1MV0B

Nmr structure of the tumor suppressor bin1: alternative splicing in melanoma and interaction with c-myc
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
81
Chain Sequence
b'GRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKKLEKCRGVFPENFTERVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myc proto-oncogene protein
publication title A structure-based model of the c-Myc/Bin1 protein interaction shows alternative splicing of Bin1 and c-Myc phosphorylation are key binding determinants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis, transcription
total genus 12
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2002-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1mv0B00
4HVWA 3M0UA 2B86A 4K11A 1WX6A 1VYUA 3JV3A 4Z88A 2DRKA 2LCSA 2D8JA 5HCKA 1WFWA 2ABLA 1VYTA 1PRMC 2D1XA 2J6FA 2A08A 3KFVA 1GFCA 3H41A 2DLPA 1SRLA 2J6KA 2BZYA 2DYBA 2GBQA 2CUBA 2GQIA 3NPFA 2FG0A 1RLQC 2RF0A 2EGCA 1WYXA 1JO8A 1NM7A 3UA6A 2RMOA 4J9GA 2DMOA 4OMPA 2HBWA 2VWFA 2J05A 1MV0B 4AFSC 1AD5A 2KRNA 2MIOA 2CDTA 3I5RA 2W0ZA 1MV3A 1T3LA 1NEBA 2RQVA 3THKA 4F14A 2LJ0A 2RPNA 2A28A 1ABQA 3REAB 4CC4B 2GTOA 3VS1A 1E7OA 2DILA 2FEIA 4QT7A 3ZL7C 4F16A 3PVQA 1SHFA 1NLPC 4DEYA 1KSWA 2FPEA 2HSPA 1ZBJA 3M0SA 1UHCA 1UE9A 2NUZA 1K0XA 1SRMA 2JW4A 4Z8AA 1GRIA 2O88A 1PHTA 3RBBB 4CC7A 2CT4A 1NYFA 2KT1A 2M0YA 1WIEA 5IHNA 2DL7A 3M0TA 4RTWA 1YP5A 1T0HA 2RNAA 4AFQC 2J7IA 3NGPA 1AOJA 2LX7A 3O5ZA 2EPDA 2PTKA 2IIMA 2O9VA 1PKSA 1M3BA 2YUNA 2DF6A 2CSIA 1UJYA 2AZVA 5IHIA 1K9AA 2V1QA 2DE0X 1H92A 4JZ4A 2DVJA 2JM8A 1I0CA 2ESWA 2O31A 2OJ2A 2EYYA 1NG2A 2G6FX 4AG2C 1QWFA 3UF4A 4IIMA 2QDLA 2YT6A 4F17A 2GNCA 1M27C 4Y92A 4E6RA 4LE9A 2E5KA 5IXFA 4J9EA 4RTZA 1JXMA 2X3WD 1GCPA 1X69A 1ARKA 2D8HA 2O2OA 2FRWA 1SSHA 1X6BA 3IQLA 2C0OA 1VA7A 1Z9ZA 4HCKA 2BTTA 1GCQC 1J3TA 1QKXA 2A36A 3M0PA 1M30A 1UDLA 1AVZC 2LZ6B 1OEBA 2JMCA 5ECAA 3EG3A 2K3BA 2GTJA 2JMAA 2KRSA 3NHNA 3EG1A 2SEMA 3M0RA 4DEXA 1OOTA 1OPLA 3C0CA 4AFUC 3QWXX 4RTVA 1XOVA 2MOXA 1B07A 1I1JA 2LQNA 2VKNA 3I35A 4J9IA 1U3OA 2XMFA 2DM1A 3ULRB 1I07A 2A37A 2LMJA 2AK5A 4EIKA 1JU5C 1FYNA 1G83A 1LCKA 4J9BA 2VVKA 3VS4A 2JT4A 2KXCA 3EHQA 2DX1A 2DJQA 4JJDA 2FPFA 2P4RA 2FRYA 4RTYA 3PVLA 1HD3A 1NYGA 2ECZA 1Z9QA 2K2MA 1KFZA 1A0NB 3CQTA 2LP5A 3I9QA 4JZ3A 1WDXA 1OV3A 2YUQA 4JJCA 2HCKA 2KGTA 2X3XD 1K4US 1YWOA 3EHRA 2DA9A 2AZSA 2CSQA 4LUEA 1BBZA 4GLMA 4OMQA 1X6GA 1W70A 2I0NA 2M51A 1WXUA 5FW9A 3TSWA 1ZUYA 1UJ0A 2J06A 4IIOA 4D8DA 4Z89A 3TSZA 2CT3A 1ZLMA 4HVUA 1BK2A 1W6XA 1ZSGA 2KRMA 2KR3A 2CREA 3VS0A 1X2QA 1N5ZA 2DBMA 1QKWA 1M3AA 2KBTA 1X2KA 2DL3A 4JJBA 3VS5A 2DL5A 2LJ1A 2EGEA 2EKHA 1E6HA 2K79A 5FWBA 2J6OA 2C0TA 3TVTA 2DBKA 1X43A 1QWEA 1JQQA 1K76A 3VRYA 4LUDA 2GGRA 1S1NA 1YNZA 1BU1A 2W10A 2KROA 1Y0MA 4RUGA 4A63B 1JEGA 1KJWA 2L3PA 4LN2A 2EBPA 4AG1C 3EGUA 2EVRA 1IO6A 5GJWB 2DNUA 4J9HA 4OMOA 2JS2A 2YSQA 3NMZC 1QCFA 5GJVB 2EYZA 3LH5A 4ZNXA 1WXTA 4CC2A 1AEYA 1KIKA 1WXBA 1M8MA 2ROLA 2RQUA 1UECA 4JPBW 1ABOA 2EGAA 5FWCA 1BB9A 2NWMA 2KEAA 3RNJA 1WA7A 2EW3A 2BZ8A 3I5SA 3H0IA 1UUEA 4HVVA 2K6DA 1VYVA 1E6GA 4OMMA 3H0FA 1NLOC 4ESRA 4RTTA 2RQTA 2MCNA 5IXBA 1GCQA 1K0SA 1H3HA 2YUOA 2KE9A 2ED0A 1UGVA 2CUDA 1AWJA 1HJDA 3SHWA 1UFFA 2LNHB 2EQIA 1JXOA 1FMKA 5L23A 1ZUUA 1AWXA 1W1FA 3VS6A 1Y57A 1QLYA 4OMLA 5IHKA 1CKAA 1T3SA 3GBQA 4CC3A 2F2VA 2BZXA 2F2XA 2OAWA 1RLPC 2CH4W 3VS7A 1UHFA 1SEMA 1M3CA 2FO0A 1RI9A 5EC7A 1TG0A 1V1CA 2KNBB 3UA7A 3M0QA 4ORZA 1TUCA 4J9FA 1H8KA 3FJ5A 1WLPB 2PZ1A 1ZX6A 2KYMA 2O9SA 1MUZA 2OI3A 2YUPA 1CSKA 2C0IA 1YCSB 2DL4A 4RTXA 1CKBA 2F2WA 4X1VA 3VS2A 4OMNA 4WCIA 1GFDA 2SRCA 1AWOA 1AWWA 1RUWA 2HDAA 2ROTA 1OPKA 4KRTA 1WI7A 2EYXA 2L3SA 4GBQA 2K7AA 2K9GA 4RTUA 3EG2A 1PNJA 1PWTA 3REBB 4LNPA 1PKTA 1ZUKA 1YN8A 4FSSA 4AFZC 5I22A 1T0JA 2DRMA 3UATA 2L2PA 2ENMA 3VRZA 2CH4A 3SEMA 1SHGA 1U5SA 5IH2A 3A98A 2KXDA 3EG0A 2L3QA 2V1RA 1HSQA 1PRLC 1X27A 2ED1A 1GBQA 2H8HA 2RN8A 2JXBA 2EYWA 1U06A 1GL5A 2L0AA 3H0HA 2AKLA 2AKKA 2YDLA 3PE0A 2PNIA 1B3QA 4D8KA 2JTEA 1K1ZA 2DL8A 2LJ3A 3R6NA 4J9DA 3VS3A 1YWPA 2RQWA 2KYBA 1G2BA 2RQRA 1AZEA 1EFNA 1AZGB 1TUDA 4HXJA 1SPKA 4M4ZA 1UTIA 2D0NA 2LQWA 1UG1A 1NEGA 2JS0A 3QWYA 5I11A 1GBRA 2HEQA 2FPDA 4J9CA 2KT8A 4R0KA 2JM9A 3U23A
chains in the Genus database with same CATH superfamily
3A8HB 2X35A 5D7UA 1OX8A 1VYUA 1MNDA 3JV3A 5CKBA 3MJXA 2DRKA 2LCSA 5HCKA 1WFWA 1QQJA 3WVEB 2QA4Q 3H41A 3ZEHA 2BZYA 2HQXA 2GQIA 2Y4YA 2CZ7B 3CD6T 1BCOA 2RF0A 1PD1A 3JCMh 1NM7A 2M1HA 6AT1B 2KK4A 1R8OB 1WZOA 5CKFA 4J9GA 1Q86C 2K5FA 2DMOA 3CBPA 2HBWA 3P8DA 3I56Q 1MV0B 3CCQQ 1N6AA 3I5RA 3CC2A 2W0ZA 1T3LA 2RJDA 2RQVA 1ZQ1A 2LJ0A 2RPNA 3A8GB 2LQKA 2GTOA 3L2UA 3EGXA 3CMAQ 1BIAA 3J80E 3ZL7C 1XTDA 4F16A 2VV5A 2XDBA 3VV0A 2LT1A 2HSPA 4Y91A 3M0SA 2XDDA 1UE9A 1SRMA 5GAOr 2EQJA 4M75C 1D09B 3HFOA 3OA6A 3RBBB 2EQKA 1ZSZA 2YHTA 5GAN6 4PJOG 3CCUQ 4N4GA 3M0TA 5CQYA 2E65A 3EAEA 2O4XA 2XK0A 1SF9A 3M4YA 2J7IA 5HK3A 1FWZA 3PTAA 2QXFA 1VQ6T 2EPDA 2PTKA 4QQGA 4M78D 2KQWA 3A8MB 4GY5A 3QBYA 1M3BA 2QEXA 1D0XA 1UJYA 5GAN4 5IHIA 4LDXA 4F7UF 3OYIA 1H92A 2O01E 4M7AA 1I0CA 1IB8A 2PVOB 3Q1JA 4M77B 4XTXA 1VQKQ 2DPPB 4N0AA 3GNFB 2EYYA 2VGMA 1QWFA 5GANh 2EJFA 2EAYA 4LE9A 2E5KA 5IXFA 1JXMA 3V7RA 2X3WD 1GCPA 3R6OA 3QO3A 4ZGJB 2QGGA 1X6BA 3CCEQ 3M55A 1Z9ZA 4HCKA 2BTTA 3CCVQ 1GCQC 2KI7A 1K9MC 3CC7T 1TH7A 2R57A 1UDLA 1VQPT 2LZ6B 1WJSA 3EG3A 2XICA 3RMQA 1AHJB 1U1TA 4DEXA 1VIEA 2K57A 3LYIA 5GAN7 1OPLA 4RTVA 1B07A 2ZPFB 1I1JA 1D0YA 1YCYA 3M58A 1YITA 2VXFA 4C5GA 3OYMA 3JCMX 2JTMA 3I35A 2A0FB 3NTIA 2LMJA 4R56A 2DVEA 2AK5A 3J81E 1FYNA 3VS4A 2KXCA 2XG8D 4YTLA 4PJOB 5LJ3j 2X4WA 4V2SA 1UEBA 1VQMT 2FRYA 2EFIA 2XDPA 3BE3A 1KQSS 4RG2A 2PQWA 1NYGA 1KFZA 1A0NB 2L89A 3PT9A 2X3XD 1K4US 4L59A 4EPCA 2DA9A 2DK3A 4J6YA 3V7SA 3AHUA 1QVPA 2LCCA 3G6EA 1M2VB 3CCST 1W70A 1WXUA 2IG0A 4KH0B 1ZUYA 2J06A 5CR2A 3TSZA 2CT3A 4KGZB 3HKSA 1ZLMA 3MEVA 1BK2A 1M5Q1 3X24B 1ZSGA 2E6ZA 2KRMA 5KCHA 2KR3A 4HCZA 4ME7A 2DBMA 4QVCA 1QKWA 1YJWT 4LD6A 2CP7A 5GMKi 1S72A 4B6MA 3PMTA 2DL3A 3M4GA 4C8QA 5KCOA 4PFZA 3SDZA 4OMFB 1D3BB 1FX7A 2EQUA 2LTOA 4M7AD 5FWBA 3EFOB 2P4TA 4M77F 1QWEA 1JQQA 3VRYA 1YNZA 5GAN3 1VQNA 2DFUA 1Y0MA 4RUGA 4BDYA 4B9WA 1KJWA 