1MV3A

Nmr structure of the tumor suppressor bin1: alternative splicing in melanoma and interaction with c-myc
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
213
structure length
213
Chain Sequence
b'DGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILSLFEDTFVPEISVTTPSQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKKLEKCRGVFPENFTERVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myc box dependent interacting protein 1
publication title A structure-based model of the c-Myc/Bin1 protein interaction shows alternative splicing of Bin1 and c-Myc phosphorylation are key binding determinants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 15
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2002-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1mv3A01
1BBZA 4Z8AA 3QWXX 3VS2A 2DNUA 2KGTA 3M0RA 2NWMA 2KRSA 2IIMA 1BK2A 4J9CA 2ROLA 3I5SA 2BZYA 3UATA 1NEGA 2HDAA 1V1CA 3THKA 4J9DA 2RMOA 4ESRA 2DL4A 1G2BA 3VRZA 4IIMA 2RNAA 1GFCA 2D8HA 1FYNA 2HCKA 1MV3A 3RNJA 1AWXA 1WIEA 1QWFA 1NLOC 2VVKA 4RTZA 1K0SA 1ZX6A 1X43A 2OI3A 5GJWB 1UGVA 2KYBA 3PE0A 5IHIA 2EKHA 2PNIA 1ZSGA 2AKKA 2DRMA 4KRTA 2YUOA 3H41A 1MUZA 3I35A 4LE9A 4JPBW 4Z88A 1W1FA 3JV3A 4QT7A 4F16A 2FPDA 4GLMA 2DF6A 2NUZA 1NEBA 1QLYA 2F2VA 4J9HA 2DX1A 2MOXA 1B3QA 2DL3A 2LQNA 3CQTA 1N5ZA 2P4RA 2KRMA 4J9IA 3VS1A 2LQWA 1NG2A 1JQQA 1YWOA 2ED1A 3VS4A 4LUDA 1NYFA 2KXCA 4E6RA 1T3SA 3M0TA 1SHGA 2GNCA 1Z9QA 1PHTA 2JW4A 1HSQA 3TSWA 2RPNA 2X3WD 2GGRA 3VS5A 1WX6A 2J6FA 2D0NA 3QWYA 1WXTA 4OMNA 3SHWA 2CT3A 1Z9ZA 1X27A 4IIOA 3NGPA 1AWWA 2AK5A 2CSIA 1NLPC 1TG0A 3PVQA 3I5RA 2W0ZA 4FSSA 1JXOA 3EG2A 1KJWA 2LZ6B 1NM7A 1ZBJA 2KT8A 4HVUA 3M0QA 2YT6A 1GBQA 2BZ8A 2GTOA 1GL5A 2ESWA 4AFUC 1RI9A 2E5KA 2AKLA 2LJ0A 4CC3A 1J3TA 2A08A 2K79A 1PRMC 1YNZA 3VS6A 1B07A 1HD3A 2KROA 3O5ZA 4HCKA 2AZSA 2EGCA 2G6FX 4OMOA 2JT4A 1UFFA 1TUCA 2D8JA 1SEMA 2RQRA 3ZL7C 1AZEA 4OMQA 2L0AA 3EGUA 1VYVA 1I0CA 2DL8A 1UJYA 1JO8A 2FEIA 2W10A 1WLPB 4RTUA 2SRCA 5IXBA 4D8KA 2JM8A 4ORZA 3A98A 2YUQA 2J6KA 4J9BA 1WI7A 1QKWA 4EIKA 2ED0A 2BTTA 1QKXA 2RQVA 1JU5C 1ZUKA 1IO6A 2KYMA 4AG2C 1S1NA 2OAWA 1BB9A 2JM9A 4JZ4A 5EC7A 5HCKA 2LJ3A 2O88A 4AG1C 4ZNXA 4RTYA 2K2MA 1U3OA 2CREA 2RF0A 4DEYA 2KNBB 5L23A 3RBBB 2DL7A 3EG0A 1E6HA 1OEBA 4JZ3A 1A0NB 1SPKA 2RQTA 3VRYA 3GBQA 3NPFA 2O9VA 1K4US 1WDXA 2VKNA 4CC4B 2MIOA 1SHFA 1UG1A 2GQIA 2L3PA 3PVLA 1OV3A 1LCKA 1VYUA 2YDLA 3VS7A 2FO0A 1EFNA 3KFVA 2M51A 2XMFA 2I0NA 2DA9A 2V1QA 1AD5A 2CH4W 4R0KA 4J9GA 1WXUA 2EYXA 4D8DA 1AOJA 1QCFA 4RTWA 2KE9A 4CC7A 1M3CA 2HEQA 2GTJA 2BZXA 4RTVA 1HJDA 2ECZA 1K9AA 4HXJA 1CKBA 1YCSB 2DBKA 3UA6A 2DLPA 2LJ1A 1RLQC 5FWBA 5IXFA 1TUDA 1AWOA 1ABOA 2O2OA 4JJDA 2GBQA 3REBB 4HVWA 2JXBA 2O9SA 1E7OA 2J6OA 1M3BA 1U06A 2PZ1A 2J7IA 3H0HA 3C0CA 1Y57A 4AFQC 2EQIA 1RUWA 3NHNA 1U5SA 1VA7A 2DE0X 1UTIA 1FMKA 1UJ0A 1ZUUA 2J06A 4CC2A 1NYGA 4Z89A 3R6NA 1AEYA 3UA7A 1OOTA 3ULRB 2CT4A 4F17A 4OMPA 1UDLA 4M4ZA 3U23A 1KSWA 2FG0A 1WYXA 5IHNA 1QWEA 1WFWA 2EVRA 1KIKA 2O31A 2EYZA 3UF4A 2DILA 2A37A 1ABQA 2SEMA 3REAB 2RQWA 2K7AA 2YUPA 3EG1A 1ZUYA 1AVZC 1AWJA 3H0FA 3LH5A 2K9GA 3H0IA 1X69A 2KT1A 1JXMA 4JJBA 3IQLA 2K3BA 1SRLA 1T0JA 2A36A 3EHQA 2EBPA 5FWCA 4OMMA 2EGAA 2B86A 1WXBA 4Y92A 2YUNA 2EGEA 2LMJA 1Y0MA 3FJ5A 3M0PA 2EPDA 4HVVA 2CH4A 1X6GA 1T0HA 2C0TA 2DYBA 1CSKA 2EW3A 4OMLA 1K1ZA 2KXDA 1M3AA 2DVJA 1ARKA 2F2WA 1W6XA 1UHFA 4LN2A 1JEGA 2JMAA 3VS3A 4J9FA 1YWPA 2LCSA 2L2PA 2DMOA 4A63B 3M0UA 2DRKA 1GBRA 1T3LA 3VS0A 1H8KA 5GJVB 2RQUA 1WA7A 2QDLA 4RUGA 1X6BA 2D1XA 1X2KA 1W70A 2HBWA 2YSQA 1BU1A 4RTTA 1CKAA 2CUBA 1M27C 2DJQA 2DM1A 1UECA 2JTEA 1MV0B 2X3XD 3EG3A 2AZVA 4DEXA 5I11A 4K11A 5IHKA 1OPKA 4LUEA 1VYTA 2JMCA 2MCNA 4AFSC 1YP5A 1I07A 1RLPC 1GRIA 2C0IA 1UHCA 2CSQA 2KBTA 2V1RA 5IH2A 2ROTA 2ENMA 1GCPA 1M8MA 4AFZC 1SSHA 2J05A 4X1VA 1GFDA 4JJCA 2LNHB 2FRWA 1SRMA 2DL5A 3M0SA 4WCIA 1PRLC 2HSPA 3EHRA 3TSZA 1K0XA 1YN8A 2LP5A 2C0OA 2K6DA 4GBQA 2CDTA 1ZLMA 1PWTA 2KRNA 1UUEA 1GCQA 2F2XA 1K76A 2ABLA 1GCQC 2DBMA 2LX7A 5ECAA 1AZGB 5FW9A 1I1JA 4F14A 1PNJA 2FPEA 1H3HA 4J9EA 1PKSA 2JS2A 2OJ2A 2CUDA 2A28A 1UE9A 2EYWA 1E6GA 2RN8A 2PTKA 2KR3A 1X2QA 2FRYA 4LNPA 3I9QA 3SEMA 2M0YA 2EYYA 4RTXA 2KEAA 3TVTA 1H92A 1G83A 2L3QA 1XOVA 2H8HA 1M30A 2VWFA 1KFZA 5I22A 1OPLA 1PKTA 2L3SA 3NMZC 2FPFA 2JS0A
chains in the Genus database with same CATH superfamily
1BBZA 2RI2A 2DNUA 2FL7A 4OMFB 5A0GA 2NWMA 4M75A 1BK2A 4J9CA 3I5SA 1NEGA 2E12A 1V1CA 1R8OB 4Y28E 5LJ3h 4J9DA 1Q81R 2K3XA 4JRPA 2DL4A 4F7UA 4ANJA 3C95A 2MWPA 4OF1A 2AIRB 2DD5A 4IIMA 4TVRA 1BIAA 4X34A 2RNAA 5LJ5e 2EQKA 3RNJA 4A54A 4DA4A 1P92A 2D9TA 1X43A 4C5HA 2OTLA 1IB8A 2EKHA 3OMCA 4PLLA 1VQOT 2HBPA 3Q1JA 2YRVA 2ZCFB 2DRMA 2JN0A 4KRTA 3SFMA 2MMPA 2P0QA 2L89A 3CC2A 4LE9A 4F16A 4MMLA 3OYBA 2ZGWA 3OQ5A 1QVGS 2DX1A 2MOXA 2LRQA 5LJ3f 2LQNA 1VQ7Q 2OTJT 2JNGA 3MCAB 3VS1A 2LQWA 1NG2A 3UDCA 2QK0A 4M78B 3C94A 4IKFA 2F69A 2RHXA 3CCUA 2X3WD 3CCQT 3VS5A 1YITA 2J6FA 4O6JA 1MHNA 1Z9ZA 2QG9B 1W2BP 2E70A 2XDDA 1S72T 1KHIA 4Z02A 2CGHA 2PU9B 2HL3A 1M90R 1JXOA 3EG2A 2EJ9A 4PJOB 1KJWA 2LZ6B 3CCST 2HD0A 4HVUA 3M0QA 1GBQA 2GTOA 1GL5A 4N4GA 3VYHB 2AKLA 3CCVQ 2MI6A 3M9QA 4M7DA 1N8RU 4BB7A 1YNZA 2MPXC 1B07A 3O5ZA 3RUXA 2AT1B 1VQPT 2EGCA 4OMOA 2L0AA 5KCHA 4N4HA 3G71T 3EGUA 2DL8A 1YJWQ 2RJFA 1VQMQ 4QW2A 3M57A 3INZA 3CEYA 5J26A 5GAN2 1YIJA 2IPOB 3CCRA 3S6WA 2ED0A 1QKXA 2WACA 5C6SA 1Q82U 3QDRB 2COWA 1IO6A 2H3JA 3JB9H 2KYMA 4FYXB 4AG2C 2QYZA 