1MV0B

Nmr structure of the tumor suppressor bin1: alternative splicing in melanoma and interaction with c-myc
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
81
Chain Sequence
GRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKKLEKCRGVFPENFTERVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myc proto-oncogene protein
publication title A structure-based model of the c-Myc/Bin1 protein interaction shows alternative splicing of Bin1 and c-Myc phosphorylation are key binding determinants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis, transcription
total genus 12
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2002-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1mv0B00
1QKXA 4J9EA 2RMOA 5FWBA 4CC4B 1H3HA 1PWTA 2B86A 1AZEA 1ZUKA 2CDTA 1MV0B 1NYFA 1QLYA 3H0FA 2EKHA 4J9GA 4LUEA 1JO8A 2KEAA 1BK2A 1M27C 2YDLA 2CH4A 2RN8A 4DEXA 4Y92A 2O9SA 1J3TA 2ROLA 2D1XA 4GBQA 2KXDA 2RQTA 1GCQC 3A98A 2JM9A 4X1VA 1YN8A 1QKWA 2L3QA 1WYXA 2PZ1A 1AZGB 1JXOA 5IHKA 1JQQA 1TG0A 1PRMC 3TSZA 2KT1A 1ABOA 1SPKA 4HVWA 1U3OA 2X3XD 4IIOA 2LJ1A 5ECAA 2RQRA 2PNIA 4AFUC 1OPKA 3VS4A 1VYTA 4J9HA 4Z89A 1ARKA 4JPBW 3LH5A 1UJ0A 1ABQA 3PE0A 1PHTA 1GFDA 2XMFA 3SEMA 2HCKA 2JW4A 3H0HA 2J7IA 3FJ5A 1U5SA 2JMAA 1K0SA 2A37A 2CT3A 1HJDA 2MOXA 4WCIA 2ROTA 3VRZA 2AK5A 3REAB 1FYNA 3VS3A 1W70A 3EHQA 2A36A 2KGTA 3CQTA 2EYYA 1SEMA 2DNUA 4HVVA 2J6FA 3KFVA 2FPDA 1CSKA 4JJBA 1WLPB 2JTEA 4R0KA 1GBQA 1BB9A 3M0PA 2LZ6B 2YUOA 1W6XA 3R6NA 3VS7A 4HXJA 1UECA 1AEYA 1RUWA 4F16A 5IHNA 1WXTA 2K6DA 1LCKA 3M0QA 2SRCA 1H8KA 4QT7A 3I5RA 1RI9A 2DYBA 2FEIA 1VA7A 3NGPA 1G83A 1I0CA 3EG0A 1ZUUA 1RLQC 2AKKA 1SSHA 3C0CA 1SHFA 3UF4A 1B3QA 1ZLMA 1X6BA 5GJWB 4AG1C 2DL7A 4D8DA 4Z88A 1NYGA 2CT4A 2J06A 1Z9ZA 2YUQA 4HCKA 3UA7A 1MUZA 5FWCA 2H8HA 2DVJA 4LUDA 1Z9QA 2ECZA 1TUDA 2GTJA 2X3WD 2GQIA 2K3BA 2MIOA 2DRMA 5EC7A 1GL5A 2LMJA 3GBQA 4CC7A 3RNJA 4GLMA 1WXBA 3VS5A 2ED0A 1NLPC 1VYVA 4J9IA 2C0TA 2ABLA 1E6GA 2ESWA 2OJ2A 2RQUA 3VS2A 2D8HA 1U06A 1HD3A 3EGUA 3PVQA 2EBPA 4AG2C 1WFWA 2SEMA 2LNHB 2W10A 1GCQA 3M0UA 4OMLA 1UDLA 2J05A 2A08A 2KXCA 2A28A 3REBB 1OEBA 1VYUA 4JJDA 2EYZA 1ZSGA 1ZX6A 2M0YA 2J6KA 2GNCA 1RLPC 2DF6A 2VVKA 1H92A 3EHRA 5L23A 4LE9A 2VWFA 1SRLA 3I5SA 2JT4A 2D0NA 3ULRB 2RF0A 3H0IA 2JMCA 1K0XA 1PKSA 2DL8A 2DX1A 2O88A 1ZUYA 4JZ3A 2IIMA 1NEGA 4AFSC 4OMNA 1OPLA 2GBQA 4ORZA 3UA6A 4A63B 3O5ZA 4OMOA 1K76A 3EG1A 2J6OA 2DL5A 4RTUA 1QWEA 4RTWA 1OOTA 4J9FA 2LQNA 1UJYA 1JEGA 3IQLA 1PRLC 4FSSA 1SHGA 1UTIA 3EG2A 2BTTA 2NUZA 4ESRA 2DLPA 2KRNA 1GFCA 2HBWA 4RTZA 3UATA 2V1QA 1YP5A 2OI3A 1EFNA 1UFFA 2F2XA 1AVZC 2YUPA 2L3SA 1QCFA 1UE9A 2KRSA 1X6GA 2EGAA 2EW3A 1GCPA 1K9AA 3M0SA 2LCSA 1N5ZA 2DM1A 5IH2A 1I07A 4D8KA 2E5KA 5GJVB 1UHCA 2CREA 2O9VA 1QWFA 2OAWA 2HEQA 4OMMA 2KROA 1T3LA 2CH4W 1JU5C 1UGVA 1M3AA 4RUGA 2I0NA 1WX6A 2YUNA 2KR3A 1HSQA 2HDAA 2C0OA 2CUBA 3THKA 2LP5A 4RTVA 1AWXA 3RBBB 3QWYA 2EQIA 2EYXA 1KIKA 1X69A 1S1NA 3H41A 2DE0X 3EG3A 1X2KA 1KSWA 1NEBA 2L2PA 2JM8A 2YSQA 1BU1A 2AKLA 2RNAA 1X2QA 2HSPA 2K9GA 1JXMA 5FW9A 2V1RA 2DBMA 1V1CA 1AWOA 1G2BA 1UHFA 1KJWA 5IXBA 2K2MA 4F14A 1K4US 1Y0MA 2FG0A 4Z8AA 1AWJA 2K79A 2CSQA 2KRMA 1T0HA 4OMQA 1CKBA 2EYWA 2DILA 1UUEA 1E7OA 2EPDA 2F2WA 4AFQC 1Y57A 2AZSA 1PNJA 2DL3A 1UG1A 3I35A 2DJQA 2LJ3A 1KFZA 2NWMA 4CC3A 1YWOA 1ZBJA 1TUCA 1BBZA 4LNPA 1YNZA 5IXFA 2EVRA 2QDLA 1A0NB 4F17A 2JS0A 1M30A 5I11A 2KYMA 4KRTA 1AOJA 2FRYA 2FO0A 5IHIA 2LJ0A 3QWXX 2G6FX 3M0TA 3VS1A 1IO6A 3I9QA 2JXBA 1MV3A 2FPFA 2ENMA 2MCNA 2O2OA 1M3CA 5HCKA 2LX7A 1NLOC 2O31A 1M3BA 1K1ZA 2KBTA 2CUDA 4RTXA 2DA9A 2BZ8A 4JJCA 4LN2A 2M51A 4J9BA 4JZ4A 1CKAA 2GTOA 1B07A 3TSWA 4EIKA 2ED1A 2F2VA 2FRWA 2DMOA 3U23A 1WDXA 2W0ZA 2C0IA 4J9DA 1WIEA 2L3PA 1I1JA 1GBRA 4K11A 2K7AA 1OV3A 2JS2A 2AZVA 1NM7A 3JV3A 3PVLA 2BZYA 5I22A 1WXUA 3NHNA 1T3SA 2PTKA 1T0JA 4M4ZA 2KNBB 1SRMA 3TVTA 3SHWA 1AWWA 4ZNXA 1FMKA 3NPFA 1M8MA 2KYBA 4IIMA 4CC2A 4HVUA 2L0AA 1GRIA 2CSIA 4RTYA 2KT8A 1NG2A 2YT6A 1WI7A 1XOVA 2RPNA 3VRYA 3VS6A 2RQWA 2VKNA 2DRKA 4AFZC 2BZXA 4E6RA 3M0RA 1E6HA 2DL4A 4OMPA 4DEYA 2FPEA 1WA7A 1AD5A 2D8JA 2DBKA 4RTTA 2P4RA 1YCSB 1YWPA 3VS0A 1X43A 2KE9A 1PKTA 4J9CA 2LQWA 1X27A 3ZL7C 2GGRA 3NMZC 2EGCA 2RQVA 2EGEA 1W1FA
chains in the Genus database with same CATH superfamily
1Q81U 3JCMX 2RMOA 5FWBA 3GIBA 1ZA2B 3CCUA 1QLYA 3L2ZA 2RA2A 3JCMc 2EKHA 4J9GA 4LUEA 1JO8A 1VQ4A 4M75D 4M7AE 4J5YA 1NJIC 5DM7R 5GAOr 5LJ5e 1YJ9A 2F5KA 3FRNA 1BCOA 5GANf 4B9WA 3EGXA 1YJNT 1NBEB 4GBQA 5GAOn 2JM9A 4M7DG 1QKWA 2L3QA 1KQSP 1I5OB 1M4ZA 3CD6Q 2M0OA 2XG8D 5IHKA 3CCMT 2AIRB 5GANj 2E6ZA 4C92F 1VQNT 1SPKA 2A0FB 1U3OA 3CEYA 2YXYA 4IIOA 2COYA 4PL6A 2RQRA 5KYXA 4BACA 3VS4A 2QQ9A 1BCMA 4XU2A 1G8XA 3OYEA 1ABQA 1VQMA 2X35A 2EIFA 3FJ5A 1KG1A 1Q86R 1W2BP 3E2UA 2O4XB 4DBHA 2ROTA 3EG9B 3JCMf 1M2OA 3VRZA 2M16A 2AK5A 3REAB 1FYNA 3VS3A 3S3NA 1W70A 1VIEA 3CXCP 4A53A 1SG5A 4M78F 5GAOl 3PIPA 3JCMP 2FVUA 5KYYA 4Y28E 4C92D 4M75C 4JJBA 5D7UA 4DBRA 2JTEA 2JTFA 3UDCA 2DD5A 3HP9A 1W6XA 4PLIA 5GAN7 1AEYA 1VQ9T 3ASKA 3H9NA 1QMCA 1XJWB 2DIGA 4F7UB 3M54A 2EWNA 1C1AA 2Y4YA 5GAN5 2DTOA 4OB1B 5J26A 1RI9A 4BY6C 3EGDA 3HRUA 3CMET 2DXCA 3CCMQ 5KYWB 1Q82U 2OTJA 1ZHIA 3G6EA 1SSHA 3JB9F 4F7UE 2CP7A 3CCLT 1X6BA 1K9MR 1YFNA 3CC7A 2E1HA 4AG1C 1VQ4Q 4D8DA 2ATCB 3JCMQ 3X25B 1Z9ZA 1BI0A 3H8ZA 4NOYA 2PQWA 4C92C 1M2VA 2H8HA 2DVJA 4C92A 2V8KA 4E2FB 4M7DF 4J6YA 2MIOA 1GL5A 3VUZA 5FU7B 4GLMA 1WXBA 2ABLA 3L2QA 4A4EA 3PNWC 4WF2A 3VS2A 5KYUA 1HD3A 1VQ8Q 4ANJA 2LC4A 4PJNA 4M78A 4B9XA 5GAN4 3P8DA 5D6YA 1GCQA 1VQMQ 4PKCC 1UDLA 2J05A 2KXCA 2A28A 2K5FA 3A8LB 2GNCA 3A8HB 3EHRA 5KE3A 3BY7A 3EGXB 1YHQA 3QBYA 1QVGA 3MEWA 1MMGA 2RF0A 4FW2A 4A4KA 2O88A 3QUIA 3QXEB 3HFOA 1OPLA 2G3RA 2GBQA 2QASA 4ORZA 4A63B 2X4YA 4FW1A 3CC2A 3I56T 2DL5A 1OOTA 3DLMA 2MK5A 1EZZB 2DTIA 1UJYA 4YTLA 3QYHB 3LWIA 1JEGA 4QQGA 3EG2A 4C5GA 1GFCA 4JJNK 5A2QE 2HBWA 5GAOp 4E7ZA 3FEOA 4LDVA 2OTLQ 1G3TA 4M75B 1WHHA 1N8RC 3OBYA 3OA6A 1QCFA 1TH7A 3OYKA 3CCJQ 2EKOA 2EW3A 1IHWA 4PJLA 1M1KR 1GCPA 3FIFA 1WHKA 2LCSA 1VQ7T 1N5ZA 3MP1A 2DM1A 2FYKA 1I07A 4D8KA 4OF1A 2E5KA 4D6WA 1RAHB 2CREA 2EJ9A 3J7AF 2PU9B 2RH2A 1T3LA 3L2WA 1UGVA 1M3AA 1R8OB 4M75E 4EMGA 1HSQA 