5GAMh 4OGEA 1BKBA 1TU0B 3QPHA 3RKYA 1WJRA 5GJWB 2DNUA 4J5YA 4C5EA 2I2LA 2EYQA 3CC2T 3E9GA 1VQ9Q 1LOJA 2YSQA 2PUOB 3QZ9B 4EDUA 2EYZA 3LH5A 4JS4A 1VQ5Q 1HYOA 2D6FA 1KC8U 2CS7A 3MP1A 4KULA 1M8MA 5GAOq 4JUVA 4BE2A 5FWCA 2X4JA 1QVGP 3A5ZB 3I5SA 2VB6A 4D6WA 4HVVA 4C0FA 4IKFA 4LD9K 1E6GA 3H0FA 1NLOC 4MMLA 4ESRA 3JAME 4RTTA 5J3BA 2KDSA 5IXBA 2RHYA 4OB2B 1ZA2B 3V8LA 5CVIA 2LDMA 3I56A 3OYFA 3ZFJA 1UFFA 2LNHB 5LJ3f 4M78B 4DBHA 2V8IA 1K73U 3VS6A 2DTOA 4BE1A 3EFSA 4EMHA 1M90R 1WHHA 4LDYA 2QEXT 4PJOF 2R58A 5AT1B 1RAHB 3VS7A 3CMAA 4QW2A 1V1CA 3BDLA 1OU9A 3HTRA 1MNEA 3JB9D 3NTKA 1YHQA 2Y90A 2ZCFB 1VIFA 3DB4A 1VQ8Q 2OI3A 2C0IA 4PK4A 4RTXA 1D1AA 3KUFA 4X1VA 3H6ZA 4WCIA 3INZA 4M7DA 1AWWA 1BYMA 1B34B 3CCUA 2XIDA 1IHVA 3HRUA 3JCMP 2H3EB 4FSXA 5I2SA 4EMKA 2EYXA 3V7CA 3EG2A 1LVKA 2QQAA 3RKWA 4Q5WA 4WF2A 3JCMg 4M7AG 2L2PA 3JRZA 2CH4A 5D6XA 5IH2A 1FMWA 2LNVA 1KQSP 1M9SA 2FB7A 2NLUA 4J83A 4C8QD 2PVDB 2RHZA 1VQKA 1HSQA 4BY6B 1OYXA 1X27A 2RN8A 2JXBA 2EYWA 4Z02A 1YITT 1U06A 1N9RA 4C92D 4DBRA 4M77C 4DOWA 3ME9A 3PE0A 2L3RA 1RI0A 2JTEA 3CXCA 1K1ZA 2DL8A 3RERA 3EG9A 2CP5A 3QJ6A 1YWPA 4KH1B 2KYBA 3CCVA 1RAEB 5C6SA 1EFNA 3UWNA 1SPKA 3M59A 1UTIA 1UG1A 2FPDA 1TS9A 3OS2A 2HL3A 4R0KA 2LC4A 4HVWA 3EGXB 2B86A 1OU8A 3I55Q 4XAXB 3PMIA 4ATOA 2LVMA 1KC8C 2D1XA 2QQBA 1GXIE 4GLKA 4ZGDB 1Q86U 2A08A 3KFVA 5GAOm 3MEUA 2DLPA 3MPUB 4A4KA 4ZN3A 1UGQB 2GBQA 3NPFA 1OZ3A 4FW2A 3G6ET 3SWNB 1YI2Q 2JOYA 4HCCA 2RMOA 4FYYB 4AT1B 5GAOp 1X6OA 5GANg 4XU0A 2VWFA 4AFSC 1AD5A 1Q82U 2O4XB 1MV3A 1NEBA 3WXMB 4M78F 3JB9G 5KYYA 1IGQA 3VS1A 1S72T 1K73C 9ATCB 4PJOC 4QT7A 1MMNA 2AT1B 1SHFA 4M7AB 3F70A 1KSWA 2FPEA 3VUBA 3CMEQ 1KG1A 3FIFA 1UHCA 2JW4A 2HKNA 1GRIA 3FLGA 1G5VA 1PHTA 4M7DE 1NYFA 3FDRA 1KK7A 2DJZA 1K8AU 1IGUA 2EQMA 1VQNT 5LJ5j 3L2VA 2YLBA 2DL7A 2LQ8A 3DLLA 1G8XA 3OYJA 2RNAA 3JCMW 3NGPA 1AOJA 4C8QG 1H3ZA 2LX7A 4PNOA 2GF7A 2IIMA 2RK1A 2CSIA 1VQ4A 2BIVA 5GAOn 2RA2A 2GFUA 4C92G 2O31A 3OS0A 4UC4A 4M75A 4A53A 3RMSA 3URGA 4FYXB 2F1LA 2E4HA 4BACA 1W2BA 3CC4Q 4E6RA 2E6NA 4LXCA 1M4ZA 1AT1B 1KD1R 4J6WA 1K9MU 3RKXA 3OBWA 2H3JA 2NUPA 5FU7B 3I56T 1YJWA 1SSHA 4FL6A 1NJIR 5KYWA 1FXXA 3EGDB 1VQ9A 1J3TA 3L2RA 3C94A 1JJ2P 3CCMA 2CZ1B 3M0PA 1M30A 3JCMQ 3J7AF 3RIRA 2QK0A 1VQ5A 1OEBA 2JMCA 2K3BA 3NHNA 4C5HA 3EG1A 2ZPIB 3CMAT 5GAN5 3QG1A 3TREA 2F5KA 2YRCA 4B9XA 1YHQT 5CQXA 1VQOQ 4J9IA 2DD5A 3G4SA 4BB7A 4BI4A 4J6XA 2XMFA 2DM1A 3LW5E 1Q81R 1VQLQ 1N8RR 3EH2A 1Y96B 3CCUT 1ACMB 3A8OB 2RK2A 4CI0C 3QZ5B 4EIKA 2C06A 2ZPHB 1TSFA 2JT4A 2CP6A 2CP3A 2DD4A 1IZ6A 3M57A 1Q82C 2HD0A 3TEEA 1VOMA 5GAMg 1B7TA 4M78C 1HD3A 3LX7A 4BE0A 4C8QB 5LJ3h 2ECZA 2OTLQ 2K2MA 3GPLA 5IN1A 1I81A 1WQWA 4JZ3A 1VQKT 2QDYB 1OV3A 4JJCA 4M7AF 4C92B 1YWOA 2CSQA 1TOVA 4GLMA 5LJ5f 1BI1A 1X6GA 3LGLA 4D8DA 4Z89A 1UGRB 1K8AC 1JB0E 2CGHA 5IAYA 3FC3A 3CCVT 4MDWA 4A4FA 3VS0A 1N5ZA 1X2KA 4WTOB 2AIRB 3JCMJ 4JJBA 2F5TX 1O75A 1QVGS 2DL5A 4L5GA 2LJ1A 4M75E 2K5LA 2DZCA 4HCBA 1P92A 2EKHA 4J7IA 1RABB 4FYVB 3E2UA 1DJ7B 4ELZC 3TVTA 2W10A 4BY6C 4A63B 5CKHA 1JEGA 3QJYA 4MZTA 1OULA 4LN2A 2EBPA 3CCJA 3P8BB 3JCMd 4RCBA 3OW2A 4J9HA 1HXDA 2FHDA 2JS2A 3QYGB 4IUPA 1C0MA 2MYSA 3G71Q 1BI2A 5GJVB 5CKDA 4ZNXA 4BUGA 3OBYA 4CC2A 3HHTB 1AEYA 1KIKA 1WXBA 1X01A 2FZKB 2RQUA 1UECA 3M5AA 4JPBW 4JLGA 5KYNA 1R0BG 3JB9F 3H0IA 3OYDA 2K6DA 4DA4A 1VYVA 2VGNA 4O5VA 4OMMA 4E47A 4A4EA 5LL6S 5CAIA 1PSFA 1K0SA 2YUOA 4ZTFA 1MGQA 3UPUA 2PVGB 1JXOA 3SWNC 5L23A 4QQ6A 3GP8A 2RI2A 3MP8A 5CCAA 2ZZDA 1QLYA 4OMLA 1CKAA 1T3SA 3GBQA 3OSVA 2Z0WA 4CC3A 2F2VA 2LRQA 4Y28E 1VQ4T 1UHFA 1SEMA 3GLXA 2NUTB 1RI9A 5EC7A 2GCXA 2KNBB 3HL8A 5HY6A 1VQPQ 1YJ9A 5DY9A 4PFOA 1WHLA 3CMEA 4C8QF 3RR6A 3FJ5A 3NFCA 3L2QA 2PZ1A 2O9SA 1QP3A 1MUZA 1M1KR 2YUPA 4M78G 2F2WA 4M7AC 1KHIA 2E3HA 3L2WA 4C92F 4OMNA 2ATCB 4N0AC 1GFDA 5GANd 1AWOA 2P0QA 1YJNQ 4A4HA 3QUIA 4KRTA 7AT1B 3HSBA 2L3SA 2DEQA 2E70A 2OTJA 1PWTA 3REBB 4LNPA 4BD3A 1KHCA 4FSSA 5J39A 1VQ9T 3VRZA 3VKIA 3A8LB 5CIUA 3CCMT 3KBGA 1U5SA 2CP0A 3DLMA 4J8OA 1VQ5T 3A98A 4FM4B 1VQMQ 4XU2A 2KXDA 4XTZA 2XI9A 3VJPA 3GIBA 1LPLA 1PRLC 3OYHA 1GBQA 2HQHA 5CK9A 1Q86R 3OYEA 2E41A 3CPWA 3H0HA 2COWA 3OYCA 2X4XA 2AKLA 5GMKj 4HA8A 3G4ST 3HRSA 1YIJQ 4MZPA 2LJ3A 2JTFA 4E7LA 3GNGA 1AZEA 1M2OA 4P5NA 4HXJA 5D6WA 2DZ9A 1QVFA 3FB9A 2MI6A 4FT2A 1OZ2A 5FU7C 1RAFB 2HEQA 4F7UE 2KT8A 4DBQA 3G7ZA 2JM9A 3U23A 3V8JA 3QYHB 1W4SA 2QA4A 4BDZA 4Z88A 2RO0A 2DERA 2D8JA 2ABLA 4JDSA 4AMCA 1VYTA 3RUXA 1PRMC 4X9CA 1VQ8T 3JCMf 1VQOA 4O6JA 2DYBA 1RAIB 2FG0A 1WYXA 5LJ3e 1JO8A 2HQEA 3UA6A 3UT1A 3CCQA 2RI5A 4ZN1A 1M1GA 4E7SA 1TXQA 4OMPA 2KY9A 2KRNA 2MIOA 3PNWC 3THKA 2A28A 2DXTA 2PU9B 3ER0A 3LWHA 1E7OA 5FROA 4R55A 2OTLA 2FEIA 4RMOA 3OS1A 3LGFA 1QMCA 1NLPC 2RI3A 4DEYA 1UGSB 4JRIA 2FVUA 2NUZA 1Y71A 4C8QC 2IPOB 4Z8AA 1SG5A 3CPWP 2CT4A 2QQRA 2MAMA 2KT1A 2M0YA 4C92C 1K9MR 3QDFA 2RHXA 5IHNA 1JJ2S 1TUGB 2NUPB 3QXEB 5GMKl 2FZGB 3CCJT 1YP5A 1T0HA 5LJ5h 4HT9A 3LH0A 3OB9A 5GAMd 1QVFP 3HRTA 3BY7A 1PKSA 4HKEA 2V8KA 2DF6A 4LDWA 4PJOA 3EFRA 2AZVA 2DKGA 1K9AA 3MEAA 4JZ4A 5GANf 2JM8A 1MMGA 2ESWA 1IRXA 2OJ2A 2L8DA 2VC8A 1QW1A 2G6FX 5GMKe 1I5LA 4IIMA 3CCLQ 4OVAA 2QDLA 5A0DA 1LJOA 2RH2A 4JRKA 4L6V5 3OYKA 4A4GA 3JCMc 4RTZA 3CCEA 4XQ3A 1X69A 1YI2T 1ARKA 1M8VA 1M2VA 2D8HA 2O2OA 1ZHIA 1WHJA 3IQLA 5M9OA 2P0KA 1PM3A 2HMAA 5KYXA 2QASA 3HP9A 3KXTA 3QDRB 2V26A 1JBMA 1NZ9A 1R77A 2KRSA 2WACA 4MZMA 2SEMA 3M0RA 4IURA 1WHMA 4M77E 4XTUA 3C0CA 4AFUC 1YJ9T 1XOVA 2MOXA 2OX7A 3M53A 2PUKB 4IUUA 3CMET 3TQ7P 1XQHA 1ZSZB 2JJ9A 2YRDA 3RDVA 2DXCA 4PLIA 3EFOA 5A2QE 4JRPA 1U3OA 1YITQ 3ULRB 3M9QA 3X20B 2A37A 4XTVA 2M02A 3TU4K 2QQSA 5I21A 3V8KA 4OP0A 5GMKm 1JU5C 2OTJT 4J9BA 2VVKA 3P8HA 2KVQG 4M7DC 3X26B 4OGCA 4EMKC 3OMCA 2DJQA 3S3MA 3PGGA 4N4HA 2FPFA 2P4RA 4RTYA 4FU6A 2DEUA 1Z9QA 2A7YA 3A1PA 2LP5A 3I9QA 4C0DB 2HKQB 2HCKA 1MMAA 2KGTA 3L1AA 2JVVA 3EHRA 3CXCP 2M9UA 2XHCA 4M7DD 1YJNA 2I0NA 3PIPA 1I4K1 1UJ0A 4OF1A 3CCRQ 4RCCA 3H9NA 4BI3A 4HVUA 1W6XA 4PJOE 2CREA 2KAFA 1X2QA 1QCNA 2QAZA 2BE7D 4C0GA 1M90U 3VS5A 1OI1A 2EGEA 4OB1B 2HBPA 1S72Q 2QA4T 2K79A 2J6OA 3TCJA 1NPPA 1D1BA 2K5IA 1X43A 4LUDA 5AYFA 2GGRA 1S1NA 5GAMf 1VQOT 4MMKA 2MF2A 1LNXA 3OYBA 4F04B 1YIJA 3CPFA 4FIBA 2AHJB 2L3PA 3N5BB 3CCQT 1B34A 