1MV3A

Nmr structure of the tumor suppressor bin1: alternative splicing in melanoma and interaction with c-myc
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
213
structure length
213
Chain Sequence
b'DGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILSLFEDTFVPEISVTTPSQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKKLEKCRGVFPENFTERVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myc box dependent interacting protein 1
molecule tags Endocytosis/exocytosis
source organism Homo sapiens
publication title A structure-based model of the c-Myc/Bin1 protein interaction shows alternative splicing of Bin1 and c-Myc phosphorylation are key binding determinants.
pubmed doi rcsb
total genus 15
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2002-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1mv3A01
3C0CA 2ECZA 2F2WA 2EPDA 2CUDA 2RQVA 1UG1A 2AKKA 2L3SA 2HDAA 1VYTA 3M0PA 1GBQA 2FEIA 4R0KA 2AK5A 2W0ZA 2LJ3A 5HCKA 2L0AA 3REBB 3I35A 2BZYA 1E6HA 1AZGB 3U23A 2P4RA 1S1NA 2DNUA 4OMQA 1I1JA 2J7IA 4Y92A 1WA7A 2K2MA 4D8KA 2OAWA 1UGVA 1PKSA 2JMAA 5IXFA 1K4US 1AVZC 2JT4A 2JTEA 1TG0A 1UECA 1YP5A 2KROA 4RTTA 3RNJA 2HCKA 1ZUUA 2X3XD 1V1CA 2DYBA 3VS0A 2EKHA 1AEYA 2J05A 1X27A 2VKNA 2RQRA 2EW3A 1Y57A 4LE9A 2EBPA 4AFZC 1AZEA 2CT4A 3UA6A 2DL8A 2YT6A 3EHQA 3UATA 1KIKA 1NLOC 1ZX6A 4AFSC 2RN8A 2M51A 1ABQA 2K3BA 1RI9A 4IIOA 1K1ZA 1ZUKA 1GCPA 1JU5C 2JMCA 5FW9A 1RUWA 2MCNA 2JS0A 1T3LA 1OPKA 3I5SA 2LJ1A 5IHNA 4JJBA 4E6RA 5L23A 2JXBA 2J06A 4ORZA 2DX1A 2XMFA 3A98A 4CC2A 1IO6A 1K9AA 3O5ZA 5IH2A 2GBQA 2B86A 2C0OA 2CT3A 2EQIA 2K7AA 4OMLA 1AD5A 2ED1A 1MUZA 2YUOA 4D8DA 3NHNA 2KRNA 2AZSA 2FG0A 4JJDA 2DL4A 1QLYA 1UUEA 1M3AA 2KT1A 1SHGA 4Z88A 2W10A 3LH5A 2OI3A 2YDLA 3VS3A 1PKTA 2FRWA 1X6BA 4RTVA 2GNCA 1YN8A 2EYZA 1NYGA 2FO0A 1SRLA 2RMOA 1UHCA 2D8JA 4X1VA 4RTXA 4HVWA 2LMJA 2H8HA 1NM7A 2DA9A 1QWEA 2V1QA 1RLPC 3I9QA 4RTUA 4F17A 3PE0A 3JV3A 2RQUA 4IIMA 1UHFA 5IHKA 4JPBW 1E7OA 2QDLA 2MIOA 4CC4B 2SEMA 4RTZA 3KFVA 4F16A 2CUBA 1WXUA 4HVUA 2J6OA 4HVVA 1QCFA 2RF0A 3SEMA 2DMOA 2PNIA 1X2KA 2DJQA 2DL3A 1H8KA 2LNHB 2D1XA 1M27C 1PNJA 4JJCA 1K0SA 1M8MA 2ROTA 2VVKA 3VS5A 2CSIA 4WCIA 4QT7A 2ROLA 2JW4A 1U3OA 1ABOA 4JZ3A 2F2VA 4F14A 1WYXA 2DRMA 1Z9QA 3EGUA 1KSWA 2KRMA 4A63B 1Y0MA 1GFCA 2DBMA 2C0TA 2GQIA 1HJDA 3VS1A 1AWOA 2JM8A 2JS2A 2EYXA 4Z8AA 4DEXA 2KXCA 2LQNA 1I0CA 1X69A 1YWPA 2HEQA 4J9IA 3SHWA 1VYUA 2YUNA 4J9BA 3EG1A 4LUEA 2HSPA 2VWFA 4GBQA 2JM9A 1UTIA 2OJ2A 3UA7A 4J9HA 4J9FA 4EIKA 1TUCA 2DVJA 2KRSA 3M0TA 1UE9A 1G2BA 2L3QA 1LCKA 1NG2A 2DILA 2A28A 2KGTA 1ARKA 2DRKA 3M0RA 1B3QA 1YNZA 2DL5A 1GCQC 2KNBB 2ABLA 4RUGA 1QKXA 1UJ0A 4RTWA 2YSQA 4J9EA 1JO8A 1M3BA 2KR3A 3EG0A 2X3WD 2KE9A 1FMKA 1WDXA 1WXTA 1GRIA 3VS6A 5EC7A 2KYMA 1YCSB 3I5RA 3REAB 2F2XA 1PRLC 3VRYA 2J6KA 2KT8A 1U5SA 1SPKA 2O31A 1I07A 1AWWA 1T0HA 2KEAA 2LCSA 4GLMA 3TVTA 4J9DA 2A08A 4CC7A 2LJ0A 3NGPA 1BB9A 4Z89A 1PWTA 1RLQC 1ZSGA 3H0FA 2GTJA 1BBZA 2FPDA 2M0YA 2DM1A 2EGAA 2EYWA 1OPLA 1WI7A 2GGRA 4OMPA 4FSSA 4KRTA 2O9VA 1X6GA 1UJYA 1AWXA 4HCKA 3EG3A 1X2QA 3NPFA 2ENMA 1PRMC 1U06A 3PVLA 2IIMA 2CDTA 2DL7A 2HBWA 2EGCA 1A0NB 2K6DA 1T0JA 1WIEA 2EVRA 5IXBA 1AWJA 2EYYA 1NEGA 2LQWA 1EFNA 2BZ8A 1VYVA 2DBKA 1ZUYA 3CQTA 2E5KA 1XOVA 3R6NA 4AG2C 2D8HA 2AZVA 4M4ZA 1MV0B 1CKAA 2RQWA 1K0XA 3M0UA 2AKLA 1GBRA 2NWMA 4K11A 3THKA 3QWYA 3EG2A 2V1RA 1QKWA 1WX6A 4RTYA 2G6FX 1GFDA 4OMMA 1FYNA 2EGEA 2O88A 3RBBB 1SHFA 1ZLMA 2CH4A 1GCQA 3VS2A 1CSKA 2KBTA 2FRYA 3VS4A 2GTOA 4AFQC 4OMNA 1OEBA 1ZBJA 4ESRA 1W70A 2O9SA 2D0NA 2ED0A 2L3PA 1OOTA 2A36A 2ESWA 3GBQA 3ULRB 3UF4A 4LNPA 2DF6A 1WXBA 2K79A 3FJ5A 2FPEA 5FWCA 1MV3A 1Z9ZA 1JEGA 3ZL7C 1M30A 2SRCA 1SEMA 2CSQA 1HSQA 1UFFA 2K9GA 1KJWA 1NLPC 4JZ4A 2L2PA 1K76A 1B07A 2KYBA 1NEBA 2C0IA 1JXOA 4LN2A 3M0SA 2LZ6B 2CREA 1VA7A 2LX7A 2PZ1A 3H0HA 1E6GA 1T3SA 2RQTA 4J9CA 1X43A 1G83A 4AFUC 5I22A 4ZNXA 3TSWA 2LP5A 1KFZA 1YWOA 1H92A 2BZXA 3TSZA 1H3HA 3PVQA 1M3CA 2RPNA 1OV3A 5I11A 3EHRA 2J6FA 2YUQA 1JXMA 2CH4W 2O2OA 4CC3A 5ECAA 1BK2A 2NUZA 4LUDA 2KXDA 3M0QA 1J3TA 1HD3A 1NYFA 1UDLA 2A37A 1SRMA 5GJWB 1QWFA 1SSHA 2DLPA 1GL5A 3VS7A 3VRZA 1W1FA 3IQLA 1CKBA 2BTTA 4DEYA 5FWBA 1BU1A 2RNAA 1WFWA 2I0NA 5GJVB 2DE0X 1PHTA 3QWXX 4OMOA 4HXJA 3NMZC 2PTKA 1JQQA 4J9GA 5IHIA 1W6XA 1TUDA 1AOJA 1WLPB 2MOXA 3H0IA 2YUPA 3H41A 2FPFA 4AG1C 1N5ZA
chains in the Genus database with same CATH superfamily
4O6JA 2ECZA 2HDAA 3URGA 4R0KA 4M7DA 5HCKA 3CMAQ 3I35A 2BZYA 4M7AG 3DKMA 2P4RA 1H3ZA 3OS2A 2CZ6B 2QGFB 4XTXA 4D8KA 2OAWA 1PD1A 4XTWA 3L2VA 2JMAA 1I4K1 3OS5A 2EWNA 2JTEA 3CCSA 1UECA 4J7FA 3R6OA 3OS1A 2OTJA 2ZPEB 2X3XD 2DYBA 1LJOA 1AEYA 5J39A 3UT1A 1PC0A 2CP7A 1KQ2A 3OY9A 3NFCA 2M9UA 2JN0A 5CIUA 2M51A 2D9TA 2M1HA 3M56A 3HFNA 1KD1C 5CVIA 4M78D 3I5SA 2LJ1A 2J06A 4WF2A 2DX1A 1QVGS 2OTLA 1IO6A 5LJ5j 2RK2A 2GBQA 1OX8A 3QO3A 1V29B 1LOJA 2B86A 2C0OA 1VQNQ 4AMCA 2O4XB 5KYWA 1R0CB 5A2QE 5GMKh 2K7AA 2E10A 3KBGA 5C6SA 5LJ5d 1NPPA 3G6EA 2EFIA 2RI3A 2KRNA 2AZSA 1RAHB 2FG0A 1YHQQ 4P5NA 4DBRA 4M7DC 1QLYA 1B34A 2E5QA 1TWBA 2OI3A 3VS3A 2LNVA 3ME9A 1PCXA 2P0KA 1WZOA 2GNCA 5GAN5 1OZ2A 3ER0A 3M58A 1NYGA 1VQOA 3JCMg 1SRLA 1VQ5T 1YJ9Q 2KQWA 4E7JA 4N4GA 3OSSC 1JRIA 5FU7B 1QWEA 3AHUA 2L3RA 4C92D 3PE0A 3JV3A 1G3SA 4ELZC 5IHKA 5FROA 5GANf 4HCZA 1PSFA 2RJEA 1VQKT 4PKCC 4CC4B 1G3YA 3A8HB 1OU8A 1U1SA 4HVUA 3PIOA 5A0LA 2OTLT 3OS0A 2VYTA 1W2BS 1X2KA 5KYUB 2HL5C 3L2WA 1HXDA 3H8ZA 1R0BG 1SKUB 1YIJT 4M78B 5GAN8 1YJ9A 4C0GA 2VVKA 2KDSA 3VS5A 3HP9A 4WCIA 4DOWA 2ROLA 5D6WA 2F5TX 3OBYA 3EGDA 1ABOA 1EZZB 4JDSA 2CKKA 4ANJA 1Y96A 4JS4A 1FMWA 1XQHA 1KSWA 2KRMA 4M7DG 1RAGB 4A4EA 2C0TA 3JCMQ 4M77B 1Q7YU 4VUBA 4Z8AA 2EJGA 2EYXA 4E47A 3L2UA 2KXCA 1I0CA 4C92E 1X69A 1ZSZB 3EG1A 4BACA 2VWFA 4GBQA 2XKOC 1KD1R 2M02A 4PL6A 2E70A 4EIKA 1Q81R 1BKBA 2CP2A 4E7LA 2GQVA 1G2BA 4EMKC 1LCKA 1X6OA 4LDUA 3OYBA 5FLXE 3PT9A 1UGSB 2HL3A 2KNBB 4C5GA 1QKXA 2ZCFB 4PJNA 3Q1JA 4CRIA 2Y4XA 4OB3B 4X34A 4FCYA 2XU8A 1YCSB 3REAB 4A4GA 5FU6C 3RDVA 5LJ5g 1U5SA 2O31A 1I07A 1AWWA 4FYVB 1T0HA 3OYDA 3PGGA 4JRIA 1VQPQ 4J9DA 2FZGB 2LJ0A 4FW2A 4II1A 4Z89A 1VQ4T 1BCMA 5HY6A 4E7HA 1N8RC 3MP6A 2FZKB 1WHHA 2GGRA 3J7AF 2QAZA 1YITQ 2CP3A 6AT1B 3CCLT 