4FT2A 2HDAA 3CPFA 2C0OA 1WHLA 1D0YA 1VOMA 3EGDB 4BY6B 3THKA 1IGUA 5DY9A 7AT1B 2LP5A 2VGMA 1YITT 1I5LA 1KIKA 1X69A 2E6NA 3I56Q 3H41A 2DE0X 3EG3A 1TOVA 4DA4A 2H3JA 4E7LA 2JM8A 2RHZA 4C8QD 2AKLA 5J3BA 2K57A 2CZ7B 5FW9A 3FJPA 2V1RA 2FB7A 2DBMA 5IAYA 1G2BA 1YHQQ 1UHFA 1GXIE 1Y0MA 4OGCA 2K5IA 2K4YA 1QP2A 2FG0A 3JAME 4Z8AA 1AWJA 1G3WA 4OMQA 2COWA 4KGZB 3OYAA 3I55T 1OI1A 4F7UG 2DL3A 5KYUB 2DJQA 2BUDA 2LJ3A 2L89A 1KFZA 1B34A 2NWMA 4CC3A 4M7AF 3F70A 2FL7A 3JCMg 1TUCA 3N5BB 1DJ7B 4J7IA 5IXFA 4F17A 2BIVA 4KRTA 2E10A 3BE3A 3VYHB 2FRYA 5IHIA 4QQDA 1KC8R 2X4JA 4C8QC 1BIAA 4XTWA 4IUPA 1S72T 3DLLA 2MCNA 2O31A 1RAFB 2O01E 1M3BA 2LX9A 2KBTA 4HT8A 2CZ6B 2DA9A 3JRZA 2BZ8A 2ZPBB 1QVFS 1TS9A 1VIFA 1V76A 2DK3A 4EIKA 2ED1A 2FRWA 3OW2A 2LVMA 2ZGWA 1WIEA 2CP3A 2JNGA 4JRPA 2E41A 2GQVA 3FLGA 3C94A 1OV3A 4LDUA 4FCYA 1WQWA 2DZCA 2QQAA 2IVWA 3KUFA 4E47A 1VQ6T 2A7YA 4OVAA 2CP5A 5FRNA 3MKDA 3QZ5B 4E7SA 4XK8E 5A0LA 1M90R 3JB9H 4ZNXA 1D1BA 1M8MA 2DAQA 1XQHA 3OYCA 1KQ1A 1TUGB 4JUVA 2L0AA 1YJWT 2CSIA 2GFUA 2KT8A 1JJ2A 3OYNA 3G71T 1WI7A 2HNIA 4M7AA 1K8AU 3CCST 2DRKA 2RI5A 3OYJA 1FMVA 2BZXA 1OULA 3M0RA 1VQOT 4R55A 4F7UF 3CCET 1WA7A 2P4RA 5EG2A 1YCSB 3MP6A 3CC4A 5IT9E 1F1BB 1X27A 3SWNC 3ZL7C 1XTDA 2RQVA 1ZLMA 1W1FA 3PMIA 1K73R 2X9HA 4FYWB 3LGFA 1PWTA 1AZEA 2CDTA 3CPWA 2LNVA 2QQSA 3CCRQ 3H0FA 2Z0WA 4OB0B 3V8KA 1BK2A 3M5AA 3TQ7P 4DEXA 2BKDN 3RMSA 2LCLA 2XKOC 2BE9B 1WPYA 1LVKA 4NL2A 3G4ST 3A98A 2QQBA 2DYIA 2PZ1A 4MDXA 4UC4A 1Y7XA 2KAFA 2VC8A 3TSZA 1VQ5A 4Z02A 1ABOA 3GOXA 1YJWQ 2YRVA 4M77B 3LLRA 2K3YA 2O4XA 2V8JA 4ZGJB 2PNIA 4FL6A 2C06A 2MWPA 3LW5E 4JPBW 1WNLA 2CP2A 3LH5A 3SB2A 1UJ0A 1OX9A 2DEQA 1QCNA 1PHTA 3UT1A 1N9SA 4C0GA 3SEMA 1VQLQ 2XK0A 1GFDA 3H0HA 1Q86U 4JRKA 2RJFA 4C8QB 2MOXA 4DBQA 5DLOA 4XTYA 2RI2A 4XTZA 2KGTA 2EQKA 3J81E 4MMLA 3HRTA 4C92G 1SEMA 2DNUA 4PFOA 3S3OA 2ZCFB 4VUBA 1D0XA 3M0PA 3CCQA 2YUOA 3CCVA 4NS5A 5LJ5h 3QSUA 3VS7A 4C8QE 4F16A 4BB7A 2VXFA 3CD6T 5KYWA 4C0FA 4KGVB 1M1FA 3CC4Q 4QT7A 1WGSA 5LJ3f 1RL2A 2NUPB 3OS0A 2FEIA 5LJ5d 1KK7A 4ZGDB 1KQ2A 1G83A 2HSEB 1RLQC 4M75F 1K9MU 1VUBA 1VQPT 2DL7A 1FX7A 4Z88A 2CT4A 2FHDA 3OSSC 3UA7A 3PT9A 3VU3C 5FWCA 5GMKl 1Q81C 2ECZA 1QVFP 3RERA 3OS5A 2X3WD 1Q7YR 2K3BA 4N0AC 4N0AA 5EC7A 1X6OA 1I81A 3JB9G 1YJNA 4KH1B 3SWNB 2KDSA 3QJ6A 1NLPC 2C0TA 1E6GA 4PNOA 2CGHA 1IGQA 3CMAQ 2ZPEB 3EGUA 3PVQA 4AG2C 2W10A 5FRMA 1VQNA 2EYZA 3RKXA 2M0YA 3M58A 2E5QA 4JS4A 4LE9A 2VWFA 3I5SA 4E7IA 3OYHA 3H0IA 3QYGB 1PKSA 2DX1A 3CCUT 1VQKQ 1VQ4T 5DLQE 3A1PA 3UA6A 1KD1R 4OMOA 1D3BB 4ZN1A 4OP0A 4QVDA 1K76A 5CKBA 1VQPQ 3EG1A 2LT4A 5KE2A 4J9FA 2LQNA 4IUQA 3WVEB 1U8RA 3V7CA 1PG5B 3BDUA 4FSSA 3OYLA 3GNFB 1JRIA 3SFMA 1SHGA 4M75A 2BTTA 2HQEA 2QEXA 2NLUA 3UATA 5LJ5f 3KXTA 2WSCE 1YP5A 1VQ8T 1Y71A 3HL8A 2F2XA 2XDPA 1Q95G 3OYMA 1VQMT 2IPOB 2EYQA 2DXTA 5D6XA 3L2RA 3CMEA 3RMQA 4PLLA 1X6GA 1M1KU 2OAUA 2WSFE 5LJ5j 3CBMA 5GMKe 2A3LA 1N9RA 4L5GA 5GJVB 4QVZA 3MEVA 2O9VA 1Q82C 3HSBA 1IREB 3M53A 1JU5C 2YUNA 2JN0A 2E65A 4A4FA 3CCUQ 3L1AA 3LWHA 2HKQB 2QTVA 4EMHA 1TTHB 2JOYA 4DOWA 2VXEA 4QVCA 4LXCA 1YJ9Q 2RJEA 2D9TA 3P8BB 1S1NA 2EQMA 4FYYB 1W4SA 1X2KA 1KSWA 2L2PA 1BU1A 2K5LA 2HSPA 2RJCA 4Y91A 1AT1B 4IUUA 1AWOA 2XDDA 2MF2A 2OTLT 1KJWA 2M1HA 3G6ET 1K4US 3CCJT 1LPLA 1UGSB 2K79A 2LRQA 1T0HA 4MZMA 3MEUA 2DILA 2MI6A 2EJGA 5GMKm 1Y57A 1I4K1 4O6JA 4J83A 1YWOA 4BI8B 1JB0E 1NJIR 2DZ9A 3JCMJ 8AT1B 2EVRA 2QDLA 2JS0A 4LDXA 4RCBA 5I11A 3CBOA 3AHUA 2QEXQ 3E19A 1AOJA 2VB6A 4IURA 2R5MA 2CYZB 1KC8U 3TEEA 3OW2S 3VS1A 1IO6A 4M7AG 1MV3A 2FPFA 2YWWA 2ENMA 4BDYA 2IG0A 2O2OA 3G1JA 5HCKA 2LX7A 1YHQT 4Q5WA 5KH6A 2GF7A 1VQ7A 4N4GA 3C12A 2MMPA 5LJ3g 1B07A 2EQUA 2F2VA 1YIJA 2OTJQ 1HXDA 1QVGP 3G6EQ 1OZ3A 2C0IA 4J9DA 4ELYC 3RIRA 5GAMg 3CC7Q 3D7SB 5CR2A 2EJFA 1JJ2S 2AZVA 1NM7A 3JV3A 2BZYA 1RACB 1T3SA 1WJRA 5GMKi 3OMCA 4C8QF 4M4ZA 5HK3A 2L3RA 1BI1A 1O75A 1YITA 1M90U 3VV0A 3TVTA 2HZYA 2HD0A 5AYFA 1MNEA 3OQ5A 3G7ZA 4CC2A 4DBFA 1UB4A 3R6OA 4M77D 4RTYA 3HPWA 4AT1B 3RR6A 3OYGA 3JCMW 2RPNA 4BE1A 4E7JA 2DTHA 3VS6A 2RQWA 2VKNA 4E6RA 5GANg 3CPWS 3VYGA 2M9UA 5CKDA 3M4GA 1ZSZC 4PJOD 3VS0A 2NUTB 4RCCA 4EMKC 2KE9A 3I55A 4P5NA 3DKMA 3SDZA 1M1GA 3NMZC 1K73U 4X9CA 1PD0A 1QKXA 1RAAB 4QW2A 4XAXB 2HL3A 2PVGB 4J9EA 4CC4B 4PJMA 2B86A 1BKBA 1MV0B 2VGNA 1NZ9A 4QKUA 3CC2Q 2P4TA 3FDRA 1OZ2A 2KY9A 1M27C 2YDLA 2CH4A 2RN8A 4Y92A 2O9SA 3PIOA 1J3TA 2ROLA 4QQ6A 1BYMA 2KXDA 2RQTA 4M77C 4X1VA 4M77A 1S72A 1WYXA 2VASA 4JLGA 1AZGB 1JQQA 2EAYA 1TG0A 3KBGA 1M5Q1 2KT1A 1YIJQ 4HVWA 4C8QA 1U1TA 4AFUC 3RKYA 1OPKA 1VYTA 5HKCA 4PJOC 4J9HA 2DXUA 4Z89A 2V26A 4PJOA 1RI0A 1D09B 3PE0A 1C0MA 3BFMA 2XMFA 1RAEB 2HCKA 2JW4A 2X4WA 2JMAA 2RHUA 3T9NA 3JCMV 2A37A 1HJDA 4WCIA 3EFSA 2A36A 3CQTA 1YI2A 1R77A 4KH0B 1VQ6A 2CKKA 3KFVA 3CCRT 1CSKA 1WLPB 1PSEA 4R0KA 4HCZA 1GBQA 2WACA 5CK9A 4FU6A 2LZ6B 3V8LA 5J39A 3BDLA 3R6NA 4J8OA 1LNXA 3NTHA 4HXJA 1UECA 4J6XA 1RUWA 3OSVA 1OX8A 3HTRA 5IHNA 1WXTA 1N8RR 2K6DA 2NUPA 1MHNA 5I2SA 4KBMB 5FU6C 3CCSA 1LCKA 3QHSA 1VQOA 1H8KA 2RJDA 3I5RA 4WTOB 1UGQB 1FWZA 3CCEA 2JTMA 1Y07A 3DB3A 1K8AC 4M7DB 1VA7A 3NGPA 3LX7A 2WSEE 1MGQA 2MAMA 1MMNA 2F69A 1VQLT 1H641 2VUBA 1IRXA 3NFCA 5AT1B 3OW2P 3S3MA 3UF4A 1IZ6A 5GJWB 2QK0A 1RABB 1NYGA 2YUQA 4HCKA 8ATCB 5M9OA 2E3HA 3SWNA 1LOJA 4XTVA 3VUBA 2YRCA 4C5IA 4LUDA 5KYNA 1Z9QA 3C4SA 3PTAA 1TUDA 2GTJA 1Q7YU 1ZSZB 2GQIA 2KQWA 2QA4A 2DRMA 3GF5A 2LMJA 3ZFJA 4C5HA 3FB9A 4M75G 4ELZC 3GBQA 4EMKB 3RNJA 3G4SA 2DEUA 3OMGA 1NE8A 3VS5A 1VYVA 4J9IA 4FT4A 3OS1A 2ZPIB 2OJ2A 2Y4XA 2RQUA 4OB2B 2D8HA 1JJ2P 1U06A 2EBPA 1ZA1B 2SEMA 2LNHB 4IUVA 4OMLA 2A08A 3CC4T 3REBB 4RMOA 1ZSGA 1ZX6A 5CVIA 2J6KA 1H92A 2VVKA 1SKUB 5L23A 4JRQA 2L5QA 2DJZA 3RKWA 1D3BA 3URGA 4JLIA 1R0CB 2JT4A 3PGGA 2D0NA 2K3XA 1ZUYA 2M02A 2IIMA 1NEGA 4AFSC 2MWOA 1QW1A 2QQRA 4OMNA 2DXBA 3WXMB 3INZA 2OX7A 1X01A 3GP8A 1Q86C 1KD1U 3O5ZA 2PUOB 3CPWP 1Y96B 3MO8A 4RTUA 2J6OA 1R0BG 2KVQG 4PJOB 4BDZA 4JS5A 4NL3A 2DFUA 2KK4A 4M77E 1PRLC 1QCOA 2HQHA 1UTIA 3EH1A 2BE7D 2NUZA 4ESRA 2DLPA 4LD6A 3CD6A 4XU0A 2VV5A 3M9QA 3JCMh 2V1QA 3CMAT 5L8RE 4OGEA 2OI3A 1EFNA 1UFFA 2JUFA 2I2LA 1NPPA 4PJOE 2RM4A 3E9GA 4GY5A 1K9AA 3M0SA 1TU0B 2RHYA 2LDMA 5IH2A 1UHCA 2LCCA 1G3SA 3JCMd 1VQKT 2CH4W 