1VQNQ 2YLCA 3EGUA 4J7FA 4E2FB 1IHWA 2EVRA 1JRIA 1TTHB 4OMOA 3NMZC 2QI2A 1PD0A 4RKUE 5A0GA 1NE8A 3L42A 2ROLA 2OTLT 4ZGEB 2EGAA 1BB9A 2QGFB 2FL7A 1WA7A 2BKDN 2EW3A 1UUEA 1WNLA 2QTVA 3JB9J 4FYWB 4TVRA 5L8RE 2MCNA 5FU6B 3OW2S 1GCQA 1VQ7Q 1G3TA 1H3HA 5GAN2 2ED0A 2KE9A 1UGVA 1NBEB 3LWIA 3SHWA 1KQ2A 1QP2A 2EQIA 1FMKA 2K2VA 1W1FA 5IHKA 1MMDA 5KE2A 1WHGA 1RLPC 3PFSA 2CH4W 4KGVB 2HSEB 1M3CA 3CEYA 1TG0A 1XJWB 3M0QA 1VQ8A 4ORZA 1TUCA 4M7DG 1O9SA 4J9FA 4DBFA 1RADB 5LJ5e 1W2BP 4EMGA 2KYMA 3BFMA 2XD0A 4PL6A 1QCOA 1CSKA 3O8VA 3X25B 3G1JA 1CKBA 3OSSC 3VYHB 2K3XA 1BI3A 3VS2A 3CD6Q 1YHQQ 4XU1A 2SRCA 5KYUA 2HDAA 3CCET 2E5QA 4RTUA 3SWNA 5C0MA 2DTIA 4M78E 1ZUKA 3OQ5A 1YN8A 1T0JA 3EH1A 4NS5A 3S3NA 4IUVA 2DRMA 1Q95G 2RB6A 2ENMA 2VASA 3G71T 1KC8R 1Q7YU 3OS5A 1VUBA 5FRMA 5DLOA 4IUQA 4XK8E 4FW1A 3EG0A 2L3QA 2V1RA 2OAUA 4M75D 1M90C 3JSCA 4PLLA 2ED1A 1BI0A 3CCLA 4JLIA 2H8HA 1YFNA 1GL5A 4E7JA 2JN0A 2ZPGB 2AKKA 2L5QA 5EG2A 4D8KA 3VS3A 1U1SA 3HFNA 2G3RA 5GMKh 3SD4A 4LDUA 2RQWA 1G2BA 1K73R 1AZGB 1C1AA 1VQ6Q 4M4ZA 2D0NA 2COYA 2DO3A 1V76A 2JS0A 1NEGA 5I11A 3I55A 4F7UA 5D6YA 1N27A 3M0UA 4K11A 1WX6A 3JB9I 4II1A 5LJ5g 3BW1A 3CPWS 1I5OB 2D9TA 2J6FA 5LJ3d 1GFCA 2J6KA 1SRLA 1YI2A 4CRIA 4M7DB 2CZ6B 1X75C 2CUBA 4EMKB 3OY9A 1RLQC 4XTWA 2EGCA 2GFAA 1ZSZC 1YJNT 1QVFS 2ZGWA 2YXYA 5IT9E 1KD1U 2J05A 3GOXA 4IUTA 2CDTA 5HKCA 1NJIU 3CC7Q 4F14A 1FMVA 1ABQA 3EGDA 1UB4A 3REAB 3JCMb 4CC4B 2DILA 3T9NA 3PVQA 2MK5A 2MWOA 3MKDA 1ZBJA 2XKOC 4QQDA 4JRQA 1K0XA 2O88A 2CKKA 4CC7A 1QVGA 2ZPEB 4C0DC 3EG9B 2CZ0B 5KE3A 1WIEA 1MHNA 2RHUA 4RG8A 4XTYA 1YIJT 3OW2P 3CCRA 2X9HA 1Q81U 4RTWA 1N8RU 1IREB 2EJGA 1Y96A 2WSEE 4PJNA 5DLQE 4AFQC 2M0OA 3O5ZA 4M75G 2O9VA 2YUNA 2RD1A 1BCMA 8AT1B 5KYXB 1D0ZA 2DIQA 3E19A 2V1QA 4E7KA 1EX4A 2DE0X 5GANj 2E64A 2DVJA 4M7AE 2XU8A 1Q7YC 2YRVA 1VQ4Q 2E1HA 3CC4A 2GQVA 2DTHA 1NG2A 2P0PA 4AG2C 3UF4A 3ASKA 4OB0B 3OYAA 2MWPA 2YT6A 4F17A 1RACB 1M27C 2GNCA 4Y92A 4C92A 2KSSA 2BUDA 3H8ZA 3CCSQ 4J9EA 3DB3A 4MDXA 2VUBA 1EIFA 1PG5B 2HNIA 3E1SA 1I8FA 1Q82R 3C4SA 5CO7A 3MCAB 2DXUA 2FRWA 2C0OA 1VA7A 4QVDA 5KYYB 2X4YA 1QKXA 2A36A 5GAN8 1YJWQ 2F69A 2MPXC 1AVZC 1WJQA 5ECAA 2GTJA 2JMAA 2WSCE 4KT0E 3JCMe 3CCMQ 1D1CA 2LX9A 1OOTA 4M77A 2E3IA 2DAQA 3CXCS 3QWXX 2BE9B 4PJLA 2E12A 1KQSA 2YWWA 2LQNA 2VKNA 4PJMA 1KQ1A 1VQLA 1K8AR 2RJEA 4X34A 1VQ7A 4M7DF 1I07A 2ZAEA 5KH6A 3G4SQ 4NL2A 1OX9A 3ZBDA 2E10A 1G83A 1LCKA 5FU6C 1U8RA 4NL3A 1KD1C 3CC2Q 3GF5A 3EHQA 2B8AA 2DX1A 4JJDA 3RESA 3PVLA 1WPYA 1NJIC 5FLXE 4M75B 1YBYA 4BI8B 2DIGA 3CQTA 3OYLA 1WDXA 4HT8A 2YUQA 2QTXA 2R5MA 4KUIA 3CCLT 3AT1B 3X28B 2AZSA 3QSUA 3OYGA 4LUEA 3CD6A 1BBZA 2FYKA 1PSEA 2DYIA 5GAOl 8ATCB 2A3LA 4OMQA 2M51A 5FW9A 3TSWA 1F1BB 4IIOA 3L2ZA 1PCXA 1M1FA 5KYWB 2JUFA 3WVDB 3UDCA 4OB3B 3S6WA 5I2MA 3VUZA 1G3WA 4E7ZA 1Q81C 5GANe 1N8RC 2EKOA 1M3AA 2KBTA 1SSFA 4X9DA 2QEXQ 3I55T 1TWBA 4QVZA 3LLRA 2K4YA 4C0ZA 4C8QE 3OYNA 4VUBA 2EJ9A 4JS5A 2HZYA 2NUTA 1RL2A 1E6HA 4XU3A 2C0TA 4KGXB 4C92E 4QKUA 5LJ3g 2RJFA 3MHXA 4PKCC 2DBKA 5GAMj 1K76A 2X51A 3FJPA 1BU1A 1WQ7A 2KROA 1M1KU 4PJJA 3VYGA 1RAAB 2RM4A 1EZZB 2LT4A 1WGSA 2EIFA 3C95A 1Y7XA 4AG1C 4F7UG 2QYZA 3BDUA 1IO6A 3G71A 1VQ6A 2HAXA 3C12A 2CYZB 3CCJQ 2JZ2A 1QCFA 2IVWA 4FT4A 1V29B 1W2BS 1WXTA 1PC0A 3E9FA 1D3BA 2RJCA 2ZPBB 2VYTA 4ZTJA 2QG9B 1ABOA 2R5AA 2NWMA 2M16A 2KEAA 3OMGA 3RNJA 4M77D 3NTHA 4N4IA 3QHSA 2BZ8A 2RHIA 2EWNA 3HPWA 3CBMA 3QKJA 5FRNA 5A0LA 3PIOA 3JB9H 2RQTA 5KYUB 3FEOA 2CUDA 1AWJA 1IXDA 1HJDA 2WSFE 4DOVA 3CCRT 3MEWA 1OQKA 5J26A 2D0QB 2V8JA 1ZUUA 3CC7A 1AWXA 2Y4XA 1Y57A 3VU3C 1VQPA 1NPRA 2BZXA 2F2XA 2OAWA 1H641 5LJ5d 5CKEA 1Q7YR 2COZA 1JJ2A 2FO0A 3D7SB 3UA7A 4FCYA 1H8KA 3FRNA 3MP6A 1WLPB 4M75F 1ZX6A 1Y07A 3CC4T 3M54A 1YJ9Q 2DXBA 1YCSB 2DL4A 2MMPA 4A54A 2KMTA 3SFMA 5DM7R 4DQ2A 2CP2A 1UGPB 3G6EQ 1R0CB 1RUWA 1ZA1B 5HK0A 2ROTA 2JNGA 2DETA 1XNIA 1OPKA 2K3YA 1WI7A 3QIIA 4GBQA 2K7AA 2K9GA 2VXEA 1G3YA 1PNJA 4ANJA 3CBOA 4C5IA 4M78A 1PKTA 4AFZC 5I22A 4JJNK 3UATA 1VQMA 2OTJQ 3META 4PJOD 4F7UB 4KUDK 3JCMV 3SEMA 1WHKA 2HL5C 1SHGA 3MO8A 1RAGB 2QQ9A 4NOYA 5GAMe 4E7IA 4LDVA 4ELYC 2P84A 4PFPA 2L0AA 1VQLT 3CCSA 3SB2A 3M56A 2YDLA 2PNIA 2LCLA 1B3QA 1VQ7T 3R6NA 1M1KC 4J9DA 4E7HA 1C6VX 1ZBXA 2FZCB 1N9SA 2RQRA 3DKMA 1TUDA 4KBMB 2LQWA 3OYYA 1SKUB 3QWYA 1GBRA 1G3SA 1BIBA 4M77G 4J9CA 3S3OA 1HK9A 2NYSA
chains in the Genus database with same CATH topology
4HVWA 3M0UA 2B86A 4K11A 1WX6A 1VYUA 3JV3A 4Z88A 2DRKA 2LCSA 2D8JA 5HCKA 1WFWA 2ABLA 1VYTA 1PRMC 2D1XA 2J6FA 2A08A 3KFVA 1GFCA 3H41A 2DLPA 1SRLA 2J6KA 2BZYA 2DYBA 2GBQA 2CUBA 2GQIA 3NPFA 2FG0A 1RLQC 2RF0A 2EGCA 1WYXA 1JO8A 1NM7A 3UA6A 2RMOA 4J9GA 2DMOA 4OMPA 2HBWA 2VWFA 2J05A 1MV0B 4AFSC 1AD5A 2KRNA 2MIOA 2CDTA 3I5RA 2W0ZA 1MV3A 1T3LA 1NEBA 2RQVA 3THKA 4F14A 2LJ0A 2RPNA 2A28A 1ABQA 3REAB 4CC4B 2GTOA 3VS1A 1E7OA 2DILA 2FEIA 4QT7A 3ZL7C 4F16A 3PVQA 1SHFA 1NLPC 4DEYA 1KSWA 2FPEA 2HSPA 1ZBJA 3M0SA 1UHCA 1UE9A 2NUZA 1K0XA 1SRMA 2JW4A 4Z8AA 1GRIA 2O88A 1PHTA 3RBBB 4CC7A 2CT4A 1NYFA 2KT1A 2M0YA 1WIEA 5IHNA 2DL7A 3M0TA 4RTWA 1YP5A 1T0HA 2RNAA 4AFQC 2J7IA 3NGPA 1AOJA 2LX7A 3O5ZA 2EPDA 2PTKA 2IIMA 2O9VA 1PKSA 1M3BA 2YUNA 2DF6A 2CSIA 1UJYA 2AZVA 5IHIA 1K9AA 2V1QA 2DE0X 1H92A 4JZ4A 2DVJA 2JM8A 1I0CA 2ESWA 2O31A 2OJ2A 2EYYA 1NG2A 2G6FX 4AG2C 1QWFA 3UF4A 4IIMA 2QDLA 2YT6A 4F17A 2GNCA 1M27C 4Y92A 4E6RA 4LE9A 2E5KA 5IXFA 4J9EA 4RTZA 1JXMA 2X3WD 1GCPA 1X69A 1ARKA 2D8HA 2O2OA 2FRWA 1SSHA 1X6BA 3IQLA 2C0OA 1VA7A 1Z9ZA 4HCKA 2BTTA 1GCQC 1J3TA 1QKXA 2A36A 3M0PA 1M30A 1UDLA 1AVZC 2LZ6B 1OEBA 2JMCA 5ECAA 3EG3A 2K3BA 2GTJA 2JMAA 2KRSA 3NHNA 3EG1A 2SEMA 3M0RA 4DEXA 1OOTA 1OPLA 3C0CA 4AFUC 3QWXX 4RTVA 1XOVA 2MOXA 1B07A 1I1JA 2LQNA 2VKNA 3I35A 4J9IA 1U3OA 2XMFA 2DM1A 3ULRB 1I07A 2A37A 2LMJA 2AK5A 4EIKA 1JU5C 1FYNA 1G83A 1LCKA 4J9BA 2VVKA 3VS4A 2JT4A 2KXCA 3EHQA 2DX1A 2DJQA 4JJDA 2FPFA 2P4RA 2FRYA 4RTYA 3PVLA 1HD3A 1NYGA 2ECZA 1Z9QA 2K2MA 1KFZA 1A0NB 3CQTA 2LP5A 3I9QA 4JZ3A 1WDXA 1OV3A 2YUQA 4JJCA 2HCKA 2KGTA 2X3XD 1K4US 1YWOA 3EHRA 2DA9A 2AZSA 2CSQA 4LUEA 1BBZA 4GLMA 4OMQA 1X6GA 1W70A 2I0NA 2M51A 1WXUA 5FW9A 3TSWA 1ZUYA 1UJ0A 2J06A 4IIOA 4D8DA 4Z89A 3TSZA 2CT3A 1ZLMA 4HVUA 1BK2A 1W6XA 1ZSGA 2KRMA 2KR3A 