4M78F 1XJWB 4A4FA 4AG1C 1NJIU 4ZNXA 2CREA 4M77G 4DEYA 3L2VA 3CC4T 1QCNA 3EG0A 2V8IA 1E6HA 3X20B 1ZBXA 5CAIA 1OEBA 4RCBA 1SPKA 2WSEE 3VRYA 4X9DA 1VQKA 2O9VA 1K4US 5AYFA 2HSEB 5DY9A 2MIOA 4PJOD 1UG1A 3BE3A 1QVGA 1I5LA 1KQSA 2BIVA 2YDLA 4PJOF 4C0FA 2RI5A 2FO0A 5HK3A 3KFVA 2NUTB 2XMFA 4C8QG 3OYMA 4XU3A 1VQ8T 4FSXA 3AT1B 2V1QA 3OYNA 1RAGB 4J9GA 4M77D 4RTWA 5GAMh 5GANh 3JB9G 1M3CA 3MP8A 4FU6A 2M02A 2BZXA 2XICA 4BI4A 3SWNB 4HXJA 1I8FA 2VC8A 1RABB 2V8JA 3LLRA 1KHCA 2DLPA 2XU8A 3M4GA 3BFMA 2IG0A 4BDYA 2X51A 3SDZA 5AT1B 1HK9A 2E3HA 4HVWA 4C5IA 4KT0E 4J83A 3MEVA 5IN1A 1YJ9Q 2EIFA 2AHJB 2FHDA 5IAYA 3JB9D 2J7IA 1VQNQ 3CPFA 3CXCS 2QA4Q 2VYTA 2DTHA 2DJZA 4DBFA 3A8OB 2PUOB 1VA7A 1UTIA 2FYKA 2M9UA 4BI3A 2J06A 2COYA 4Z89A 5GAMf 3PGGA 5GANf 1YI2T 1R0CB 4M7DC 3ULRB 2CT4A 4OMPA 3M55A 4EDUA 2JZ2A 2NUPA 2YXYA 3MEUA 4PK4A 5IHNA 4BI8B 3A5ZB 4XAXB 4Y91A 3G4SQ 2XDBA 2EVRA 1WJSA 2EYZA 1Y96B 3ZFJA 1H641 1AT1B 1W2BS 3REAB 2YUPA 4C92B 1G3YA 2QQBA 1JXMA 2KAFA 1VQ5A 5LJ5h 1VQ4T 5KYNA 2K4YA 3FIFA 1WXBA 4JRQA 4M7AB 5L8RE 2YUNA 5GMKm 3FJ5A 3FB9A 2X4YA 4LXCA 1KD1C 2CH4A 2EW3A 2D6FA 2CZ6B 5I2SA 2KXDA 2BUDA 1M3AA 1C1AA 4LN2A 1BI1A 3HL8A 1K8AU 2ZPIB 5DLQE 4N0AC 1KQ1A 3QDFA 1C6VX 1IGQA 2RI3A 2LCSA 3CMAQ 2OTJQ 2DRKA 5KH6A 3T9NA 2LT4A 2QEXT 1D1BA 5GJVB 4E47A 4KUIA 3CCET 1UGRB 2D1XA 4LDVA 4BD3A 3JAME 3V8KA 3TEEA 4HKEA 2CUBA 1H3ZA 2DJQA 1S72Q 3EG3A 2AZVA 5I11A 4K11A 4FT2A 3M5AA 2CP6A 2KVQG 2MCNA 5FLXE 3I55T 3PT9A 2A7YA 1K9MC 4FYWB 4C92D 3OSVA 4C5EA 1UHCA 1M2VB 3E9FA 4XTUA 1QP3A 3TU4K 4C92F 2L3RA 2E4HA 4M7AD 1SSHA 4PJOA 4NL2A 1GFDA 3EGDB 3MJXA 2PQWA 4M7AF 2DL5A 2MWOA 1Q86R 2HSPA 4E7JA 2LCLA 4PJMA 1M1KC 3OA6A 1RAFB 3FLGA 1K76A 2MAMA 2ABLA 2LT1A 5DM7R 3PIOA 3FRNA 5ECAA 4J5YA 2JVVA 4F14A 5KYXB 1W2BA 4FYVB 1QP2A 3WVEB 3OYKA 3JCMe 4J9EA 5LJ3g 1OU9A 2DO3A 1G3TA 4CRIA 2OJ2A 4FCYA 1Q81U 4IUVA 2A0FB 2EYWA 3I9QA 3SEMA 1U1SA 2DAQA 2XDPA 2HNIA 1Y07A 2H8HA 3LX7A 1QVFS 3OYDA 1OPLA 5GAOp 1PSFA 4YTLA 3CMEA 4XU0A 2CZ7B 2KGTA 1MNEA 3M0RA 3HP9A 2KRSA 2IIMA 2CP5A 2DD4A 3HSBA 3HRSA 2GFUA 4XTYA 2DEUA 2BZYA 3UATA 2HDAA 3THKA 3JCMb 4NOYA 4ESRA 3VRZA 5D6YA 2OTLT 2HCKA 1M1FA 3CCLT 2NLUA 1JRIA 1K73C 2E5QA 4RTZA 1K0SA 3CC2T 3LGFA 3LH0A 4OP0A 1N9RA 2DXTA 5GJWB 1KD1R 1O9SA 3A1PA 3EAEA 5IHIA 3L42A 2BE9B 2VXEA 2VXFA 4EMGA 3M56A 3VJPA 3LW5E 1Y71A 2YUOA 4PNOA 1M90U 3I35A 3CBMA 4QT7A 1D09B 3OYHA 3GIBA 3SWNA 2DF6A 3MO8A 1WHGA 2NUZA 1NEBA 1YBYA 3PTAA 4J9HA 3CCUT 3CQTA 2R57A 4J9IA 1PD1A 1Q7YC 1TWBA 2CP7A 1YWOA 1YITT 3VS4A 3D7SB 1NYFA 2R5MA 3QIIA 4E6RA 4JLGA 2GNCA 2LDMA 4MMKA 1HSQA 2GGRA 3PIPA 3OYEA 2CT3A 3HKSA 1RACB 1W4SA 4HA8A 3CCMQ 1NLPC 1TG0A 3I5RA 3OW2P 4ATOA 1NM7A 2G3RA 4M77C 3JCMc 1RI9A 2E5KA 4MDXA 2LJ0A 2A08A 4JUVA 2EWNA 1HD3A 2KROA 1Y96A 2DTOA 1G8XA 1VQLQ 4J6WA 4KH0B 2JT4A 4C92A 4C8QC 1SEMA 1YIJT 1AZEA 4M75E 1VQ6T 1RADB 4PL6A 3CCRT 3OYGA 9ATCB 4M7AA 3QO3A 1WLPB 4D8KA 4RG8A 1EIFA 4OGEA 4GY5A 3QG1A 4J7FA 4IUTA 4F7UE 1MNDA 3H9NA 4J9BA 1QKWA 5C0MA 3CCEQ 1KC8C 1DJ7B 4QQGA 3WXMB 1JU5C 3EGXB 1D1AA 5CKBA 1ZUKA 1VQ9Q 5GAMg 1S1NA 5GANg 4MDWA 1BB9A 3I56Q 5HCKA 1VQKT 2O88A 1I81A 3HHTB 3VKIA 1Q95G 2K2MA 1U3OA 4EMKA 1OX9A 3G1JA 2DL7A 1M4ZA 3L2UA 3A8GB 3CC7Q 3I55Q 2XHCA 2GQIA 2DETA 3CXCP 3H6ZA 1VYUA 3PMIA 2MF2A 1EFNA 4UC4A 1VUBA 2NYSA 2DA9A 3MKDA 1AD5A 1MMAA 1YJNA 2OAUA 5LJ3d 1YHQA 4R0KA 3SWNC 3PNWC 2HKQB 4D8DA 2DXBA 1PCXA 2H3EB 5FRNA 2JTFA 4LD9K 2XK0A 4NS5A 2ECZA 1K9AA 1M2VA 5LJ5j 3TREA 1YCSB 5GAOl 4FL6A 3G6EQ 1WHMA 3OMGA 1QCOA 3EGDA 4ZGDB 3GPLA 3A8HB 1ZQ1A 4JJDA 3HRTA 1BKBA 3QXEB 2O9SA 1E7OA 3JCMh 2QQAA 2F1LA 4AFQC 5CQYA 2EQIA 5LJ5g 3NHNA 2FZKB 5KYXA 1U5SA 2DE0X 2KY9A 1UJ0A 4CC2A 1PM3A 1NYGA 2FVUA 3VUZA 2P4TA 3R6NA 1AEYA 4M77B 3C4SA 1OOTA 2Y90A 1LVKA 2EYQA 4M4ZA 3U23A 4OB0B 1KSWA 4C92C 2RHUA 1ACMB 1WFWA 2F5TX 2O4XB 1BCOA 1QW1A 1ZSZB 1VQ5T 4GLKA 2O31A 3L2WA 1I4K1 1N8RC 2EFIA 4M7AC 4BE2A 3CD6Q 4C8QB 2RQWA 2K7AA 4Q5WA 4M78G 5FRMA 1ZUYA 3CCLQ 3H0FA 3JCMf 3OW2S 1IHWA 3FJPA 2K3BA 2A36A 3P8DA 3EHQA 4OMMA 2B86A 3CC2Q 3P8BB 2LMJA 1YJ9A 4R55A 4QVCA 1T0HA 2C0TA 1MGQA 3CCJT 2QA4A 3DB3A 4OMLA 4E7IA 1N6AA 5LL6S 1B7TA 1U1TA 1ARKA 4DBRA 4EMKC 4N0AA 3MEWA 2JMAA 3VS3A 3J7AF 1ZA1B 1G3WA 3CCUQ 2L2PA 3EH1A 3UPUA 2A3LA 3M0UA 4J6XA 5KYYA 1GBRA 3JB9I 2YRDA 3G4SA 4FIBA 1KK7A 4ZTJA 4FT4A 2DERA 1X6BA 4MZTA 3TCJA 2HBWA 2RH2A 5HY6A 3JCMJ 1Q86U 1M27C 1KQ2A 4M77F 1UECA 2X3XD 4E7SA 2QASA 2QQRA 4ZGJB 4JS5A 1IXDA 1PG5B 2Z0WA 1VYTA 4PFZA 3DLMA 1V29B 2RB6A 4E7HA 1YFNA 4AFSC 2XD0A 4C8QD 3ZEHA 1GRIA 2C0IA 4J8OA 2FB7A 3RKYA 2CSQA 2KBTA 2V1RA 4C8QF 2QGGA 1D0ZA 1C0MA 1QVFP 2ENMA 1GCPA 4E7KA 1OZ2A 2L5QA 4BUGA 3CMAA 1X6OA 4X1VA 3JB9F 3NFCA 2FRWA 1SRMA 2RHZA 4JS4A 1VQ6Q 5GAMd 3EHRA 3TSZA 5GANd 4GBQA 3QZ9B 5KYWB 1X01A 4OVAA 1EX4A 1PD0A 1UUEA 2RA2A 3TQ7P 1TH7A 2F2XA 3OS2A 2DBMA 2P84A 5FW9A 5KYUB 1I1JA 5GAOq 2BE7D 2VASA 1PNJA 2QXFA 2FPEA 2E65A 4B6MA 1S72A 1PKSA 2JS2A 2LNVA 3OW2A 2R58A 3META 2E10A 2RN8A 5CKFA 2KR3A 4XU1A 5A0DA 3CMET 2QAZA 1H92A 1G83A 1XOVA 3MHXA 3QKJA 3GOXA 2R5AA 1TOVA 2YLBA 1PKTA 1VIFA 2FPFA 2JS0A 3EGXA 3VS2A 3S3OA 1KD1U 1VQOQ 2EJGA 2ROLA 4JJNK 4HCBA 3C12A 2EJFA 1RAIB 4RMOA 3LYIA 4HT9A 4XK8E 2QQSA 1GFCA 2D8HA 1FYNA 4EMKB 1MV3A 2ZPHB 1M2OA 1XNIA 2LVMA 1AWXA 5CO7A 1FMVA 2K3YA 1TXQA 1NLOC 2VVKA 1K8AC 5LJ5d 1OZ3A 3ER0A 3L2RA 3CCQQ 5LJ5f 4A4EA 2OI3A 3PE0A 4M78E 2Y4YA 2PNIA 1ZSGA 2DIQA 3H41A 3HFNA 1UGQB 3CCSQ 2QTVA 1WPYA 4JPBW 4Z88A 3DB4A 3JV3A 4V2SA 1XQHA 2FPDA 4GLMA 3PFSA 3EG9A 