Y57 A;  4ORZ A;  2W10 A;  5FW9 A;  2RQW A;  3FJ5 A;  2KNB B;  4RTW A;  1WDX A;  3R6N A;  2EGC A;  1GBQ A;  1GCP A;  1AEY A;  1WYX A;  5IHI A;  2KYM A;  3PVL A;  2CH4 W;  2A08 A;  2IIM A;  2CH4 A;  2EPD A;  1UEC A;  3IQL A;  3M0R A;  3PE0 A;  2PTK A;  5IH2 A;  2O2O A;  2I0N A;  4OML A;  2JMC A;  2FPF A;  1JO8 A;  1NLP C;  2D1X A;  1OPL A;  3NPF A;  4GBQ A;  1HJD A;  2KT1 A;  4CC2 A;  2RNA A;  2RQU A;  2MCN A;  4X1V A;  2D8J A;  2DJQ A;  5ECA A;  1SEM A;  1I07 A;  4J9I A;  1QKX A;  1ZUY A;  2L0A A;  1OOT A;  2CT3 A;  1W6X A;  2HDA A;  2DRK A;  1QWF A;  1KIK A;  1CKA A;  4LN2 A;  4OMQ A;  2BZX A;  3VRZ A;  1VA7 A;  1E6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...