5GAN3 5FU6B 2K2VA 1M8VA 2QA4Q 4KGXB 1K9MC 1IHVA 2YLBA 1IB8A 2E70A 3NTKA 4RTVA 1AWXA 3QWYA 2EQIA 2DPPB 4LD9K 2R57A 2EYXA 4JDSA 5GAOq 4FM4B 3PFSA 2QXFA 1KQSA 2X4XA 1ACMB 3EAEA 1EX4A 3OS2A 4EDUA 2E64A 1TXQA 1X2QA 5CKEA 2ZPHB 2RHIA 1V1CA 2DETA 1QVGS 1UEBA 1VQ5Q 1QQJA 4BUGA 4FSXA 2K2MA 4F14A 3JCMe 2XHCA 1NPRA 1FMWA 3CCMA 5CAIA 2CSQA 1QP3A 3E1SA 5GMKh 1D1AA 1W2BA 4TVRA 2AZSA 3OYIA 4X34A 1M9SA 3RDVA 3CXCA 1ZBJA 1NJIU 3MP8A 4DOVA 4HA8A 3EFOA 1YNZA 4CRIA 2QGGA 1A0NB 5C0MA 1M30A 3QDRB 1QVPA 3LGLA 3CCQQ 2KYMA 3CCVQ 1PSFA 3MEAA 1YJ9T 3RUXA 3QWXX 2G6FX 1LJOA 3I9QA 2GCXA 2JXBA 1VQ8A 1M3CA 4O5VA 1VQ9A 1K1ZA 2CUDA 3Q1JA 4RTXA 4CI0C 3MHXA 4FYXB 1O9SA 2P84A 4LN2A 3QKJA 2GTOA 4N4HA 3QPHA 4RG2A 3NTIA 3ZEHA 3U23A 1B7TA 1WJQA 2RK1A 3TCJA 2W0ZA 1M1KC 2L3PA 1XNIA 4E7HA 2YHTA 1GBRA 4K11A 2K7AA 2JS2A 5I22A 2KMTA 3PMTA 1WXUA 3NHNA 3CCLA 4BI4A 3HRSA 1T0JA 4ATOA 2EQJA 2KNBB 1SRMA 1AWWA 2QEXT 1FMKA 3NPFA 2KYBA 4MDWA 1YJNQ 5GAN2 4M77G 3EFRA 4IIMA 4M78D 4RG8A 2DKGA 1GRIA 2VYTA 2LQKA 1N27A 1XOVA 2NUTA 4C8QG 2OTLA 5A0DA 1VQNQ 3CCJA 1RADB 4DEYA 4PJOG 2FPEA 2D8JA 2AHJB 2DBKA 4RTTA 1YWPA 2CZ1B 1X43A 4J9CA 2OTJT 4FYVB 1ZQ1A 3MJXA 2EGCA 3CC7T 4ZGEB 2EGEA 4KULA 3META 1Q81R 1H3HA 2XU8A 4MZTA 1ZUKA 4IKFA 1D1CA 2XICA 1NYFA 4LDWA 5IN1A 3X26B 2KEAA 5HY6A 3JB9D 4OMFB 5GMKj 2QI2A 3I56A 4M78C 1YBYA 1WQ7A 2D1XA 1VQ9Q 1GCQC 2LTOA 1YN8A 1KHCA 4M7DD 1WHGA 1JXOA 1JBMA 3EFOB 1KC8C 1PRMC 3QZ9B 2E3IA 3TU4K 3GNGA 2RK2A 3JB9I 5GAN8 1RAIB 2X3XD 2LJ1A 3CMEQ 2CP6A 4XU3A 5ECAA 3QIIA 3H6ZA 4R56A 1ARKA 4JRIA 2J7IA 4C0DC 1U5SA 4AMCA 1K0SA 1ZBXA 3P8HA 3HFNA 4HKEA 2CT3A 3CCLQ 4E7KA 4BE2A 5KYXB 3OB9A 3OBWA 9ATCB 2RI3A 1OQKA 3EHQA 2MYSA 2P0QA 2EYYA 2PVDB 4HCCA 4HVVA 2J6FA 1OYXA 4M77F 4MZPA 2FPDA 3CC2T 1X75C 2DD4A 3A8OB 1BB9A 1MMAA 3EH2A 4F04B 3QDFA 2E4HA 2PUKB 3HHTB 5KYYB 2LT1A 1M90C 2CS7A 3L2UA 3OYDA 1C6VX 2YLCA 4BD3A 1N8RU 4XU1A 4PJOF 4M7DC 2COZA 2QGFB 4M7DA 2X51A 3ER0A 2HL5C 3GPLA 3M0QA 2KSSA 2SRCA 5GAOm 1YIJT 3JSCA 2DYBA 4EPCA 2QYZA 3MPUB 1Q82R 5CKFA 1I0CA 2CZ0B 3EG0A 1ZUUA 2AKKA 3C0CA 1SHFA 3BW1A 1UGPB 3M57A 1B3QA 1PD1A 1D0ZA 1SSFA 1ZSZA 4L6V5 2KI7A 3C95A 3A8GB 2J06A 4B6MA 4EMKA 4LDYA 3X20B 4PJJA 2YRDA 1MUZA 4OB3B 2D6FA 2XDBA 1K73C 5GAN6 2F5TX 3L2VA 4ME7A 1AHJB 4MMKA 4A4GA 4XTXA 2RD1A 4PFZA 4CC7A 1N6AA 2PVOB 1M2VB 4C92B 2ED0A 3V8JA 2ESWA 1TWBA 1SF9A 3E9FA 1WFWA 5KCOA 2R58A 3M0UA 2AT1B 5HK0A 1OEBA 1VYUA 4JJDA 2QG9B 1V29B 4ZN3A 1RLPC 2DF6A 4C0ZA 4HT9A 1VQ7Q 4C92E 4M78B 3UPUA 1SRLA 5LJ5g 1OU8A 3ULRB 1K0XA 2JMCA 3O8VA 1Y96A 2DL8A 3RESA 4JZ3A 3A5ZB 2H3EB 2XIDA 3OY9A 1PCXA 2MPXC 2ZPGB 1FXXA 4BI3A 2QDYB 3QG1A 2DO3A 3GLXA 3CCRA 3LYIA 4N4IA 4PK4A 3OYFA 5CQXA 1QWEA 4KUIA 3WVDB 2JJ9A 3CBPA 4RTWA 1YITQ 3V7RA 4M78E 5D6WA 3X24B 3IQLA 4XQ3A 3LH0A 4C0DB 4M7AD 1U1SA 2NYSA 3OYYA 3QO3A 4RKUE 2KRNA 3JB9J 5KCHA 4RTZA 4V2SA 4ZTJA 2RHXA 2FZCB 1AVZC 1YJWA 2YUPA 2L3SA 1UE9A 3G71A 2P0KA 2KRSA 4HCBA 2EGAA 5CKHA 5CCAA 2HKNA 4J7FA 1VQLA 2FZKB 3I55Q 1G5VA 1YI2T 2QAZA 1QWFA 2OAWA 2HEQA 4OMMA 4X9DA 2L8DA 2KROA 3L42A 1KQSS 5FLXE 5I21A 4RUGA 2I0NA 3X28B 1WX6A 2ZZDA 2KR3A 2CUBA 1P92A 3OYBA 5CIUA 2P0PA 3RBBB 5LL6S 1KHIA 5LJ3h 1BI2A 4M7AC 4II1A 1G3YA 4L59A 4M7DE 5GAMh 1Q7YC 3M56A 1NEBA 1W2BS 1S72Q 2YSQA 2RNAA 4KT0E 2K9GA 1JXMA 5C6SA 3M59A 4KUDK 4GLKA 3CXCS 3SD4A 2XI9A 3V7SA 2CP0A 4PFPA 5LJ3d 5IXBA 3UWNA 5A0GA 1PC0A 2GFAA 5CQYA 1UGRB 5GAMd 1RAGB 2KRMA 1HK9A 1MMDA 1CKBA 5I2MA 2EYWA 4XTUA 1UUEA 1E7OA 2EPDA 2F2WA 3JCMb 4AFQC 1PNJA 1UG1A 3I35A 2JVVA 2DERA 1YI2Q 2QA4T 2Y90A 1BBZA 1VQ6Q 4LNPA 5GANh 2RO0A 3ZBDA 1KD1C 2V8IA 1B34B 4ZTFA 3J80E 2FO0A 1HYOA 2LJ0A 4DQ2A 5LJ3e 3VJPA 2RB6A 1WZOA 3M0TA 4A54A 3G71Q 3EG9A 4A4HA 2F1LA 2FZGB 5GAMe 5GANd 3CMAA 3CCSQ 1MNDA 3TREA 2D0QB 3M4YA 1NLOC 3AT1B 2HAXA 1OU9A 1VQOQ 1VQ5T 2XD0A 3CCEQ 4JJCA 1IXDA 2M51A 3VKIA 4J9BA 4JZ4A 6AT1B 1CKAA 5FROA 3TSWA 2DMOA 2B8AA 3S6WA 2ZAEA 4J6WA 1WDXA 2JZ2A 3ME9A 3MCAB 4IUTA 2DVEA 1VQKA 2LQ8A 2QTXA 1I1JA 4F7UA 3HKSA 2HBPA 3PVLA 2R5AA 1VQPA 1I8FA 1QVFA 2PTKA 3QJYA 1WHJA 2ZPFB 3FC3A 3DB4A 3CCQT 3SHWA 5GANe 4FIBA 1WJSA 4M78G 3CCVT 3A8MB 3G4SQ 4HVUA 2EFIA 1TSFA 3M55A 1NG2A 1H3ZA 1PM3A 2YT6A 1WHMA 1K8AR 4C5EA 2DIQA 3VRYA 1BI3A 1EIFA 5GAMf 4AFZC 2HMAA 1E6HA 2DL4A 4OMPA 5LJ3j 1YCYA 1AD5A 1BIBA 5CO7A 4M7AB 5GAMj 4BE0A 2E12A 1PKTA 2LQWA 5FU7C 2GGRA 2HQXA
chains in the Genus database with same CATH topology
1QKXA 4J9EA 2RMOA 5FWBA 4CC4B 1H3HA 1PWTA 2B86A 1AZEA 1ZUKA 2CDTA 1MV0B 1NYFA 1QLYA 3H0FA 2EKHA 4J9GA 4LUEA 1JO8A 2KEAA 1BK2A 1M27C 2YDLA 2CH4A 2RN8A 4DEXA 4Y92A 2O9SA 1J3TA 2ROLA 2D1XA 4GBQA 2KXDA 2RQTA 1GCQC 3A98A 2JM9A 4X1VA 1YN8A 1QKWA 2L3QA 1WYXA 2PZ1A 1AZGB 1JXOA 5IHKA 1JQQA 1TG0A 1PRMC 3TSZA 2KT1A 1ABOA 1SPKA 4HVWA 1U3OA 2X3XD 4IIOA 2LJ1A 5ECAA 2RQRA 2PNIA 4AFUC 1OPKA 3VS4A 1VYTA 4J9HA 4Z89A 1ARKA 4JPBW 3LH5A 1UJ0A 1ABQA 3PE0A 1PHTA 1GFDA 2XMFA 3SEMA 2HCKA 2JW4A 3H0HA 2J7IA 3FJ5A 1U5SA 2JMAA 1K0SA 2A37A 2CT3A 1HJDA 2MOXA 4WCIA 2ROTA 3VRZA 2AK5A 3REAB 1FYNA 3VS3A 1W70A 3EHQA 2A36A 2KGTA 3CQTA 2EYYA 1SEMA 2DNUA 4HVVA 2J6FA 3KFVA 2FPDA 1CSKA 4JJBA 1WLPB 2JTEA 4R0KA 1GBQA 1BB9A 3M0PA 2LZ6B 2YUOA 1W6XA 3R6NA 3VS7A 4HXJA 1UECA 1AEYA 1RUWA 4F16A 5IHNA 1WXTA 2K6DA 1LCKA 3M0QA 2SRCA 1H8KA 4QT7A 3I5RA 1RI9A 2DYBA 2FEIA 1VA7A 3NGPA 1G83A 1I0CA 3EG0A 1ZUUA 1RLQC 2AKKA 1SSHA 3C0CA 1SHFA 3UF4A 1B3QA 1ZLMA 1X6BA 5GJWB 4AG1C 2DL7A 4D8DA 4Z88A 1NYGA 2CT4A 2J06A 1Z9ZA 2YUQA 4HCKA 3UA7A 1MUZA 5FWCA 2H8HA 2DVJA 4LUDA 1Z9QA 2ECZA 1TUDA 2GTJA 2X3WD 2GQIA 2K3BA 2MIOA 2DRMA 5EC7A 1GL5A 2LMJA 3GBQA 4CC7A 3RNJA 4GLMA 1WXBA 3VS5A 2ED0A 1NLPC 1VYVA 4J9IA 2C0TA 2ABLA 1E6GA 2ESWA 2OJ2A 2RQUA 3VS2A 2D8HA 1U06A 1HD3A 3EGUA 3PVQA 2EBPA 4AG2C 1WFWA 2SEMA 2LNHB 2W10A 1GCQA 3M0UA 4OMLA 1UDLA 2J05A 2A08A 2KXCA 2A28A 3REBB 1OEBA 1VYUA 4JJDA 2EYZA 1ZSGA 1ZX6A 2M0YA 2J6KA 2GNCA 1RLPC 2DF6A 2VVKA 1H92A 3EHRA 5L23A 4LE9A 2VWFA 1SRLA 3I5SA 2JT4A 2D0NA 3ULRB 2RF0A 3H0IA 2JMCA 1K0XA 1PKSA 2DL8A 2DX1A 2O88A 1ZUYA 4JZ3A 2IIMA 1NEGA 4AFSC 4OMNA 1OPLA 2GBQA 4ORZA 3UA6A 4A63B 3O5ZA 4OMOA 1K76A 3EG1A 2J6OA 2DL5A 4RTUA 1QWEA 4RTWA 1OOTA 4J9FA 2LQNA 1UJYA 1JEGA 3IQLA 1PRLC 4FSSA 1SHGA 1UTIA 3EG2A 2BTTA 2NUZA 4ESRA 2DLPA 