2DVEA 2F2VA 3QJ6A 3CXCA 2DL3A 3GP8A 1F1BB 4BY6C 1N5ZA 2P4RA 2KRMA 5GAN6 3LWHA 1JQQA 4M75G 4PJOE 2RK1A 5J3BA 2KXCA 1VQPQ 1T3SA 3M0TA 1SHGA 1Z9QA 2CP2A 2DFUA 3TSWA 2RPNA 2DXCA 1ZHIA 5IT9E 3RIRA 4F7UG 2D0NA 4OMNA 3G71Q 3SHWA 1VQ5Q 3FEOA 1GXIE 1X27A 1WQ7A 5CIUA 4IIOA 4F04B 2E64A 1AWWA 1R77A 4FSSA 5I2MA 1O75A 4M77A 1OX8A 2DZCA 2KT8A 1NBEB 2XG8D 1D3BA 2E6ZA 4M75D 4AFUC 4CC3A 2K79A 2CZ0B 3M58A 2O4XA 1ZSZA 2D0QB 3VS6A 3CCJQ 3H8ZA 2AZSA 4C8QA 2P0PA 4NL3A 2G6FX 2BKDN 1TUCA 3CC4Q 2D8JA 3ZL7C 3OBWA 1QMCA 3NTHA 3UT1A 3SB2A 1Q81C 1VYVA 5CKHA 1WGSA 2PVDB 1UJYA 1WJQA 1JO8A 2FEIA 2W10A 4RTUA 3WVDB 2SRCA 1IRXA 4ORZA 2YUQA 1D0XA 1WI7A 3OS1A 1VQ8Q 2I2LA 3CCMA 4JDSA 1QVPA 4D6WA 4VUBA 2JM9A 2JTMA 4JZ4A 2LJ3A 4JLIA 1OYXA 3V8LA 2RF0A 2OX7A 3VYGA 2DKGA 2KNBB 5L23A 3RBBB 1KQSP 2EQMA 3N5BB 3G7ZA 5KYYB 3X24B 4L5GA 3NPFA 4BDZA 1LNXA 1YJNT 1YHQT 4CC4B 4M7DG 1VQLA 3PVLA 2L3PA 2X4WA 3VS7A 4ZGEB 3JCMg 2EAYA 2M51A 4X9CA 2RO0A 2CH4W 4EPCA 1WXUA 2RK2A 4A4GA 2RHYA 1M8VA 5CVIA 1B34B 1YI2Q 1TS9A 2HEQA 2Y4XA 3CCEA 4QQ6A 3DKMA 1M90C 1CKBA 2X4XA 3UA6A 4BY6B 1BIBA 3EFOB 1VQ9A 2YRCA 2LJ1A 1RLQC 4QQDA 5FWBA 5IXFA 3JCMQ 3I56A 2B8AA 3RKXA 2O2OA 2ZPBB 3RESA 1UB4A 2JXBA 4BACA 3QUIA 2EQUA 5KYWA 3CBPA 1M3BA 1U06A 4HT8A 2PZ1A 3H0HA 3C0CA 3CC7A 3I55A 1N9SA 1VQ4Q 4IUUA 1MMDA 4B9WA 5KYUA 1K9MR 1WHJA 2QQ9A 1QVFA 3EFRA 4XTZA 5A2QE 2WSCE 2KSSA 2KMTA 3HRUA 4IUPA 1ZSZC 4F17A 1N27A 1UDLA 2ZAEA 5CK9A 3AHUA 2FG0A 1VQ7A 2M16A 4AT1B 1M1KR 2DXUA 3UF4A 3G6EA 3RMSA 1YJ9T 1ABQA 2LQ8A 2LQKA 4E7LA 5CQXA 2QEXQ 3V7SA 2GCXA 1AVZC 1AWJA 3LH5A 5D7UA 2K9GA 3H0IA 1X69A 2QA4T 2L8DA 4JJBA 2FZGB 2O01E 3IQLA 1SRLA 3MP1A 2HQEA 2EGAA 2QDYB 5FWCA 4Y92A 4AMCA 2XKOC 3R6OA 4CI0C 4FM4B 2EGEA 1Y0MA 4ZN1A 3OS0A 2K57A 5KE2A 2YLCA 4PJJA 1PSEA 2DYBA 1CSKA 1UGSB 1VIEA 1K1ZA 2K2VA 3CCVA 3OBYA 1M1GA 5FROA 3X28B 2RHIA 5CKDA 2K5LA 1JEGA 4FW2A 8AT1B 3G4ST 3RMQA 1YWPA 5EG2A 2GQVA 4BE1A 1TSFA 4OB1B 2DMOA 3JCMW 4A63B 1LPLA 1T3LA 4PFPA 3VS0A 1UGPB 2GF7A 3RKWA 2XIDA 3VU3C 3RDVA 1H8KA 3BY7A 3OS5A 2RQUA 5GAN4 1LJOA 3OYYA 1YJWA 3RR6A 2QDLA 4HCZA 1VQMA 3CD6A 1BU1A 3NTIA 1M9SA 1CKAA 2DM1A 4PLIA 3CCLA 5HK0A 2JTEA 2HMAA 1MV0B 1G3SA 1WQWA 4L6V5 1D1CA 1K73R 1BCMA 3EG9B 5IHKA 1HXDA 4LUEA 2JMCA 1MMNA 3S3NA 4RKUE 1KQSS 3CMAT 4E2FB 3OYAA 1YP5A 1I07A 1UEBA 2CZ1B 1SSFA 4JRIA 2E41A 2ATCB 4AFZC 3URGA 2J05A 1YCYA 1JBMA 4JJCA 4M7DE 5DLOA 1VOMA 5GAN5 3M0SA 1Q7YR 4WCIA 1PRLC 5M9OA 4A4HA 3OSSC 1K0XA 2LP5A 4ELYC 2CP0A 2K6DA 2VB6A 1ZLMA 3OYIA 1PWTA 3EFSA 1FWZA 5GAN8 4LDUA 1IREB 2ZPFB 1D3BB 1GCQC 3QSUA 3M4YA 4C0DB 3JCMV 1WHHA 5GAOr 3A8LB 3A8MB 3JCMP 2KQWA 4KGXB 4P5NA 1UE9A 3J81E 1E6GA 2HAXA 1X2QA 4LNPA 2OTLQ 2PVGB 4RTXA 3JCMd 1FXXA 2KEAA 3TVTA 5GAOm 1M30A 2VWFA 3ASKA 2K5FA 2L3SA 3NMZC 1TUGB 1RAEB 4Z8AA 3QWXX 1IZ6A 1YJNQ 1YHQQ 1WHLA 6AT1B 2EQJA 1VQNA 4A4KA 3CPWP 2ZPGB 3GNFB 3NTKA 4PFOA 4M75C 4XU2A 1BI3A 3LGLA 1SF9A 1VQ6A 4R56A 3QYGB 4PJOG 1AHJB 2RMOA 3X25B 1Q82C 1G2BA 4M78D 4ELZC 3OYFA 2DZ9A 4LDWA 2P0KA 1YITQ 1BI0A 3QPHA 1NJIC 1RI0A 1WIEA 1KC8R 3QYHB 3OYLA 1QWFA 2M0OA 1ZX6A 2CYZB 4XTXA 4IUQA 1UGVA 2KYBA 1OU8A 2X9HA 1NPRA 2AKKA 5FU6C 1MUZA 2QTXA 1B34A 2LCCA 5A0LA 3JB9J 1W1FA 3OB9A 4C0GA 2VUBA 4J7IA 7AT1B 4IURA 1QLYA 1VQOA 3EFOA 4E7ZA 1B3QA 1JJ2P 4QVZA 1Q86C 2ED1A 4XQ3A 4XTWA 3KBGA 4LUDA 3MP6A 4N4IA 4LDYA 2IVWA 1D0YA 4FW1A 1PHTA 2JW4A 3QHSA 1IGUA 3ME9A 1YIJQ 2OTJA 3V8JA 3LWIA 3CCRQ 1WX6A 5GMKl 3QWYA 4RCCA 1WXTA 4PKCC 1M5Q1 3VV0A 3JSCA 3NGPA 1V76A 2V8KA 2AK5A 2CSIA 3PVQA 5D6WA 5CR2A 2W0ZA 2HQXA 1NE8A 2DIGA 3JCMX 1ZBJA 2DTIA 4ME7A 3CCQA 1FX7A 2YT6A 2BZ8A 2ZZDA 2ESWA 2QGFB 3L1AA 2DYIA 2RJCA 3MPUB 4FYYB 5HKCA 4DOVA 4BE0A 1J3TA 1WJRA 2RD1A 3CCSA 3O8VA 3MEAA 1PRMC 1VQKQ 4HCKA 3DLLA 3QZ5B 1UFFA 3CBOA 2RQRA 4KUDK 2PUKB 4OMQA 2M1HA 1I0CA 4MZMA 4ZN3A 3CCMT 1NZ9A 4O5VA 2LX9A 1VQPA 1KG1A 2E3IA 3M59A 5IXBA 2V26A 2JM8A 3A98A 2J6KA 3GNGA 4KGZB 3G71A 2C06A 4EIKA 2BTTA 1RAAB 1Y7XA 3PMTA 2RQVA 3HFOA 3S3MA 2LC4A 5GMKe 1N8RR 1JB0E 4M75B 2PVOB 2OAWA 4JRKA 5EC7A 1RAHB 1XTDA 3GLXA 1SG5A 4RTYA 3L2QA 2KDSA 3L2ZA 1VQLT 3FDRA 5GAN7 4F7UB 2QI2A 1WNLA 2WSFE 4JZ3A 1A0NB 2CP3A 2RQTA 1RL2A 3GBQA 3CCJA 1WDXA 2VKNA 8ATCB 3FC3A 1SHFA 5LJ3e 3E19A 4B9XA 2JJ9A 4L59A 1OV3A 5KCOA 1LCKA 3CC4A 4PJLA 2HZYA 3CPWS 4EMHA 3BDUA 2I0NA 2VV5A 4C92G 1Q82R 4PJNA 2E1HA 5CCAA 2EYXA 2KI7A 1AOJA 1QCFA 2X35A 5FU6B 3M54A 4QKUA 1VQ9T 1K9MU 2KE9A 5GMKi 4M7AG 3I56T 1NJIR 4CC7A 1U8RA 5GMKj 2GTJA 1VQ8A 4RTVA 4M78A 1HJDA 2K5IA 2DBKA 1ZA2B 1MMGA 1TUDA 4WF2A 3CC7T 1AWOA 1ABOA 4M77E 1G5VA 3REBB 2GBQA 4HCCA 1M1KU 2CS7A 5CKEA 2J6OA 1OQKA 1R0BG 5D6XA 5LJ3j 4QVDA 1Y57A 1RUWA 2RJDA 4M75F 1FMKA 1ZUUA 1VQ7T 5FU7C 2HQHA 1TU0B 4C8QE 1WHKA 3UA7A 2VGMA 4KBMB 1JJ2S 1WZOA 2MYSA 4LD6A 3G6ET 3M53A 4F7UF 4KGVB 3E9GA 1WYXA 2JUFA 3ZBDA 1QWEA 1YI2A 4M7DB 1KIKA 3QJYA 1OULA 1SKUB 2FZCB 2DILA 2A37A 1LOJA 4J6YA 2SEMA 2CKKA 4MZPA 1X75C 3EG1A 3SD4A 3HTRA 3VUBA 2KT1A 1I5OB 3OYJA 4DOWA 1T0JA 2MK5A 2EBPA 3CCVT 3EH2A 2COZA 3QBYA 3M0PA 2EPDA 4HVVA 1X6GA 3HPWA 2DK3A 2F5KA 4OB3B 3J80E 4DQ2A 1VQ4A 2DVJA 1QVGP 2F2WA 1NPPA 1W6XA 1UHFA 1K73U 3OYCA 1TTHB 4J9FA 3CPWA 1QQJA 5J39A 1YJWT 2GFAA 3X26B 1VQMT 4WTOB 2ZPEB 2EKOA 3UWNA 3CD6T 3BDLA 3RERA 2YWWA 3GF5A 3BW1A 3V7RA 3KXTA 1WA7A 4XTVA 2DPPB 2E6NA 2NUTA 5GAN3 4RUGA 4DBHA 1X2KA 1W70A 2YSQA 4RTTA 5KE3A 2QEXA 1Q7YU 3F70A 4DBQA 4DEXA 1K8AR 2YHTA 4M78C 4C5GA 1OPKA 4M7DD 5I21A 2X4JA 3E1SA 4M7DF 3OY9A 1RLPC 2RM4A 5IH2A 3CMEQ 4KH1B 4RG2A 1OI1A 2ROTA 5GAMe 5GANe 1M8MA 1JJ2A 2RJEA 3KUFA 4PJOC 2LNHB 3P8HA 4C0DC 3E2UA 4C0ZA 2HKNA 1YN8A 2C0OA 2CDTA 2VGNA 2JOYA 2KRNA 4C92E 1GCQA 1IHVA 1PC0A 3JRZA 4KULA 2LX7A 1AZGB 1HYOA 5FU7B 4M7AE 2KK4A 1H3HA 2XI9A 2CUDA 1BYMA 2A28A 4OGCA 4A53A 2HL5C 2PTKA 2FRYA 3V7CA 2M0YA 2EYYA 5GAOn 1EZZB 2LTOA 4OB2B 4ZTFA 2NUPB 1FMWA 5GMKh 1VQNT 2L3QA 1BI2A 1KC8U 5GAMj 1KFZA 5I22A 5GANj 2DEQA 4LDXA 4II1A