2CREA 3VS0A 1X2QA 1N5ZA 2DBMA 1QKWA 1M3AA 2KBTA 1X2KA 2DL3A 4JJBA 3VS5A 2DL5A 2LJ1A 2EGEA 2EKHA 1E6HA 2K79A 5FWBA 2J6OA 2C0TA 3TVTA 2DBKA 1X43A 1QWEA 1JQQA 1K76A 3VRYA 4LUDA 2GGRA 1S1NA 1YNZA 1BU1A 2W10A 2KROA 1Y0MA 4RUGA 4A63B 1JEGA 1KJWA 2L3PA 4LN2A 2EBPA 4AG1C 3EGUA 2EVRA 1IO6A 5GJWB 2DNUA 4J9HA 4OMOA 2JS2A 2YSQA 3NMZC 1QCFA 5GJVB 2EYZA 3LH5A 4ZNXA 1WXTA 4CC2A 1AEYA 1KIKA 1WXBA 1M8MA 2ROLA 2RQUA 1UECA 4JPBW 1ABOA 2EGAA 5FWCA 1BB9A 2NWMA 2KEAA 3RNJA 1WA7A 2EW3A 2BZ8A 3I5SA 3H0IA 1UUEA 4HVVA 2K6DA 1VYVA 1E6GA 4OMMA 3H0FA 1NLOC 4ESRA 4RTTA 2RQTA 2MCNA 5IXBA 1GCQA 1K0SA 1H3HA 2YUOA 2KE9A 2ED0A 1UGVA 2CUDA 1AWJA 1HJDA 3SHWA 1UFFA 2LNHB 2EQIA 1JXOA 1FMKA 5L23A 1ZUUA 1AWXA 1W1FA 3VS6A 1Y57A 1QLYA 4OMLA 5IHKA 1CKAA 1T3SA 3GBQA 4CC3A 2F2VA 2BZXA 2F2XA 2OAWA 1RLPC 2CH4W 3VS7A 1UHFA 1SEMA 1M3CA 2FO0A 1RI9A 5EC7A 1TG0A 1V1CA 2KNBB 3UA7A 3M0QA 4ORZA 1TUCA 4J9FA 1H8KA 3FJ5A 1WLPB 2PZ1A 1ZX6A 2KYMA 2O9SA 1MUZA 2OI3A 2YUPA 1CSKA 2C0IA 1YCSB 2DL4A 4RTXA 1CKBA 2F2WA 4X1VA 3VS2A 4OMNA 4WCIA 1GFDA 2SRCA 1AWOA 1AWWA 1RUWA 2HDAA 2ROTA 1OPKA 4KRTA 1WI7A 2EYXA 2L3SA 4GBQA 2K7AA 2K9GA 4RTUA 3EG2A 1PNJA 1PWTA 3REBB 4LNPA 1PKTA 1ZUKA 1YN8A 4FSSA 4AFZC 5I22A 1T0JA 2DRMA 3UATA 2L2PA 2ENMA 3VRZA 2CH4A 3SEMA 1SHGA 1U5SA 5IH2A 3A98A 2KXDA 3EG0A 2L3QA 2V1RA 1HSQA 1PRLC 1X27A 2ED1A 1GBQA 2H8HA 2RN8A 2JXBA 2EYWA 1U06A 1GL5A 2L0AA 3H0HA 2AKLA 2AKKA 2YDLA 3PE0A 2PNIA 1B3QA 4D8KA 2JTEA 1K1ZA 2DL8A 2LJ3A 3R6NA 4J9DA 3VS3A 1YWPA 2RQWA 2KYBA 1G2BA 2RQRA 1AZEA 1EFNA 1AZGB 1TUDA 4HXJA 1SPKA 4M4ZA 1UTIA 2D0NA 2LQWA 1UG1A 1NEGA 2JS0A 3QWYA 5I11A 1GBRA 2HEQA 2FPDA 4J9CA 2KT8A 4R0KA 2JM9A 3U23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HVW A;  3M0U A;  2B86 A;  4K11 A;  1WX6 A;  1VYU A;  3JV3 A;  4Z88 A;  2DRK A;  2LCS A;  2D8J A;  5HCK A;  1WFW A;  2ABL A;  1VYT A;  1PRM C;  2D1X A;  2J6F A;  2A08 A;  3KFV A;  1GFC A;  3H41 A;  2DLP A;  1SRL A;  2J6K A;  2BZY A;  2DYB A;  2GBQ A;  2CUB A;  2GQI A;  3NPF A;  2FG0 A;  1RLQ C;  2RF0 A;  2EGC A;  1WYX A;  1JO8 A;  1NM7 A;  3UA6 A;  2RMO A;  4J9G A;  2DMO A;  4OMP A;  2HBW A;  2VWF A;  2J05 A;  1MV0 B;  4AFS C;  1AD5 A;  2KRN A;  2MIO A;  2CDT A;  3I5R A;  2W0Z A;  1MV3 A;  1T3L A;  1NEB A;  2RQV A;  3THK A;  4F14 A;  2LJ0 A;  2RPN A;  2A28 A;  1ABQ A;  3REA B;  4CC4 B;  2GTO A;  3VS1 A;  1E7O A;  2DIL A;  2FEI A;  4QT7 A;  3ZL7 C;  4F16 A;  3PVQ A;  1SHF A;  1NLP C;  4DEY A;  1KSW A;  2FPE A;  2HSP A;  1ZBJ A;  3M0S A;  1UHC A;  1UE9 A;  2NUZ A;  1K0X A;  1SRM A;  2JW4 A;  4Z8A A;  1GRI A;  2O88 A;  1PHT A;  3RBB B;  4CC7 A;  2CT4 A;  1NYF A;  2KT1 A;  2M0Y A;  1WIE A;  5IHN A;  2DL7 A;  3M0T A;  4RTW A;  1YP5 A;  1T0H A;  2RNA A;  4AFQ C;  2J7I A;  3NGP A;  1AOJ A;  2LX7 A;  3O5Z A;  2EPD A;  2PTK A;  2IIM A;  2O9V A;  1PKS A;  1M3B A;  2YUN A;  2DF6 A;  2CSI A;  1UJY A;  2AZV A;  5IHI A;  1K9A A;  2V1Q A;  2DE0 X;  1H92 A;  4JZ4 A;  2DVJ A;  2JM8 A;  1I0C A;  2ESW A;  2O31 A;  2OJ2 A;  2EYY A;  1NG2 A;  2G6F X;  4AG2 C;  1QWF A;  3UF4 A;  4IIM A;  2QDL A;  2YT6 A;  4F17 A;  2GNC A;  1M27 C;  4Y92 A;  4E6R A;  4LE9 A;  2E5K A;  5IXF A;  4J9E A;  4RTZ A;  1JXM A;  2X3W D;  1GCP A;  1X69 A;  1ARK A;  2D8H A;  2O2O A;  2FRW A;  1SSH A;  1X6B A;  3IQL A;  2C0O A;  1VA7 A;  1Z9Z A;  4HCK A;  2BTT A;  1GCQ C;  1J3T A;  1QKX A;  2A36 A;  3M0P A;  1M30 A;  1UDL A;  1AVZ C;  2LZ6 B;  1OEB A;  2JMC A;  5ECA A;  3EG3 A;  2K3B A;  2GTJ A;  2JMA A;  2KRS A;  3NHN A;  3EG1 A;  2SEM A;  3M0R A;  4DEX A;  1OOT A;  1OPL A;  3C0C A;  4AFU C;  3QWX X;  4RTV A;  1XOV A;  2MOX A;  1B07 A;  1I1J A;  2LQN A;  2VKN A;  3I35 A;  4J9I A;  1U3O A;  2XMF A;  2DM1 A;  3ULR B;  1I07 A;  2A37 A;  2LMJ A;  2AK5 A;  4EIK A;  1JU5 C;  1FYN A;  1G83 A;  1LCK A;  4J9B A;  2VVK A;  3VS4 A;  2JT4 A;  2KXC A;  3EHQ A;  2DX1 A;  2DJQ A;  4JJD A;  2FPF A;  2P4R A;  2FRY A;  4RTY A;  3PVL A;  1HD3 A;  1NYG A;  2ECZ A;  1Z9Q A;  2K2M A;  1KFZ A;  1A0N B;  3CQT A;  2LP5 A;  3I9Q A;  4JZ3 A;  1WDX A;  1OV3 A;  2YUQ A;  4JJC A;  2HCK A;  2KGT A;  2X3X D;  1K4U S;  1YWO A;  3EHR A;  2DA9 A;  2AZS A;  2CSQ A;  4LUE A;  1BBZ A;  4GLM A;  4OMQ A;  1X6G A;  1W70 A;  2I0N A;  2M51 A;  1WXU A;  5FW9 A;  3TSW A;  1ZUY A;  1UJ0 A;  2J06 A;  4IIO A;  4D8D A;  4Z89 A;  3TSZ A;  2CT3 A;  1ZLM A;  4HVU A;  1BK2 A;  1W6X A;  1ZSG A;  2KRM A;  2KR3 A;  2CRE A;  3VS0 A;  1X2Q A;  1N5Z A;  2DBM A;  1QKW A;  1M3A A;  2KBT A;  1X2K A;  2DL3 A;  4JJB A;  3VS5 A;  2DL5 A;  2LJ1 A;  2EGE A;  2EKH A;  1E6H A;  2K79 A;  5FWB A;  2J6O A;  2C0T A;  3TVT A;  2DBK A;  1X43 A;  1QWE A;  1JQQ A;  1K76 A;  3VRY A;  4LUD A;  2GGR A;  1S1N A;  1YNZ A;  1BU1 A;  2W10 A;  2KRO A;  1Y0M A;  4RUG A;  4A63 B;  1JEG A;  1KJW A;  2L3P A;  4LN2 A;  2EBP A;  4AG1 C;  3EGU A;  2EVR A;  1IO6 A;  5GJW B;  2DNU A;  4J9H A;  4OMO A;  2JS2 A;  2YSQ A;  3NMZ C;  1QCF A;  5GJV B;  2EYZ A;  3LH5 A;  4ZNX A;  1WXT A;  4CC2 A;  1AEY A;  1KIK A;  1WXB A;  1M8M A;  2ROL A;  2RQU A;  1UEC A;  4JPB W;  1ABO A;  2EGA A;  5FWC A;  1BB9 A;  2NWM A;  2KEA A;  3RNJ A;  1WA7 A;  2EW3 A;  2BZ8 A;  3I5S A;  3H0I A;  1UUE A;  4HVV A;  2K6D A;  1VYV A;  1E6G A;  4OMM A;  3H0F A;  1NLO C;  4ESR A;  4RTT A;  2RQT A;  2MCN A;  5IXB A;  1GCQ A;  1K0S A;  1H3H A;  2YUO A;  2KE9 A;  2ED0 A;  1UGV A;  2CUD A;  1AWJ A;  1HJD A;  3SHW A;  1UFF A;  2LNH B;  2EQI A;  1JXO A;  1FMK A;  5L23 A;  1ZUU A;  1AWX A;  1W1F A;  3VS6 A;  1Y57 A;  1QLY A;  4OML A;  5IHK A;  1CKA A;  1T3S A;  3GBQ A;  4CC3 A;  2F2V A;  2BZX A;  2F2X A;  2OAW A;  1RLP C;  2CH4 W;  3VS7 A;  1UHF A;  1SEM A;  1M3C A;  2FO0 A;  1RI9 A;  5EC7 A;  1TG0 A;  1V1C A;  2KNB B;  3UA7 A;  3M0Q A;  4ORZ A;  1TUC A;  4J9F A;  1H8K A;  3FJ5 A;  1WLP B;  2PZ1 A;  1ZX6 A;  2KYM A;  2O9S A;  1MUZ A;  2OI3 A;  2YUP A;  1CSK A;  2C0I A;  1YCS B;  2DL4 A;  4RTX A;  1CKB A;  2F2W A;  4X1V A;  3VS2 A;  4OMN A;  4WCI A;  1GFD A;  2SRC A;  1AWO A;  1AWW A;  1RUW A;  2HDA A;  2ROT A;  1OPK A;  4KRT A;  1WI7 A;  2EYX A;  2L3S A;  4GBQ A;  2K7A A;  2K9G A;  4RTU A;  3EG2 A;  1PNJ A;  1PWT A;  3REB B;  4LNP A;  1PKT A;  1ZUK A;  1YN8 A;  4FSS A;  4AFZ C;  5I22 A;  1T0J A;  2DRM A;  3UAT A;  2L2P A;  2ENM A;  3VRZ A;  2CH4 A;  3SEM A;  1SHG A;  1U5S A;  5IH2 A;  3A98 A;  2KXD A;  3EG0 A;  2L3Q A;  2V1R A;  1HSQ A;  1PRL C;  1X27 A;  2ED1 A;  1GBQ A;  2H8H A;  2RN8 A;  2JXB A;  2EYW A;  1U06 A;  1GL5 A;  2L0A A;  3H0H A;  2AKL A;  2AKK A;  2YDL A;  3PE0 A;  2PNI A;  1B3Q A;  4D8K A;  2JTE A;  1K1Z A;  2DL8 A;  2LJ3 A;  3R6N A;  4J9D A;  3VS3 A;  1YWP A;  2RQW A;  2KYB A;  1G2B A;  2RQR A;  1AZE A;  1EFN A;  1AZG B;  1TUD A;  4HXJ A;  1SPK A;  4M4Z A;  1UTI A;  2D0N A;  2LQW A;  1UG1 A;  1NEG A;  2JS0 A;  3QWY A;  5I11 A;  1GBR A;  2HEQ A;  2FPD A;  4J9C A;  2KT8 A;  4R0K A;  2JM9 A;  3U23 A; 