2KRNA 1GFCA 2HBWA 4RTZA 3UATA 2V1QA 1YP5A 2OI3A 1EFNA 1UFFA 2F2XA 1AVZC 2YUPA 2L3SA 1QCFA 1UE9A 2KRSA 1X6GA 2EGAA 2EW3A 1GCPA 1K9AA 3M0SA 2LCSA 1N5ZA 2DM1A 5IH2A 1I07A 4D8KA 2E5KA 5GJVB 1UHCA 2CREA 2O9VA 1QWFA 2OAWA 2HEQA 4OMMA 2KROA 1T3LA 2CH4W 1JU5C 1UGVA 1M3AA 4RUGA 2I0NA 1WX6A 2YUNA 2KR3A 1HSQA 2HDAA 2C0OA 2CUBA 3THKA 2LP5A 4RTVA 1AWXA 3RBBB 3QWYA 2EQIA 2EYXA 1KIKA 1X69A 1S1NA 3H41A 2DE0X 3EG3A 1X2KA 1KSWA 1NEBA 2L2PA 2JM8A 2YSQA 1BU1A 2AKLA 2RNAA 1X2QA 2HSPA 2K9GA 1JXMA 5FW9A 2V1RA 2DBMA 1V1CA 1AWOA 1G2BA 1UHFA 1KJWA 5IXBA 2K2MA 4F14A 1K4US 1Y0MA 2FG0A 4Z8AA 1AWJA 2K79A 2CSQA 2KRMA 1T0HA 4OMQA 1CKBA 2EYWA 2DILA 1UUEA 1E7OA 2EPDA 2F2WA 4AFQC 1Y57A 2AZSA 1PNJA 2DL3A 1UG1A 3I35A 2DJQA 2LJ3A 1KFZA 2NWMA 4CC3A 1YWOA 1ZBJA 1TUCA 1BBZA 4LNPA 1YNZA 5IXFA 2EVRA 2QDLA 1A0NB 4F17A 2JS0A 1M30A 5I11A 2KYMA 4KRTA 1AOJA 2FRYA 2FO0A 5IHIA 2LJ0A 3QWXX 2G6FX 3M0TA 3VS1A 1IO6A 3I9QA 2JXBA 1MV3A 2FPFA 2ENMA 2MCNA 2O2OA 1M3CA 5HCKA 2LX7A 1NLOC 2O31A 1M3BA 1K1ZA 2KBTA 2CUDA 4RTXA 2DA9A 2BZ8A 4JJCA 4LN2A 2M51A 4J9BA 4JZ4A 1CKAA 2GTOA 1B07A 3TSWA 4EIKA 2ED1A 2F2VA 2FRWA 2DMOA 3U23A 1WDXA 2W0ZA 2C0IA 4J9DA 1WIEA 2L3PA 1I1JA 1GBRA 4K11A 2K7AA 1OV3A 2JS2A 2AZVA 1NM7A 3JV3A 3PVLA 2BZYA 5I22A 1WXUA 3NHNA 1T3SA 2PTKA 1T0JA 4M4ZA 2KNBB 1SRMA 3TVTA 3SHWA 1AWWA 4ZNXA 1FMKA 3NPFA 1M8MA 2KYBA 4IIMA 4CC2A 4HVUA 2L0AA 1GRIA 2CSIA 4RTYA 2KT8A 1NG2A 2YT6A 1WI7A 1XOVA 2RPNA 3VRYA 3VS6A 2RQWA 2VKNA 2DRKA 4AFZC 2BZXA 4E6RA 3M0RA 1E6HA 2DL4A 4OMPA 4DEYA 2FPEA 1WA7A 1AD5A 2D8JA 2DBKA 4RTTA 2P4RA 1YCSB 1YWPA 3VS0A 1X43A 2KE9A 1PKTA 4J9CA 2LQWA 1X27A 3ZL7C 2GGRA 3NMZC 2EGCA 2RQVA 2EGEA 1W1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QKX A;  4J9E A;  2RMO A;  5FWB A;  4CC4 B;  1H3H A;  1PWT A;  2B86 A;  1AZE A;  1ZUK A;  2CDT A;  1MV0 B;  1NYF A;  1QLY A;  3H0F A;  2EKH A;  4J9G A;  4LUE A;  1JO8 A;  2KEA A;  1BK2 A;  1M27 C;  2YDL A;  2CH4 A;  2RN8 A;  4DEX A;  4Y92 A;  2O9S A;  1J3T A;  2ROL A;  2D1X A;  4GBQ A;  2KXD A;  2RQT A;  1GCQ C;  3A98 A;  2JM9 A;  4X1V A;  1YN8 A;  1QKW A;  2L3Q A;  1WYX A;  2PZ1 A;  1AZG B;  1JXO A;  5IHK A;  1JQQ A;  1TG0 A;  1PRM C;  3TSZ A;  2KT1 A;  1ABO A;  1SPK A;  4HVW A;  1U3O A;  2X3X D;  4IIO A;  2LJ1 A;  5ECA A;  2RQR A;  2PNI A;  4AFU C;  1OPK A;  3VS4 A;  1VYT A;  4J9H A;  4Z89 A;  1ARK A;  4JPB W;  3LH5 A;  1UJ0 A;  1ABQ A;  3PE0 A;  1PHT A;  1GFD A;  2XMF A;  3SEM A;  2HCK A;  2JW4 A;  3H0H A;  2J7I A;  3FJ5 A;  1U5S A;  2JMA A;  1K0S A;  2A37 A;  2CT3 A;  1HJD A;  2MOX A;  4WCI A;  2ROT A;  3VRZ A;  2AK5 A;  3REA B;  1FYN A;  3VS3 A;  1W70 A;  3EHQ A;  2A36 A;  2KGT A;  3CQT A;  2EYY A;  1SEM A;  2DNU A;  4HVV A;  2J6F A;  3KFV A;  2FPD A;  1CSK A;  4JJB A;  1WLP B;  2JTE A;  4R0K A;  1GBQ A;  1BB9 A;  3M0P A;  2LZ6 B;  2YUO A;  1W6X A;  3R6N A;  3VS7 A;  4HXJ A;  1UEC A;  1AEY A;  1RUW A;  4F16 A;  5IHN A;  1WXT A;  2K6D A;  1LCK A;  3M0Q A;  2SRC A;  1H8K A;  4QT7 A;  3I5R A;  1RI9 A;  2DYB A;  2FEI A;  1VA7 A;  3NGP A;  1G83 A;  1I0C A;  3EG0 A;  1ZUU A;  1RLQ C;  2AKK A;  1SSH A;  3C0C A;  1SHF A;  3UF4 A;  1B3Q A;  1ZLM A;  1X6B A;  5GJW B;  4AG1 C;  2DL7 A;  4D8D A;  4Z88 A;  1NYG A;  2CT4 A;  2J06 A;  1Z9Z A;  2YUQ A;  4HCK A;  3UA7 A;  1MUZ A;  5FWC A;  2H8H A;  2DVJ A;  4LUD A;  1Z9Q A;  2ECZ A;  1TUD A;  2GTJ A;  2X3W D;  2GQI A;  2K3B A;  2MIO A;  2DRM A;  5EC7 A;  1GL5 A;  2LMJ A;  3GBQ A;  4CC7 A;  3RNJ A;  4GLM A;  1WXB A;  3VS5 A;  2ED0 A;  1NLP C;  1VYV A;  4J9I A;  2C0T A;  2ABL A;  1E6G A;  2ESW A;  2OJ2 A;  2RQU A;  3VS2 A;  2D8H A;  1U06 A;  1HD3 A;  3EGU A;  3PVQ A;  2EBP A;  4AG2 C;  1WFW A;  2SEM A;  2LNH B;  2W10 A;  1GCQ A;  3M0U A;  4OML A;  1UDL A;  2J05 A;  2A08 A;  2KXC A;  2A28 A;  3REB B;  1OEB A;  1VYU A;  4JJD A;  2EYZ A;  1ZSG A;  1ZX6 A;  2M0Y A;  2J6K A;  2GNC A;  1RLP C;  2DF6 A;  2VVK A;  1H92 A;  3EHR A;  5L23 A;  4LE9 A;  2VWF A;  1SRL A;  3I5S A;  2JT4 A;  2D0N A;  3ULR B;  2RF0 A;  3H0I A;  2JMC A;  1K0X A;  1PKS A;  2DL8 A;  2DX1 A;  2O88 A;  1ZUY A;  4JZ3 A;  2IIM A;  1NEG A;  4AFS C;  4OMN A;  1OPL A;  2GBQ A;  4ORZ A;  3UA6 A;  4A63 B;  3O5Z A;  4OMO A;  1K76 A;  3EG1 A;  2J6O A;  2DL5 A;  4RTU A;  1QWE A;  4RTW A;  1OOT A;  4J9F A;  2LQN A;  1UJY A;  1JEG A;  3IQL A;  1PRL C;  4FSS A;  1SHG A;  1UTI A;  3EG2 A;  2BTT A;  2NUZ A;  4ESR A;  2DLP A;  2KRN A;  1GFC A;  2HBW A;  4RTZ A;  3UAT A;  2V1Q A;  1YP5 A;  2OI3 A;  1EFN A;  1UFF A;  2F2X A;  1AVZ C;  2YUP A;  2L3S A;  1QCF A;  1UE9 A;  2KRS A;  1X6G A;  2EGA A;  2EW3 A;  1GCP A;  1K9A A;  3M0S A;  2LCS A;  1N5Z A;  2DM1 A;  5IH2 A;  1I07 A;  4D8K A;  2E5K A;  5GJV B;  1UHC A;  2CRE A;  2O9V A;  1QWF A;  2OAW A;  2HEQ A;  4OMM A;  2KRO A;  1T3L A;  2CH4 W;  1JU5 C;  1UGV A;  1M3A A;  4RUG A;  2I0N A;  1WX6 A;  2YUN A;  2KR3 A;  1HSQ A;  2HDA A;  2C0O A;  2CUB A;  3THK A;  2LP5 A;  4RTV A;  1AWX A;  3RBB B;  3QWY A;  2EQI A;  2EYX A;  1KIK A;  1X69 A;  1S1N A;  3H41 A;  2DE0 X;  3EG3 A;  1X2K A;  1KSW A;  1NEB A;  2L2P A;  2JM8 A;  2YSQ A;  1BU1 A;  2AKL A;  2RNA A;  1X2Q A;  2HSP A;  2K9G A;  1JXM A;  5FW9 A;  2V1R A;  2DBM A;  1V1C A;  1AWO A;  1G2B A;  1UHF A;  1KJW A;  5IXB A;  2K2M A;  4F14 A;  1K4U S;  1Y0M A;  2FG0 A;  4Z8A A;  1AWJ A;  2K79 A;  2CSQ A;  2KRM A;  1T0H A;  4OMQ A;  1CKB A;  2EYW A;  2DIL A;  1UUE A;  1E7O A;  2EPD A;  2F2W A;  4AFQ C;  1Y57 A;  2AZS A;  1PNJ A;  2DL3 A;  1UG1 A;  3I35 A;  2DJQ A;  2LJ3 A;  1KFZ A;  2NWM A;  4CC3 A;  1YWO A;  1ZBJ A;  1TUC A;  1BBZ A;  4LNP A;  1YNZ A;  5IXF A;  2EVR A;  2QDL A;  1A0N B;  4F17 A;  2JS0 A;  1M30 A;  5I11 A;  2KYM A;  4KRT A;  1AOJ A;  2FRY A;  2FO0 A;  5IHI A;  2LJ0 A;  3QWX X;  2G6F X;  3M0T A;  3VS1 A;  1IO6 A;  3I9Q A;  2JXB A;  1MV3 A;  2FPF A;  2ENM A;  2MCN A;  2O2O A;  1M3C A;  5HCK A;  2LX7 A;  1NLO C;  2O31 A;  1M3B A;  1K1Z A;  2KBT A;  2CUD A;  4RTX A;  2DA9 A;  2BZ8 A;  4JJC A;  4LN2 A;  2M51 A;  4J9B A;  4JZ4 A;  1CKA A;  2GTO A;  1B07 A;  3TSW A;  4EIK A;  2ED1 A;  2F2V A;  2FRW A;  2DMO A;  3U23 A;  1WDX A;  2W0Z A;  2C0I A;  4J9D A;  1WIE A;  2L3P A;  1I1J A;  1GBR A;  4K11 A;  2K7A A;  1OV3 A;  2JS2 A;  2AZV A;  1NM7 A;  3JV3 A;  3PVL A;  2BZY A;  5I22 A;  1WXU A;  3NHN A;  1T3S A;  2PTK A;  1T0J A;  4M4Z A;  2KNB B;  1SRM A;  3TVT A;  3SHW A;  1AWW A;  4ZNX A;  1FMK A;  3NPF A;  1M8M A;  2KYB A;  4IIM A;  4CC2 A;  4HVU A;  2L0A A;  1GRI A;  2CSI A;  4RTY A;  2KT8 A;  1NG2 A;  2YT6 A;  1WI7 A;  1XOV A;  2RPN A;  3VRY A;  3VS6 A;  2RQW A;  2VKN A;  2DRK A;  4AFZ C;  2BZX A;  4E6R A;  3M0R A;  1E6H A;  2DL4 A;  4OMP A;  4DEY A;  2FPE A;  1WA7 A;  1AD5 A;  2D8J A;  2DBK A;  4RTT A;  2P4R A;  1YCS B;  1YWP A;  3VS0 A;  1X43 A;  2KE9 A;  1PKT A;  4J9C A;  2LQW A;  1X27 A;  3ZL7 C;  2GGR A;  3NMZ C;  2EGC A;  2RQV A;  2EGE A;  1W1F A; 