chains in the Genus database with same CATH topology
1BBZA 4Z8AA 3QWXX 3VS2A 2DNUA 2KGTA 3M0RA 2NWMA 2KRSA 2IIMA 1BK2A 4J9CA 2ROLA 3I5SA 2BZYA 3UATA 1NEGA 2HDAA 1V1CA 3THKA 4J9DA 2RMOA 4ESRA 2DL4A 1G2BA 3VRZA 4IIMA 2RNAA 1GFCA 2D8HA 1FYNA 2HCKA 1MV3A 3RNJA 1AWXA 1WIEA 1QWFA 1NLOC 2VVKA 4RTZA 1K0SA 1ZX6A 1X43A 2OI3A 5GJWB 1UGVA 2KYBA 3PE0A 5IHIA 2EKHA 2PNIA 1ZSGA 2AKKA 2DRMA 4KRTA 2YUOA 3H41A 1MUZA 3I35A 4LE9A 4JPBW 4Z88A 1W1FA 3JV3A 4QT7A 4F16A 2FPDA 4GLMA 2DF6A 2NUZA 1NEBA 1QLYA 2F2VA 4J9HA 2DX1A 2MOXA 1B3QA 2DL3A 2LQNA 3CQTA 1N5ZA 2P4RA 2KRMA 4J9IA 3VS1A 2LQWA 1NG2A 1JQQA 1YWOA 2ED1A 3VS4A 4LUDA 1NYFA 2KXCA 4E6RA 1T3SA 3M0TA 1SHGA 2GNCA 1Z9QA 1PHTA 2JW4A 1HSQA 3TSWA 2RPNA 2X3WD 2GGRA 3VS5A 1WX6A 2J6FA 2D0NA 3QWYA 1WXTA 4OMNA 3SHWA 2CT3A 1Z9ZA 1X27A 4IIOA 3NGPA 1AWWA 2AK5A 2CSIA 1NLPC 1TG0A 3PVQA 3I5RA 2W0ZA 4FSSA 1JXOA 3EG2A 1KJWA 2LZ6B 1NM7A 1ZBJA 2KT8A 4HVUA 3M0QA 2YT6A 1GBQA 2BZ8A 2GTOA 1GL5A 2ESWA 4AFUC 1RI9A 2E5KA 2AKLA 2LJ0A 4CC3A 1J3TA 2A08A 2K79A 1PRMC 1YNZA 3VS6A 1B07A 1HD3A 2KROA 3O5ZA 4HCKA 2AZSA 2EGCA 2G6FX 4OMOA 2JT4A 1UFFA 1TUCA 2D8JA 1SEMA 2RQRA 3ZL7C 1AZEA 4OMQA 2L0AA 3EGUA 1VYVA 1I0CA 2DL8A 1UJYA 1JO8A 2FEIA 2W10A 1WLPB 4RTUA 2SRCA 5IXBA 4D8KA 2JM8A 4ORZA 3A98A 2YUQA 2J6KA 4J9BA 1WI7A 1QKWA 4EIKA 2ED0A 2BTTA 1QKXA 2RQVA 1JU5C 1ZUKA 1IO6A 2KYMA 4AG2C 1S1NA 2OAWA 1BB9A 2JM9A 4JZ4A 5EC7A 5HCKA 2LJ3A 2O88A 4AG1C 4ZNXA 4RTYA 2K2MA 1U3OA 2CREA 2RF0A 4DEYA 2KNBB 5L23A 3RBBB 2DL7A 3EG0A 1E6HA 1OEBA 4JZ3A 1A0NB 1SPKA 2RQTA 3VRYA 3GBQA 3NPFA 2O9VA 1K4US 1WDXA 2VKNA 4CC4B 2MIOA 1SHFA 1UG1A 2GQIA 2L3PA 3PVLA 1OV3A 1LCKA 1VYUA 2YDLA 3VS7A 2FO0A 1EFNA 3KFVA 2M51A 2XMFA 2I0NA 2DA9A 2V1QA 1AD5A 2CH4W 4R0KA 4J9GA 1WXUA 2EYXA 4D8DA 1AOJA 1QCFA 4RTWA 2KE9A 4CC7A 1M3CA 2HEQA 2GTJA 2BZXA 4RTVA 1HJDA 2ECZA 1K9AA 4HXJA 1CKBA 1YCSB 2DBKA 3UA6A 2DLPA 2LJ1A 1RLQC 5FWBA 5IXFA 1TUDA 1AWOA 1ABOA 2O2OA 4JJDA 2GBQA 3REBB 4HVWA 2JXBA 2O9SA 1E7OA 2J6OA 1M3BA 1U06A 2PZ1A 2J7IA 3H0HA 3C0CA 1Y57A 4AFQC 2EQIA 1RUWA 3NHNA 1U5SA 1VA7A 2DE0X 1UTIA 1FMKA 1UJ0A 1ZUUA 2J06A 4CC2A 1NYGA 4Z89A 3R6NA 1AEYA 3UA7A 1OOTA 3ULRB 2CT4A 4F17A 4OMPA 1UDLA 4M4ZA 3U23A 1KSWA 2FG0A 1WYXA 5IHNA 1QWEA 1WFWA 2EVRA 1KIKA 2O31A 2EYZA 3UF4A 2DILA 2A37A 1ABQA 2SEMA 3REAB 2RQWA 2K7AA 2YUPA 3EG1A 1ZUYA 1AVZC 1AWJA 3H0FA 3LH5A 2K9GA 3H0IA 1X69A 2KT1A 1JXMA 4JJBA 3IQLA 2K3BA 1SRLA 1T0JA 2A36A 3EHQA 2EBPA 5FWCA 4OMMA 2EGAA 2B86A 1WXBA 4Y92A 2YUNA 2EGEA 2LMJA 1Y0MA 3FJ5A 3M0PA 2EPDA 4HVVA 2CH4A 1X6GA 1T0HA 2C0TA 2DYBA 1CSKA 2EW3A 4OMLA 1K1ZA 2KXDA 1M3AA 2DVJA 1ARKA 2F2WA 1W6XA 1UHFA 4LN2A 1JEGA 2JMAA 3VS3A 4J9FA 1YWPA 2LCSA 2L2PA 2DMOA 4A63B 3M0UA 2DRKA 1GBRA 1T3LA 3VS0A 1H8KA 5GJVB 2RQUA 1WA7A 2QDLA 4RUGA 1X6BA 2D1XA 1X2KA 1W70A 2HBWA 2YSQA 1BU1A 4RTTA 1CKAA 2CUBA 1M27C 2DJQA 2DM1A 1UECA 2JTEA 1MV0B 2X3XD 3EG3A 2AZVA 4DEXA 5I11A 4K11A 5IHKA 1OPKA 4LUEA 1VYTA 2JMCA 2MCNA 4AFSC 1YP5A 1I07A 1RLPC 1GRIA 2C0IA 1UHCA 2CSQA 2KBTA 2V1RA 5IH2A 2ROTA 2ENMA 1GCPA 1M8MA 4AFZC 1SSHA 2J05A 4X1VA 1GFDA 4JJCA 2LNHB 2FRWA 1SRMA 2DL5A 3M0SA 4WCIA 1PRLC 2HSPA 3EHRA 3TSZA 1K0XA 1YN8A 2LP5A 2C0OA 2K6DA 4GBQA 2CDTA 1ZLMA 1PWTA 2KRNA 1UUEA 1GCQA 2F2XA 1K76A 2ABLA 1GCQC 2DBMA 2LX7A 5ECAA 1AZGB 5FW9A 1I1JA 4F14A 1PNJA 2FPEA 1H3HA 4J9EA 1PKSA 2JS2A 2OJ2A 2CUDA 2A28A 1UE9A 2EYWA 1E6GA 2RN8A 2PTKA 2KR3A 1X2QA 2FRYA 4LNPA 3I9QA 3SEMA 2M0YA 2EYYA 4RTXA 2KEAA 3TVTA 1H92A 1G83A 2L3QA 1XOVA 2H8HA 1M30A 2VWFA 1KFZA 5I22A 1OPLA 1PKTA 2L3SA 3NMZC 2FPFA 2JS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BBZ A;  4Z8A A;  3QWX X;  3VS2 A;  2DNU A;  2KGT A;  3M0R A;  2NWM A;  2KRS A;  2IIM A;  1BK2 A;  4J9C A;  2ROL A;  3I5S A;  2BZY A;  3UAT A;  1NEG A;  2HDA A;  1V1C A;  3THK A;  4J9D A;  2RMO A;  4ESR A;  2DL4 A;  1G2B A;  3VRZ A;  4IIM A;  2RNA A;  1GFC A;  2D8H A;  1FYN A;  2HCK A;  1MV3 A;  3RNJ A;  1AWX A;  1WIE A;  1QWF A;  1NLO C;  2VVK A;  4RTZ A;  1K0S A;  1ZX6 A;  1X43 A;  2OI3 A;  5GJW B;  1UGV A;  2KYB A;  3PE0 A;  5IHI A;  2EKH A;  2PNI A;  1ZSG A;  2AKK A;  2DRM A;  4KRT A;  2YUO A;  3H41 A;  1MUZ A;  3I35 A;  4LE9 A;  4JPB W;  4Z88 A;  1W1F A;  3JV3 A;  4QT7 A;  4F16 A;  2FPD A;  4GLM A;  2DF6 A;  2NUZ A;  1NEB A;  1QLY A;  2F2V A;  4J9H A;  2DX1 A;  2MOX A;  1B3Q A;  2DL3 A;  2LQN A;  3CQT A;  1N5Z A;  2P4R A;  2KRM A;  4J9I A;  3VS1 A;  2LQW A;  1NG2 A;  1JQQ A;  1YWO A;  2ED1 A;  3VS4 A;  4LUD A;  1NYF A;  2KXC A;  4E6R A;  1T3S A;  3M0T A;  1SHG A;  2GNC A;  1Z9Q A;  1PHT A;  2JW4 A;  1HSQ A;  3TSW A;  2RPN A;  2X3W D;  2GGR A;  3VS5 A;  1WX6 A;  2J6F A;  2D0N A;  3QWY A;  1WXT A;  4OMN A;  3SHW A;  2CT3 A;  1Z9Z A;  1X27 A;  4IIO A;  3NGP A;  1AWW A;  2AK5 A;  2CSI A;  1NLP C;  1TG0 A;  3PVQ A;  3I5R A;  2W0Z A;  4FSS A;  1JXO A;  3EG2 A;  1KJW A;  2LZ6 B;  1NM7 A;  1ZBJ A;  2KT8 A;  4HVU A;  3M0Q A;  2YT6 A;  1GBQ A;  2BZ8 A;  2GTO A;  1GL5 A;  2ESW A;  4AFU C;  1RI9 A;  2E5K A;  2AKL A;  2LJ0 A;  4CC3 A;  1J3T A;  2A08 A;  2K79 A;  1PRM C;  1YNZ A;  3VS6 