3RKWA 1N6AA 2AT1B 1Q82C 3L2ZA 5GAMf 2IIMA 1ZSZA 3MP1A 3I56A 2CDTA 2DXCA 2HBWA 4OGEA 3G1JA 3GP8A 3QUIA 2LT4A 2VC8A 1OYXA 5IXBA 3HFOA 1FX7A 3A8GB 1RAFB 2BZ8A 1VYVA 3CQTA 3NTIA 2BE7D 4AG2C 5LJ3d 4M4ZA 3JB9F 4ZGJB 1XJWB 1VQ7A 3NTHA 1WHLA 2RH2A 2ZPGB 5GMKm 1NE8A 3CPWP 4F7UG 2V1RA 1QKWA 1YHQT 1GFDA 1FYNA 3JCMd 1TXQA 1ZLMA 4M78A 4BI8B 5I2MA 5DLOA 2ZPHB 2E6NA 2RHYA 3VS4A 1VQLQ 1VUBA 4OMNA 1RI0A 3RERA 2O9SA 3VUBA 1YI2T 3RMSA 2ED0A 2A36A 3ULRB 2D6FA 4LNPA 2DF6A 2K79A 3CMEQ 4C92F 5GAOq 4C92C 4MZPA 1TUGB 2PU9B 5A0GA 3RIRA 2EJFA 1K76A 2XK0A 2X35A 8ATCB 2QYZA 1JXOA 1EIFA 3CCET 1BYMA 3MKDA 2LZ6B 2CREA 1S72A 2LX7A 2L89A 2HSEB 3H0HA 1E6GA 3WVEB 4J9CA 2RJFA 4GLKA 4AFUC 1YJWT 3O8VA 1P92A 3TSZA 2A3LA 3OB9A 2KY9A 2DFUA 4JLGA 3L42A 3JCMX 2YRCA 4DBHA 5GAMh 1LNXA 3CCUQ 3C95A 5ECAA 3JCMf 4HA8A 4LXCA 1YI2A 3OYAA 2A37A 1SRMA 5GJWB 4UC4A 5GAOm 1VQPA 4L59A 3INZA 4RCBA 3VS7A 3VRZA 1Q82R 1K9MU 3AT1B 1CKBA 1KG1A 1M2VB 3CC2A 2EQJA 5GJVB 1PHTA 3CCSQ 4M78C 2CP5A 4OMOA 5LJ5e 4PJOF 2PTKA 1YFNA 1F1BB 1BIAA 1WLPB 1VQ6T 3CC4Q 5EG2A 4KUIA 4AG1C 3JSCA 4F04B 4A4FA 3M53A 3C0CA 1XNIA 2WSCE 2IG0A 1JJ2A 1NBEB 2AKKA 1VYTA 2OTLQ 3M0PA 1GBQA 3FC3A 1TU0B 3MEVA 3OYEA 3G7ZA 3CCQA 1X75C 3CC7T 2V8KA 1HK9A 1Q86R 2JVVA 4J6YA 1V76A 1AZGB 3EAEA 3U23A 2KAFA 4C92A 4PJOE 3QZ5B 1S1NA 4O5VA 1QVFA 4XU0A 3RKYA 4Y92A 1WA7A 3E19A 2EKOA 3OW2S 2CGHA 3NTKA 2YHTA 2WSEE 3JB9G 5IXFA 4ZGDB 5I2SA 2JT4A 2KROA 3RNJA 1ZUUA 2J05A 1X27A 5KH6A 2XG8D 5GAOp 2EBPA 4QVZA 1QVFS 2EAYA 2QK0A 2MPXC 5HKCA 3KXTA 5LJ3h 5CCAA 1AZEA 3DLLA 2YWWA 3UATA 3VYGA 3CCUT 4LDYA 4AFSC 2RN8A 1QVGP 1KHIA 1M5Q1 1FMVA 1RI9A 1NJIC 1ZUKA 1VQOQ 2VUBA 5FRMA 2EJ9A 2JMCA 2RB6A 3OYIA 1KQ1A 2JS0A 1YJNQ 5CKHA 2LCLA 3BFMA 3CBOA 2JXBA 2QTVA 3JCMh 1YJNT 4A54A 3PMTA 3A98A 1GXIE 3SWNC 3O5ZA 4OF1A 5IH2A 3QDRB 5CR2A 1KK7A 1IZ6A 5KYXA 3JAME 3JCMV 2CT3A 1VQ5Q 3D7SB 4JS5A 3CCJT 1B34B 1HYOA 3C4SA 1VQKA 5LJ3g 2YUOA 3RR6A 4KH1B 4M77D 2DL4A 3BDLA 1M3AA 2R58A 2X4JA 2W10A 3QYGB 2DEUA 1PKTA 3CCLA 4PJOB 2FRWA 1OX9A 3OYLA 4RCCA 2FO0A 4ME7A 2D8JA 5HK3A 1R77A 5KE2A 4N0AA 3ASKA 3OMCA 2LMJA 2H8HA 2K4YA 5CKDA 1RLPC 1VQMA 3I9QA 3I55Q 4F17A 2JNGA 2RQUA 4J8OA 1UHFA 4JPBW 1E7OA 2QDLA 2FHDA 2DXUA 2CUBA 1WXUA 4M78F 2J6OA 3M4GA 4HVVA 5GMKe 1VQ7T 1QCFA 2E6ZA 2ZPIB 2HBPA 2PNIA 1Q7YR 2VASA 4Q5WA 2DJQA 2DL3A 2ZPBB 2YLCA 2D1XA 1M27C 2QQRA 2KVQG 4KH0B 2ROTA 5KYXB 5GAMd 3OW2P 1VIFA 1U3OA 3JB9H 3V7SA 1KHCA 4F14A 2VXEA 4M77F 1M4ZA 1G8XA 1Z9QA 3V7RA 3MEWA 1GFCA 3JCMb 3I56T 2GQIA 1HJDA 1MMAA 1WGSA 4DEXA 1YWPA 2CZ7B 4B6MA 3SHWA 4ZGEB 5I21A 4LUEA 1EX4A 2HSPA 1SSFA 2JM9A 4V2SA 3OYCA 3MP8A 1UTIA 2NUPA 4C5EA 4C8QF 2DVJA 3HKSA 2KRSA 2DEQA 4A53A 1UE9A 2L3QA 1MGQA 1K73C 3H6ZA 5LJ3e 5GAOl 2ABLA 3EG9B 4PFPA 1Y07A 4J9EA 2FB7A 1M3BA 3CBMA 2MF2A 4MDXA 1WXTA 1GRIA 5AT1B 3I5RA 3JCMe 4C92G 3VRYA 2KT8A 1SPKA 2PVDB 4XTUA 1PD0A 1ACMB 2KEAA 4WTOB 4GLMA 3CD6T 1LPLA 4CC7A 2FL7A 4FSXA 1BB9A 1VQPT 4LDVA 3HL8A 4XTVA 2ZPFB 3M4YA 5GMKl 1WI7A 4FYXB 1NJIR 1B7TA 1X2QA 1U06A 3CCST 4PJOA 2LC4A 1BI0A 2DL7A 3QJYA 2EGCA 4IUTA 1T0JA 2NUPB 1WIEA 2KSSA 1RAEB 3HSBA 1N8RR 1Q82U 4FIBA 2EYYA 2JOYA 1QVGA 1MHNA 2LQWA 4AT1B 1KC8U 3CCEQ 4FU6A 1K9MC 2XI9A 1I8FA 3R6NA 4R56A 1D09B 3JCMW 2D8HA 4D6WA 1VQNT 1M90U 1MV0B 3T9NA 4K11A 1WHKA 3EG2A 4ATOA 4FYWB 4A4KA 2RA2A 1TH7A 4OMMA 5GMKj 3RBBB 3RMQA 2LT1A 2MYSA 1MMNA 3CC2T 1KQSP 3LX7A 5GAN2 3VV0A 1AHJB 1QCNA 3MPUB 1IRXA 1OEBA 4M77E 1SF9A 4FT4A 2LCCA 3CCVA 4Z02A 3MEUA 3RESA 3UF4A 3QKJA 4F7UE 4BE1A 5GAN3 1KC8C 1WXBA 3S3MA 2FPEA 1VQ9Q 2LQKA 1JEGA 1C1AA 4BDYA 1WPYA 3CMET 1M1KU 1KD1U 2FZCB 5CQYA 3M59A 4C8QC 1UGRB 3LH0A 2P84A 2CSQA 2K5FA 3LWIA 5IN1A 1UFFA 4C0DC 1KJWA 3MJXA 4HT8A 2KYBA 1NEBA 3L1AA 4M78E 3M0SA 5KYWB 2E64A 5LJ3f 4FL6A 3G4SQ 4NOYA 2DXTA 4A4HA 3TSWA 1MMGA 2LP5A 4OP0A 1XTDA 1YWOA 1WJRA 2KI7A 2R5AA 3EFSA 4EDUA 1H3HA 2CP6A 4M7AE 2MWPA 4PLLA 1BI3A 4RMOA 1VQ6A 5I11A 1M2OA 4X9CA 2J6FA 4EMHA 4CC3A 1QMCA 1BK2A 2AIRB 2RK1A 4ZN1A 1Q86U 8AT1B 1JB0E 2KXDA 3M0QA 3TEEA 1ZBXA 3JCMc 1UDLA 3CCQT 4TVRA 1OQKA 2XHCA 3P8BB 1M1KC 1QWFA 2A7YA 4KT0E 4QQDA 1SSHA 2DLPA 1K8AU 2IPOB 2PVGB 3IQLA 3CPWS 4BD3A 1ZHIA 2QEXA 3S6WA 1N9SA 4RKUE 2I0NA 3EH2A 2F5KA 3OYYA 3BW1A 4HXJA 4HKEA 3OYHA 2XICA 5IHIA 2DD4A 1W6XA 2HQEA 2P0QA 4BI4A 2MOXA 2V8IA 2YUPA 4BE0A 3H41A 4QVCA 4QQGA 4HCCA 2FPFA 1W2BP 4PJMA 4ZN3A 3CXCP 2EPDA 2QA4T 3I56Q 2CUDA 1UG1A 2HQXA 2L3SA 3ZBDA 1O75A 3QHSA 2W0ZA 2LJ3A 2L0AA 2QEXQ 4M7AD 3E9FA 3FRNA 2M0OA 3CCLQ 3F70A 2RD1A 3OW2A 1M90R 1I5OB 2R5MA 4C8QG 3HTRA 2FVUA 1WHMA 2J7IA 3CCMT 3CCRA 1OI1A 4BY6C 3QYHB 1M1FA 3FB9A 1PKSA 1AVZC 2RHZA 2CZ1B 4HT9A 4C8QD 2DIGA 4IURA 3JCMP 1YJNA 1VQ8T 1YP5A 4RTTA 1IHVA 2X4WA 4GY5A 2HCKA 1Q81C 1WHJA 2EKHA 2HQHA 2EW3A 2QQAA 4LE9A 4LD6A 2DAQA 2QTXA 1VQ9A 3PIPA 4DBFA 3V8LA 1VQLA 2HMAA 3QPHA 4AFZC 4B9WA 2BE9B 2CT4A 3UA6A 2DL8A 2YT6A 3I55A 1KIKA 1NLOC 3V8JA 3TU4K 3CCJQ 3MCAB 2K2VA 5CKBA 4M7DD 1QQJA 4DBQA 4OB2B 4JJNK 1JU5C 5FW9A 1FWZA 1D1AA 1M8VA 4R55A 1T3LA 3JB9I 3LYIA 2DXBA 4B9XA 4JJBA 4LDXA 4E6RA 7AT1B 5L23A 4ORZA 4KGVB 3OBWA 1QP3A 3G4ST 2XMFA 1X01A 4XQ3A 4CC2A 2X51A 5GAMe 4NS5A 3PTAA 4OMFB 1D0XA 4PJOG 2EQIA 1UB4A 1NZ9A 3A8MB 1Q81U 1N27A 3PFSA 3ZFJA 4E7SA 2E3HA 2FYKA 4D8DA 1VQ4A 4J6WA 4LD9K 1VQ8A 1BI2A 2QG9B 1UUEA 2EQKA 1IREB 4MZTA 2KT1A 3LH5A 4JLIA 2YDLA 1VOMA 5LJ3j 1X6BA 3OYJA 1MMDA 1YN8A 1C6VX 4IUQA 3M5AA 4CI0C 2EYZA 1K8AC 4PJJA 2K5LA 2QASA 2GFAA 2KMTA 4RTXA 3EG9A 1NM7A 2M16A 2LVMA 2QDYB 2DJZA 3V7CA 2BIVA 3S3NA 1PSEA 1VQ7Q 2SEMA 3CXCS 4RTZA 3KFVA 4C5IA 4F16A 5CK9A 5D6XA 4JRPA 1U8RA 4MDWA 1TOVA 2RF0A 2VXFA 2EYQA 3BE3A 3SEMA 2DMOA 3QIIA 2MK5A 3HRTA 1D1CA 4ZTJA 4LDWA 4JJCA 1K0SA 2XDBA 1M8MA 4L5GA 4C8QB 5KE3A 2CP0A 3HPWA 2CSIA 3CCMQ 2JW4A 1M9SA 4JZ3A 2YRVA 1VQKQ 3WXMB 2DRMA 1I81A 4EPCA 3EGUA 3OYGA 4A63B 1YITT 1KQSS 3CCQQ 1WQ7A 2LQNA 4J9IA 3QDFA 2P0PA 2YUNA 3HRSA 3GIBA 4BI3A 3UA7A 2YXYA 2HD0A 5GAN7 1JBMA 2DTHA 4J9HA 2HZYA 1VQNA 3SFMA 3M0TA 1TUCA 3OQ5A 4ELYC 4IUUA 4KGXB 5AYFA 2A28A 2KGTA 3CBPA 1ARKA 3EGXA 5D6YA 1B3QA 1YNZA 2DL5A 3G71T 1GCQC 4BB7A 2ZZDA 3DLMA 1UJ0A 4MZMA 3SD4A 2KR3A 2X3WD 2KE9A 5C0MA 1WDXA 3VS6A 2CS7A 3CCUA 2KYMA 3LGLA 5IT9E 1PRLC 3LGFA 2K5IA 5GANg 2LCSA 3TVTA 2QXFA 2A08A 5GAN6 2L8DA 3EGDB 