#chains in the Genus database with same CATH topology
 3A8H B;  2X35 A;  5D7U A;  1OX8 A;  1VYU A;  1MND A;  3JV3 A;  5CKB A;  3MJX A;  2DRK A;  2LCS A;  5HCK A;  1WFW A;  1QQJ A;  3WVE B;  2QA4 Q;  3H41 A;  3ZEH A;  2BZY A;  2HQX A;  2GQI A;  2Y4Y A;  2CZ7 B;  3CD6 T;  1BCO A;  2RF0 A;  1PD1 A;  3JCM h;  1NM7 A;  2M1H A;  6AT1 B;  2KK4 A;  1R8O B;  1WZO A;  5CKF A;  4J9G A;  1Q86 C;  2K5F A;  2DMO A;  3CBP A;  2HBW A;  3P8D A;  3I56 Q;  1MV0 B;  3CCQ Q;  1N6A A;  3I5R A;  3CC2 A;  2W0Z A;  1T3L A;  2RJD A;  2RQV A;  1ZQ1 A;  2LJ0 A;  2RPN A;  3A8G B;  2LQK A;  2GTO A;  3L2U A;  3EGX A;  3CMA Q;  1BIA A;  3J80 E;  3ZL7 C;  1XTD A;  4F16 A;  2VV5 A;  2XDB A;  3VV0 A;  2LT1 A;  2HSP A;  4Y91 A;  3M0S A;  2XDD A;  1UE9 A;  1SRM A;  5GAO r;  2EQJ A;  4M75 C;  1D09 B;  3HFO A;  3OA6 A;  3RBB B;  2EQK A;  1ZSZ A;  2YHT A;  5GAN 6;  4PJO G;  3CCU Q;  4N4G A;  3M0T A;  5CQY A;  2E65 A;  3EAE A;  2O4X A;  2XK0 A;  1SF9 A;  3M4Y A;  2J7I A;  5HK3 A;  1FWZ A;  3PTA A;  2QXF A;  1VQ6 T;  2EPD A;  2PTK A;  4QQG A;  4M78 D;  2KQW A;  3A8M B;  4GY5 A;  3QBY A;  1M3B A;  2QEX A;  1D0X A;  1UJY A;  5GAN 4;  5IHI A;  4LDX A;  4F7U F;  3OYI A;  1H92 A;  2O01 E;  4M7A A;  1I0C A;  1IB8 A;  2PVO B;  3Q1J A;  4M77 B;  4XTX A;  1VQK Q;  2DPP B;  4N0A A;  3GNF B;  2EYY A;  2VGM A;  1QWF A;  5GAN h;  2EJF A;  2EAY A;  4LE9 A;  2E5K A;  5IXF A;  1JXM A;  3V7R A;  2X3W D;  1GCP A;  3R6O A;  3QO3 A;  4ZGJ B;  2QGG A;  1X6B A;  3CCE Q;  3M55 A;  1Z9Z A;  4HCK A;  2BTT A;  3CCV Q;  1GCQ C;  2KI7 A;  1K9M C;  3CC7 T;  1TH7 A;  2R57 A;  1UDL A;  1VQP T;  2LZ6 B;  1WJS A;  3EG3 A;  2XIC A;  3RMQ A;  1AHJ B;  1U1T A;  4DEX A;  1VIE A;  2K57 A;  3LYI A;  5GAN 7;  1OPL A;  4RTV A;  1B07 A;  2ZPF B;  1I1J A;  1D0Y A;  1YCY A;  3M58 A;  1YIT A;  2VXF A;  4C5G A;  3OYM A;  3JCM X;  2JTM A;  3I35 A;  2A0F B;  3NTI A;  2LMJ A;  4R56 A;  2DVE A;  2AK5 A;  3J81 E;  1FYN A;  3VS4 A;  2KXC A;  2XG8 D;  4YTL A;  4PJO B;  5LJ3 j;  2X4W A;  4V2S A;  1UEB A;  1VQM T;  2FRY A;  2EFI A;  2XDP A;  3BE3 A;  1KQS S;  4RG2 A;  2PQW A;  1NYG A;  1KFZ A;  1A0N B;  2L89 A;  3PT9 A;  2X3X D;  1K4U S;  4L59 A;  4EPC A;  2DA9 A;  2DK3 A;  4J6Y A;  3V7S A;  3AHU A;  1QVP A;  2LCC A;  3G6E A;  1M2V B;  3CCS T;  1W70 A;  1WXU A;  2IG0 A;  4KH0 B;  1ZUY A;  2J06 A;  5CR2 A;  3TSZ A;  2CT3 A;  4KGZ B;  3HKS A;  1ZLM A;  3MEV A;  1BK2 A;  1M5Q 1;  3X24 B;  1ZSG A;  2E6Z A;  2KRM A;  5KCH A;  2KR3 A;  4HCZ A;  4ME7 A;  2DBM A;  4QVC A;  1QKW A;  1YJW T;  4LD6 A;  2CP7 A;  5GMK i;  1S72 A;  4B6M A;  3PMT A;  2DL3 A;  3M4G A;  4C8Q A;  5KCO A;  4PFZ A;  3SDZ A;  4OMF B;  1D3B B;  1FX7 A;  2EQU A;  2LTO A;  4M7A D;  5FWB A;  3EFO B;  2P4T A;  4M77 F;  1QWE A;  1JQQ A;  3VRY A;  1YNZ A;  5GAN 3;  1VQN A;  2DFU A;  1Y0M A;  4RUG A;  4BDY A;  4B9W A;  1KJW A;  5GAM h;  4OGE A;  1BKB A;  1TU0 B;  3QPH A;  3RKY A;  1WJR A;  5GJW B;  2DNU A;  4J5Y A;  4C5E A;  2I2L A;  2EYQ A;  3CC2 T;  3E9G A;  1VQ9 Q;  1LOJ A;  2YSQ A;  2PUO B;  3QZ9 B;  4EDU A;  2EYZ A;  3LH5 A;  4JS4 A;  1VQ5 Q;  1HYO A;  2D6F A;  1KC8 U;  2CS7 A;  3MP1 A;  4KUL A;  1M8M A;  5GAO q;  4JUV A;  4BE2 A;  5FWC A;  2X4J A;  1QVG P;  3A5Z B;  3I5S A;  2VB6 A;  4D6W A;  4HVV A;  4C0F A;  4IKF A;  4LD9 K;  1E6G A;  3H0F A;  1NLO C;  4MML A;  4ESR A;  3JAM E;  4RTT A;  5J3B A;  2KDS A;  5IXB A;  2RHY A;  4OB2 B;  1ZA2 B;  3V8L A;  5CVI A;  2LDM A;  3I56 A;  3OYF A;  3ZFJ A;  1UFF A;  2LNH B;  5LJ3 f;  4M78 B;  4DBH A;  2V8I A;  1K73 U;  3VS6 A;  2DTO A;  4BE1 A;  3EFS A;  4EMH A;  1M90 R;  1WHH A;  4LDY A;  2QEX T;  4PJO F;  2R58 A;  5AT1 B;  1RAH B;  3VS7 A;  3CMA A;  4QW2 A;  1V1C A;  3BDL A;  1OU9 A;  3HTR A;  1MNE A;  3JB9 D;  3NTK A;  1YHQ A;  2Y90 A;  2ZCF B;  1VIF A;  3DB4 A;  1VQ8 Q;  2OI3 A;  2C0I A;  4PK4 A;  4RTX A;  1D1A A;  3KUF A;  4X1V A;  3H6Z A;  4WCI A;  3INZ A;  4M7D A;  1AWW A;  1BYM A;  1B34 B;  3CCU A;  2XID A;  1IHV A;  3HRU A;  3JCM P;  2H3E B;  4FSX A;  5I2S A;  4EMK A;  2EYX A;  3V7C A;  3EG2 A;  1LVK A;  2QQA A;  3RKW A;  4Q5W A;  4WF2 A;  3JCM g;  4M7A G;  2L2P A;  3JRZ A;  2CH4 A;  5D6X A;  5IH2 A;  1FMW A;  2LNV A;  1KQS P;  1M9S A;  2FB7 A;  2NLU A;  4J83 A;  4C8Q D;  2PVD B;  2RHZ A;  1VQK A;  1HSQ A;  4BY6 B;  1OYX A;  1X27 A;  2RN8 A;  2JXB A;  2EYW A;  4Z02 A;  1YIT T;  1U06 A;  1N9R A;  4C92 D;  4DBR A;  4M77 C;  4DOW A;  3ME9 A;  3PE0 A;  2L3R A;  1RI0 A;  2JTE A;  3CXC A;  1K1Z A;  2DL8 A;  3RER A;  3EG9 A;  2CP5 A;  3QJ6 A;  1YWP A;  4KH1 B;  2KYB A;  3CCV A;  1RAE B;  5C6S A;  1EFN A;  3UWN A;  1SPK A;  3M59 A;  1UTI A;  1UG1 A;  2FPD A;  1TS9 A;  3OS2 A;  2HL3 A;  4R0K A;  2LC4 A;  4HVW A;  3EGX B;  2B86 A;  1OU8 A;  3I55 Q;  4XAX B;  3PMI A;  4ATO A;  2LVM A;  1KC8 C;  2D1X A;  2QQB A;  1GXI E;  4GLK A;  4ZGD B;  1Q86 U;  2A08 A;  3KFV A;  5GAO m;  3MEU A;  2DLP A;  3MPU B;  4A4K A;  4ZN3 A;  1UGQ B;  2GBQ A;  3NPF A;  1OZ3 A;  4FW2 A;  3G6E T;  3SWN B;  1YI2 Q;  2JOY A;  4HCC A;  2RMO A;  4FYY B;  4AT1 B;  5GAO p;  1X6O A;  5GAN g;  4XU0 A;  2VWF A;  4AFS C;  1AD5 A;  1Q82 U;  2O4X B;  1MV3 A;  1NEB A;  3WXM B;  4M78 F;  3JB9 G;  5KYY A;  1IGQ A;  3VS1 A;  1S72 T;  1K73 C;  9ATC B;  4PJO C;  4QT7 A;  1MMN A;  2AT1 B;  1SHF A;  4M7A B;  3F70 A;  1KSW A;  2FPE A;  3VUB A;  3CME Q;  1KG1 A;  3FIF A;  1UHC A;  