A;  1B07 A;  1HD3 A;  2KRO A;  3O5Z A;  4HCK A;  2AZS A;  2EGC A;  2G6F X;  4OMO A;  2JT4 A;  1UFF A;  1TUC A;  2D8J A;  1SEM A;  2RQR A;  3ZL7 C;  1AZE A;  4OMQ A;  2L0A A;  3EGU A;  1VYV A;  1I0C A;  2DL8 A;  1UJY A;  1JO8 A;  2FEI A;  2W10 A;  1WLP B;  4RTU A;  2SRC A;  5IXB A;  4D8K A;  2JM8 A;  4ORZ A;  3A98 A;  2YUQ A;  2J6K A;  4J9B A;  1WI7 A;  1QKW A;  4EIK A;  2ED0 A;  2BTT A;  1QKX A;  2RQV A;  1JU5 C;  1ZUK A;  1IO6 A;  2KYM A;  4AG2 C;  1S1N A;  2OAW A;  1BB9 A;  2JM9 A;  4JZ4 A;  5EC7 A;  5HCK A;  2LJ3 A;  2O88 A;  4AG1 C;  4ZNX A;  4RTY A;  2K2M A;  1U3O A;  2CRE A;  2RF0 A;  4DEY A;  2KNB B;  5L23 A;  3RBB B;  2DL7 A;  3EG0 A;  1E6H A;  1OEB A;  4JZ3 A;  1A0N B;  1SPK A;  2RQT A;  3VRY A;  3GBQ A;  3NPF A;  2O9V A;  1K4U S;  1WDX A;  2VKN A;  4CC4 B;  2MIO A;  1SHF A;  1UG1 A;  2GQI A;  2L3P A;  3PVL A;  1OV3 A;  1LCK A;  1VYU A;  2YDL A;  3VS7 A;  2FO0 A;  1EFN A;  3KFV A;  2M51 A;  2XMF A;  2I0N A;  2DA9 A;  2V1Q A;  1AD5 A;  2CH4 W;  4R0K A;  4J9G A;  1WXU A;  2EYX A;  4D8D A;  1AOJ A;  1QCF A;  4RTW A;  2KE9 A;  4CC7 A;  1M3C A;  2HEQ A;  2GTJ A;  2BZX A;  4RTV A;  1HJD A;  2ECZ A;  1K9A A;  4HXJ A;  1CKB A;  1YCS B;  2DBK A;  3UA6 A;  2DLP A;  2LJ1 A;  1RLQ C;  5FWB A;  5IXF A;  1TUD A;  1AWO A;  1ABO A;  2O2O A;  4JJD A;  2GBQ A;  3REB B;  4HVW A;  2JXB A;  2O9S A;  1E7O A;  2J6O A;  1M3B A;  1U06 A;  2PZ1 A;  2J7I A;  3H0H A;  3C0C A;  1Y57 A;  4AFQ C;  2EQI A;  1RUW A;  3NHN A;  1U5S A;  1VA7 A;  2DE0 X;  1UTI A;  1FMK A;  1UJ0 A;  1ZUU A;  2J06 A;  4CC2 A;  1NYG A;  4Z89 A;  3R6N A;  1AEY A;  3UA7 A;  1OOT A;  3ULR B;  2CT4 A;  4F17 A;  4OMP A;  1UDL A;  4M4Z A;  3U23 A;  1KSW A;  2FG0 A;  1WYX A;  5IHN A;  1QWE A;  1WFW A;  2EVR A;  1KIK A;  2O31 A;  2EYZ A;  3UF4 A;  2DIL A;  2A37 A;  1ABQ A;  2SEM A;  3REA B;  2RQW A;  2K7A A;  2YUP A;  3EG1 A;  1ZUY A;  1AVZ C;  1AWJ A;  3H0F A;  3LH5 A;  2K9G A;  3H0I A;  1X69 A;  2KT1 A;  1JXM A;  4JJB A;  3IQL A;  2K3B A;  1SRL A;  1T0J A;  2A36 A;  3EHQ A;  2EBP A;  5FWC A;  4OMM A;  2EGA A;  2B86 A;  1WXB A;  4Y92 A;  2YUN A;  2EGE A;  2LMJ A;  1Y0M A;  3FJ5 A;  3M0P A;  2EPD A;  4HVV A;  2CH4 A;  1X6G A;  1T0H A;  2C0T A;  2DYB A;  1CSK A;  2EW3 A;  4OML A;  1K1Z A;  2KXD A;  1M3A A;  2DVJ A;  1ARK A;  2F2W A;  1W6X A;  1UHF A;  4LN2 A;  1JEG A;  2JMA A;  3VS3 A;  4J9F A;  1YWP A;  2LCS A;  2L2P A;  2DMO A;  4A63 B;  3M0U A;  2DRK A;  1GBR A;  1T3L A;  3VS0 A;  1H8K A;  5GJV B;  2RQU A;  1WA7 A;  2QDL A;  4RUG A;  1X6B A;  2D1X A;  1X2K A;  1W70 A;  2HBW A;  2YSQ A;  1BU1 A;  4RTT A;  1CKA A;  2CUB A;  1M27 C;  2DJQ A;  2DM1 A;  1UEC A;  2JTE A;  1MV0 B;  2X3X D;  3EG3 A;  2AZV A;  4DEX A;  5I11 A;  4K11 A;  5IHK A;  1OPK A;  4LUE A;  1VYT A;  2JMC A;  2MCN A;  4AFS C;  1YP5 A;  1I07 A;  1RLP C;  1GRI A;  2C0I A;  1UHC A;  2CSQ A;  2KBT A;  2V1R A;  5IH2 A;  2ROT A;  2ENM A;  1GCP A;  1M8M A;  4AFZ C;  1SSH A;  2J05 A;  4X1V A;  1GFD A;  4JJC A;  2LNH B;  2FRW A;  1SRM A;  2DL5 A;  3M0S A;  4WCI A;  1PRL C;  2HSP A;  3EHR A;  3TSZ A;  1K0X A;  1YN8 A;  2LP5 A;  2C0O A;  2K6D A;  4GBQ A;  2CDT A;  1ZLM A;  1PWT A;  2KRN A;  1UUE A;  1GCQ A;  2F2X A;  1K76 A;  2ABL A;  1GCQ C;  2DBM A;  2LX7 A;  5ECA A;  1AZG B;  5FW9 A;  1I1J A;  4F14 A;  1PNJ A;  2FPE A;  1H3H A;  4J9E A;  1PKS A;  2JS2 A;  2OJ2 A;  2CUD A;  2A28 A;  1UE9 A;  2EYW A;  1E6G A;  2RN8 A;  2PTK A;  2KR3 A;  1X2Q A;  2FRY A;  4LNP A;  3I9Q A;  3SEM A;  2M0Y A;  2EYY A;  4RTX A;  2KEA A;  3TVT A;  1H92 A;  1G83 A;  2L3Q A;  1XOV A;  2H8H A;  1M30 A;  2VWF A;  1KFZ A;  5I22 A;  1OPL A;  1PKT A;  2L3S A;  3NMZ C;  2FPF A;  2JS0 A; 
#chains in the Genus database with same CATH topology
 1BBZ A;  2RI2 A;  2DNU A;  2FL7 A;  4OMF B;  5A0G A;  2NWM A;  4M75 A;  1BK2 A;  4J9C A;  3I5S A;  1NEG A;  2E12 A;  1V1C A;  1R8O B;  4Y28 E;  5LJ3 h;  4J9D A;  1Q81 R;  2K3X A;  4JRP A;  2DL4 A;  4F7U A;  4ANJ A;  3C95 A;  2MWP A;  4OF1 A;  2AIR B;  2DD5 A;  4IIM A;  4TVR A;  1BIA A;  4X34 A;  2RNA A;  5LJ5 e;  2EQK A;  3RNJ A;  4A54 A;  4DA4 A;  1P92 A;  2D9T A;  1X43 A;  4C5H A;  2OTL A;  1IB8 A;  2EKH A;  3OMC A;  4PLL A;  1VQO T;  2HBP A;  3Q1J A;  2YRV A;  2ZCF B;  2DRM A;  2JN0 A;  4KRT A;  3SFM A;  2MMP A;  2P0Q A;  2L89 A;  3CC2 A;  4LE9 A;  4F16 A;  4MML A;  3OYB A;  2ZGW A;  3OQ5 A;  1QVG S;  2DX1 A;  2MOX A;  2LRQ A;  5LJ3 f;  2LQN A;  1VQ7 Q;  2OTJ T;  2JNG A;  3MCA B;  3VS1 A;  2LQW A;  1NG2 A;  3UDC A;  2QK0 A;  4M78 B;  3C94 A;  4IKF A;  2F69 A;  2RHX A;  3CCU A;  2X3W D;  3CCQ T;  3VS5 A;  1YIT A;  2J6F A;  4O6J A;  1MHN A;  1Z9Z A;  2QG9 B;  1W2B P;  2E70 A;  2XDD A;  1S72 T;  1KHI A;  4Z02 A;  2CGH A;  2PU9 B;  2HL3 A;  1M90 R;  1JXO A;  3EG2 A;  2EJ9 A;  4PJO B;  1KJW A;  2LZ6 B;  3CCS T;  2HD0 A;  4HVU A;  3M0Q A;  1GBQ A;  2GTO A;  1GL5 A;  4N4G A;  3VYH B;  2AKL A;  3CCV Q;  2MI6 A;  3M9Q A;  4M7D A;  1N8R U;  4BB7 A;  1YNZ A;  2MPX C;  1B07 A;  3O5Z A;  3RUX A;  2AT1 B;  1VQP T;  2EGC A;  4OMO A;  2L0A A;  5KCH A;  4N4H A;  3G71 T;  3EGU A;  2DL8 A;  1YJW Q;  2RJF A;  1VQM Q;  4QW2 A;  3M57 A;  3INZ A;  3CEY A;  5J26 A;  5GAN 2;  1YIJ A;  2IPO B;  3CCR A;  3S6W A;  2ED0 A;  1QKX A;  2WAC A;  5C6S A;  1Q82 U;  3QDR B;  2COW A;  1IO6 A;  2H3J A;  3JB9 H;  2KYM A;  4FYX B;  4AG2 C;  2QYZ A;  4M78 F;  1XJW B;  4A4F A;  4AG1 C;  