3NGPA 1PWTA 1ZSGA 4N4IA 1VQMQ 2ZAEA 4J83A 4BUGA 5GAMj 2FPDA 4FW1A 1YI2Q 3VKIA 1OPLA 4C8QE 4OMPA 1O9SA 1WQWA 2CZ0B 1UJYA 3RKXA 2PUOB 3C94A 3NPFA 1PRMC 4BY6B 1WNLA 3FEOA 1VQ5A 2I2LA 4PLIA 3CD6Q 1A0NB 3EFOB 3G6EQ 2EVRA 3P8HA 1AWJA 2QI2A 1S72Q 3DB4A 3CCVT 3BY7A 3UDCA 1YBYA 5FU6B 4PNOA 4XU3A 1W4SA 3CCVQ 3CC7A 4E7IA 1YIJQ 2AZVA 2DVEA 2NUTB 2K3XA 2DO3A 2RQWA 1K0XA 1GBRA 5FU7C 2NWMA 3QWYA 4EMKA 1WX6A 4J5YA 3QG1A 2RHIA 2G6FX 2O88A 1RAAB 1M90C 1SHFA 5GAN4 1GCQA 1YCYA 2BUDA 2QA4Q 2GFUA 3SB2A 3QBYA 2WSFE 3CC4T 4XK8E 2FRYA 2GTOA 2EQMA 1ZBJA 2X4XA 1W70A 2MI6A 1NPRA 2D0NA 2COZA 3S3OA 1TTHB 1OU9A 4Y91A 3JRZA 1QP2A 3E2UA 5DM7R 4M75A 1Z9ZA 1DJ7B 3GLXA 2DERA 5GMKi 4J6XA 2K9GA 1UGPB 1ZA1B 1NLPC 4JZ4A 2L2PA 1B07A 2C0IA 2VV5A 4LN2A 2OX7A 1VQMT 2QQ9A 2PZ1A 3PMIA 4KUDK 1ZSZC 2QEXT 2L5QA 3M55A 1T3SA 3ZEHA 2DZCA 1X43A 5GANd 1G83A 3EGXB 5I22A 4ZNXA 3BDUA 4MMKA 2BZXA 3PVQA 1YJWQ 1VQOT 4KULA 5GANj 2JJ9A 1RL2A 3HRUA 3CXCA 3CC4A 4PJLA 1JXMA 3X20B 2CH4W 2O2OA 4M78G 3X28B 1K9MR 2QA4A 4LUDA 4E7KA 1HD3A 1J3TA 1NYFA 1N9RA 2IVWA 1JJ2S 1GL5A 3FJPA 1W1FA 4L6V5 3M54A 5FWBA 1BU1A 2F69A 4C0FA 1WFWA 3QXEB 1PG5B 1G3WA 2DE0X 2CYZB 3QWXX 2ATCB 4OVAA 1YIJA 3CCMA 1JQQA 4J9GA 5KYYB 1TUDA 4NL3A 2HKNA 3UPUA 2R57A 4F7UA 2VGNA 9ATCB 4PJOD 1IB8A 4X9DA 2F2WA 4OGCA 2RQVA 1KQSA 4MMLA 4M75C 3CMAT 2FEIA 2A0FB 2AK5A 3UWNA 2RM4A 3REBB 3A8LB 1E6HA 3I55T 4M7DB 1C0MA 3GNFB 5GANh 2DNUA 4OMQA 1I1JA 1IHWA 3FDRA 2MWOA 2YLBA 2K2MA 1YHQA 1D1BA 1UGVA 4XAXB 4N0AC 1K4US 5LL6S 5DLQE 1TG0A 3CPFA 5KCHA 2P4TA 3JB9J 1V1CA 1U1TA 3VS0A 3CC7Q 2VKNA 2RQRA 1Y57A 4M7AB 1RADB 2RI2A 3TQ7P 3L2RA 2DZ9A 3GNGA 3EHQA 4JRQA 3H9NA 1M1GA 1ZX6A 1ABQA 2K3BA 1BI1A 2COWA 2E3IA 5KYYA 2GCXA 2XDDA 4IIOA 1K1ZA 1RAIB 2E4HA 2JUFA 2E1HA 1GCPA 4F7UB 1RUWA 2QQBA 2MCNA 1OPKA 3OYNA 3L2QA 4N4HA 5IHNA 5CKFA 5L8RE 2DK3A 2O4XA 3VYHB 4XU1A 3TREA 2HKQB 1K9AA 2OAUA 5LJ5h 2H3EB 4FM4B 1SG5A 2RI5A 3DB3A 1RACB 4RG2A 3VU3C 1VIEA 1AD5A 1D3BB 2ED1A 4OMLA 1VQ6Q 3CD6A 1TSFA 1MUZA 3NHNA 2PQWA 4JJDA 3MHXA 3E1SA 2XD0A 1ZA2B 2BKDN 1SHGA 4Z88A 1D0YA 4IKFA 4BE2A 1BIBA 4J7IA 1NJIU 4RTVA 1OULA 2LX9A 3C12A 4M75F 5GANe 2Y90A 3N5BB 2RMOA 2MAMA 1UHCA 2PUKB 4X1VA 1QCOA 1R8OB 2RJDA 4HVWA 3LW5E 5CKEA 2RHUA 2KK4A 2DA9A 2OTJT 2V1QA 4RTUA 2AHJB 1Y71A 4IIMA 4RG8A 3CC2Q 3QSUA 4DOVA 3G6ET 3M9QA 2NLUA 3J81E 2MIOA 5A0DA 5CO7A 4IUPA 2DETA 4QKUA 2RJCA 4M75G 3VUZA 1AT1B 1K8AR 4FT2A 4M7DF 1H8KA 1G3TA 2LNHB 5KYUA 1PNJA 3LWHA 2QQSA 1QVFP 4M75D 2D0QB 3EH1A 2E41A 4QT7A 1MNEA 4EMGA 5HK0A 5KCOA 3X26B 4C0ZA 2F2VA 4PJOC 2K3YA 2HNIA 2E65A 1WYXA 1VQ8Q 1Q86C 3P8DA 3SWNA 1PM3A 1Y0MA 2DBMA 2WACA 4PFZA 3QJ6A 3GPLA 3EFOA 1UGQB 3VS1A 5GAOr 1AWOA 1TS9A 2RHXA 3CEYA 2JM8A 3CCEA 2JS2A 2JTMA 2HEQA 1VYUA 3JCMJ 4J9BA 3V8KA 2DKGA 1YJ9T 3OSVA 1Y7XA 4F7UF 2OJ2A 3CMEA 5CAIA 4J9FA 4YTLA 2NUTA 2XDPA 2O01E 1NG2A 2DILA 1WJQA 2DRKA 3M0RA 3KUFA 5KYNA 3LLRA 2ZGWA 2YRDA 1ZQ1A 4RUGA 4RTWA 2YSQA 1VQLT 1JO8A 3EG0A 3GF5A 1FMKA 3OYMA 2QGGA 2Z0WA 3JB9D 5EC7A 3OYKA 2F2XA 1M1KR 2J6KA 2DPPB 2EIFA 2DD5A 1VQ4Q 3CCJA 3RUXA 4DA4A 1QVPA 3SDZA 5M9OA 2VGMA 2Y4YA 1RLQC 3VJPA 4M75B 4PK4A 1D3BA 3G4SA 3H0FA 4C8QA 2V8JA 3MO8A 2GTJA 1BBZA 2M0YA 2DM1A 3OYFA 2EGAA 2EYWA 3SWNB 4FSSA 2DTOA 4KRTA 2O9VA 1X6GA 4C5HA 3MEAA 4OB0B 1AWXA 4HCKA 3EG3A 1Y96B 3OMGA 3M57A 2ENMA 2K57A 5GAMg 3PVLA 1N8RU 2COYA 3CCRQ 2K6DA 4Y28E 4M77A 1WJSA 1IGQA 1I5LA 1NEGA 2XIDA 2LRQA 2E12A 1JJ2P 1EFNA 2DBKA 4M7AC 1IGUA 1ZUYA 3E9GA 2E5KA 1XOVA 2DIQA 4FYYB 4XU2A 1CKAA 3M0UA 2AKLA 2DTIA 1MNDA 3THKA 5DY9A 1Q7YC 4RTYA 3CCRT 2VB6A 2EGEA 5IAYA 3PNWC 5GAOn 2CH4A 4M7AF 4E2FB 3VS2A 4DQ2A 1CSKA 3A5ZB 2KBTA 4AFQC 1WHGA 2V26A 2X9HA 2JZ2A 4ESRA 3X24B 4OB1B 2L3PA 3G71Q 1OOTA 2ESWA 2H3JA 3EFRA 1LVKA 3GBQA 1KC8R 2C06A 5J3BA 1VQ9T 2G3RA 4XTZA 3FJ5A 3TCJA 5FWCA 1MV3A 3META 3FLGA 3ZL7C 1G5VA 5CQXA 1M30A 3CMAA 2SRCA 1RABB 1SEMA 1D0ZA 2OTJQ 1BCOA 4M7DE 1W2BA 2F1LA 1HSQA 3QZ9B 4C92B 4PFOA 2DYIA 4ZTFA 1QW1A 1VA7A 2B8AA 2HAXA 3WVDB 1K73R 4E7ZA 2RQTA 3A1PA 4KGZB 5J26A 3CPWA 1IXDA 1KFZA 1H92A 4KBMB 4M77C 1H641 3A8OB 1M3CA 1UEBA 4QW2A 2RPNA 1OV3A 3J80E 1FXXA 4M75E 3EHRA 2RO0A 3FIFA 3G71A 2YUQA 4M7AA 2EQUA 2NUZA 2NYSA 2JTFA 2PVOB 5FRNA 5LJ5f 3X25B 4EMKB 3HHTB 1S72T 2LTOA 2X4YA 2GF7A 2BTTA 4DEYA 1OZ3A 2RNAA 4JUVA 1Q95G 4XTYA 4QVDA 3GOXA 3NMZC 4C0DB 5D7UA 2MMPA 2LQ8A 4IUVA 1M2VA 1YJWA 3OA6A 1AOJA 4NL2A 3H0IA 1YITA 4M77G 4JRKA 1K73U 1N5ZA 4QQ6A 2LDMA 4HCBA 4BDZA
chains in the Genus database with same CATH topology
3C0CA 2ECZA 2F2WA 2EPDA 2CUDA 2RQVA 1UG1A 2AKKA 2L3SA 2HDAA 1VYTA 3M0PA 1GBQA 2FEIA 4R0KA 2AK5A 2W0ZA 2LJ3A 5HCKA 2L0AA 3REBB 3I35A 2BZYA 1E6HA 1AZGB 3U23A 2P4RA 1S1NA 2DNUA 4OMQA 1I1JA 2J7IA 4Y92A 1WA7A 2K2MA 4D8KA 2OAWA 1UGVA 1PKSA 2JMAA 5IXFA 1K4US 1AVZC 2JT4A 2JTEA 1TG0A 1UECA 1YP5A 2KROA 4RTTA 3RNJA 2HCKA 1ZUUA 2X3XD 1V1CA 2DYBA 3VS0A 2EKHA 1AEYA 2J05A 1X27A 2VKNA 2RQRA 2EW3A 1Y57A 4LE9A 2EBPA 4AFZC 1AZEA 2CT4A 3UA6A 2DL8A 2YT6A 3EHQA 3UATA 1KIKA 1NLOC 1ZX6A 4AFSC 2RN8A 2M51A 1ABQA 2K3BA 1RI9A 4IIOA 1K1ZA 1ZUKA 1GCPA 1JU5C 2JMCA 5FW9A 1RUWA 2MCNA 2JS0A 1T3LA 1OPKA 3I5SA 2LJ1A 5IHNA 4JJBA 4E6RA 5L23A 2JXBA 2J06A 4ORZA 2DX1A 2XMFA 3A98A 4CC2A 1IO6A 1K9AA 3O5ZA 5IH2A 2GBQA 2B86A 2C0OA 2CT3A 2EQIA 2K7AA 4OMLA 1AD5A 2ED1A 1MUZA 2YUOA 4D8DA 3NHNA 2KRNA 2AZSA 2FG0A 4JJDA 2DL4A 1QLYA 1UUEA 1M3AA 2KT1A 1SHGA 4Z88A 2W10A 3LH5A 2OI3A 2YDLA 3VS3A 1PKTA 2FRWA 1X6BA 4RTVA 2GNCA 1YN8A 2EYZA 1NYGA 2FO0A 1SRLA 2RMOA 1UHCA 2D8JA 4X1VA 4RTXA 4HVWA 2LMJA 2H8HA 1NM7A 2DA9A 1QWEA 2V1QA 1RLPC 3I9QA 4RTUA 4F17A 3PE0A 3JV3A 2RQUA 4IIMA 1UHFA 5IHKA 4JPBW 1E7OA 2QDLA 2MIOA 4CC4B 2SEMA 4RTZA 3KFVA 4F16A 2CUBA 1WXUA 4HVUA 2J6OA 4HVVA 1QCFA 2RF0A 3SEMA 2DMOA 2PNIA 1X2KA 2DJQA 2DL3A 1H8KA 2LNHB 2D1XA 1M27C 1PNJA 4JJCA 1K0SA 1M8MA 2ROTA 2VVKA 3VS5A 2CSIA 4WCIA 4QT7A 2ROLA 2JW4A 1U3OA 1ABOA 4JZ3A 2F2VA 4F14A 1WYXA 2DRMA 1Z9QA 3EGUA 1KSWA 2KRMA 4A63B 1Y0MA 1GFCA 2DBMA 2C0TA 2GQIA 1HJDA 3VS1A 1AWOA 2JM8A 2JS2A 2EYXA 4Z8AA 4DEXA 2KXCA 2LQNA 1I0CA 1X69A 1YWPA 2HEQA 4J9IA 3SHWA 1VYUA 2YUNA 4J9BA 3EG1A 4LUEA 2HSPA 2VWFA 4GBQA 2JM9A 1UTIA 2OJ2A 3UA7A 4J9HA 4J9FA 4EIKA 1TUCA 2DVJA 2KRSA 3M0TA 1UE9A 1G2BA 2L3QA 1LCKA 1NG2A 2DILA 2A28A 2KGTA 