2JW4 A;  2HKN A;  1GRI A;  3FLG A;  1G5V A;  1PHT A;  4M7D E;  1NYF A;  3FDR A;  1KK7 A;  2DJZ A;  1K8A U;  1IGU A;  2EQM A;  1VQN T;  5LJ5 j;  3L2V A;  2YLB A;  2DL7 A;  2LQ8 A;  3DLL A;  1G8X A;  3OYJ A;  2RNA A;  3JCM W;  3NGP A;  1AOJ A;  4C8Q G;  1H3Z A;  2LX7 A;  4PNO A;  2GF7 A;  2IIM A;  2RK1 A;  2CSI A;  1VQ4 A;  2BIV A;  5GAO n;  2RA2 A;  2GFU A;  4C92 G;  2O31 A;  3OS0 A;  4UC4 A;  4M75 A;  4A53 A;  3RMS A;  3URG A;  4FYX B;  2F1L A;  2E4H A;  4BAC A;  1W2B A;  3CC4 Q;  4E6R A;  2E6N A;  4LXC A;  1M4Z A;  1AT1 B;  1KD1 R;  4J6W A;  1K9M U;  3RKX A;  3OBW A;  2H3J A;  2NUP A;  5FU7 B;  3I56 T;  1YJW A;  1SSH A;  4FL6 A;  1NJI R;  5KYW A;  1FXX A;  3EGD B;  1VQ9 A;  1J3T A;  3L2R A;  3C94 A;  1JJ2 P;  3CCM A;  2CZ1 B;  3M0P A;  1M30 A;  3JCM Q;  3J7A F;  3RIR A;  2QK0 A;  1VQ5 A;  1OEB A;  2JMC A;  2K3B A;  3NHN A;  4C5H A;  3EG1 A;  2ZPI B;  3CMA T;  5GAN 5;  3QG1 A;  3TRE A;  2F5K A;  2YRC A;  4B9X A;  1YHQ T;  5CQX A;  1VQO Q;  4J9I A;  2DD5 A;  3G4S A;  4BB7 A;  4BI4 A;  4J6X A;  2XMF A;  2DM1 A;  3LW5 E;  1Q81 R;  1VQL Q;  1N8R R;  3EH2 A;  1Y96 B;  3CCU T;  1ACM B;  3A8O B;  2RK2 A;  4CI0 C;  3QZ5 B;  4EIK A;  2C06 A;  2ZPH B;  1TSF A;  2JT4 A;  2CP6 A;  2CP3 A;  2DD4 A;  1IZ6 A;  3M57 A;  1Q82 C;  2HD0 A;  3TEE A;  1VOM A;  5GAM g;  1B7T A;  4M78 C;  1HD3 A;  3LX7 A;  4BE0 A;  4C8Q B;  5LJ3 h;  2ECZ A;  2OTL Q;  2K2M A;  3GPL A;  5IN1 A;  1I81 A;  1WQW A;  4JZ3 A;  1VQK T;  2QDY B;  1OV3 A;  4JJC A;  4M7A F;  4C92 B;  1YWO A;  2CSQ A;  1TOV A;  4GLM A;  5LJ5 f;  1BI1 A;  1X6G A;  3LGL A;  4D8D A;  4Z89 A;  1UGR B;  1K8A C;  1JB0 E;  2CGH A;  5IAY A;  3FC3 A;  3CCV T;  4MDW A;  4A4F A;  3VS0 A;  1N5Z A;  1X2K A;  4WTO B;  2AIR B;  3JCM J;  4JJB A;  2F5T X;  1O75 A;  1QVG S;  2DL5 A;  4L5G A;  2LJ1 A;  4M75 E;  2K5L A;  2DZC A;  4HCB A;  1P92 A;  2EKH A;  4J7I A;  1RAB B;  4FYV B;  3E2U A;  1DJ7 B;  4ELZ C;  3TVT A;  2W10 A;  4BY6 C;  4A63 B;  5CKH A;  1JEG A;  3QJY A;  4MZT A;  1OUL A;  4LN2 A;  2EBP A;  3CCJ A;  3P8B B;  3JCM d;  4RCB A;  3OW2 A;  4J9H A;  1HXD A;  2FHD A;  2JS2 A;  3QYG B;  4IUP A;  1C0M A;  2MYS A;  3G71 Q;  1BI2 A;  5GJV B;  5CKD A;  4ZNX A;  4BUG A;  3OBY A;  4CC2 A;  3HHT B;  1AEY A;  1KIK A;  1WXB A;  1X01 A;  2FZK B;  2RQU A;  1UEC A;  3M5A A;  4JPB W;  4JLG A;  5KYN A;  1R0B G;  3JB9 F;  3H0I A;  3OYD A;  2K6D A;  4DA4 A;  1VYV A;  2VGN A;  4O5V A;  4OMM A;  4E47 A;  4A4E A;  5LL6 S;  5CAI A;  1PSF A;  1K0S A;  2YUO A;  4ZTF A;  1MGQ A;  3UPU A;  2PVG B;  1JXO A;  3SWN C;  5L23 A;  4QQ6 A;  3GP8 A;  2RI2 A;  3MP8 A;  5CCA A;  2ZZD A;  1QLY A;  4OML A;  1CKA A;  1T3S A;  3GBQ A;  3OSV A;  2Z0W A;  4CC3 A;  2F2V A;  2LRQ A;  4Y28 E;  1VQ4 T;  1UHF A;  1SEM A;  3GLX A;  2NUT B;  1RI9 A;  5EC7 A;  2GCX A;  2KNB B;  3HL8 A;  5HY6 A;  1VQP Q;  1YJ9 A;  5DY9 A;  4PFO A;  1WHL A;  3CME A;  4C8Q F;  3RR6 A;  3FJ5 A;  3NFC A;  3L2Q A;  2PZ1 A;  2O9S A;  1QP3 A;  1MUZ A;  1M1K R;  2YUP A;  4M78 G;  2F2W A;  4M7A C;  1KHI A;  2E3H A;  3L2W A;  4C92 F;  4OMN A;  2ATC B;  4N0A C;  1GFD A;  5GAN d;  1AWO A;  2P0Q A;  1YJN Q;  4A4H A;  3QUI A;  4KRT A;  7AT1 B;  3HSB A;  2L3S A;  2DEQ A;  2E70 A;  2OTJ A;  1PWT A;  3REB B;  4LNP A;  4BD3 A;  1KHC A;  4FSS A;  5J39 A;  1VQ9 T;  3VRZ A;  3VKI A;  3A8L B;  5CIU A;  3CCM T;  3KBG A;  1U5S A;  2CP0 A;  3DLM A;  4J8O A;  1VQ5 T;  3A98 A;  4FM4 B;  1VQM Q;  4XU2 A;  2KXD A;  4XTZ A;  2XI9 A;  3VJP A;  3GIB A;  1LPL A;  1PRL C;  3OYH A;  1GBQ A;  2HQH A;  5CK9 A;  1Q86 R;  3OYE A;  2E41 A;  3CPW A;  3H0H A;  2COW A;  3OYC A;  2X4X A;  2AKL A;  5GMK j;  4HA8 A;  3G4S T;  3HRS A;  1YIJ Q;  4MZP A;  2LJ3 A;  2JTF A;  4E7L A;  3GNG A;  1AZE A;  1M2O A;  4P5N A;  4HXJ A;  5D6W A;  2DZ9 A;  1QVF A;  3FB9 A;  2MI6 A;  4FT2 A;  1OZ2 A;  5FU7 C;  1RAF B;  2HEQ A;  4F7U E;  2KT8 A;  4DBQ A;  3G7Z A;  2JM9 A;  3U23 A;  3V8J A;  3QYH B;  1W4S A;  2QA4 A;  4BDZ A;  4Z88 A;  2RO0 A;  2DER A;  2D8J A;  2ABL A;  4JDS A;  4AMC A;  1VYT A;  3RUX A;  1PRM C;  4X9C A;  1VQ8 T;  3JCM f;  1VQO A;  4O6J A;  2DYB A;  1RAI B;  2FG0 A;  1WYX A;  5LJ3 e;  1JO8 A;  2HQE A;  3UA6 A;  3UT1 A;  3CCQ A;  2RI5 A;  4ZN1 A;  1M1G A;  4E7S A;  1TXQ A;  4OMP A;  2KY9 A;  2KRN A;  2MIO A;  3PNW C;  3THK A;  2A28 A;  2DXT A;  2PU9 B;  3ER0 A;  3LWH A;  1E7O A;  5FRO A;  4R55 A;  2OTL A;  2FEI A;  4RMO A;  3OS1 A;  3LGF A;  1QMC A;  1NLP C;  2RI3 A;  4DEY A;  1UGS B;  4JRI A;  2FVU A;  2NUZ A;  1Y71 A;  4C8Q C;  2IPO B;  4Z8A A;  1SG5 A;  3CPW P;  2CT4 A;  2QQR A;  2MAM A;  2KT1 A;  2M0Y A;  4C92 C;  1K9M R;  3QDF A;  2RHX A;  5IHN A;  1JJ2 S;  1TUG B;  2NUP B;  3QXE B;  5GMK l;  2FZG B;  3CCJ T;  1YP5 A;  1T0H A;  5LJ5 h;  4HT9 A;  3LH0 A;  3OB9 A;  5GAM d;  1QVF P;  3HRT A;  3BY7 A;  1PKS A;  4HKE A;  2V8K A;  2DF6 A;  4LDW A;  4PJO A;  3EFR A;  2AZV A;  2DKG A;  1K9A A;  3MEA A;  4JZ4 A;  5GAN f;  2JM8 A;  1MMG A;  2ESW A;  1IRX A;  2OJ2 A;  2L8D A;  2VC8 A;  1QW1 A;  2G6F X;  5GMK e;  1I5L A;  4IIM A;  3CCL Q;  4OVA A;  2QDL A;  5A0D A;  1LJO A;  2RH2 A;  4JRK A;  4L6V 5;  3OYK A;  4A4G A;  3JCM c;  4RTZ A;  3CCE A;  4XQ3 A;  1X69 A;  1YI2 T;  1ARK A;  1M8V A;  1M2V A;  2D8H A;  2O2O A;  1ZHI A;  1WHJ A;  3IQL A;  5M9O A;  2P0K A;  1PM3 A;  2HMA A;  5KYX A;  2QAS A;  3HP9 A;  3KXT A;  3QDR B;  2V26 A;  1JBM A;  1NZ9 A;  1R77 A;  2KRS A;  2WAC A;  4MZM A;  2SEM A;  3M0R A;  4IUR A;  1WHM A;  4M77 E;  4XTU A;  3C0C A;  4AFU C;  1YJ9 T;  1XOV A;  2MOX A;  2OX7 A;  3M53 A;  2PUK B;  4IUU A;  3CME T;  3TQ7 P;  1XQH A;  1ZSZ B;  2JJ9 A;  2YRD A;  3RDV A;  2DXC A;  4PLI A;  3EFO A;  5A2Q E;  4JRP A;  1U3O A;  1YIT Q;  3ULR B;  3M9Q A;  3X20 B;  2A37 A;  4XTV A;  2M02 A;  3TU4 K;  2QQS A;  5I21 A;  3V8K A;  4OP0 A;  5GMK m;  1JU5 C;  2OTJ T;  4J9B A;  2VVK A;  3P8H A;  2KVQ G;  4M7D C;  3X26 B;  4OGC A;  4EMK C;  3OMC A;  2DJQ A;  3S3M A;  3PGG A;  4N4H A;  2FPF A;  2P4R A;  4RTY A;  4FU6 A;  2DEU A;  1Z9Q A;  2A7Y A;  3A1P A;  2LP5 A;  3I9Q A;  4C0D B;  2HKQ B;  2HCK A;  1MMA A;  2KGT A;  3L1A A;  2JVV A;  