1NJI U;  4ZNX A;  2CRE A;  4M77 G;  4DEY A;  3L2V A;  3CC4 T;  1QCN A;  3EG0 A;  2V8I A;  1E6H A;  3X20 B;  1ZBX A;  5CAI A;  1OEB A;  4RCB A;  1SPK A;  2WSE E;  3VRY A;  4X9D A;  1VQK A;  2O9V A;  1K4U S;  5AYF A;  2HSE B;  5DY9 A;  2MIO A;  4PJO D;  1UG1 A;  3BE3 A;  1QVG A;  1I5L A;  1KQS A;  2BIV A;  2YDL A;  4PJO F;  4C0F A;  2RI5 A;  2FO0 A;  5HK3 A;  3KFV A;  2NUT B;  2XMF A;  4C8Q G;  3OYM A;  4XU3 A;  1VQ8 T;  4FSX A;  3AT1 B;  2V1Q A;  3OYN A;  1RAG B;  4J9G A;  4M77 D;  4RTW A;  5GAM h;  5GAN h;  3JB9 G;  1M3C A;  3MP8 A;  4FU6 A;  2M02 A;  2BZX A;  2XIC A;  4BI4 A;  3SWN B;  4HXJ A;  1I8F A;  2VC8 A;  1RAB B;  2V8J A;  3LLR A;  1KHC A;  2DLP A;  2XU8 A;  3M4G A;  3BFM A;  2IG0 A;  4BDY A;  2X51 A;  3SDZ A;  5AT1 B;  1HK9 A;  2E3H A;  4HVW A;  4C5I A;  4KT0 E;  4J83 A;  3MEV A;  5IN1 A;  1YJ9 Q;  2EIF A;  2AHJ B;  2FHD A;  5IAY A;  3JB9 D;  2J7I A;  1VQN Q;  3CPF A;  3CXC S;  2QA4 Q;  2VYT A;  2DTH A;  2DJZ A;  4DBF A;  3A8O B;  2PUO B;  1VA7 A;  1UTI A;  2FYK A;  2M9U A;  4BI3 A;  2J06 A;  2COY A;  4Z89 A;  5GAM f;  3PGG A;  5GAN f;  1YI2 T;  1R0C B;  4M7D C;  3ULR B;  2CT4 A;  4OMP A;  3M55 A;  4EDU A;  2JZ2 A;  2NUP A;  2YXY A;  3MEU A;  4PK4 A;  5IHN A;  4BI8 B;  3A5Z B;  4XAX B;  4Y91 A;  3G4S Q;  2XDB A;  2EVR A;  1WJS A;  2EYZ A;  1Y96 B;  3ZFJ A;  1H64 1;  1AT1 B;  1W2B S;  3REA B;  2YUP A;  4C92 B;  1G3Y A;  2QQB A;  1JXM A;  2KAF A;  1VQ5 A;  5LJ5 h;  1VQ4 T;  5KYN A;  2K4Y A;  3FIF A;  1WXB A;  4JRQ A;  4M7A B;  5L8R E;  2YUN A;  5GMK m;  3FJ5 A;  3FB9 A;  2X4Y A;  4LXC A;  1KD1 C;  2CH4 A;  2EW3 A;  2D6F A;  2CZ6 B;  5I2S A;  2KXD A;  2BUD A;  1M3A A;  1C1A A;  4LN2 A;  1BI1 A;  3HL8 A;  1K8A U;  2ZPI B;  5DLQ E;  4N0A C;  1KQ1 A;  3QDF A;  1C6V X;  1IGQ A;  2RI3 A;  2LCS A;  3CMA Q;  2OTJ Q;  2DRK A;  5KH6 A;  3T9N A;  2LT4 A;  2QEX T;  1D1B A;  5GJV B;  4E47 A;  4KUI A;  3CCE T;  1UGR B;  2D1X A;  4LDV A;  4BD3 A;  3JAM E;  3V8K A;  3TEE A;  4HKE A;  2CUB A;  1H3Z A;  2DJQ A;  1S72 Q;  3EG3 A;  2AZV A;  5I11 A;  4K11 A;  4FT2 A;  3M5A A;  2CP6 A;  2KVQ G;  2MCN A;  5FLX E;  3I55 T;  3PT9 A;  2A7Y A;  1K9M C;  4FYW B;  4C92 D;  3OSV A;  4C5E A;  1UHC A;  1M2V B;  3E9F A;  4XTU A;  1QP3 A;  3TU4 K;  4C92 F;  2L3R A;  2E4H A;  4M7A D;  1SSH A;  4PJO A;  4NL2 A;  1GFD A;  3EGD B;  3MJX A;  2PQW A;  4M7A F;  2DL5 A;  2MWO A;  1Q86 R;  2HSP A;  4E7J A;  2LCL A;  4PJM A;  1M1K C;  3OA6 A;  1RAF B;  3FLG A;  1K76 A;  2MAM A;  2ABL A;  2LT1 A;  5DM7 R;  3PIO A;  3FRN A;  5ECA A;  4J5Y A;  2JVV A;  4F14 A;  5KYX B;  1W2B A;  4FYV B;  1QP2 A;  3WVE B;  3OYK A;  3JCM e;  4J9E A;  5LJ3 g;  1OU9 A;  2DO3 A;  1G3T A;  4CRI A;  2OJ2 A;  4FCY A;  1Q81 U;  4IUV A;  2A0F B;  2EYW A;  3I9Q A;  3SEM A;  1U1S A;  2DAQ A;  2XDP A;  2HNI A;  1Y07 A;  2H8H A;  3LX7 A;  1QVF S;  3OYD A;  1OPL A;  5GAO p;  1PSF A;  4YTL A;  3CME A;  4XU0 A;  2CZ7 B;  2KGT A;  1MNE A;  3M0R A;  3HP9 A;  2KRS A;  2IIM A;  2CP5 A;  2DD4 A;  3HSB A;  3HRS A;  2GFU A;  4XTY A;  2DEU A;  2BZY A;  3UAT A;  2HDA A;  3THK A;  3JCM b;  4NOY A;  4ESR A;  3VRZ A;  5D6Y A;  2OTL T;  2HCK A;  1M1F A;  3CCL T;  2NLU A;  1JRI A;  1K73 C;  2E5Q A;  4RTZ A;  1K0S A;  3CC2 T;  3LGF A;  3LH0 A;  4OP0 A;  1N9R A;  2DXT A;  5GJW B;  1KD1 R;  1O9S A;  3A1P A;  3EAE A;  5IHI A;  3L42 A;  2BE9 B;  2VXE A;  2VXF A;  4EMG A;  3M56 A;  3VJP A;  3LW5 E;  1Y71 A;  2YUO A;  4PNO A;  1M90 U;  3I35 A;  3CBM A;  4QT7 A;  1D09 B;  3OYH A;  3GIB A;  3SWN A;  2DF6 A;  3MO8 A;  1WHG A;  2NUZ A;  1NEB A;  1YBY A;  3PTA A;  4J9H A;  3CCU T;  3CQT A;  2R57 A;  4J9I A;  1PD1 A;  1Q7Y C;  1TWB A;  2CP7 A;  1YWO A;  1YIT T;  3VS4 A;  3D7S B;  1NYF A;  2R5M A;  3QII A;  4E6R A;  4JLG A;  2GNC A;  2LDM A;  4MMK A;  1HSQ A;  2GGR A;  3PIP A;  3OYE A;  2CT3 A;  3HKS A;  1RAC B;  1W4S A;  4HA8 A;  3CCM Q;  1NLP C;  1TG0 A;  3I5R A;  3OW2 P;  4ATO A;  1NM7 A;  2G3R A;  4M77 C;  3JCM c;  1RI9 A;  2E5K A;  4MDX A;  2LJ0 A;  2A08 A;  4JUV A;  2EWN A;  1HD3 A;  2KRO A;  1Y96 A;  2DTO A;  1G8X A;  1VQL Q;  4J6W A;  4KH0 B;  2JT4 A;  4C92 A;  4C8Q C;  1SEM A;  1YIJ T;  1AZE A;  4M75 E;  1VQ6 T;  1RAD B;  4PL6 A;  3CCR T;  3OYG A;  9ATC B;  4M7A A;  3QO3 A;  1WLP B;  4D8K A;  4RG8 A;  1EIF A;  4OGE A;  4GY5 A;  3QG1 A;  4J7F A;  4IUT A;  4F7U E;  1MND A;  3H9N A;  4J9B A;  1QKW A;  5C0M A;  3CCE Q;  1KC8 C;  1DJ7 B;  4QQG A;  3WXM B;  1JU5 C;  3EGX B;  1D1A A;  5CKB A;  1ZUK A;  1VQ9 Q;  5GAM g;  1S1N A;  5GAN g;  4MDW A;  1BB9 A;  3I56 Q;  5HCK A;  1VQK T;  2O88 A;  1I81 A;  3HHT B;  3VKI A;  1Q95 G;  2K2M A;  1U3O A;  4EMK A;  1OX9 A;  3G1J A;  2DL7 A;  1M4Z A;  3L2U A;  3A8G B;  3CC7 Q;  3I55 Q;  2XHC A;  2GQI A;  2DET A;  3CXC P;  3H6Z A;  1VYU A;  3PMI A;  2MF2 A;  1EFN A;  4UC4 A;  1VUB A;  2NYS A;  2DA9 A;  3MKD A;  1AD5 A;  1MMA A;  1YJN A;  2OAU A;  5LJ3 d;  1YHQ A;  4R0K A;  3SWN C;  3PNW C;  2HKQ B;  4D8D A;  2DXB A;  1PCX A;  2H3E B;  5FRN A;  2JTF A;  4LD9 K;  2XK0 A;  4NS5 A;  2ECZ A;  1K9A A;  1M2V A;  5LJ5 j;  3TRE A;  1YCS B;  5GAO l;  4FL6 A;  3G6E Q;  1WHM A;  3OMG A;  1QCO A;  3EGD A;  4ZGD B;  3GPL A;  3A8H B;  1ZQ1 A;  4JJD A;  3HRT A;  1BKB A;  3QXE B;  2O9S A;  1E7O A;  3JCM h;  2QQA A;  2F1L A;  4AFQ C;  5CQY A;  2EQI A;  5LJ5 g;  3NHN A;  2FZK B;  5KYX A;  1U5S A;  2DE0 X;  2KY9 A;  1UJ0 A;  4CC2 A;  1PM3 A;  