#chains in the Genus database with same CATH topology
 1Q81 U;  3JCM X;  2RMO A;  5FWB A;  3GIB A;  1ZA2 B;  3CCU A;  1QLY A;  3L2Z A;  2RA2 A;  3JCM c;  2EKH A;  4J9G A;  4LUE A;  1JO8 A;  1VQ4 A;  4M75 D;  4M7A E;  4J5Y A;  1NJI C;  5DM7 R;  5GAO r;  5LJ5 e;  1YJ9 A;  2F5K A;  3FRN A;  1BCO A;  5GAN f;  4B9W A;  3EGX A;  1YJN T;  1NBE B;  4GBQ A;  5GAO n;  2JM9 A;  4M7D G;  1QKW A;  2L3Q A;  1KQS P;  1I5O B;  1M4Z A;  3CD6 Q;  2M0O A;  2XG8 D;  5IHK A;  3CCM T;  2AIR B;  5GAN j;  2E6Z A;  4C92 F;  1VQN T;  1SPK A;  2A0F B;  1U3O A;  3CEY A;  2YXY A;  4IIO A;  2COY A;  4PL6 A;  2RQR A;  5KYX A;  4BAC A;  3VS4 A;  2QQ9 A;  1BCM A;  4XU2 A;  1G8X A;  3OYE A;  1ABQ A;  1VQM A;  2X35 A;  2EIF A;  3FJ5 A;  1KG1 A;  1Q86 R;  1W2B P;  3E2U A;  2O4X B;  4DBH A;  2ROT A;  3EG9 B;  3JCM f;  1M2O A;  3VRZ A;  2M16 A;  2AK5 A;  3REA B;  1FYN A;  3VS3 A;  3S3N A;  1W70 A;  1VIE A;  3CXC P;  4A53 A;  1SG5 A;  4M78 F;  5GAO l;  3PIP A;  3JCM P;  2FVU A;  5KYY A;  4Y28 E;  4C92 D;  4M75 C;  4JJB A;  5D7U A;  4DBR A;  2JTE A;  2JTF A;  3UDC A;  2DD5 A;  3HP9 A;  1W6X A;  4PLI A;  5GAN 7;  1AEY A;  1VQ9 T;  3ASK A;  3H9N A;  1QMC A;  1XJW B;  2DIG A;  4F7U B;  3M54 A;  2EWN A;  1C1A A;  2Y4Y A;  5GAN 5;  2DTO A;  4OB1 B;  5J26 A;  1RI9 A;  4BY6 C;  3EGD A;  3HRU A;  3CME T;  2DXC A;  3CCM Q;  5KYW B;  1Q82 U;  2OTJ A;  1ZHI A;  3G6E A;  1SSH A;  3JB9 F;  4F7U E;  2CP7 A;  3CCL T;  1X6B A;  1K9M R;  1YFN A;  3CC7 A;  2E1H A;  4AG1 C;  1VQ4 Q;  4D8D A;  2ATC B;  3JCM Q;  3X25 B;  1Z9Z A;  1BI0 A;  3H8Z A;  4NOY A;  2PQW A;  4C92 C;  1M2V A;  2H8H A;  2DVJ A;  4C92 A;  2V8K A;  4E2F B;  4M7D F;  4J6Y A;  2MIO A;  1GL5 A;  3VUZ A;  5FU7 B;  4GLM A;  1WXB A;  2ABL A;  3L2Q A;  4A4E A;  3PNW C;  4WF2 A;  3VS2 A;  5KYU A;  1HD3 A;  1VQ8 Q;  4ANJ A;  2LC4 A;  4PJN A;  4M78 A;  4B9X A;  5GAN 4;  3P8D A;  5D6Y A;  1GCQ A;  1VQM Q;  4PKC C;  1UDL A;  2J05 A;  2KXC A;  2A28 A;  2K5F A;  3A8L B;  2GNC A;  3A8H B;  3EHR A;  5KE3 A;  3BY7 A;  3EGX B;  1YHQ A;  3QBY A;  1QVG A;  3MEW A;  1MMG A;  2RF0 A;  4FW2 A;  4A4K A;  2O88 A;  3QUI A;  3QXE B;  3HFO A;  1OPL A;  2G3R A;  2GBQ A;  2QAS A;  4ORZ A;  4A63 B;  2X4Y A;  4FW1 A;  3CC2 A;  3I56 T;  2DL5 A;  1OOT A;  3DLM A;  2MK5 A;  1EZZ B;  2DTI A;  1UJY A;  4YTL A;  3QYH B;  3LWI A;  1JEG A;  4QQG A;  3EG2 A;  4C5G A;  1GFC A;  4JJN K;  5A2Q E;  2HBW A;  5GAO p;  4E7Z A;  3FEO A;  4LDV A;  2OTL Q;  1G3T A;  4M75 B;  1WHH A;  1N8R C;  3OBY A;  3OA6 A;  1QCF A;  1TH7 A;  3OYK A;  3CCJ Q;  2EKO A;  2EW3 A;  1IHW A;  4PJL A;  1M1K R;  1GCP A;  3FIF A;  1WHK A;  2LCS A;  1VQ7 T;  1N5Z A;  3MP1 A;  2DM1 A;  2FYK A;  1I07 A;  4D8K A;  4OF1 A;  2E5K A;  4D6W A;  1RAH B;  2CRE A;  2EJ9 A;  3J7A F;  2PU9 B;  2RH2 A;  1T3L A;  3L2W A;  1UGV A;  1M3A A;  1R8O B;  4M75 E;  4EMG A;  1HSQ A;  4FT2 A;  2HDA A;  3CPF A;  2C0O A;  1WHL A;  1D0Y A;  1VOM A;  3EGD B;  4BY6 B;  3THK A;  1IGU A;  5DY9 A;  7AT1 B;  2LP5 A;  2VGM A;  1YIT T;  1I5L A;  1KIK A;  1X69 A;  2E6N A;  3I56 Q;  3H41 A;  2DE0 X;  3EG3 A;  1TOV A;  4DA4 A;  2H3J A;  4E7L A;  2JM8 A;  2RHZ A;  4C8Q D;  2AKL A;  5J3B A;  2K57 A;  2CZ7 B;  5FW9 A;  3FJP A;  2V1R A;  2FB7 A;  2DBM A;  5IAY A;  1G2B A;  1YHQ Q;  1UHF A;  1GXI E;  1Y0M A;  4OGC A;  2K5I A;  2K4Y A;  1QP2 A;  2FG0 A;  3JAM E;  4Z8A A;  1AWJ A;  1G3W A;  4OMQ A;  2COW A;  4KGZ B;  3OYA A;  3I55 T;  1OI1 A;  4F7U G;  2DL3 A;  5KYU B;  2DJQ A;  2BUD A;  2LJ3 A;  2L89 A;  1KFZ A;  1B34 A;  2NWM A;  4CC3 A;  4M7A F;  3F70 A;  2FL7 A;  3JCM g;  1TUC A;  3N5B B;  1DJ7 B;  4J7I A;  5IXF A;  4F17 A;  2BIV A;  4KRT A;  2E10 A;  3BE3 A;  3VYH B;  2FRY A;  5IHI A;  4QQD A;  1KC8 R;  2X4J A;  4C8Q C;  1BIA A;  4XTW A;  4IUP A;  1S72 T;  3DLL A;  2MCN A;  2O31 A;  1RAF B;  2O01 E;  1M3B A;  2LX9 A;  2KBT A;  4HT8 A;  2CZ6 B;  2DA9 A;  3JRZ A;  2BZ8 A;  2ZPB B;  1QVF S;  1TS9 A;  1VIF A;  1V76 A;  2DK3 A;  4EIK A;  2ED1 A;  2FRW A;  3OW2 A;  2LVM A;  2ZGW A;  1WIE A;  2CP3 A;  2JNG A;  4JRP A;  2E41 A;  2GQV A;  3FLG A;  3C94 A;  1OV3 A;  4LDU A;  4FCY A;  1WQW A;  2DZC A;  2QQA A;  2IVW A;  3KUF A;  4E47 A;  1VQ6 T;  2A7Y A;  4OVA A;  2CP5 A;  5FRN A;  3MKD A;  3QZ5 B;  4E7S A;  4XK8 E;  5A0L A;  1M90 R;  3JB9 H;  4ZNX A;  1D1B A;  1M8M A;  2DAQ A;  1XQH A;  3OYC A;  1KQ1 A;  1TUG B;  4JUV A;  2L0A A;  1YJW T;  2CSI A;  2GFU A;  2KT8 A;  1JJ2 A;  3OYN A;  3G71 T;  1WI7 A;  2HNI A;  4M7A A;  1K8A U;  3CCS T;  2DRK A;  2RI5 A;  3OYJ A;  1FMV A;  2BZX A;  1OUL A;  3M0R A;  1VQO T;  4R55 A;  4F7U F;  3CCE T;  1WA7 A;  2P4R A;  5EG2 A;  1YCS B;  3MP6 A;  3CC4 A;  5IT9 E;  1F1B B;  1X27 A;  3SWN C;  3ZL7 C;  1XTD A;  2RQV A;  1ZLM A;  1W1F A;  3PMI A;  1K73 R;  2X9H A;  4FYW B;  3LGF A;  1PWT A;  1AZE A;  2CDT A;  3CPW A;  2LNV A;  2QQS A;  3CCR Q;  3H0F A;  2Z0W A;  4OB0 B;  3V8K A;  1BK2 A;  3M5A A;  3TQ7 P;  4DEX A;  2BKD N;  3RMS A;  2LCL A;  2XKO C;  2BE9 B;  1WPY A;  1LVK A;  4NL2 A;  3G4S T;  3A98 A;  2QQB A;  2DYI A;  2PZ1 A;  4MDX A;  4UC4 A;  1Y7X A;  2KAF A;  2VC8 A;  3TSZ A;  1VQ5 A;  4Z02 A;  1ABO A;  3GOX A;  1YJW Q;  2YRV A;  4M77 B;  3LLR A;  2K3Y A;  2O4X A;  2V8J A;  4ZGJ B;  2PNI A;  4FL6 A;  2C06 A;  2MWP A;  3LW5 E;  4JPB W;  1WNL A;  2CP2 A;  3LH5 A;  3SB2 A;  1UJ0 A;  1OX9 A;  2DEQ A;  1QCN A;  1PHT A;  