1ARKA 2DRKA 3M0RA 1B3QA 1YNZA 2DL5A 1GCQC 2KNBB 2ABLA 4RUGA 1QKXA 1UJ0A 4RTWA 2YSQA 4J9EA 1JO8A 1M3BA 2KR3A 3EG0A 2X3WD 2KE9A 1FMKA 1WDXA 1WXTA 1GRIA 3VS6A 5EC7A 2KYMA 1YCSB 3I5RA 3REAB 2F2XA 1PRLC 3VRYA 2J6KA 2KT8A 1U5SA 1SPKA 2O31A 1I07A 1AWWA 1T0HA 2KEAA 2LCSA 4GLMA 3TVTA 4J9DA 2A08A 4CC7A 2LJ0A 3NGPA 1BB9A 4Z89A 1PWTA 1RLQC 1ZSGA 3H0FA 2GTJA 1BBZA 2FPDA 2M0YA 2DM1A 2EGAA 2EYWA 1OPLA 1WI7A 2GGRA 4OMPA 4FSSA 4KRTA 2O9VA 1X6GA 1UJYA 1AWXA 4HCKA 3EG3A 1X2QA 3NPFA 2ENMA 1PRMC 1U06A 3PVLA 2IIMA 2CDTA 2DL7A 2HBWA 2EGCA 1A0NB 2K6DA 1T0JA 1WIEA 2EVRA 5IXBA 1AWJA 2EYYA 1NEGA 2LQWA 1EFNA 2BZ8A 1VYVA 2DBKA 1ZUYA 3CQTA 2E5KA 1XOVA 3R6NA 4AG2C 2D8HA 2AZVA 4M4ZA 1MV0B 1CKAA 2RQWA 1K0XA 3M0UA 2AKLA 1GBRA 2NWMA 4K11A 3THKA 3QWYA 3EG2A 2V1RA 1QKWA 1WX6A 4RTYA 2G6FX 1GFDA 4OMMA 1FYNA 2EGEA 2O88A 3RBBB 1SHFA 1ZLMA 2CH4A 1GCQA 3VS2A 1CSKA 2KBTA 2FRYA 3VS4A 2GTOA 4AFQC 4OMNA 1OEBA 1ZBJA 4ESRA 1W70A 2O9SA 2D0NA 2ED0A 2L3PA 1OOTA 2A36A 2ESWA 3GBQA 3ULRB 3UF4A 4LNPA 2DF6A 1WXBA 2K79A 3FJ5A 2FPEA 5FWCA 1MV3A 1Z9ZA 1JEGA 3ZL7C 1M30A 2SRCA 1SEMA 2CSQA 1HSQA 1UFFA 2K9GA 1KJWA 1NLPC 4JZ4A 2L2PA 1K76A 1B07A 2KYBA 1NEBA 2C0IA 1JXOA 4LN2A 3M0SA 2LZ6B 2CREA 1VA7A 2LX7A 2PZ1A 3H0HA 1E6GA 1T3SA 2RQTA 4J9CA 1X43A 1G83A 4AFUC 5I22A 4ZNXA 3TSWA 2LP5A 1KFZA 1YWOA 1H92A 2BZXA 3TSZA 1H3HA 3PVQA 1M3CA 2RPNA 1OV3A 5I11A 3EHRA 2J6FA 2YUQA 1JXMA 2CH4W 2O2OA 4CC3A 5ECAA 1BK2A 2NUZA 4LUDA 2KXDA 3M0QA 1J3TA 1HD3A 1NYFA 1UDLA 2A37A 1SRMA 5GJWB 1QWFA 1SSHA 2DLPA 1GL5A 3VS7A 3VRZA 1W1FA 3IQLA 1CKBA 2BTTA 4DEYA 5FWBA 1BU1A 2RNAA 1WFWA 2I0NA 5GJVB 2DE0X 1PHTA 3QWXX 4OMOA 4HXJA 3NMZC 2PTKA 1JQQA 4J9GA 5IHIA 1W6XA 1TUDA 1AOJA 1WLPB 2MOXA 3H0IA 2YUPA 3H41A 2FPFA 4AG1C 1N5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C0C A;  2ECZ A;  2F2W A;  2EPD A;  2CUD A;  2RQV A;  1UG1 A;  2AKK A;  2L3S A;  2HDA A;  1VYT A;  3M0P A;  1GBQ A;  2FEI A;  4R0K A;  2AK5 A;  2W0Z A;  2LJ3 A;  5HCK A;  2L0A A;  3REB B;  3I35 A;  2BZY A;  1E6H A;  1AZG B;  3U23 A;  2P4R A;  1S1N A;  2DNU A;  4OMQ A;  1I1J A;  2J7I A;  4Y92 A;  1WA7 A;  2K2M A;  4D8K A;  2OAW A;  1UGV A;  1PKS A;  2JMA A;  5IXF A;  1K4U S;  1AVZ C;  2JT4 A;  2JTE A;  1TG0 A;  1UEC A;  1YP5 A;  2KRO A;  4RTT A;  3RNJ A;  2HCK A;  1ZUU A;  2X3X D;  1V1C A;  2DYB A;  3VS0 A;  2EKH A;  1AEY A;  2J05 A;  1X27 A;  2VKN A;  2RQR A;  2EW3 A;  1Y57 A;  4LE9 A;  2EBP A;  4AFZ C;  1AZE A;  2CT4 A;  3UA6 A;  2DL8 A;  2YT6 A;  3EHQ A;  3UAT A;  1KIK A;  1NLO C;  1ZX6 A;  4AFS C;  2RN8 A;  2M51 A;  1ABQ A;  2K3B A;  1RI9 A;  4IIO A;  1K1Z A;  1ZUK A;  1GCP A;  1JU5 C;  2JMC A;  5FW9 A;  1RUW A;  2MCN A;  2JS0 A;  1T3L A;  1OPK A;  3I5S A;  2LJ1 A;  5IHN A;  4JJB A;  4E6R A;  5L23 A;  2JXB A;  2J06 A;  4ORZ A;  2DX1 A;  2XMF A;  3A98 A;  4CC2 A;  1IO6 A;  1K9A A;  3O5Z A;  5IH2 A;  2GBQ A;  2B86 A;  2C0O A;  2CT3 A;  2EQI A;  2K7A A;  4OML A;  1AD5 A;  2ED1 A;  1MUZ A;  2YUO A;  4D8D A;  3NHN A;  2KRN A;  2AZS A;  2FG0 A;  4JJD A;  2DL4 A;  1QLY A;  1UUE A;  1M3A A;  2KT1 A;  1SHG A;  4Z88 A;  2W10 A;  3LH5 A;  2OI3 A;  2YDL A;  3VS3 A;  1PKT A;  2FRW A;  1X6B A;  4RTV A;  2GNC A;  1YN8 A;  2EYZ A;  1NYG A;  2FO0 A;  1SRL A;  2RMO A;  1UHC A;  2D8J A;  4X1V A;  4RTX A;  4HVW A;  2LMJ A;  2H8H A;  1NM7 A;  2DA9 A;  1QWE A;  2V1Q A;  1RLP C;  3I9Q A;  4RTU A;  4F17 A;  3PE0 A;  3JV3 A;  2RQU A;  4IIM A;  1UHF A;  5IHK A;  4JPB W;  1E7O A;  2QDL A;  2MIO A;  4CC4 B;  2SEM A;  4RTZ A;  3KFV A;  4F16 A;  2CUB A;  1WXU A;  4HVU A;  2J6O A;  4HVV A;  1QCF A;  2RF0 A;  3SEM A;  2DMO A;  2PNI A;  1X2K A;  2DJQ A;  2DL3 A;  1H8K A;  2LNH B;  2D1X A;  1M27 C;  1PNJ A;  4JJC A;  1K0S A;  1M8M A;  2ROT A;  2VVK A;  3VS5 A;  2CSI A;  4WCI A;  4QT7 A;  2ROL A;  2JW4 A;  1U3O A;  1ABO A;  4JZ3 A;  2F2V A;  4F14 A;  1WYX A;  2DRM A;  1Z9Q A;  3EGU A;  1KSW A;  2KRM A;  4A63 B;  1Y0M A;  1GFC A;  2DBM A;  2C0T A;  2GQI A;  1HJD A;  3VS1 A;  1AWO A;  2JM8 A;  2JS2 A;  2EYX A;  4Z8A A;  4DEX A;  2KXC A;  2LQN A;  1I0C A;  1X69 A;  1YWP A;  2HEQ A;  4J9I A;  3SHW A;  1VYU A;  2YUN A;  4J9B A;  3EG1 A;  4LUE A;  2HSP A;  2VWF A;  4GBQ A;  2JM9 A;  1UTI A;  2OJ2 A;  3UA7 A;  4J9H A;  4J9F A;  4EIK A;  1TUC A;  2DVJ A;  2KRS A;  3M0T A;  1UE9 A;  1G2B A;  2L3Q A;  1LCK A;  1NG2 A;  2DIL A;  2A28 A;  2KGT A;  1ARK A;  2DRK A;  3M0R A;  1B3Q A;  1YNZ A;  2DL5 A;  1GCQ C;  2KNB B;  2ABL A;  4RUG A;  1QKX A;  1UJ0 A;  4RTW A;  2YSQ A;  4J9E A;  1JO8 A;  1M3B A;  2KR3 A;  3EG0 A;  2X3W D;  2KE9 A;  1FMK A;  1WDX A;  1WXT A;  1GRI A;  3VS6 A;  5EC7 A;  2KYM A;  1YCS B;  3I5R A;  3REA B;  2F2X A;  1PRL C;  3VRY A;  2J6K A;  2KT8 A;  1U5S A;  1SPK A;  2O31 A;  1I07 A;  1AWW A;  1T0H A;  2KEA A;  2LCS A;  4GLM A;  3TVT A;  4J9D A;  2A08 A;  4CC7 A;  2LJ0 A;  3NGP A;  1BB9 A;  4Z89 A;  1PWT A;  1RLQ C;  1ZSG A;  3H0F A;  2GTJ A;  1BBZ A;  2FPD A;  2M0Y A;  2DM1 A;  2EGA A;  2EYW A;  1OPL A;  1WI7 A;  2GGR A;  4OMP A;  4FSS A;  4KRT A;  2O9V A;  1X6G A;  1UJY A;  1AWX A;  4HCK A;  3EG3 A;  1X2Q A;  3NPF A;  2ENM A;  1PRM C;  1U06 A;  3PVL A;  2IIM A;  2CDT A;  2DL7 A;  2HBW A;  2EGC A;  1A0N B;  2K6D A;  1T0J A;  1WIE A;  2EVR A;  5IXB A;  1AWJ A;  2EYY A;  1NEG A;  2LQW A;  1EFN A;  2BZ8 A;  1VYV A;  2DBK A;  1ZUY A;  3CQT A;  2E5K A;  1XOV A;  3R6N A;  4AG2 C;  2D8H A;  2AZV A;  4M4Z A;  1MV0 B;  1CKA A;  2RQW A;  1K0X A;  3M0U A;  2AKL A;  1GBR A;  2NWM A;  4K11 A;  3THK A;  3QWY A;  3EG2 A;  2V1R A;  1QKW A;  1WX6 A;  4RTY A;  2G6F X;  1GFD A;  4OMM A;  1FYN A;  2EGE A;  2O88 A;  3RBB B;  1SHF A;  1ZLM A;  2CH4 A;  1GCQ A;  3VS2 A;  1CSK A;  2KBT A;  2FRY A;  3VS4 A;  2GTO A;  4AFQ C;  4OMN A;  1OEB A;  1ZBJ A;  4ESR A;  1W70 A;  2O9S A;  2D0N A;  2ED0 A;  2L3P A;  1OOT A;  2A36 A;  2ESW A;  3GBQ A;  3ULR B;  3UF4 A;  4LNP A;  2DF6 A;  1WXB A;  2K79 A;  3FJ5 A;  2FPE A;  5FWC A;  1MV3 A;  1Z9Z A;  1JEG A;  3ZL7 C;  1M30 A;  2SRC A;  1SEM A;  2CSQ A;  1HSQ A;  1UFF A;  2K9G A;  1KJW A;  1NLP C;  4JZ4 A;  2L2P A;  1K76 A;  1B07 A;  2KYB A;  1NEB A;  2C0I A;  1JXO A;  4LN2 A;  3M0S A;  2LZ6 B;  2CRE A;  1VA7 A;  2LX7 A;  2PZ1 A;  3H0H A;  1E6G A;  1T3S A;  2RQT A;  4J9C A;  1X43 A;  1G83 A;  4AFU C;  5I22 A;  4ZNX A;  3TSW A;  2LP5 A;  1KFZ A;  1YWO A;  1H92 A;  2BZX A;  3TSZ A;  1H3H A;  3PVQ A;  1M3C A;  2RPN A;  1OV3 A;  5I11 A;  3EHR A;  2J6F A;  2YUQ A;  1JXM A;  2CH4 W;  2O2O A;  4CC3 A;  5ECA A;  1BK2 A;  2NUZ A;  4LUD A;  2KXD A;  3M0Q A;  1J3T A;  1HD3 A;  1NYF A;  1UDL A;  2A37 A;  1SRM A;  5GJW B;  1QWF A;  1SSH A;  2DLP A;  1GL5 A;  3VS7 A;  3VRZ A;  1W1F A;  3IQL A;  1CKB A;  2BTT A;  4DEY A;  5FWB A;  1BU1 A;  2RNA A;  1WFW A;  2I0N A;  5GJV B;  2DE0 X;  1PHT A;  3QWX X;  4OMO A;  4HXJ A;  3NMZ C;  2PTK A;  1JQQ A;  4J9G A;  5IHI A;  1W6X A;  1TUD A;  1AOJ A;  1WLP B;  2MOX A;  3H0I A;  2YUP A;  3H41 A;  2FPF A;  4AG1 C;  1N5Z A; 