1NYG A;  2FVU A;  3VUZ A;  2P4T A;  3R6N A;  1AEY A;  4M77 B;  3C4S A;  1OOT A;  2Y90 A;  1LVK A;  2EYQ A;  4M4Z A;  3U23 A;  4OB0 B;  1KSW A;  4C92 C;  2RHU A;  1ACM B;  1WFW A;  2F5T X;  2O4X B;  1BCO A;  1QW1 A;  1ZSZ B;  1VQ5 T;  4GLK A;  2O31 A;  3L2W A;  1I4K 1;  1N8R C;  2EFI A;  4M7A C;  4BE2 A;  3CD6 Q;  4C8Q B;  2RQW A;  2K7A A;  4Q5W A;  4M78 G;  5FRM A;  1ZUY A;  3CCL Q;  3H0F A;  3JCM f;  3OW2 S;  1IHW A;  3FJP A;  2K3B A;  2A36 A;  3P8D A;  3EHQ A;  4OMM A;  2B86 A;  3CC2 Q;  3P8B B;  2LMJ A;  1YJ9 A;  4R55 A;  4QVC A;  1T0H A;  2C0T A;  1MGQ A;  3CCJ T;  2QA4 A;  3DB3 A;  4OML A;  4E7I A;  1N6A A;  5LL6 S;  1B7T A;  1U1T A;  1ARK A;  4DBR A;  4EMK C;  4N0A A;  3MEW A;  2JMA A;  3VS3 A;  3J7A F;  1ZA1 B;  1G3W A;  3CCU Q;  2L2P A;  3EH1 A;  3UPU A;  2A3L A;  3M0U A;  4J6X A;  5KYY A;  1GBR A;  3JB9 I;  2YRD A;  3G4S A;  4FIB A;  1KK7 A;  4ZTJ A;  4FT4 A;  2DER A;  1X6B A;  4MZT A;  3TCJ A;  2HBW A;  2RH2 A;  5HY6 A;  3JCM J;  1Q86 U;  1M27 C;  1KQ2 A;  4M77 F;  1UEC A;  2X3X D;  4E7S A;  2QAS A;  2QQR A;  4ZGJ B;  4JS5 A;  1IXD A;  1PG5 B;  2Z0W A;  1VYT A;  4PFZ A;  3DLM A;  1V29 B;  2RB6 A;  4E7H A;  1YFN A;  4AFS C;  2XD0 A;  4C8Q D;  3ZEH A;  1GRI A;  2C0I A;  4J8O A;  2FB7 A;  3RKY A;  2CSQ A;  2KBT A;  2V1R A;  4C8Q F;  2QGG A;  1D0Z A;  1C0M A;  1QVF P;  2ENM A;  1GCP A;  4E7K A;  1OZ2 A;  2L5Q A;  4BUG A;  3CMA A;  1X6O A;  4X1V A;  3JB9 F;  3NFC A;  2FRW A;  1SRM A;  2RHZ A;  4JS4 A;  1VQ6 Q;  5GAM d;  3EHR A;  3TSZ A;  5GAN d;  4GBQ A;  3QZ9 B;  5KYW B;  1X01 A;  4OVA A;  1EX4 A;  1PD0 A;  1UUE A;  2RA2 A;  3TQ7 P;  1TH7 A;  2F2X A;  3OS2 A;  2DBM A;  2P84 A;  5FW9 A;  5KYU B;  1I1J A;  5GAO q;  2BE7 D;  2VAS A;  1PNJ A;  2QXF A;  2FPE A;  2E65 A;  4B6M A;  1S72 A;  1PKS A;  2JS2 A;  2LNV A;  3OW2 A;  2R58 A;  3MET A;  2E10 A;  2RN8 A;  5CKF A;  2KR3 A;  4XU1 A;  5A0D A;  3CME T;  2QAZ A;  1H92 A;  1G83 A;  1XOV A;  3MHX A;  3QKJ A;  3GOX A;  2R5A A;  1TOV A;  2YLB A;  1PKT A;  1VIF A;  2FPF A;  2JS0 A;  3EGX A;  3VS2 A;  3S3O A;  1KD1 U;  1VQO Q;  2EJG A;  2ROL A;  4JJN K;  4HCB A;  3C12 A;  2EJF A;  1RAI B;  4RMO A;  3LYI A;  4HT9 A;  4XK8 E;  2QQS A;  1GFC A;  2D8H A;  1FYN A;  4EMK B;  1MV3 A;  2ZPH B;  1M2O A;  1XNI A;  2LVM A;  1AWX A;  5CO7 A;  1FMV A;  2K3Y A;  1TXQ A;  1NLO C;  2VVK A;  1K8A C;  5LJ5 d;  1OZ3 A;  3ER0 A;  3L2R A;  3CCQ Q;  5LJ5 f;  4A4E A;  2OI3 A;  3PE0 A;  4M78 E;  2Y4Y A;  2PNI A;  1ZSG A;  2DIQ A;  3H41 A;  3HFN A;  1UGQ B;  3CCS Q;  2QTV A;  1WPY A;  4JPB W;  4Z88 A;  3DB4 A;  3JV3 A;  4V2S A;  1XQH A;  2FPD A;  4GLM A;  3PFS A;  3EG9 A;  2DVE A;  2F2V A;  3QJ6 A;  3CXC A;  2DL3 A;  3GP8 A;  1F1B B;  4BY6 C;  1N5Z A;  2P4R A;  2KRM A;  5GAN 6;  3LWH A;  1JQQ A;  4M75 G;  4PJO E;  2RK1 A;  5J3B A;  2KXC A;  1VQP Q;  1T3S A;  3M0T A;  1SHG A;  1Z9Q A;  2CP2 A;  2DFU A;  3TSW A;  2RPN A;  2DXC A;  1ZHI A;  5IT9 E;  3RIR A;  4F7U G;  2D0N A;  4OMN A;  3G71 Q;  3SHW A;  1VQ5 Q;  3FEO A;  1GXI E;  1X27 A;  1WQ7 A;  5CIU A;  4IIO A;  4F04 B;  2E64 A;  1AWW A;  1R77 A;  4FSS A;  5I2M A;  1O75 A;  4M77 A;  1OX8 A;  2DZC A;  2KT8 A;  1NBE B;  2XG8 D;  1D3B A;  2E6Z A;  4M75 D;  4AFU C;  4CC3 A;  2K79 A;  2CZ0 B;  3M58 A;  2O4X A;  1ZSZ A;  2D0Q B;  3VS6 A;  3CCJ Q;  3H8Z A;  2AZS A;  4C8Q A;  2P0P A;  4NL3 A;  2G6F X;  2BKD N;  1TUC A;  3CC4 Q;  2D8J A;  3ZL7 C;  3OBW A;  1QMC A;  3NTH A;  3UT1 A;  3SB2 A;  1Q81 C;  1VYV A;  5CKH A;  1WGS A;  2PVD B;  1UJY A;  1WJQ A;  1JO8 A;  2FEI A;  2W10 A;  4RTU A;  3WVD B;  2SRC A;  1IRX A;  4ORZ A;  2YUQ A;  1D0X A;  1WI7 A;  3OS1 A;  1VQ8 Q;  2I2L A;  3CCM A;  4JDS A;  1QVP A;  4D6W A;  4VUB A;  2JM9 A;  2JTM A;  4JZ4 A;  2LJ3 A;  4JLI A;  1OYX A;  3V8L A;  2RF0 A;  2OX7 A;  3VYG A;  2DKG A;  2KNB B;  5L23 A;  3RBB B;  1KQS P;  2EQM A;  3N5B B;  3G7Z A;  5KYY B;  3X24 B;  4L5G A;  3NPF A;  4BDZ A;  1LNX A;  1YJN T;  1YHQ T;  4CC4 B;  4M7D G;  1VQL A;  3PVL A;  2L3P A;  2X4W A;  3VS7 A;  4ZGE B;  3JCM g;  2EAY A;  2M51 A;  4X9C A;  2RO0 A;  2CH4 W;  4EPC A;  1WXU A;  2RK2 A;  4A4G A;  2RHY A;  1M8V A;  5CVI A;  1B34 B;  1YI2 Q;  1TS9 A;  2HEQ A;  2Y4X A;  3CCE A;  4QQ6 A;  3DKM A;  1M90 C;  1CKB A;  2X4X A;  3UA6 A;  4BY6 B;  1BIB A;  3EFO B;  1VQ9 A;  2YRC A;  2LJ1 A;  1RLQ C;  4QQD A;  5FWB A;  5IXF A;  3JCM Q;  3I56 A;  2B8A A;  3RKX A;  2O2O A;  2ZPB B;  3RES A;  1UB4 A;  2JXB A;  4BAC A;  3QUI A;  2EQU A;  5KYW A;  3CBP A;  1M3B A;  1U06 A;  4HT8 A;  2PZ1 A;  3H0H A;  3C0C A;  3CC7 A;  3I55 A;  1N9S A;  1VQ4 Q;  4IUU A;  1MMD A;  4B9W A;  5KYU A;  1K9M R;  1WHJ A;  2QQ9 A;  1QVF A;  3EFR A;  4XTZ A;  5A2Q E;  2WSC E;  2KSS A;  2KMT A;  3HRU A;  4IUP A;  1ZSZ C;  4F17 A;  1N27 A;  1UDL A;  2ZAE A;  5CK9 A;  3AHU A;  2FG0 A;  1VQ7 A;  2M16 A;  4AT1 B;  1M1K R;  2DXU A;  3UF4 A;  3G6E A;  3RMS A;  1YJ9 T;  1ABQ A;  2LQ8 A;  2LQK A;  4E7L A;  5CQX A;  2QEX Q;  3V7S A;  2GCX A;  1AVZ C;  1AWJ A;  3LH5 A;  5D7U A;  2K9G A;  3H0I A;  1X69 A;  2QA4 T;  2L8D A;  4JJB A;  2FZG B;  2O01 E;  3IQL A;  1SRL A;  3MP1 A;  2HQE A;  2EGA A;  2QDY B;  5FWC A;  4Y92 A;  4AMC A;  2XKO C;  3R6O A;  4CI0 C;  4FM4 B;  2EGE A;  1Y0M A;  4ZN1 A;  3OS0 A;  2K57 A;  5KE2 A;  2YLC A;  4PJJ A;  1PSE A;  2DYB A;  1CSK A;  1UGS B;  1VIE A;  1K1Z A;  2K2V A;  3CCV A;  3OBY A;  1M1G A;  5FRO A;  3X28 B;  