3UT1 A;  1N9S A;  4C0G A;  3SEM A;  1VQL Q;  2XK0 A;  1GFD A;  3H0H A;  1Q86 U;  4JRK A;  2RJF A;  4C8Q B;  2MOX A;  4DBQ A;  5DLO A;  4XTY A;  2RI2 A;  4XTZ A;  2KGT A;  2EQK A;  3J81 E;  4MML A;  3HRT A;  4C92 G;  1SEM A;  2DNU A;  4PFO A;  3S3O A;  2ZCF B;  4VUB A;  1D0X A;  3M0P A;  3CCQ A;  2YUO A;  3CCV A;  4NS5 A;  5LJ5 h;  3QSU A;  3VS7 A;  4C8Q E;  4F16 A;  4BB7 A;  2VXF A;  3CD6 T;  5KYW A;  4C0F A;  4KGV B;  1M1F A;  3CC4 Q;  4QT7 A;  1WGS A;  5LJ3 f;  1RL2 A;  2NUP B;  3OS0 A;  2FEI A;  5LJ5 d;  1KK7 A;  4ZGD B;  1KQ2 A;  1G83 A;  2HSE B;  1RLQ C;  4M75 F;  1K9M U;  1VUB A;  1VQP T;  2DL7 A;  1FX7 A;  4Z88 A;  2CT4 A;  2FHD A;  3OSS C;  3UA7 A;  3PT9 A;  3VU3 C;  5FWC A;  5GMK l;  1Q81 C;  2ECZ A;  1QVF P;  3RER A;  3OS5 A;  2X3W D;  1Q7Y R;  2K3B A;  4N0A C;  4N0A A;  5EC7 A;  1X6O A;  1I81 A;  3JB9 G;  1YJN A;  4KH1 B;  3SWN B;  2KDS A;  3QJ6 A;  1NLP C;  2C0T A;  1E6G A;  4PNO A;  2CGH A;  1IGQ A;  3CMA Q;  2ZPE B;  3EGU A;  3PVQ A;  4AG2 C;  2W10 A;  5FRM A;  1VQN A;  2EYZ A;  3RKX A;  2M0Y A;  3M58 A;  2E5Q A;  4JS4 A;  4LE9 A;  2VWF A;  3I5S A;  4E7I A;  3OYH A;  3H0I A;  3QYG B;  1PKS A;  2DX1 A;  3CCU T;  1VQK Q;  1VQ4 T;  5DLQ E;  3A1P A;  3UA6 A;  1KD1 R;  4OMO A;  1D3B B;  4ZN1 A;  4OP0 A;  4QVD A;  1K76 A;  5CKB A;  1VQP Q;  3EG1 A;  2LT4 A;  5KE2 A;  4J9F A;  2LQN A;  4IUQ A;  3WVE B;  1U8R A;  3V7C A;  1PG5 B;  3BDU A;  4FSS A;  3OYL A;  3GNF B;  1JRI A;  3SFM A;  1SHG A;  4M75 A;  2BTT A;  2HQE A;  2QEX A;  2NLU A;  3UAT A;  5LJ5 f;  3KXT A;  2WSC E;  1YP5 A;  1VQ8 T;  1Y71 A;  3HL8 A;  2F2X A;  2XDP A;  1Q95 G;  3OYM A;  1VQM T;  2IPO B;  2EYQ A;  2DXT A;  5D6X A;  3L2R A;  3CME A;  3RMQ A;  4PLL A;  1X6G A;  1M1K U;  2OAU A;  2WSF E;  5LJ5 j;  3CBM A;  5GMK e;  2A3L A;  1N9R A;  4L5G A;  5GJV B;  4QVZ A;  3MEV A;  2O9V A;  1Q82 C;  3HSB A;  1IRE B;  3M53 A;  1JU5 C;  2YUN A;  2JN0 A;  2E65 A;  4A4F A;  3CCU Q;  3L1A A;  3LWH A;  2HKQ B;  2QTV A;  4EMH A;  1TTH B;  2JOY A;  4DOW A;  2VXE A;  4QVC A;  4LXC A;  1YJ9 Q;  2RJE A;  2D9T A;  3P8B B;  1S1N A;  2EQM A;  4FYY B;  1W4S A;  1X2K A;  1KSW A;  2L2P A;  1BU1 A;  2K5L A;  2HSP A;  2RJC A;  4Y91 A;  1AT1 B;  4IUU A;  1AWO A;  2XDD A;  2MF2 A;  2OTL T;  1KJW A;  2M1H A;  3G6E T;  1K4U S;  3CCJ T;  1LPL A;  1UGS B;  2K79 A;  2LRQ A;  1T0H A;  4MZM A;  3MEU A;  2DIL A;  2MI6 A;  2EJG A;  5GMK m;  1Y57 A;  1I4K 1;  4O6J A;  4J83 A;  1YWO A;  4BI8 B;  1JB0 E;  1NJI R;  2DZ9 A;  3JCM J;  8AT1 B;  2EVR A;  2QDL A;  2JS0 A;  4LDX A;  4RCB A;  5I11 A;  3CBO A;  3AHU A;  2QEX Q;  3E19 A;  1AOJ A;  2VB6 A;  4IUR A;  2R5M A;  2CYZ B;  1KC8 U;  3TEE A;  3OW2 S;  3VS1 A;  1IO6 A;  4M7A G;  1MV3 A;  2FPF A;  2YWW A;  2ENM A;  4BDY A;  2IG0 A;  2O2O A;  3G1J A;  5HCK A;  2LX7 A;  1YHQ T;  4Q5W A;  5KH6 A;  2GF7 A;  1VQ7 A;  4N4G A;  3C12 A;  2MMP A;  5LJ3 g;  1B07 A;  2EQU A;  2F2V A;  1YIJ A;  2OTJ Q;  1HXD A;  1QVG P;  3G6E Q;  1OZ3 A;  2C0I A;  4J9D A;  4ELY C;  3RIR A;  5GAM g;  3CC7 Q;  3D7S B;  5CR2 A;  2EJF A;  1JJ2 S;  2AZV A;  1NM7 A;  3JV3 A;  2BZY A;  1RAC B;  1T3S A;  1WJR A;  5GMK i;  3OMC A;  4C8Q F;  4M4Z A;  5HK3 A;  2L3R A;  1BI1 A;  1O75 A;  1YIT A;  1M90 U;  3VV0 A;  3TVT A;  2HZY A;  2HD0 A;  5AYF A;  1MNE A;  3OQ5 A;  3G7Z A;  4CC2 A;  4DBF A;  1UB4 A;  3R6O A;  4M77 D;  4RTY A;  3HPW A;  4AT1 B;  3RR6 A;  3OYG A;  3JCM W;  2RPN A;  4BE1 A;  4E7J A;  2DTH A;  3VS6 A;  2RQW A;  2VKN A;  4E6R A;  5GAN g;  3CPW S;  3VYG A;  2M9U A;  5CKD A;  3M4G A;  1ZSZ C;  4PJO D;  3VS0 A;  2NUT B;  4RCC A;  4EMK C;  2KE9 A;  3I55 A;  4P5N A;  3DKM A;  3SDZ A;  1M1G A;  3NMZ C;  1K73 U;  4X9C A;  1PD0 A;  1QKX A;  1RAA B;  4QW2 A;  4XAX B;  2HL3 A;  2PVG B;  4J9E A;  4CC4 B;  4PJM A;  2B86 A;  1BKB A;  1MV0 B;  2VGN A;  1NZ9 A;  4QKU A;  3CC2 Q;  2P4T A;  3FDR A;  1OZ2 A;  2KY9 A;  1M27 C;  2YDL A;  2CH4 A;  2RN8 A;  4Y92 A;  2O9S A;  3PIO A;  1J3T A;  2ROL A;  4QQ6 A;  1BYM A;  2KXD A;  2RQT A;  4M77 C;  4X1V A;  4M77 A;  1S72 A;  1WYX A;  2VAS A;  4JLG A;  1AZG B;  1JQQ A;  2EAY A;  1TG0 A;  3KBG A;  1M5Q 1;  2KT1 A;  1YIJ Q;  4HVW A;  4C8Q A;  1U1T A;  4AFU C;  3RKY A;  1OPK A;  1VYT A;  5HKC A;  4PJO C;  4J9H A;  2DXU A;  4Z89 A;  2V26 A;  4PJO A;  1RI0 A;  1D09 B;  3PE0 A;  1C0M A;  3BFM A;  2XMF A;  1RAE B;  2HCK A;  2JW4 A;  2X4W A;  2JMA A;  2RHU A;  3T9N A;  3JCM V;  2A37 A;  1HJD A;  4WCI A;  3EFS A;  2A36 A;  3CQT A;  1YI2 A;  1R77 A;  4KH0 B;  1VQ6 A;  2CKK A;  3KFV A;  3CCR T;  1CSK A;  1WLP B;  1PSE A;  4R0K A;  4HCZ A;  1GBQ A;  2WAC A;  5CK9 A;  4FU6 A;  2LZ6 B;  3V8L A;  5J39 A;  3BDL A;  3R6N A;  4J8O A;  1LNX A;  3NTH A;  4HXJ A;  1UEC A;  4J6X A;  1RUW A;  3OSV A;  1OX8 A;  3HTR A;  5IHN A;  1WXT A;  1N8R R;  2K6D A;  2NUP A;  1MHN A;  5I2S A;  4KBM B;  5FU6 C;  3CCS A;  1LCK A;  3QHS A;  1VQO A;  1H8K A;  2RJD A;  3I5R A;  4WTO B;  1UGQ B;  1FWZ A;  3CCE A;  2JTM A;  1Y07 A;  3DB3 A;  1K8A C;  4M7D B;  1VA7 A;  3NGP A;  3LX7 A;  2WSE E;  1MGQ A;  2MAM A;  1MMN A;  2F69 A;  1VQL T;  1H64 1;  2VUB A;  1IRX A;  3NFC A;  5AT1 B;  3OW2 P;  3S3M A;  3UF4 A;  1IZ6 A;  5GJW B;  2QK0 A;  1RAB B;  1NYG A;  2YUQ A;  4HCK A;  8ATC B;  5M9O A;  2E3H A;  3SWN A;  1LOJ A;  4XTV A;  3VUB A;  2YRC A;  4C5I A;  4LUD A;  5KYN A;  1Z9Q A;  3C4S A;  3PTA A;  1TUD A;  2GTJ A;  1Q7Y U;  1ZSZ B;  2GQI A;  2KQW A;  2QA4 A;  2DRM A;  3GF5 A;  2LMJ A;  3ZFJ A;  4C5H A;  3FB9 A;  4M75 G;  4ELZ C;  3GBQ A;  4EMK B;  3RNJ A;  3G4S A;  2DEU A;  3OMG A;  1NE8 A;  3VS5 A;  1VYV A;  4J9I A;  4FT4 A;  3OS1 A;  2ZPI B;  2OJ2 A;  2Y4X A;  2RQU A;  4OB2 B;  2D8H A;  1JJ2 P;  1U06 A;  2EBP A;  1ZA1 B;  2SEM A;  2LNH B;  4IUV A;  4OML A;  2A08 A;  3CC4 T;  3REB B;  4RMO A;  1ZSG A;  1ZX6 A;  5CVI A;  2J6K A;  1H92 A;  2VVK A;  1SKU B;  5L23 A;  4JRQ A;  2L5Q A;  2DJZ A;  3RKW A;  1D3B A;  3URG A;  4JLI A;  1R0C B;  2JT4 A;  3PGG A;  2D0N A;  2K3X A;  1ZUY A;  2M02 A;  2IIM A;  1NEG A;  4AFS C;  2MWO A;  1QW1 A;  2QQR A;  4OMN A;  2DXB A;  3WXM B;  3INZ A;  2OX7 A;  1X01 A;  3GP8 A;  