3EHR A;  3CXC P;  2M9U A;  2XHC A;  4M7D D;  1YJN A;  2I0N A;  3PIP A;  1I4K 1;  1UJ0 A;  4OF1 A;  3CCR Q;  4RCC A;  3H9N A;  4BI3 A;  4HVU A;  1W6X A;  4PJO E;  2CRE A;  2KAF A;  1X2Q A;  1QCN A;  2QAZ A;  2BE7 D;  4C0G A;  1M90 U;  3VS5 A;  1OI1 A;  2EGE A;  4OB1 B;  2HBP A;  1S72 Q;  2QA4 T;  2K79 A;  2J6O A;  3TCJ A;  1NPP A;  1D1B A;  2K5I A;  1X43 A;  4LUD A;  5AYF A;  2GGR A;  1S1N A;  5GAM f;  1VQO T;  4MMK A;  2MF2 A;  1LNX A;  3OYB A;  4F04 B;  1YIJ A;  3CPF A;  4FIB A;  2AHJ B;  2L3P A;  3N5B B;  3CCQ T;  1B34 A;  1VQN Q;  2YLC A;  3EGU A;  4J7F A;  4E2F B;  1IHW A;  2EVR A;  1JRI A;  1TTH B;  4OMO A;  3NMZ C;  2QI2 A;  1PD0 A;  4RKU E;  5A0G A;  1NE8 A;  3L42 A;  2ROL A;  2OTL T;  4ZGE B;  2EGA A;  1BB9 A;  2QGF B;  2FL7 A;  1WA7 A;  2BKD N;  2EW3 A;  1UUE A;  1WNL A;  2QTV A;  3JB9 J;  4FYW B;  4TVR A;  5L8R E;  2MCN A;  5FU6 B;  3OW2 S;  1GCQ A;  1VQ7 Q;  1G3T A;  1H3H A;  5GAN 2;  2ED0 A;  2KE9 A;  1UGV A;  1NBE B;  3LWI A;  3SHW A;  1KQ2 A;  1QP2 A;  2EQI A;  1FMK A;  2K2V A;  1W1F A;  5IHK A;  1MMD A;  5KE2 A;  1WHG A;  1RLP C;  3PFS A;  2CH4 W;  4KGV B;  2HSE B;  1M3C A;  3CEY A;  1TG0 A;  1XJW B;  3M0Q A;  1VQ8 A;  4ORZ A;  1TUC A;  4M7D G;  1O9S A;  4J9F A;  4DBF A;  1RAD B;  5LJ5 e;  1W2B P;  4EMG A;  2KYM A;  3BFM A;  2XD0 A;  4PL6 A;  1QCO A;  1CSK A;  3O8V A;  3X25 B;  3G1J A;  1CKB A;  3OSS C;  3VYH B;  2K3X A;  1BI3 A;  3VS2 A;  3CD6 Q;  1YHQ Q;  4XU1 A;  2SRC A;  5KYU A;  2HDA A;  3CCE T;  2E5Q A;  4RTU A;  3SWN A;  5C0M A;  2DTI A;  4M78 E;  1ZUK A;  3OQ5 A;  1YN8 A;  1T0J A;  3EH1 A;  4NS5 A;  3S3N A;  4IUV A;  2DRM A;  1Q95 G;  2RB6 A;  2ENM A;  2VAS A;  3G71 T;  1KC8 R;  1Q7Y U;  3OS5 A;  1VUB A;  5FRM A;  5DLO A;  4IUQ A;  4XK8 E;  4FW1 A;  3EG0 A;  2L3Q A;  2V1R A;  2OAU A;  4M75 D;  1M90 C;  3JSC A;  4PLL A;  2ED1 A;  1BI0 A;  3CCL A;  4JLI A;  2H8H A;  1YFN A;  1GL5 A;  4E7J A;  2JN0 A;  2ZPG B;  2AKK A;  2L5Q A;  5EG2 A;  4D8K A;  3VS3 A;  1U1S A;  3HFN A;  2G3R A;  5GMK h;  3SD4 A;  4LDU A;  2RQW A;  1G2B A;  1K73 R;  1AZG B;  1C1A A;  1VQ6 Q;  4M4Z A;  2D0N A;  2COY A;  2DO3 A;  1V76 A;  2JS0 A;  1NEG A;  5I11 A;  3I55 A;  4F7U A;  5D6Y A;  1N27 A;  3M0U A;  4K11 A;  1WX6 A;  3JB9 I;  4II1 A;  5LJ5 g;  3BW1 A;  3CPW S;  1I5O B;  2D9T A;  2J6F A;  5LJ3 d;  1GFC A;  2J6K A;  1SRL A;  1YI2 A;  4CRI A;  4M7D B;  2CZ6 B;  1X75 C;  2CUB A;  4EMK B;  3OY9 A;  1RLQ C;  4XTW A;  2EGC A;  2GFA A;  1ZSZ C;  1YJN T;  1QVF S;  2ZGW A;  2YXY A;  5IT9 E;  1KD1 U;  2J05 A;  3GOX A;  4IUT A;  2CDT A;  5HKC A;  1NJI U;  3CC7 Q;  4F14 A;  1FMV A;  1ABQ A;  3EGD A;  1UB4 A;  3REA B;  3JCM b;  4CC4 B;  2DIL A;  3T9N A;  3PVQ A;  2MK5 A;  2MWO A;  3MKD A;  1ZBJ A;  2XKO C;  4QQD A;  4JRQ A;  1K0X A;  2O88 A;  2CKK A;  4CC7 A;  1QVG A;  2ZPE B;  4C0D C;  3EG9 B;  2CZ0 B;  5KE3 A;  1WIE A;  1MHN A;  2RHU A;  4RG8 A;  4XTY A;  1YIJ T;  3OW2 P;  3CCR A;  2X9H A;  1Q81 U;  4RTW A;  1N8R U;  1IRE B;  2EJG A;  1Y96 A;  2WSE E;  4PJN A;  5DLQ E;  4AFQ C;  2M0O A;  3O5Z A;  4M75 G;  2O9V A;  2YUN A;  2RD1 A;  1BCM A;  8AT1 B;  5KYX B;  1D0Z A;  2DIQ A;  3E19 A;  2V1Q A;  4E7K A;  1EX4 A;  2DE0 X;  5GAN j;  2E64 A;  2DVJ A;  4M7A E;  2XU8 A;  1Q7Y C;  2YRV A;  1VQ4 Q;  2E1H A;  3CC4 A;  2GQV A;  2DTH A;  1NG2 A;  2P0P A;  4AG2 C;  3UF4 A;  3ASK A;  4OB0 B;  3OYA A;  2MWP A;  2YT6 A;  4F17 A;  1RAC B;  1M27 C;  2GNC A;  4Y92 A;  4C92 A;  2KSS A;  2BUD A;  3H8Z A;  3CCS Q;  4J9E A;  3DB3 A;  4MDX A;  2VUB A;  1EIF A;  1PG5 B;  2HNI A;  3E1S A;  1I8F A;  1Q82 R;  3C4S A;  5CO7 A;  3MCA B;  2DXU A;  2FRW A;  2C0O A;  1VA7 A;  4QVD A;  5KYY B;  2X4Y A;  1QKX A;  2A36 A;  5GAN 8;  1YJW Q;  2F69 A;  2MPX C;  1AVZ C;  1WJQ A;  5ECA A;  2GTJ A;  2JMA A;  2WSC E;  4KT0 E;  3JCM e;  3CCM Q;  1D1C A;  2LX9 A;  1OOT A;  4M77 A;  2E3I A;  2DAQ A;  3CXC S;  3QWX X;  2BE9 B;  4PJL A;  2E12 A;  1KQS A;  2YWW A;  2LQN A;  2VKN A;  4PJM A;  1KQ1 A;  1VQL A;  1K8A R;  2RJE A;  4X34 A;  1VQ7 A;  4M7D F;  1I07 A;  2ZAE A;  5KH6 A;  3G4S Q;  4NL2 A;  1OX9 A;  3ZBD A;  2E10 A;  1G83 A;  1LCK A;  5FU6 C;  1U8R A;  4NL3 A;  1KD1 C;  3CC2 Q;  3GF5 A;  3EHQ A;  2B8A A;  2DX1 A;  4JJD A;  3RES A;  3PVL A;  1WPY A;  1NJI C;  5FLX E;  4M75 B;  1YBY A;  4BI8 B;  2DIG A;  3CQT A;  3OYL A;  1WDX A;  4HT8 A;  2YUQ A;  2QTX A;  2R5M A;  4KUI A;  3CCL T;  3AT1 B;  3X28 B;  2AZS A;  3QSU A;  3OYG A;  4LUE A;  3CD6 A;  1BBZ A;  2FYK A;  1PSE A;  2DYI A;  5GAO l;  8ATC B;  2A3L A;  4OMQ A;  2M51 A;  5FW9 A;  3TSW A;  1F1B B;  4IIO A;  3L2Z A;  1PCX A;  1M1F A;  5KYW B;  2JUF A;  3WVD B;  3UDC A;  4OB3 B;  3S6W A;  5I2M A;  3VUZ A;  1G3W A;  4E7Z A;  1Q81 C;  5GAN e;  1N8R C;  2EKO A;  1M3A A;  2KBT A;  1SSF A;  4X9D A;  2QEX Q;  3I55 T;  1TWB A;  4QVZ A;  3LLR A;  2K4Y A;  4C0Z A;  4C8Q E;  3OYN A;  4VUB A;  2EJ9 A;  4JS5 A;  2HZY A;  2NUT A;  1RL2 A;  1E6H A;  4XU3 A;  2C0T A;  4KGX B;  4C92 E;  4QKU A;  5LJ3 g;  2RJF A;  3MHX A;  4PKC C;  2DBK A;  5GAM j;  1K76 A;  2X51 A;  3FJP A;  1BU1 A;  1WQ7 A;  2KRO A;  1M1K U;  4PJJ A;  3VYG A;  1RAA B;  2RM4 A;  1EZZ B;  2LT4 A;  1WGS A;  2EIF A;  3C95 A;  1Y7X A;  4AG1 C;  4F7U G;  2QYZ A;  3BDU A;  1IO6 A;  3G71 A;  1VQ6 A;  2HAX A;  3C12 A;  2CYZ B;  3CCJ Q;  2JZ2 A;  1QCF A;  2IVW A;  4FT4 A;  1V29 B;  1W2B S;  1WXT A;  1PC0 A;  3E9F A;  1D3B A;  2RJC A;  2ZPB B;  2VYT A;  4ZTJ A;  2QG9 B;  1ABO A;  2R5A A;  2NWM A;  2M16 A;  2KEA A;  3OMG A;  3RNJ A;  4M77 D;  3NTH A;  4N4I A;  3QHS A;  2BZ8 A;  2RHI A;  2EWN A;  3HPW A;  3CBM A;  3QKJ A;  5FRN A;  5A0L A;  3PIO A;  3JB9 H;  2RQT A;  5KYU B;  3FEO A;  2CUD A;  1AWJ A;  1IXD A;  1HJD A;  2WSF E;  4DOV A;  3CCR T;  3MEW A;  1OQK A;  5J26 A;  2D0Q B;  2V8J A;  1ZUU A;  3CC7 A;  1AWX A;  2Y4X A;  1Y57 A;  3VU3 C;  1VQP A;  1NPR A;  2BZX A;  2F2X A;  2OAW A;  1H64 1;  5LJ5 d;  5CKE A;  1Q7Y R;  2COZ A;  1JJ2 A;  2FO0 A;  3D7S B;  3UA7 A;  4FCY A;  1H8K A;  3FRN A;  3MP6 A;  1WLP B;  4M75 F;  1ZX6 A;  1Y07 A;  3CC4 T;  3M54 A;  1YJ9 Q;  2DXB A;  1YCS B;  2DL4 A;  2MMP A;  4A54 A;  2KMT A;  3SFM A;  5DM7 R;  4DQ2 A;  2CP2 A;  1UGP B;  3G6E Q;  1R0C B;  1RUW A;  1ZA1 B;  5HK0 A;  2ROT A;  2JNG A;  2DET A;  1XNI A;  1OPK A;  2K3Y A;  1WI7 A;  3QII A;  4GBQ A;  2K7A A;  2K9G A;  2VXE A;  1G3Y A;  1PNJ A;  4ANJ A;  3CBO A;  4C5I A;  4M78 A;  1PKT A;  4AFZ C;  5I22 A;  4JJN K;  3UAT A;  1VQM A;  2OTJ Q;  3MET A;  4PJO D;  4F7U B;  4KUD K;  3JCM V;  3SEM A;  1WHK A;  2HL5 C;  1SHG A;  3MO8 A;  1RAG B;  2QQ9 A;  4NOY A;  5GAM e;  4E7I A;  4LDV A;  4ELY C;  2P84 A;  4PFP A;  2L0A A;  1VQL T;  3CCS A;  3SB2 A;  3M56 A;  2YDL A;  2PNI A;  2LCL A;  1B3Q A;  1VQ7 T;  3R6N A;  1M1K C;  4J9D A;  4E7H A;  1C6V X;  1ZBX A;  2FZC B;  1N9S A;  2RQR A;  3DKM A;  1TUD A;  4KBM B;  2LQW A;  3OYY A;  1SKU B;  3QWY A;  1GBR A;  1G3S A;  1BIB A;  4M77 G;  4J9C A;  3S3O A;  1HK9 A;  2NYS A; 