#chains in the Genus database with same CATH topology
 4O6J A;  2ECZ A;  2HDA A;  3URG A;  4R0K A;  4M7D A;  5HCK A;  3CMA Q;  3I35 A;  2BZY A;  4M7A G;  3DKM A;  2P4R A;  1H3Z A;  3OS2 A;  2CZ6 B;  2QGF B;  4XTX A;  4D8K A;  2OAW A;  1PD1 A;  4XTW A;  3L2V A;  2JMA A;  1I4K 1;  3OS5 A;  2EWN A;  2JTE A;  3CCS A;  1UEC A;  4J7F A;  3R6O A;  3OS1 A;  2OTJ A;  2ZPE B;  2X3X D;  2DYB A;  1LJO A;  1AEY A;  5J39 A;  3UT1 A;  1PC0 A;  2CP7 A;  1KQ2 A;  3OY9 A;  3NFC A;  2M9U A;  2JN0 A;  5CIU A;  2M51 A;  2D9T A;  2M1H A;  3M56 A;  3HFN A;  1KD1 C;  5CVI A;  4M78 D;  3I5S A;  2LJ1 A;  2J06 A;  4WF2 A;  2DX1 A;  1QVG S;  2OTL A;  1IO6 A;  5LJ5 j;  2RK2 A;  2GBQ A;  1OX8 A;  3QO3 A;  1V29 B;  1LOJ A;  2B86 A;  2C0O A;  1VQN Q;  4AMC A;  2O4X B;  5KYW A;  1R0C B;  5A2Q E;  5GMK h;  2K7A A;  2E10 A;  3KBG A;  5C6S A;  5LJ5 d;  1NPP A;  3G6E A;  2EFI A;  2RI3 A;  2KRN A;  2AZS A;  1RAH B;  2FG0 A;  1YHQ Q;  4P5N A;  4DBR A;  4M7D C;  1QLY A;  1B34 A;  2E5Q A;  1TWB A;  2OI3 A;  3VS3 A;  2LNV A;  3ME9 A;  1PCX A;  2P0K A;  1WZO A;  2GNC A;  5GAN 5;  1OZ2 A;  3ER0 A;  3M58 A;  1NYG A;  1VQO A;  3JCM g;  1SRL A;  1VQ5 T;  1YJ9 Q;  2KQW A;  4E7J A;  4N4G A;  3OSS C;  1JRI A;  5FU7 B;  1QWE A;  3AHU A;  2L3R A;  4C92 D;  3PE0 A;  3JV3 A;  1G3S A;  4ELZ C;  5IHK A;  5FRO A;  5GAN f;  4HCZ A;  1PSF A;  2RJE A;  1VQK T;  4PKC C;  4CC4 B;  1G3Y A;  3A8H B;  1OU8 A;  1U1S A;  4HVU A;  3PIO A;  5A0L A;  2OTL T;  3OS0 A;  2VYT A;  1W2B S;  1X2K A;  5KYU B;  2HL5 C;  3L2W A;  1HXD A;  3H8Z A;  1R0B G;  1SKU B;  1YIJ T;  4M78 B;  5GAN 8;  1YJ9 A;  4C0G A;  2VVK A;  2KDS A;  3VS5 A;  3HP9 A;  4WCI A;  4DOW A;  2ROL A;  5D6W A;  2F5T X;  3OBY A;  3EGD A;  1ABO A;  1EZZ B;  4JDS A;  2CKK A;  4ANJ A;  1Y96 A;  4JS4 A;  1FMW A;  1XQH A;  1KSW A;  2KRM A;  4M7D G;  1RAG B;  4A4E A;  2C0T A;  3JCM Q;  4M77 B;  1Q7Y U;  4VUB A;  4Z8A A;  2EJG A;  2EYX A;  4E47 A;  3L2U A;  2KXC A;  1I0C A;  4C92 E;  1X69 A;  1ZSZ B;  3EG1 A;  4BAC A;  2VWF A;  4GBQ A;  2XKO C;  1KD1 R;  2M02 A;  4PL6 A;  2E70 A;  4EIK A;  1Q81 R;  1BKB A;  2CP2 A;  4E7L A;  2GQV A;  1G2B A;  4EMK C;  1LCK A;  1X6O A;  4LDU A;  3OYB A;  5FLX E;  3PT9 A;  1UGS B;  2HL3 A;  2KNB B;  4C5G A;  1QKX A;  2ZCF B;  4PJN A;  3Q1J A;  4CRI A;  2Y4X A;  4OB3 B;  4X34 A;  4FCY A;  2XU8 A;  1YCS B;  3REA B;  4A4G A;  5FU6 C;  3RDV A;  5LJ5 g;  1U5S A;  2O31 A;  1I07 A;  1AWW A;  4FYV B;  1T0H A;  3OYD A;  3PGG A;  4JRI A;  1VQP Q;  4J9D A;  2FZG B;  2LJ0 A;  4FW2 A;  4II1 A;  4Z89 A;  1VQ4 T;  1BCM A;  5HY6 A;  4E7H A;  1N8R C;  3MP6 A;  2FZK B;  1WHH A;  2GGR A;  3J7A F;  2QAZ A;  1YIT Q;  2CP3 A;  6AT1 B;  3CCL T;  3RKW A;  1N6A A;  2AT1 B;  1Q82 C;  3L2Z A;  5GAM f;  2IIM A;  1ZSZ A;  3MP1 A;  3I56 A;  2CDT A;  2DXC A;  2HBW A;  4OGE A;  3G1J A;  3GP8 A;  3QUI A;  2LT4 A;  2VC8 A;  1OYX A;  5IXB A;  3HFO A;  1FX7 A;  3A8G B;  1RAF B;  2BZ8 A;  1VYV A;  3CQT A;  3NTI A;  2BE7 D;  4AG2 C;  5LJ3 d;  4M4Z A;  3JB9 F;  4ZGJ B;  1XJW B;  1VQ7 A;  3NTH A;  1WHL A;  2RH2 A;  2ZPG B;  5GMK m;  1NE8 A;  3CPW P;  4F7U G;  2V1R A;  1QKW A;  1YHQ T;  1GFD A;  1FYN A;  3JCM d;  1TXQ A;  1ZLM A;  4M78 A;  4BI8 B;  5I2M A;  5DLO A;  2ZPH B;  2E6N A;  2RHY A;  3VS4 A;  1VQL Q;  1VUB A;  4OMN A;  1RI0 A;  3RER A;  2O9S A;  3VUB A;  1YI2 T;  3RMS A;  2ED0 A;  2A36 A;  3ULR B;  2D6F A;  4LNP A;  2DF6 A;  2K79 A;  3CME Q;  4C92 F;  5GAO q;  4C92 C;  4MZP A;  1TUG B;  2PU9 B;  5A0G A;  3RIR A;  2EJF A;  1K76 A;  2XK0 A;  2X35 A;  8ATC B;  2QYZ A;  1JXO A;  1EIF A;  3CCE T;  1BYM A;  3MKD A;  2LZ6 B;  2CRE A;  1S72 A;  2LX7 A;  2L89 A;  2HSE B;  3H0H A;  1E6G A;  3WVE B;  4J9C A;  2RJF A;  4GLK A;  4AFU C;  1YJW T;  3O8V A;  1P92 A;  3TSZ A;  2A3L A;  3OB9 A;  2KY9 A;  2DFU A;  4JLG A;  3L42 A;  3JCM X;  2YRC A;  4DBH A;  5GAM h;  1LNX A;  3CCU Q;  3C95 A;  5ECA A;  3JCM f;  4HA8 A;  4LXC A;  1YI2 A;  3OYA A;  2A37 A;  1SRM A;  5GJW B;  4UC4 A;  5GAO m;  1VQP A;  4L59 A;  3INZ A;  4RCB A;  3VS7 A;  3VRZ A;  1Q82 R;  1K9M U;  3AT1 B;  1CKB A;  1KG1 A;  1M2V B;  3CC2 A;  2EQJ A;  5GJV B;  1PHT A;  3CCS Q;  4M78 C;  2CP5 A;  4OMO A;  5LJ5 e;  4PJO F;  2PTK A;  1YFN A;  1F1B B;  1BIA A;  1WLP B;  1VQ6 T;  3CC4 Q;  5EG2 A;  4KUI A;  4AG1 C;  3JSC A;  4F04 B;  4A4F A;  3M53 A;  3C0C A;  1XNI A;  2WSC E;  2IG0 A;  1JJ2 A;  1NBE B;  2AKK A;  1VYT A;  2OTL Q;  3M0P A;  1GBQ A;  3FC3 A;  1TU0 B;  3MEV A;  3OYE A;  3G7Z A;  3CCQ A;  1X75 C;  3CC7 T;  2V8K A;  1HK9 A;  1Q86 R;  2JVV A;  4J6Y A;  1V76 A;  1AZG B;  3EAE A;  3U23 A;  2KAF A;  4C92 A;  4PJO E;  3QZ5 B;  1S1N A;  4O5V A;  1QVF A;  4XU0 A;  3RKY A;  4Y92 A;  1WA7 A;  3E19 A;  2EKO A;  3OW2 S;  2CGH A;  3NTK A;  2YHT A;  2WSE E;  3JB9 G;  5IXF A;  4ZGD B;  5I2S A;  2JT4 A;  2KRO A;  3RNJ A;  1ZUU A;  2J05 A;  1X27 A;  5KH6 A;  2XG8 D;  5GAO p;  2EBP A;  4QVZ A;  1QVF S;  2EAY A;  2QK0 A;  2MPX C;  5HKC A;  3KXT A;  5LJ3 h;  5CCA A;  1AZE A;  3DLL A;  2YWW A;  3UAT A;  3VYG A;  3CCU T;  4LDY A;  4AFS C;  2RN8 A;  1QVG P;  1KHI A;  1M5Q 1;  1FMV A;  1RI9 A;  1NJI C;  1ZUK A;  1VQO Q;  2VUB A;  5FRM A;  2EJ9 A;  2JMC A;  2RB6 A;  3OYI A;  1KQ1 A;  2JS0 A;  1YJN Q;  5CKH A;  2LCL A;  3BFM A;  3CBO A;  2JXB A;  2QTV A;  3JCM h;  1YJN T;  4A54 A;  