1Q86 C;  1KD1 U;  3O5Z A;  2PUO B;  3CPW P;  1Y96 B;  3MO8 A;  4RTU A;  2J6O A;  1R0B G;  2KVQ G;  4PJO B;  4BDZ A;  4JS5 A;  4NL3 A;  2DFU A;  2KK4 A;  4M77 E;  1PRL C;  1QCO A;  2HQH A;  1UTI A;  3EH1 A;  2BE7 D;  2NUZ A;  4ESR A;  2DLP A;  4LD6 A;  3CD6 A;  4XU0 A;  2VV5 A;  3M9Q A;  3JCM h;  2V1Q A;  3CMA T;  5L8R E;  4OGE A;  2OI3 A;  1EFN A;  1UFF A;  2JUF A;  2I2L A;  1NPP A;  4PJO E;  2RM4 A;  3E9G A;  4GY5 A;  1K9A A;  3M0S A;  1TU0 B;  2RHY A;  2LDM A;  5IH2 A;  1UHC A;  2LCC A;  1G3S A;  3JCM d;  1VQK T;  2CH4 W;  5GAN 3;  5FU6 B;  2K2V A;  1M8V A;  2QA4 Q;  4KGX B;  1K9M C;  1IHV A;  2YLB A;  1IB8 A;  2E70 A;  3NTK A;  4RTV A;  1AWX A;  3QWY A;  2EQI A;  2DPP B;  4LD9 K;  2R57 A;  2EYX A;  4JDS A;  5GAO q;  4FM4 B;  3PFS A;  2QXF A;  1KQS A;  2X4X A;  1ACM B;  3EAE A;  1EX4 A;  3OS2 A;  4EDU A;  2E64 A;  1TXQ A;  1X2Q A;  5CKE A;  2ZPH B;  2RHI A;  1V1C A;  2DET A;  1QVG S;  1UEB A;  1VQ5 Q;  1QQJ A;  4BUG A;  4FSX A;  2K2M A;  4F14 A;  3JCM e;  2XHC A;  1NPR A;  1FMW A;  3CCM A;  5CAI A;  2CSQ A;  1QP3 A;  3E1S A;  5GMK h;  1D1A A;  1W2B A;  4TVR A;  2AZS A;  3OYI A;  4X34 A;  1M9S A;  3RDV A;  3CXC A;  1ZBJ A;  1NJI U;  3MP8 A;  4DOV A;  4HA8 A;  3EFO A;  1YNZ A;  4CRI A;  2QGG A;  1A0N B;  5C0M A;  1M30 A;  3QDR B;  1QVP A;  3LGL A;  3CCQ Q;  2KYM A;  3CCV Q;  1PSF A;  3MEA A;  1YJ9 T;  3RUX A;  3QWX X;  2G6F X;  1LJO A;  3I9Q A;  2GCX A;  2JXB A;  1VQ8 A;  1M3C A;  4O5V A;  1VQ9 A;  1K1Z A;  2CUD A;  3Q1J A;  4RTX A;  4CI0 C;  3MHX A;  4FYX B;  1O9S A;  2P84 A;  4LN2 A;  3QKJ A;  2GTO A;  4N4H A;  3QPH A;  4RG2 A;  3NTI A;  3ZEH A;  3U23 A;  1B7T A;  1WJQ A;  2RK1 A;  3TCJ A;  2W0Z A;  1M1K C;  2L3P A;  1XNI A;  4E7H A;  2YHT A;  1GBR A;  4K11 A;  2K7A A;  2JS2 A;  5I22 A;  2KMT A;  3PMT A;  1WXU A;  3NHN A;  3CCL A;  4BI4 A;  3HRS A;  1T0J A;  4ATO A;  2EQJ A;  2KNB B;  1SRM A;  1AWW A;  2QEX T;  1FMK A;  3NPF A;  2KYB A;  4MDW A;  1YJN Q;  5GAN 2;  4M77 G;  3EFR A;  4IIM A;  4M78 D;  4RG8 A;  2DKG A;  1GRI A;  2VYT A;  2LQK A;  1N27 A;  1XOV A;  2NUT A;  4C8Q G;  2OTL A;  5A0D A;  1VQN Q;  3CCJ A;  1RAD B;  4DEY A;  4PJO G;  2FPE A;  2D8J A;  2AHJ B;  2DBK A;  4RTT A;  1YWP A;  2CZ1 B;  1X43 A;  4J9C A;  2OTJ T;  4FYV B;  1ZQ1 A;  3MJX A;  2EGC A;  3CC7 T;  4ZGE B;  2EGE A;  4KUL A;  3MET A;  1Q81 R;  1H3H A;  2XU8 A;  4MZT A;  1ZUK A;  4IKF A;  1D1C A;  2XIC A;  1NYF A;  4LDW A;  5IN1 A;  3X26 B;  2KEA A;  5HY6 A;  3JB9 D;  4OMF B;  5GMK j;  2QI2 A;  3I56 A;  4M78 C;  1YBY A;  1WQ7 A;  2D1X A;  1VQ9 Q;  1GCQ C;  2LTO A;  1YN8 A;  1KHC A;  4M7D D;  1WHG A;  1JXO A;  1JBM A;  3EFO B;  1KC8 C;  1PRM C;  3QZ9 B;  2E3I A;  3TU4 K;  3GNG A;  2RK2 A;  3JB9 I;  5GAN 8;  1RAI B;  2X3X D;  2LJ1 A;  3CME Q;  2CP6 A;  4XU3 A;  5ECA A;  3QII A;  3H6Z A;  4R56 A;  1ARK A;  4JRI A;  2J7I A;  4C0D C;  1U5S A;  4AMC A;  1K0S A;  1ZBX A;  3P8H A;  3HFN A;  4HKE A;  2CT3 A;  3CCL Q;  4E7K A;  4BE2 A;  5KYX B;  3OB9 A;  3OBW A;  9ATC B;  2RI3 A;  1OQK A;  3EHQ A;  2MYS A;  2P0Q A;  2EYY A;  2PVD B;  4HCC A;  4HVV A;  2J6F A;  1OYX A;  4M77 F;  4MZP A;  2FPD A;  3CC2 T;  1X75 C;  2DD4 A;  3A8O B;  1BB9 A;  1MMA A;  3EH2 A;  4F04 B;  3QDF A;  2E4H A;  2PUK B;  3HHT B;  5KYY B;  2LT1 A;  1M90 C;  2CS7 A;  3L2U A;  3OYD A;  1C6V X;  2YLC A;  4BD3 A;  1N8R U;  4XU1 A;  4PJO F;  4M7D C;  2COZ A;  2QGF B;  4M7D A;  2X51 A;  3ER0 A;  2HL5 C;  3GPL A;  3M0Q A;  2KSS A;  2SRC A;  5GAO m;  1YIJ T;  3JSC A;  2DYB A;  4EPC A;  2QYZ A;  3MPU B;  1Q82 R;  5CKF A;  1I0C A;  2CZ0 B;  3EG0 A;  1ZUU A;  2AKK A;  3C0C A;  1SHF A;  3BW1 A;  1UGP B;  3M57 A;  1B3Q A;  1PD1 A;  1D0Z A;  1SSF A;  1ZSZ A;  4L6V 5;  2KI7 A;  3C95 A;  3A8G B;  2J06 A;  4B6M A;  4EMK A;  4LDY A;  3X20 B;  4PJJ A;  2YRD A;  1MUZ A;  4OB3 B;  2D6F A;  2XDB A;  1K73 C;  5GAN 6;  2F5T X;  3L2V A;  4ME7 A;  1AHJ B;  4MMK A;  4A4G A;  4XTX A;  2RD1 A;  4PFZ A;  4CC7 A;  1N6A A;  2PVO B;  1M2V B;  4C92 B;  2ED0 A;  3V8J A;  2ESW A;  1TWB A;  1SF9 A;  3E9F A;  1WFW A;  5KCO A;  2R58 A;  3M0U A;  2AT1 B;  5HK0 A;  1OEB A;  1VYU A;  4JJD A;  2QG9 B;  1V29 B;  4ZN3 A;  1RLP C;  2DF6 A;  4C0Z A;  4HT9 A;  1VQ7 Q;  4C92 E;  4M78 B;  3UPU A;  1SRL A;  5LJ5 g;  1OU8 A;  3ULR B;  1K0X A;  2JMC A;  3O8V A;  1Y96 A;  2DL8 A;  3RES A;  4JZ3 A;  3A5Z B;  2H3E B;  2XID A;  3OY9 A;  1PCX A;  2MPX C;  2ZPG B;  1FXX A;  4BI3 A;  2QDY B;  3QG1 A;  2DO3 A;  3GLX A;  3CCR A;  3LYI A;  4N4I A;  4PK4 A;  3OYF A;  5CQX A;  1QWE A;  4KUI A;  3WVD B;  2JJ9 A;  3CBP A;  4RTW A;  1YIT Q;  3V7R A;  4M78 E;  5D6W A;  3X24 B;  3IQL A;  4XQ3 A;  3LH0 A;  4C0D B;  4M7A D;  1U1S A;  2NYS A;  3OYY A;  3QO3 A;  4RKU E;  2KRN A;  3JB9 J;  5KCH A;  4RTZ A;  4V2S A;  4ZTJ A;  2RHX A;  2FZC B;  1AVZ C;  1YJW A;  2YUP A;  2L3S A;  1UE9 A;  3G71 A;  2P0K A;  2KRS A;  4HCB A;  2EGA A;  5CKH A;  5CCA A;  2HKN A;  4J7F A;  1VQL A;  2FZK B;  3I55 Q;  1G5V A;  1YI2 T;  2QAZ A;  1QWF A;  2OAW A;  2HEQ A;  4OMM A;  4X9D A;  2L8D A;  2KRO A;  3L42 A;  1KQS S;  5FLX E;  5I21 A;  4RUG A;  2I0N A;  3X28 B;  1WX6 A;  2ZZD A;  2KR3 A;  2CUB A;  1P92 A;  3OYB A;  5CIU A;  2P0P A;  3RBB B;  5LL6 S;  1KHI A;  5LJ3 h;  1BI2 A;  4M7A C;  4II1 A;  1G3Y A;  4L59 A;  4M7D E;  5GAM h;  1Q7Y C;  3M56 A;  1NEB A;  1W2B S;  1S72 Q;  2YSQ A;  2RNA A;  4KT0 E;  2K9G A;  1JXM A;  5C6S A;  3M59 A;  4KUD K;  4GLK A;  3CXC S;  3SD4 A;  2XI9 A;  3V7S A;  2CP0 A;  4PFP A;  5LJ3 d;  5IXB A;  3UWN A;  5A0G A;  1PC0 A;  2GFA A;  5CQY A;  1UGR B;  5GAM d;  1RAG B;  2KRM A;  1HK9 A;  1MMD A;  1CKB A;  5I2M A;  2EYW A;  4XTU A;  1UUE A;  1E7O A;  2EPD A;  2F2W A;  3JCM b;  4AFQ C;  1PNJ A;  1UG1 A;  3I35 A;  2JVV A;  2DER A;  1YI2 Q;  2QA4 T;  2Y90 A;  1BBZ A;  1VQ6 Q;  4LNP A;  5GAN h;  2RO0 A;  3ZBD A;  1KD1 C;  2V8I A;  1B34 B;  4ZTF A;  3J80 E;  2FO0 A;  1HYO A;  2LJ0 A;  4DQ2 A;  5LJ3 e;  3VJP A;  2RB6 A;  1WZO A;  3M0T A;  4A54 A;  3G71 Q;  3EG9 A;  4A4H A;  2F1L A;  2FZG B;  5GAM e;  5GAN d;  3CMA A;  3CCS Q;  1MND A;  3TRE A;  2D0Q B;  3M4Y A;  1NLO C;  3AT1 B;  2HAX A;  1OU9 A;  1VQO Q;  1VQ5 T;  2XD0 A;  3CCE Q;  4JJC A;  1IXD A;  2M51 A;  3VKI A;  4J9B A;  4JZ4 A;  6AT1 B;  1CKA A;  5FRO A;  3TSW A;  2DMO A;  2B8A A;  3S6W A;  2ZAE A;  4J6W A;  1WDX A;  2JZ2 A;  3ME9 A;  3MCA B;  4IUT A;  2DVE A;  1VQK A;  2LQ8 A;  2QTX A;  1I1J A;  4F7U A;  3HKS A;  2HBP A;  3PVL A;  2R5A A;  1VQP A;  1I8F A;  1QVF A;  2PTK A;  3QJY A;  1WHJ A;  2ZPF B;  3FC3 A;  3DB4 A;  3CCQ T;  3SHW A;  5GAN e;  4FIB A;  1WJS A;  4M78 G;  3CCV T;  3A8M B;  3G4S Q;  4HVU A;  2EFI A;  1TSF A;  3M55 A;  1NG2 A;  1H3Z A;  1PM3 A;  2YT6 A;  1WHM A;  1K8A R;  4C5E A;  2DIQ A;  3VRY A;  1BI3 A;  1EIF A;  5GAM f;  4AFZ C;  2HMA A;  1E6H A;  2DL4 A;  4OMP A;  5LJ3 j;  1YCY A;  1AD5 A;  1BIB A;  5CO7 A;  4M7A B;  5GAM j;  4BE0 A;  2E12 A;  1PKT A;  2LQW A;  5FU7 C;  2GGR A;  2HQX A; 