#chains in the Genus database with same CATH homology
 4HVW A;  3M0U A;  2B86 A;  4K11 A;  1WX6 A;  1VYU A;  3JV3 A;  4Z88 A;  2DRK A;  2LCS A;  2D8J A;  5HCK A;  1WFW A;  2ABL A;  1VYT A;  1PRM C;  2D1X A;  2J6F A;  2A08 A;  3KFV A;  1GFC A;  3H41 A;  2DLP A;  1SRL A;  2J6K A;  2BZY A;  2DYB A;  2GBQ A;  2CUB A;  2GQI A;  3NPF A;  2FG0 A;  1RLQ C;  2RF0 A;  2EGC A;  1WYX A;  1JO8 A;  1NM7 A;  3UA6 A;  2RMO A;  4J9G A;  2DMO A;  4OMP A;  2HBW A;  2VWF A;  2J05 A;  1MV0 B;  4AFS C;  1AD5 A;  2KRN A;  2MIO A;  2CDT A;  3I5R A;  2W0Z A;  1MV3 A;  1T3L A;  1NEB A;  2RQV A;  3THK A;  4F14 A;  2LJ0 A;  2RPN A;  2A28 A;  1ABQ A;  3REA B;  4CC4 B;  2GTO A;  3VS1 A;  1E7O A;  2DIL A;  2FEI A;  4QT7 A;  3ZL7 C;  4F16 A;  3PVQ A;  1SHF A;  1NLP C;  4DEY A;  1KSW A;  2FPE A;  2HSP A;  1ZBJ A;  3M0S A;  1UHC A;  1UE9 A;  2NUZ A;  1K0X A;  1SRM A;  2JW4 A;  4Z8A A;  1GRI A;  2O88 A;  1PHT A;  3RBB B;  4CC7 A;  2CT4 A;  1NYF A;  2KT1 A;  2M0Y A;  1WIE A;  5IHN A;  2DL7 A;  3M0T A;  4RTW A;  1YP5 A;  1T0H A;  2RNA A;  4AFQ C;  2J7I A;  3NGP A;  1AOJ A;  2LX7 A;  3O5Z A;  2EPD A;  2PTK A;  2IIM A;  2O9V A;  1PKS A;  1M3B A;  2YUN A;  2DF6 A;  2CSI A;  1UJY A;  2AZV A;  5IHI A;  1K9A A;  2V1Q A;  2DE0 X;  1H92 A;  4JZ4 A;  2DVJ A;  2JM8 A;  1I0C A;  2ESW A;  2O31 A;  2OJ2 A;  2EYY A;  1NG2 A;  2G6F X;  4AG2 C;  1QWF A;  3UF4 A;  4IIM A;  2QDL A;  2YT6 A;  4F17 A;  2GNC A;  1M27 C;  4Y92 A;  4E6R A;  4LE9 A;  2E5K A;  5IXF A;  4J9E A;  4RTZ A;  1JXM A;  2X3W D;  1GCP A;  1X69 A;  1ARK A;  2D8H A;  2O2O A;  2FRW A;  1SSH A;  1X6B A;  3IQL A;  2C0O A;  1VA7 A;  1Z9Z A;  4HCK A;  2BTT A;  1GCQ C;  1J3T A;  1QKX A;  2A36 A;  3M0P A;  1M30 A;  1UDL A;  1AVZ C;  2LZ6 B;  1OEB A;  2JMC A;  5ECA A;  3EG3 A;  2K3B A;  2GTJ A;  2JMA A;  2KRS A;  3NHN A;  3EG1 A;  2SEM A;  3M0R A;  4DEX A;  1OOT A;  1OPL A;  3C0C A;  4AFU C;  3QWX X;  4RTV A;  1XOV A;  2MOX A;  1B07 A;  1I1J A;  2LQN A;  2VKN A;  3I35 A;  4J9I A;  1U3O A;  2XMF A;  2DM1 A;  3ULR B;  1I07 A;  2A37 A;  2LMJ A;  2AK5 A;  4EIK A;  1JU5 C;  1FYN A;  1G83 A;  1LCK A;  4J9B A;  2VVK A;  3VS4 A;  2JT4 A;  2KXC A;  3EHQ A;  2DX1 A;  2DJQ A;  4JJD A;  2FPF A;  2P4R A;  2FRY A;  4RTY A;  3PVL A;  1HD3 A;  1NYG A;  2ECZ A;  1Z9Q A;  2K2M A;  1KFZ A;  1A0N B;  3CQT A;  2LP5 A;  3I9Q A;  4JZ3 A;  1WDX A;  1OV3 A;  2YUQ A;  4JJC A;  2HCK A;  2KGT A;  2X3X D;  1K4U S;  1YWO A;  3EHR A;  2DA9 A;  2AZS A;  2CSQ A;  4LUE A;  1BBZ A;  4GLM A;  4OMQ A;  1X6G A;  1W70 A;  2I0N A;  2M51 A;  1WXU A;  5FW9 A;  3TSW A;  1ZUY A;  1UJ0 A;  2J06 A;  4IIO A;  4D8D A;  4Z89 A;  3TSZ A;  2CT3 A;  1ZLM A;  4HVU A;  1BK2 A;  1W6X A;  1ZSG A;  2KRM A;  2KR3 A;  2CRE A;  3VS0 A;  1X2Q A;  1N5Z A;  2DBM A;  1QKW A;  1M3A A;  2KBT A;  1X2K A;  2DL3 A;  4JJB A;  3VS5 A;  2DL5 A;  2LJ1 A;  2EGE A;  2EKH A;  1E6H A;  2K79 A;  5FWB A;  2J6O A;  2C0T A;  3TVT A;  2DBK A;  1X43 A;  1QWE A;  1JQQ A;  1K76 A;  3VRY A;  4LUD A;  2GGR A;  1S1N A;  1YNZ A;  1BU1 A;  2W10 A;  2KRO A;  1Y0M A;  4RUG A;  4A63 B;  1JEG A;  1KJW A;  2L3P A;  4LN2 A;  2EBP A;  4AG1 C;  3EGU A;  2EVR A;  1IO6 A;  5GJW B;  2DNU A;  4J9H A;  4OMO A;  2JS2 A;  2YSQ A;  3NMZ C;  1QCF A;  5GJV B;  2EYZ A;  3LH5 A;  4ZNX A;  1WXT A;  4CC2 A;  1AEY A;  1KIK A;  1WXB A;  1M8M A;  2ROL A;  2RQU A;  1UEC A;  4JPB W;  1ABO A;  2EGA A;  5FWC A;  1BB9 A;  2NWM A;  2KEA A;  3RNJ A;  1WA7 A;  2EW3 A;  2BZ8 A;  3I5S A;  3H0I A;  1UUE A;  4HVV A;  2K6D A;  1VYV A;  1E6G A;  4OMM A;  3H0F A;  1NLO C;  4ESR A;  4RTT A;  2RQT A;  2MCN A;  5IXB A;  1GCQ A;  1K0S A;  1H3H A;  2YUO A;  2KE9 A;  2ED0 A;  1UGV A;  2CUD A;  1AWJ A;  1HJD A;  3SHW A;  1UFF A;  2LNH B;  2EQI A;  1JXO A;  1FMK A;  5L23 A;  1ZUU A;  1AWX A;  1W1F A;  3VS6 A;  1Y57 A;  1QLY A;  4OML A;  5IHK A;  1CKA A;  1T3S A;  3GBQ A;  4CC3 A;  2F2V A;  2BZX A;  2F2X A;  2OAW A;  1RLP C;  2CH4 W;  3VS7 A;  1UHF A;  1SEM A;  1M3C A;  2FO0 A;  1RI9 A;  5EC7 A;  1TG0 A;  1V1C A;  2KNB B;  3UA7 A;  3M0Q A;  4ORZ A;  1TUC A;  4J9F A;  1H8K A;  3FJ5 A;  1WLP B;  2PZ1 A;  1ZX6 A;  2KYM A;  2O9S A;  1MUZ A;  2OI3 A;  2YUP A;  1CSK A;  2C0I A;  1YCS B;  2DL4 A;  4RTX A;  1CKB A;  2F2W A;  4X1V A;  3VS2 A;  4OMN A;  4WCI A;  1GFD A;  2SRC A;  1AWO A;  1AWW A;  1RUW A;  2HDA A;  2ROT A;  1OPK A;  4KRT A;  1WI7 A;  2EYX A;  2L3S A;  4GBQ A;  2K7A A;  2K9G A;  4RTU A;  3EG2 A;  1PNJ A;  1PWT A;  3REB B;  4LNP A;  1PKT A;  1ZUK A;  1YN8 A;  4FSS A;  4AFZ C;  5I22 A;  1T0J A;  2DRM A;  3UAT A;  2L2P A;  2ENM A;  3VRZ A;  2CH4 A;  3SEM A;  1SHG A;  1U5S A;  5IH2 A;  3A98 A;  2KXD A;  3EG0 A;  2L3Q A;  2V1R A;  1HSQ A;  1PRL C;  1X27 A;  2ED1 A;  1GBQ A;  2H8H A;  2RN8 A;  2JXB A;  2EYW A;  1U06 A;  1GL5 A;  2L0A A;  3H0H A;  2AKL A;  2AKK A;  2YDL A;  3PE0 A;  2PNI A;  1B3Q A;  4D8K A;  2JTE A;  1K1Z A;  2DL8 A;  2LJ3 A;  3R6N A;  4J9D A;  3VS3 A;  1YWP A;  2RQW A;  2KYB A;  1G2B A;  2RQR A;  1AZE A;  1EFN A;  1AZG B;  1TUD A;  4HXJ A;  1SPK A;  4M4Z A;  1UTI A;  2D0N A;  2LQW A;  1UG1 A;  1NEG A;  2JS0 A;  3QWY A;  5I11 A;  1GBR A;  2HEQ A;  2FPD A;  4J9C A;  2KT8 A;  4R0K A;  2JM9 A;  3U23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...