3PMT A;  3A98 A;  1GXI E;  3SWN C;  3O5Z A;  4OF1 A;  5IH2 A;  3QDR B;  5CR2 A;  1KK7 A;  1IZ6 A;  5KYX A;  3JAM E;  3JCM V;  2CT3 A;  1VQ5 Q;  3D7S B;  4JS5 A;  3CCJ T;  1B34 B;  1HYO A;  3C4S A;  1VQK A;  5LJ3 g;  2YUO A;  3RR6 A;  4KH1 B;  4M77 D;  2DL4 A;  3BDL A;  1M3A A;  2R58 A;  2X4J A;  2W10 A;  3QYG B;  2DEU A;  1PKT A;  3CCL A;  4PJO B;  2FRW A;  1OX9 A;  3OYL A;  4RCC A;  2FO0 A;  4ME7 A;  2D8J A;  5HK3 A;  1R77 A;  5KE2 A;  4N0A A;  3ASK A;  3OMC A;  2LMJ A;  2H8H A;  2K4Y A;  5CKD A;  1RLP C;  1VQM A;  3I9Q A;  3I55 Q;  4F17 A;  2JNG A;  2RQU A;  4J8O A;  1UHF A;  4JPB W;  1E7O A;  2QDL A;  2FHD A;  2DXU A;  2CUB A;  1WXU A;  4M78 F;  2J6O A;  3M4G A;  4HVV A;  5GMK e;  1VQ7 T;  1QCF A;  2E6Z A;  2ZPI B;  2HBP A;  2PNI A;  1Q7Y R;  2VAS A;  4Q5W A;  2DJQ A;  2DL3 A;  2ZPB B;  2YLC A;  2D1X A;  1M27 C;  2QQR A;  2KVQ G;  4KH0 B;  2ROT A;  5KYX B;  5GAM d;  3OW2 P;  1VIF A;  1U3O A;  3JB9 H;  3V7S A;  1KHC A;  4F14 A;  2VXE A;  4M77 F;  1M4Z A;  1G8X A;  1Z9Q A;  3V7R A;  3MEW A;  1GFC A;  3JCM b;  3I56 T;  2GQI A;  1HJD A;  1MMA A;  1WGS A;  4DEX A;  1YWP A;  2CZ7 B;  4B6M A;  3SHW A;  4ZGE B;  5I21 A;  4LUE A;  1EX4 A;  2HSP A;  1SSF A;  2JM9 A;  4V2S A;  3OYC A;  3MP8 A;  1UTI A;  2NUP A;  4C5E A;  4C8Q F;  2DVJ A;  3HKS A;  2KRS A;  2DEQ A;  4A53 A;  1UE9 A;  2L3Q A;  1MGQ A;  1K73 C;  3H6Z A;  5LJ3 e;  5GAO l;  2ABL A;  3EG9 B;  4PFP A;  1Y07 A;  4J9E A;  2FB7 A;  1M3B A;  3CBM A;  2MF2 A;  4MDX A;  1WXT A;  1GRI A;  5AT1 B;  3I5R A;  3JCM e;  4C92 G;  3VRY A;  2KT8 A;  1SPK A;  2PVD B;  4XTU A;  1PD0 A;  1ACM B;  2KEA A;  4WTO B;  4GLM A;  3CD6 T;  1LPL A;  4CC7 A;  2FL7 A;  4FSX A;  1BB9 A;  1VQP T;  4LDV A;  3HL8 A;  4XTV A;  2ZPF B;  3M4Y A;  5GMK l;  1WI7 A;  4FYX B;  1NJI R;  1B7T A;  1X2Q A;  1U06 A;  3CCS T;  4PJO A;  2LC4 A;  1BI0 A;  2DL7 A;  3QJY A;  2EGC A;  4IUT A;  1T0J A;  2NUP B;  1WIE A;  2KSS A;  1RAE B;  3HSB A;  1N8R R;  1Q82 U;  4FIB A;  2EYY A;  2JOY A;  1QVG A;  1MHN A;  2LQW A;  4AT1 B;  1KC8 U;  3CCE Q;  4FU6 A;  1K9M C;  2XI9 A;  1I8F A;  3R6N A;  4R56 A;  1D09 B;  3JCM W;  2D8H A;  4D6W A;  1VQN T;  1M90 U;  1MV0 B;  3T9N A;  4K11 A;  1WHK A;  3EG2 A;  4ATO A;  4FYW B;  4A4K A;  2RA2 A;  1TH7 A;  4OMM A;  5GMK j;  3RBB B;  3RMQ A;  2LT1 A;  2MYS A;  1MMN A;  3CC2 T;  1KQS P;  3LX7 A;  5GAN 2;  3VV0 A;  1AHJ B;  1QCN A;  3MPU B;  1IRX A;  1OEB A;  4M77 E;  1SF9 A;  4FT4 A;  2LCC A;  3CCV A;  4Z02 A;  3MEU A;  3RES A;  3UF4 A;  3QKJ A;  4F7U E;  4BE1 A;  5GAN 3;  1KC8 C;  1WXB A;  3S3M A;  2FPE A;  1VQ9 Q;  2LQK A;  1JEG A;  1C1A A;  4BDY A;  1WPY A;  3CME T;  1M1K U;  1KD1 U;  2FZC B;  5CQY A;  3M59 A;  4C8Q C;  1UGR B;  3LH0 A;  2P84 A;  2CSQ A;  2K5F A;  3LWI A;  5IN1 A;  1UFF A;  4C0D C;  1KJW A;  3MJX A;  4HT8 A;  2KYB A;  1NEB A;  3L1A A;  4M78 E;  3M0S A;  5KYW B;  2E64 A;  5LJ3 f;  4FL6 A;  3G4S Q;  4NOY A;  2DXT A;  4A4H A;  3TSW A;  1MMG A;  2LP5 A;  4OP0 A;  1XTD A;  1YWO A;  1WJR A;  2KI7 A;  2R5A A;  3EFS A;  4EDU A;  1H3H A;  2CP6 A;  4M7A E;  2MWP A;  4PLL A;  1BI3 A;  4RMO A;  1VQ6 A;  5I11 A;  1M2O A;  4X9C A;  2J6F A;  4EMH A;  4CC3 A;  1QMC A;  1BK2 A;  2AIR B;  2RK1 A;  4ZN1 A;  1Q86 U;  8AT1 B;  1JB0 E;  2KXD A;  3M0Q A;  3TEE A;  1ZBX A;  3JCM c;  1UDL A;  3CCQ T;  4TVR A;  1OQK A;  2XHC A;  3P8B B;  1M1K C;  1QWF A;  2A7Y A;  4KT0 E;  4QQD A;  1SSH A;  2DLP A;  1K8A U;  2IPO B;  2PVG B;  3IQL A;  3CPW S;  4BD3 A;  1ZHI A;  2QEX A;  3S6W A;  1N9S A;  4RKU E;  2I0N A;  3EH2 A;  2F5K A;  3OYY A;  3BW1 A;  4HXJ A;  4HKE A;  3OYH A;  2XIC A;  5IHI A;  2DD4 A;  1W6X A;  2HQE A;  2P0Q A;  4BI4 A;  2MOX A;  2V8I A;  2YUP A;  4BE0 A;  3H41 A;  4QVC A;  4QQG A;  4HCC A;  2FPF A;  1W2B P;  4PJM A;  4ZN3 A;  3CXC P;  2EPD A;  2QA4 T;  3I56 Q;  2CUD A;  1UG1 A;  2HQX A;  2L3S A;  3ZBD A;  1O75 A;  3QHS A;  2W0Z A;  2LJ3 A;  2L0A A;  2QEX Q;  4M7A D;  3E9F A;  3FRN A;  2M0O A;  3CCL Q;  3F70 A;  2RD1 A;  3OW2 A;  1M90 R;  1I5O B;  2R5M A;  4C8Q G;  3HTR A;  2FVU A;  1WHM A;  2J7I A;  3CCM T;  3CCR A;  1OI1 A;  4BY6 C;  3QYH B;  1M1F A;  3FB9 A;  1PKS A;  1AVZ C;  2RHZ A;  2CZ1 B;  4HT9 A;  4C8Q D;  2DIG A;  4IUR A;  3JCM P;  1YJN A;  1VQ8 T;  1YP5 A;  4RTT A;  1IHV A;  2X4W A;  4GY5 A;  2HCK A;  1Q81 C;  1WHJ A;  2EKH A;  2HQH A;  2EW3 A;  2QQA A;  4LE9 A;  4LD6 A;  2DAQ A;  2QTX A;  1VQ9 A;  3PIP A;  4DBF A;  3V8L A;  1VQL A;  2HMA A;  3QPH A;  4AFZ C;  4B9W A;  2BE9 B;  2CT4 A;  3UA6 A;  2DL8 A;  2YT6 A;  3I55 A;  1KIK A;  1NLO C;  3V8J A;  3TU4 K;  3CCJ Q;  3MCA B;  2K2V A;  5CKB A;  4M7D D;  1QQJ A;  4DBQ A;  4OB2 B;  4JJN K;  1JU5 C;  5FW9 A;  1FWZ A;  1D1A A;  1M8V A;  4R55 A;  1T3L A;  3JB9 I;  3LYI A;  2DXB A;  4B9X A;  4JJB A;  4LDX A;  4E6R A;  7AT1 B;  5L23 A;  4ORZ A;  4KGV B;  3OBW A;  1QP3 A;  3G4S T;  2XMF A;  1X01 A;  4XQ3 A;  4CC2 A;  2X51 A;  5GAM e;  4NS5 A;  3PTA A;  4OMF B;  1D0X A;  4PJO G;  2EQI A;  1UB4 A;  1NZ9 A;  3A8M B;  1Q81 U;  1N27 A;  3PFS A;  3ZFJ A;  4E7S A;  2E3H A;  2FYK A;  4D8D A;  1VQ4 A;  4J6W A;  4LD9 K;  1VQ8 A;  1BI2 A;  2QG9 B;  1UUE A;  2EQK A;  1IRE B;  4MZT A;  2KT1 A;  3LH5 A;  4JLI A;  2YDL A;  1VOM A;  5LJ3 j;  1X6B A;  3OYJ A;  1MMD A;  1YN8 A;  1C6V X;  4IUQ A;  3M5A A;  4CI0 C;  2EYZ A;  1K8A C;  4PJJ A;  2K5L A;  2QAS A;  2GFA A;  2KMT A;  4RTX A;  3EG9 A;  1NM7 A;  2M16 A;  2LVM A;  2QDY B;  2DJZ A;  3V7C A;  2BIV A;  3S3N A;  1PSE A;  1VQ7 Q;  2SEM A;  3CXC S;  4RTZ A;  3KFV A;  4C5I A;  4F16 A;  5CK9 A;  5D6X A;  4JRP A;  1U8R A;  4MDW A;  1TOV A;  2RF0 A;  2VXF A;  2EYQ A;  3BE3 A;  3SEM A;  2DMO A;  3QII A;  2MK5 A;  3HRT A;  1D1C A;  4ZTJ A;  4LDW A;  4JJC A;  1K0S A;  2XDB A;  1M8M A;  4L5G A;  4C8Q B;  5KE3 A;  2CP0 A;  3HPW A;  2CSI A;  3CCM Q;  2JW4 A;  1M9S A;  4JZ3 A;  2YRV A;  1VQK Q;  3WXM B;  2DRM A;  1I81 A;  4EPC A;  3EGU A;  3OYG A;  4A63 B;  1YIT T;  1KQS S;  3CCQ Q;  1WQ7 A;  2LQN A;  4J9I A;  3QDF A;  2P0P A;  2YUN A;  3HRS A;  3GIB A;  4BI3 A;  3UA7 A;  2YXY A;  2HD0 A;  5GAN 7;  1JBM A;  2DTH A;  4J9H A;  2HZY A;  1VQN