#chains in the Genus database with same CATH homology
 1QKX A;  4J9E A;  2RMO A;  5FWB A;  4CC4 B;  1H3H A;  1PWT A;  2B86 A;  1AZE A;  1ZUK A;  2CDT A;  1MV0 B;  1NYF A;  1QLY A;  3H0F A;  2EKH A;  4J9G A;  4LUE A;  1JO8 A;  2KEA A;  1BK2 A;  1M27 C;  2YDL A;  2CH4 A;  2RN8 A;  4DEX A;  4Y92 A;  2O9S A;  1J3T A;  2ROL A;  2D1X A;  4GBQ A;  2KXD A;  2RQT A;  1GCQ C;  3A98 A;  2JM9 A;  4X1V A;  1YN8 A;  1QKW A;  2L3Q A;  1WYX A;  2PZ1 A;  1AZG B;  1JXO A;  5IHK A;  1JQQ A;  1TG0 A;  1PRM C;  3TSZ A;  2KT1 A;  1ABO A;  1SPK A;  4HVW A;  1U3O A;  2X3X D;  4IIO A;  2LJ1 A;  5ECA A;  2RQR A;  2PNI A;  4AFU C;  1OPK A;  3VS4 A;  1VYT A;  4J9H A;  4Z89 A;  1ARK A;  4JPB W;  3LH5 A;  1UJ0 A;  1ABQ A;  3PE0 A;  1PHT A;  1GFD A;  2XMF A;  3SEM A;  2HCK A;  2JW4 A;  3H0H A;  2J7I A;  3FJ5 A;  1U5S A;  2JMA A;  1K0S A;  2A37 A;  2CT3 A;  1HJD A;  2MOX A;  4WCI A;  2ROT A;  3VRZ A;  2AK5 A;  3REA B;  1FYN A;  3VS3 A;  1W70 A;  3EHQ A;  2A36 A;  2KGT A;  3CQT A;  2EYY A;  1SEM A;  2DNU A;  4HVV A;  2J6F A;  3KFV A;  2FPD A;  1CSK A;  4JJB A;  1WLP B;  2JTE A;  4R0K A;  1GBQ A;  1BB9 A;  3M0P A;  2LZ6 B;  2YUO A;  1W6X A;  3R6N A;  3VS7 A;  4HXJ A;  1UEC A;  1AEY A;  1RUW A;  4F16 A;  5IHN A;  1WXT A;  2K6D A;  1LCK A;  3M0Q A;  2SRC A;  1H8K A;  4QT7 A;  3I5R A;  1RI9 A;  2DYB A;  2FEI A;  1VA7 A;  3NGP A;  1G83 A;  1I0C A;  3EG0 A;  1ZUU A;  1RLQ C;  2AKK A;  1SSH A;  3C0C A;  1SHF A;  3UF4 A;  1B3Q A;  1ZLM A;  1X6B A;  5GJW B;  4AG1 C;  2DL7 A;  4D8D A;  4Z88 A;  1NYG A;  2CT4 A;  2J06 A;  1Z9Z A;  2YUQ A;  4HCK A;  3UA7 A;  1MUZ A;  5FWC A;  2H8H A;  2DVJ A;  4LUD A;  1Z9Q A;  2ECZ A;  1TUD A;  2GTJ A;  2X3W D;  2GQI A;  2K3B A;  2MIO A;  2DRM A;  5EC7 A;  1GL5 A;  2LMJ A;  3GBQ A;  4CC7 A;  3RNJ A;  4GLM A;  1WXB A;  3VS5 A;  2ED0 A;  1NLP C;  1VYV A;  4J9I A;  2C0T A;  2ABL A;  1E6G A;  2ESW A;  2OJ2 A;  2RQU A;  3VS2 A;  2D8H A;  1U06 A;  1HD3 A;  3EGU A;  3PVQ A;  2EBP A;  4AG2 C;  1WFW A;  2SEM A;  2LNH B;  2W10 A;  1GCQ A;  3M0U A;  4OML A;  1UDL A;  2J05 A;  2A08 A;  2KXC A;  2A28 A;  3REB B;  1OEB A;  1VYU A;  4JJD A;  2EYZ A;  1ZSG A;  1ZX6 A;  2M0Y A;  2J6K A;  2GNC A;  1RLP C;  2DF6 A;  2VVK A;  1H92 A;  3EHR A;  5L23 A;  4LE9 A;  2VWF A;  1SRL A;  3I5S A;  2JT4 A;  2D0N A;  3ULR B;  2RF0 A;  3H0I A;  2JMC A;  1K0X A;  1PKS A;  2DL8 A;  2DX1 A;  2O88 A;  1ZUY A;  4JZ3 A;  2IIM A;  1NEG A;  4AFS C;  4OMN A;  1OPL A;  2GBQ A;  4ORZ A;  3UA6 A;  4A63 B;  3O5Z A;  4OMO A;  1K76 A;  3EG1 A;  2J6O A;  2DL5 A;  4RTU A;  1QWE A;  4RTW A;  1OOT A;  4J9F A;  2LQN A;  1UJY A;  1JEG A;  3IQL A;  1PRL C;  4FSS A;  1SHG A;  1UTI A;  3EG2 A;  2BTT A;  2NUZ A;  4ESR A;  2DLP A;  2KRN A;  1GFC A;  2HBW A;  4RTZ A;  3UAT A;  2V1Q A;  1YP5 A;  2OI3 A;  1EFN A;  1UFF A;  2F2X A;  1AVZ C;  2YUP A;  2L3S A;  1QCF A;  1UE9 A;  2KRS A;  1X6G A;  2EGA A;  2EW3 A;  1GCP A;  1K9A A;  3M0S A;  2LCS A;  1N5Z A;  2DM1 A;  5IH2 A;  1I07 A;  4D8K A;  2E5K A;  5GJV B;  1UHC A;  2CRE A;  2O9V A;  1QWF A;  2OAW A;  2HEQ A;  4OMM A;  2KRO A;  1T3L A;  2CH4 W;  1JU5 C;  1UGV A;  1M3A A;  4RUG A;  2I0N A;  1WX6 A;  2YUN A;  2KR3 A;  1HSQ A;  2HDA A;  2C0O A;  2CUB A;  3THK A;  2LP5 A;  4RTV A;  1AWX A;  3RBB B;  3QWY A;  2EQI A;  2EYX A;  1KIK A;  1X69 A;  1S1N A;  3H41 A;  2DE0 X;  3EG3 A;  1X2K A;  1KSW A;  1NEB A;  2L2P A;  2JM8 A;  2YSQ A;  1BU1 A;  2AKL A;  2RNA A;  1X2Q A;  2HSP A;  2K9G A;  1JXM A;  5FW9 A;  2V1R A;  2DBM A;  1V1C A;  1AWO A;  1G2B A;  1UHF A;  1KJW A;  5IXB A;  2K2M A;  4F14 A;  1K4U S;  1Y0M A;  2FG0 A;  4Z8A A;  1AWJ A;  2K79 A;  2CSQ A;  2KRM A;  1T0H A;  4OMQ A;  1CKB A;  2EYW A;  2DIL A;  1UUE A;  1E7O A;  2EPD A;  2F2W A;  4AFQ C;  1Y57 A;  2AZS A;  1PNJ A;  2DL3 A;  1UG1 A;  3I35 A;  2DJQ A;  2LJ3 A;  1KFZ A;  2NWM A;  4CC3 A;  1YWO A;  1ZBJ A;  1TUC A;  1BBZ A;  4LNP A;  1YNZ A;  5IXF A;  2EVR A;  2QDL A;  1A0N B;  4F17 A;  2JS0 A;  1M30 A;  5I11 A;  2KYM A;  4KRT A;  1AOJ A;  2FRY A;  2FO0 A;  5IHI A;  2LJ0 A;  3QWX X;  2G6F X;  3M0T A;  3VS1 A;  1IO6 A;  3I9Q A;  2JXB A;  1MV3 A;  2FPF A;  2ENM A;  2MCN A;  2O2O A;  1M3C A;  5HCK A;  2LX7 A;  1NLO C;  2O31 A;  1M3B A;  1K1Z A;  2KBT A;  2CUD A;  4RTX A;  2DA9 A;  2BZ8 A;  4JJC A;  4LN2 A;  2M51 A;  4J9B A;  4JZ4 A;  1CKA A;  2GTO A;  1B07 A;  3TSW A;  4EIK A;  2ED1 A;  2F2V A;  2FRW A;  2DMO A;  3U23 A;  1WDX A;  2W0Z A;  2C0I A;  4J9D A;  1WIE A;  2L3P A;  1I1J A;  1GBR A;  4K11 A;  2K7A A;  1OV3 A;  2JS2 A;  2AZV A;  1NM7 A;  3JV3 A;  3PVL A;  2BZY A;  5I22 A;  1WXU A;  3NHN A;  1T3S A;  2PTK A;  1T0J A;  4M4Z A;  2KNB B;  1SRM A;  3TVT A;  3SHW A;  1AWW A;  4ZNX A;  1FMK A;  3NPF A;  1M8M A;  2KYB A;  4IIM A;  4CC2 A;  4HVU A;  2L0A A;  1GRI A;  2CSI A;  4RTY A;  2KT8 A;  1NG2 A;  2YT6 A;  1WI7 A;  1XOV A;  2RPN A;  3VRY A;  3VS6 A;  2RQW A;  2VKN A;  2DRK A;  4AFZ C;  2BZX A;  4E6R A;  3M0R A;  1E6H A;  2DL4 A;  4OMP A;  4DEY A;  2FPE A;  1WA7 A;  1AD5 A;  2D8J A;  2DBK A;  4RTT A;  2P4R A;  1YCS B;  1YWP A;  3VS0 A;  1X43 A;  2KE9 A;  1PKT A;  4J9C A;  2LQW A;  1X27 A;  3ZL7 C;  2GGR A;  3NMZ C;  2EGC A;  2RQV A;  2EGE A;  1W1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...