A;  3SFM A;  3M0T A;  1TUC A;  3OQ5 A;  4ELY C;  4IUU A;  4KGX B;  5AYF A;  2A28 A;  2KGT A;  3CBP A;  1ARK A;  3EGX A;  5D6Y A;  1B3Q A;  1YNZ A;  2DL5 A;  3G71 T;  1GCQ C;  4BB7 A;  2ZZD A;  3DLM A;  1UJ0 A;  4MZM A;  3SD4 A;  2KR3 A;  2X3W D;  2KE9 A;  5C0M A;  1WDX A;  3VS6 A;  2CS7 A;  3CCU A;  2KYM A;  3LGL A;  5IT9 E;  1PRL C;  3LGF A;  2K5I A;  5GAN g;  2LCS A;  3TVT A;  2QXF A;  2A08 A;  5GAN 6;  2L8D A;  3EGD B;  3NGP A;  1PWT A;  1ZSG A;  4N4I A;  1VQM Q;  2ZAE A;  4J83 A;  4BUG A;  5GAM j;  2FPD A;  4FW1 A;  1YI2 Q;  3VKI A;  1OPL A;  4C8Q E;  4OMP A;  1O9S A;  1WQW A;  2CZ0 B;  1UJY A;  3RKX A;  2PUO B;  3C94 A;  3NPF A;  1PRM C;  4BY6 B;  1WNL A;  3FEO A;  1VQ5 A;  2I2L A;  4PLI A;  3CD6 Q;  1A0N B;  3EFO B;  3G6E Q;  2EVR A;  3P8H A;  1AWJ A;  2QI2 A;  1S72 Q;  3DB4 A;  3CCV T;  3BY7 A;  3UDC A;  1YBY A;  5FU6 B;  4PNO A;  4XU3 A;  1W4S A;  3CCV Q;  3CC7 A;  4E7I A;  1YIJ Q;  2AZV A;  2DVE A;  2NUT B;  2K3X A;  2DO3 A;  2RQW A;  1K0X A;  1GBR A;  5FU7 C;  2NWM A;  3QWY A;  4EMK A;  1WX6 A;  4J5Y A;  3QG1 A;  2RHI A;  2G6F X;  2O88 A;  1RAA B;  1M90 C;  1SHF A;  5GAN 4;  1GCQ A;  1YCY A;  2BUD A;  2QA4 Q;  2GFU A;  3SB2 A;  3QBY A;  2WSF E;  3CC4 T;  4XK8 E;  2FRY A;  2GTO A;  2EQM A;  1ZBJ A;  2X4X A;  1W70 A;  2MI6 A;  1NPR A;  2D0N A;  2COZ A;  3S3O A;  1TTH B;  1OU9 A;  4Y91 A;  3JRZ A;  1QP2 A;  3E2U A;  5DM7 R;  4M75 A;  1Z9Z A;  1DJ7 B;  3GLX A;  2DER A;  5GMK i;  4J6X A;  2K9G A;  1UGP B;  1ZA1 B;  1NLP C;  4JZ4 A;  2L2P A;  1B07 A;  2C0I A;  2VV5 A;  4LN2 A;  2OX7 A;  1VQM T;  2QQ9 A;  2PZ1 A;  3PMI A;  4KUD K;  1ZSZ C;  2QEX T;  2L5Q A;  3M55 A;  1T3S A;  3ZEH A;  2DZC A;  1X43 A;  5GAN d;  1G83 A;  3EGX B;  5I22 A;  4ZNX A;  3BDU A;  4MMK A;  2BZX A;  3PVQ A;  1YJW Q;  1VQO T;  4KUL A;  5GAN j;  2JJ9 A;  1RL2 A;  3HRU A;  3CXC A;  3CC4 A;  4PJL A;  1JXM A;  3X20 B;  2CH4 W;  2O2O A;  4M78 G;  3X28 B;  1K9M R;  2QA4 A;  4LUD A;  4E7K A;  1HD3 A;  1J3T A;  1NYF A;  1N9R A;  2IVW A;  1JJ2 S;  1GL5 A;  3FJP A;  1W1F A;  4L6V 5;  3M54 A;  5FWB A;  1BU1 A;  2F69 A;  4C0F A;  1WFW A;  3QXE B;  1PG5 B;  1G3W A;  2DE0 X;  2CYZ B;  3QWX X;  2ATC B;  4OVA A;  1YIJ A;  3CCM A;  1JQQ A;  4J9G A;  5KYY B;  1TUD A;  4NL3 A;  2HKN A;  3UPU A;  2R57 A;  4F7U A;  2VGN A;  9ATC B;  4PJO D;  1IB8 A;  4X9D A;  2F2W A;  4OGC A;  2RQV A;  1KQS A;  4MML A;  4M75 C;  3CMA T;  2FEI A;  2A0F B;  2AK5 A;  3UWN A;  2RM4 A;  3REB B;  3A8L B;  1E6H A;  3I55 T;  4M7D B;  1C0M A;  3GNF B;  5GAN h;  2DNU A;  4OMQ A;  1I1J A;  1IHW A;  3FDR A;  2MWO A;  2YLB A;  2K2M A;  1YHQ A;  1D1B A;  1UGV A;  4XAX B;  4N0A C;  1K4U S;  5LL6 S;  5DLQ E;  1TG0 A;  3CPF A;  5KCH A;  2P4T A;  3JB9 J;  1V1C A;  1U1T A;  3VS0 A;  3CC7 Q;  2VKN A;  2RQR A;  1Y57 A;  4M7A B;  1RAD B;  2RI2 A;  3TQ7 P;  3L2R A;  2DZ9 A;  3GNG A;  3EHQ A;  4JRQ A;  3H9N A;  1M1G A;  1ZX6 A;  1ABQ A;  2K3B A;  1BI1 A;  2COW A;  2E3I A;  5KYY A;  2GCX A;  2XDD A;  4IIO A;  1K1Z A;  1RAI B;  2E4H A;  2JUF A;  2E1H A;  1GCP A;  4F7U B;  1RUW A;  2QQB A;  2MCN A;  1OPK A;  3OYN A;  3L2Q A;  4N4H A;  5IHN A;  5CKF A;  5L8R E;  2DK3 A;  2O4X A;  3VYH B;  4XU1 A;  3TRE A;  2HKQ B;  1K9A A;  2OAU A;  5LJ5 h;  2H3E B;  4FM4 B;  1SG5 A;  2RI5 A;  3DB3 A;  1RAC B;  4RG2 A;  3VU3 C;  1VIE A;  1AD5 A;  1D3B B;  2ED1 A;  4OML A;  1VQ6 Q;  3CD6 A;  1TSF A;  1MUZ A;  3NHN A;  2PQW A;  4JJD A;  3MHX A;  3E1S A;  2XD0 A;  1ZA2 B;  2BKD N;  1SHG A;  4Z88 A;  1D0Y A;  4IKF A;  4BE2 A;  1BIB A;  4J7I A;  1NJI U;  4RTV A;  1OUL A;  2LX9 A;  3C12 A;  4M75 F;  5GAN e;  2Y90 A;  3N5B B;  2RMO A;  2MAM A;  1UHC A;  2PUK B;  4X1V A;  1QCO A;  1R8O B;  2RJD A;  4HVW A;  3LW5 E;  5CKE A;  2RHU A;  2KK4 A;  2DA9 A;  2OTJ T;  2V1Q A;  4RTU A;  2AHJ B;  1Y71 A;  4IIM A;  4RG8 A;  3CC2 Q;  3QSU A;  4DOV A;  3G6E T;  3M9Q A;  2NLU A;  3J81 E;  2MIO A;  5A0D A;  5CO7 A;  4IUP A;  2DET A;  4QKU A;  2RJC A;  4M75 G;  3VUZ A;  1AT1 B;  1K8A R;  4FT2 A;  4M7D F;  1H8K A;  1G3T A;  2LNH B;  5KYU A;  1PNJ A;  3LWH A;  2QQS A;  1QVF P;  4M75 D;  2D0Q B;  3EH1 A;  2E41 A;  4QT7 A;  1MNE A;  4EMG A;  5HK0 A;  5KCO A;  3X26 B;  4C0Z A;  2F2V A;  4PJO C;  2K3Y A;  2HNI A;  2E65 A;  1WYX A;  1VQ8 Q;  1Q86 C;  3P8D A;  3SWN A;  1PM3 A;  1Y0M A;  2DBM A;  2WAC A;  4PFZ A;  3QJ6 A;  3GPL A;  3EFO A;  1UGQ B;  3VS1 A;  5GAO r;  1AWO A;  1TS9 A;  2RHX A;  3CEY A;  2JM8 A;  3CCE A;  2JS2 A;  2JTM A;  2HEQ A;  1VYU A;  3JCM J;  4J9B A;  3V8K A;  2DKG A;  1YJ9 T;  3OSV A;  1Y7X A;  4F7U F;  2OJ2 A;  3CME A;  5CAI A;  4J9F A;  4YTL A;  2NUT A;  2XDP A;  2O01 E;  1NG2 A;  2DIL A;  1WJQ A;  2DRK A;  3M0R A;  3KUF A;  5KYN A;  3LLR A;  2ZGW A;  2YRD A;  1ZQ1 A;  4RUG A;  4RTW A;  2YSQ A;  1VQL T;  1JO8 A;  3EG0 A;  3GF5 A;  1FMK A;  3OYM A;  2QGG A;  2Z0W A;  3JB9 D;  5EC7 A;  3OYK A;  2F2X A;  1M1K R;  2J6K A;  2DPP B;  2EIF A;  2DD5 A;  1VQ4 Q;  3CCJ A;  3RUX A;  4DA4 A;  1QVP A;  3SDZ A;  5M9O A;  2VGM A;  2Y4Y A;  1RLQ C;  3VJP A;  4M75 B;  4PK4 A;  1D3B A;  3G4S A;  3H0F A;  4C8Q A;  2V8J A;  3MO8 A;  2GTJ A;  1BBZ A;  2M0Y A;  2DM1 A;  3OYF A;  2EGA A;  2EYW A;  3SWN B;  4FSS A;  2DTO A;  4KRT A;  2O9V A;  1X6G A;  4C5H A;  3MEA A;  4OB0 B;  1AWX A;  4HCK A;  3EG3 A;  1Y96 B;  3OMG A;  3M57 A;  2ENM A;  2K57 A;  5GAM g;  3PVL A;  1N8R U;  2COY A;  3CCR Q;  2K6D A;  4Y28 E;  4M77 A;  1WJS A;  1IGQ A;  1I5L A;  1NEG A;  2XID A;  2LRQ A;  2E12 A;  1JJ2 P;  1EFN A;  2DBK A;  4M7A C;  1IGU A;  1ZUY A;  3E9G A;  2E5K A;  1XOV A;  2DIQ A;  4FYY B;  4XU2 A;  1CKA A;  3M0U A;  2AKL A;  2DTI A;  1MND A;  3THK A;  5DY9 A;  1Q7Y C;  4RTY A;  3CCR T;  2VB6 A;  2EGE A;  5IAY A;  3PNW C;  5GAO n;  2CH4 A;  4M7A F;  4E2F B;  3VS2 A;  4DQ2 A;  1CSK A;  3A5Z B;  2KBT A;  4AFQ C;  1WHG A;  2V26 A;  2X9H A;  2JZ2 A;  4ESR A;  3X24 B;  4OB1 B;  2L3P A;  3G71 Q;  1OOT A;  2ESW A;  2H3J A;  3EFR A;  1LVK A;  3GBQ A;  1KC8 R;  2C06 A;  5J3B A;  1VQ9 T;  2G3R A;  4XTZ A;  3FJ5 A;  3TCJ A;  5FWC A;  1MV3 A;  3MET A;  3FLG A;  3ZL7 C;  1G5V A;  5CQX A;  1M30 A;  3CMA A;  2SRC A;  1RAB B;  1SEM A;  1D0Z A;  2OTJ Q;  1BCO A;  4M7D E;  1W2B A;  2F1L A;  1HSQ A;  3QZ9 B;  4C92 B;  4PFO A;  2DYI A;  4ZTF A;  1QW1 A;  1VA7 A;  2B8A A;  2HAX A;  3WVD B;  1K73 R;  4E7Z A;  2RQT A;  3A1P A;  4KGZ B;  5J26 A;  3CPW A;  1IXD A;  1KFZ A;  1H92 A;  4KBM B;  4M77 C;  1H64 1;  3A8O B;  1M3C A;  1UEB A;  4QW2 A;  2RPN A;  1OV3 A;  3J80 E;  1FXX A;  4M75 E;  3EHR A;  2RO0 A;  3FIF A;  3G71 A;  2YUQ A;  4M7A A;  2EQU A;  2NUZ A;  2NYS A;  2JTF A;  2PVO B;  5FRN A;  5LJ5 f;  3X25 B;  4EMK B;  3HHT B;  1S72 T;  2LTO A;  2X4Y A;  2GF7 A;  2BTT A;  4DEY A;  1OZ3 A;  2RNA A;  4JUV A;  1Q95 G;  4XTY A;  4QVD A;  3GOX A;  3NMZ C;  4C0D B;  5D7U A;  2MMP A;  2LQ8 A;  4IUV A;  1M2V A;  1YJW A;  3OA6 A;  1AOJ A;  4NL2 A;  3H0I A;  1YIT A;  4M77 G;  4JRK A;  1K73 U;  1N5Z A;  4QQ6 A;  2LDM A;  4HCB A;  4BDZ A; 
#chains in the Genus database with same CATH homology
 3C0C A;  2ECZ A;  2F2W A;  2EPD A;  2CUD A;  2RQV A;  1UG1 A;  2AKK A;  2L3S A;  2HDA A;  1VYT A;  3M0P A;  1GBQ A;  2FEI A;  4R0K A;  2AK5 A;  2W0Z A;  2LJ3 A;  5HCK A;  2L0A A;  3REB B;  3I35 A;  2BZY A;  1E6H A;  1AZG B;  3U23 A;  2P4R A;  1S1N A;  2DNU A;  4OMQ A;  1I1J A;  2J7I A;  4Y92 A;  1WA7 A;  2K2M A;  4D8K A;  2OAW A;  1UGV A;  1PKS A;  2JMA A;  5IXF A;  1K4U S;  1AVZ C;  2JT4 A;  2JTE A;  1TG0 A;  1UEC A;  1YP5 A;  2KRO A;  4RTT A;  3RNJ A;  2HCK A;  1ZUU A;  2X3X D;  1V1C A;  2DYB A;  3VS0 A;  2EKH A;  1AEY A;  2J05 A;  1X27 A;  2VKN A;  2RQR A;  2EW3 A;  1Y57 A;  4LE9 A;  2EBP A;  4AFZ C;  1AZE A;  2CT4 A;  3UA6 A;  2DL8 A;  2YT6 A;  3EHQ A;  3UAT A;  1KIK A;  1NLO C;  1ZX6 A;  4AFS C;  2RN8 A;  2M51 A;  1ABQ A;  2K3B A;  1RI9 A;  4IIO A;  1K1Z A;  1ZUK A;  1GCP A;  1JU5 C;  2JMC A;  5FW9 A;  1RUW A;  2MCN A;  2JS0 A;  1T3L A;  1OPK A;  3I5S A;  2LJ1 A;  5IHN A;  4JJB A;  4E6R A;  5L23 A;  2JXB A;  2J06 A;  4ORZ A;  2DX1 A;  2XMF A;  3A98 A;  4CC2 A;  1IO6 A;  1K9A A;  3O5Z A;  5IH2 A;  2GBQ A;  2B86 A;  2C0O A;  2CT3 A;  2EQI A;  2K7A A;  4OML A;  1AD5 A;  2ED1 A;  1MUZ A;  2YUO A;  4D8D A;  3NHN A;  2KRN A;  2AZS A;  2FG0 A;  4JJD A;  2DL4 A;  1QLY A;  1UUE A;  1M3A A;  2KT1 A;  1SHG A;  4Z88 A;  2W10 A;  3LH5 A;  2OI3 A;  2YDL A;  3VS3 A;  1PKT A;  2FRW A;  1X6B A;  4RTV A;  2GNC A;  1YN8 A;  2EYZ A;  1NYG A;  2FO0 A;  1SRL A;  2RMO A;  1UHC A;  2D8J A;  4X1V A;  4RTX A;  4HVW A;  2LMJ A;  2H8H A;  1NM7 A;  2DA9 A;  1QWE A;  2V1Q A;  1RLP C;  3I9Q A;  4RTU A;  4F17 A;  3PE0 A;  3JV3 A;  2RQU A;  4IIM A;  1UHF A;  5IHK A;  4JPB W;  1E7O A;  2QDL A;  2MIO A;  4CC4 B;  2SEM A;  4RTZ A;  3KFV A;  4F16 A;  2CUB A;  1WXU A;  4HVU A;  2J6O A;  4HVV A;  1QCF A;  2RF0 A;  3SEM A;  2DMO A;  2PNI A;  1X2K A;  2DJQ A;  2DL3 A;  1H8K A;  2LNH B;  2D1X A;  1M27 C;  1PNJ A;  4JJC A;  1K0S A;  1M8M A;  2ROT A;  2VVK A;  3VS5 A;  2CSI A;  4WCI A;  4QT7 A;  2ROL A;  2JW4 A;  1U3O A;  1ABO A;  4JZ3 A;  2F2V A;  4F14 A;  1WYX A;  2DRM A;  1Z9Q A;  3EGU A;  1KSW A;  2KRM A;  4A63 B;  1Y0M A;  1GFC A;  2DBM A;  2C0T A;  2GQI A;  1HJD A;  3VS1 A;  1AWO A;  2JM8 A;  2JS2 A;  2EYX A;  4Z8A A;  4DEX A;  2KXC A;  2LQN A;  1I0C A;  1X69 A;  1YWP A;  2HEQ A;  4J9I A;  3SHW A;  1VYU A;  2YUN A;  4J9B A;  3EG1 A;  4LUE A;  2HSP A;  2VWF A;  4GBQ A;  2JM9 A;  1UTI A;  2OJ2 A;  3UA7 A;  4J9H A;  4J9F A;  4EIK A;  1TUC A;  2DVJ A;  2KRS A;  3M0T A;  1UE9 A;  1G2B A;  2L3Q A;  1LCK A;  1NG2 A;  2DIL A;  2A28 A;  2KGT A;  1ARK A;  2DRK A;  3M0R A;  1B3Q A;  1YNZ A;  2DL5 A;  1GCQ C;  2KNB B;  2ABL A;  4RUG A;  1QKX A;  1UJ0 A;  4RTW A;  2YSQ A;  4J9E A;  1JO8 A;  1M3B A;  2KR3 A;  3EG0 A;  2X3W D;  2KE9 A;  1FMK A;  1WDX A;  1WXT A;  1GRI A;  3VS6 A;  5EC7 A;  2KYM A;  1YCS B;  3I5R A;  3REA B;  2F2X A;  1PRL C;  3VRY A;  2J6K A;  2KT8 A;  1U5S A;  1SPK A;  2O31 A;  1I07 A;  1AWW A;  1T0H A;  2KEA A;  2LCS A;  4GLM A;  3TVT A;  4J9D A;  2A08 A;  4CC7 A;  2LJ0 A;  3NGP A;  1BB9 A;  4Z89 A;  1PWT A;  1RLQ C;  1ZSG A;  3H0F A;  2GTJ A;  1BBZ A;  2FPD A;  2M0Y A;  2DM1 A;  2EGA A;  2EYW A;  1OPL A;  1WI7 A;  2GGR A;  4OMP A;  4FSS A;  4KRT A;  2O9V A;  1X6G A;  1UJY A;  1AWX A;  4HCK A;  3EG3 A;  1X2Q A;  3NPF A;  2ENM A;  1PRM C;  1U06 A;  3PVL A;  2IIM A;  2CDT A;  2DL7 A;  2HBW A;  2EGC A;  1A0N B;  2K6D A;  1T0J A;  1WIE A;  2EVR A;  5IXB A;  1AWJ A;  2EYY A;  1NEG A;  2LQW A;  1EFN A;  2BZ8 A;  1VYV A;  2DBK A;  1ZUY A;  3CQT A;  2E5K A;  1XOV A;  3R6N A;  4AG2 C;  2D8H A;  2AZV A;  4M4Z A;  1MV0 B;  1CKA A;  2RQW A;  1K0X A;  3M0U A;  2AKL A;  1GBR A;  2NWM A;  4K11 A;  3THK A;  3QWY A;  3EG2 A;  2V1R A;  1QKW A;  1WX6 A;  4RTY A;  2G6F X;  1GFD A;  4OMM A;  1FYN A;  2EGE A;  2O88 A;  3RBB B;  1SHF A;  1ZLM A;  2CH4 A;  1GCQ A;  3VS2 A;  1CSK A;  2KBT A;  2FRY A;  3VS4 A;  2GTO A;  4AFQ C;  4OMN A;  1OEB A;  1ZBJ A;  4ESR A;  1W70 A;  2O9S A;  2D0N A;  2ED0 A;  2L3P A;  1OOT A;  2A36 A;  2ESW A;  3GBQ A;  3ULR B;  3UF4 A;  4LNP A;  2DF6 A;  1WXB A;  2K79 A;  3FJ5 A;  2FPE A;  5FWC A;  1MV3 A;  1Z9Z A;  1JEG A;  3ZL7 C;  1M30 A;  2SRC A;  1SEM A;  2CSQ A;  1HSQ A;  1UFF A;  2K9G A;  1KJW A;  1NLP C;  4JZ4 A;  2L2P A;  1K76 A;  1B07 A;  2KYB A;  1NEB A;  2C0I A;  1JXO A;  4LN2 A;  3M0S A;  2LZ6 B;  2CRE A;  1VA7 A;  2LX7 A;  2PZ1 A;  3H0H A;  1E6G A;  1T3S A;  2RQT A;  4J9C A;  1X43 A;  1G83 A;  4AFU C;  5I22 A;  4ZNX A;  3TSW A;  2LP5 A;  1KFZ A;  1YWO A;  1H92 A;  2BZX A;  3TSZ A;  1H3H A;  3PVQ A;  1M3C A;  2RPN A;  1OV3 A;  5I11 A;  3EHR A;  2J6F A;  2YUQ A;  1JXM A;  2CH4 W;  2O2O A;  4CC3 A;  5ECA A;  1BK2 A;  2NUZ A;  4LUD A;  2KXD A;  3M0Q A;  1J3T A;  1HD3 A;  1NYF A;  1UDL A;  2A37 A;  1SRM A;  5GJW B;  1QWF A;  1SSH A;  2DLP A;  1GL5 A;  3VS7 A;  3VRZ A;  1W1F A;  3IQL A;  1CKB A;  2BTT A;  4DEY A;  5FWB A;  1BU1 A;  2RNA A;  1WFW A;  2I0N A;  5GJV B;  2DE0 X;  1PHT A;  3QWX X;  4OMO A;  4HXJ A;  3NMZ C;  2PTK A;  1JQQ A;  4J9G A;  5IHI A;  1W6X A;  1TUD A;  1AOJ A;  1WLP B;  2MOX A;  3H0I A;  2YUP A;  3H41 A;  2FPF A;  4AG1 C;  1N5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...