2RHI A;  5CKD A;  2K5L A;  1JEG A;  4FW2 A;  8AT1 B;  3G4S T;  3RMQ A;  1YWP A;  5EG2 A;  2GQV A;  4BE1 A;  1TSF A;  4OB1 B;  2DMO A;  3JCM W;  4A63 B;  1LPL A;  1T3L A;  4PFP A;  3VS0 A;  1UGP B;  2GF7 A;  3RKW A;  2XID A;  3VU3 C;  3RDV A;  1H8K A;  3BY7 A;  3OS5 A;  2RQU A;  5GAN 4;  1LJO A;  3OYY A;  1YJW A;  3RR6 A;  2QDL A;  4HCZ A;  1VQM A;  3CD6 A;  1BU1 A;  3NTI A;  1M9S A;  1CKA A;  2DM1 A;  4PLI A;  3CCL A;  5HK0 A;  2JTE A;  2HMA A;  1MV0 B;  1G3S A;  1WQW A;  4L6V 5;  1D1C A;  1K73 R;  1BCM A;  3EG9 B;  5IHK A;  1HXD A;  4LUE A;  2JMC A;  1MMN A;  3S3N A;  4RKU E;  1KQS S;  3CMA T;  4E2F B;  3OYA A;  1YP5 A;  1I07 A;  1UEB A;  2CZ1 B;  1SSF A;  4JRI A;  2E41 A;  2ATC B;  4AFZ C;  3URG A;  2J05 A;  1YCY A;  1JBM A;  4JJC A;  4M7D E;  5DLO A;  1VOM A;  5GAN 5;  3M0S A;  1Q7Y R;  4WCI A;  1PRL C;  5M9O A;  4A4H A;  3OSS C;  1K0X A;  2LP5 A;  4ELY C;  2CP0 A;  2K6D A;  2VB6 A;  1ZLM A;  3OYI A;  1PWT A;  3EFS A;  1FWZ A;  5GAN 8;  4LDU A;  1IRE B;  2ZPF B;  1D3B B;  1GCQ C;  3QSU A;  3M4Y A;  4C0D B;  3JCM V;  1WHH A;  5GAO r;  3A8L B;  3A8M B;  3JCM P;  2KQW A;  4KGX B;  4P5N A;  1UE9 A;  3J81 E;  1E6G A;  2HAX A;  1X2Q A;  4LNP A;  2OTL Q;  2PVG B;  4RTX A;  3JCM d;  1FXX A;  2KEA A;  3TVT A;  5GAO m;  1M30 A;  2VWF A;  3ASK A;  2K5F A;  2L3S A;  3NMZ C;  1TUG B;  1RAE B;  4Z8A A;  3QWX X;  1IZ6 A;  1YJN Q;  1YHQ Q;  1WHL A;  6AT1 B;  2EQJ A;  1VQN A;  4A4K A;  3CPW P;  2ZPG B;  3GNF B;  3NTK A;  4PFO A;  4M75 C;  4XU2 A;  1BI3 A;  3LGL A;  1SF9 A;  1VQ6 A;  4R56 A;  3QYG B;  4PJO G;  1AHJ B;  2RMO A;  3X25 B;  1Q82 C;  1G2B A;  4M78 D;  4ELZ C;  3OYF A;  2DZ9 A;  4LDW A;  2P0K A;  1YIT Q;  1BI0 A;  3QPH A;  1NJI C;  1RI0 A;  1WIE A;  1KC8 R;  3QYH B;  3OYL A;  1QWF A;  2M0O A;  1ZX6 A;  2CYZ B;  4XTX A;  4IUQ A;  1UGV A;  2KYB A;  1OU8 A;  2X9H A;  1NPR A;  2AKK A;  5FU6 C;  1MUZ A;  2QTX A;  1B34 A;  2LCC A;  5A0L A;  3JB9 J;  1W1F A;  3OB9 A;  4C0G A;  2VUB A;  4J7I A;  7AT1 B;  4IUR A;  1QLY A;  1VQO A;  3EFO A;  4E7Z A;  1B3Q A;  1JJ2 P;  4QVZ A;  1Q86 C;  2ED1 A;  4XQ3 A;  4XTW A;  3KBG A;  4LUD A;  3MP6 A;  4N4I A;  4LDY A;  2IVW A;  1D0Y A;  4FW1 A;  1PHT A;  2JW4 A;  3QHS A;  1IGU A;  3ME9 A;  1YIJ Q;  2OTJ A;  3V8J A;  3LWI A;  3CCR Q;  1WX6 A;  5GMK l;  3QWY A;  4RCC A;  1WXT A;  4PKC C;  1M5Q 1;  3VV0 A;  3JSC A;  3NGP A;  1V76 A;  2V8K A;  2AK5 A;  2CSI A;  3PVQ A;  5D6W A;  5CR2 A;  2W0Z A;  2HQX A;  1NE8 A;  2DIG A;  3JCM X;  1ZBJ A;  2DTI A;  4ME7 A;  3CCQ A;  1FX7 A;  2YT6 A;  2BZ8 A;  2ZZD A;  2ESW A;  2QGF B;  3L1A A;  2DYI A;  2RJC A;  3MPU B;  4FYY B;  5HKC A;  4DOV A;  4BE0 A;  1J3T A;  1WJR A;  2RD1 A;  3CCS A;  3O8V A;  3MEA A;  1PRM C;  1VQK Q;  4HCK A;  3DLL A;  3QZ5 B;  1UFF A;  3CBO A;  2RQR A;  4KUD K;  2PUK B;  4OMQ A;  2M1H A;  1I0C A;  4MZM A;  4ZN3 A;  3CCM T;  1NZ9 A;  4O5V A;  2LX9 A;  1VQP A;  1KG1 A;  2E3I A;  3M59 A;  5IXB A;  2V26 A;  2JM8 A;  3A98 A;  2J6K A;  3GNG A;  4KGZ B;  3G71 A;  2C06 A;  4EIK A;  2BTT A;  1RAA B;  1Y7X A;  3PMT A;  2RQV A;  3HFO A;  3S3M A;  2LC4 A;  5GMK e;  1N8R R;  1JB0 E;  4M75 B;  2PVO B;  2OAW A;  4JRK A;  5EC7 A;  1RAH B;  1XTD A;  3GLX A;  1SG5 A;  4RTY A;  3L2Q A;  2KDS A;  3L2Z A;  1VQL T;  3FDR A;  5GAN 7;  4F7U B;  2QI2 A;  1WNL A;  2WSF E;  4JZ3 A;  1A0N B;  2CP3 A;  2RQT A;  1RL2 A;  3GBQ A;  3CCJ A;  1WDX A;  2VKN A;  8ATC B;  3FC3 A;  1SHF A;  5LJ3 e;  3E19 A;  4B9X A;  2JJ9 A;  4L59 A;  1OV3 A;  5KCO A;  1LCK A;  3CC4 A;  4PJL A;  2HZY A;  3CPW S;  4EMH A;  3BDU A;  2I0N A;  2VV5 A;  4C92 G;  1Q82 R;  4PJN A;  2E1H A;  5CCA A;  2EYX A;  2KI7 A;  1AOJ A;  1QCF A;  2X35 A;  5FU6 B;  3M54 A;  4QKU A;  1VQ9 T;  1K9M U;  2KE9 A;  5GMK i;  4M7A G;  3I56 T;  1NJI R;  4CC7 A;  1U8R A;  5GMK j;  2GTJ A;  1VQ8 A;  4RTV A;  4M78 A;  1HJD A;  2K5I A;  2DBK A;  1ZA2 B;  1MMG A;  1TUD A;  4WF2 A;  3CC7 T;  1AWO A;  1ABO A;  4M77 E;  1G5V A;  3REB B;  2GBQ A;  4HCC A;  1M1K U;  2CS7 A;  5CKE A;  2J6O A;  1OQK A;  1R0B G;  5D6X A;  5LJ3 j;  4QVD A;  1Y57 A;  1RUW A;  2RJD A;  4M75 F;  1FMK A;  1ZUU A;  1VQ7 T;  5FU7 C;  2HQH A;  1TU0 B;  4C8Q E;  1WHK A;  3UA7 A;  2VGM A;  4KBM B;  1JJ2 S;  1WZO A;  2MYS A;  4LD6 A;  3G6E T;  3M53 A;  4F7U F;  4KGV B;  3E9G A;  1WYX A;  2JUF A;  3ZBD A;  1QWE A;  1YI2 A;  4M7D B;  1KIK A;  3QJY A;  1OUL A;  1SKU B;  2FZC B;  2DIL A;  2A37 A;  1LOJ A;  4J6Y A;  2SEM A;  2CKK A;  4MZP A;  1X75 C;  3EG1 A;  3SD4 A;  3HTR A;  3VUB A;  2KT1 A;  1I5O B;  3OYJ A;  4DOW A;  1T0J A;  2MK5 A;  2EBP A;  3CCV T;  3EH2 A;  2COZ A;  3QBY A;  3M0P A;  2EPD A;  4HVV A;  1X6G A;  3HPW A;  2DK3 A;  2F5K A;  4OB3 B;  3J80 E;  4DQ2 A;  1VQ4 A;  2DVJ A;  1QVG P;  2F2W A;  1NPP A;  1W6X A;  1UHF A;  1K73 U;  3OYC A;  1TTH B;  4J9F A;  3CPW A;  1QQJ A;  5J39 A;  1YJW T;  2GFA A;  3X26 B;  1VQM T;  4WTO B;  2ZPE B;  2EKO A;  3UWN A;  3CD6 T;  3BDL A;  3RER A;  2YWW A;  3GF5 A;  3BW1 A;  3V7R A;  3KXT A;  1WA7 A;  4XTV A;  2DPP B;  2E6N A;  2NUT A;  5GAN 3;  4RUG A;  4DBH A;  1X2K A;  1W70 A;  2YSQ A;  4RTT A;  5KE3 A;  2QEX A;  1Q7Y U;  3F70 A;  4DBQ A;  4DEX A;  1K8A R;  2YHT A;  4M78 C;  4C5G A;  1OPK A;  4M7D D;  5I21 A;  2X4J A;  3E1S A;  4M7D F;  3OY9 A;  1RLP C;  2RM4 A;  5IH2 A;  3CME Q;  4KH1 B;  4RG2 A;  1OI1 A;  2ROT A;  5GAM e;  5GAN e;  1M8M A;  1JJ2 A;  2RJE A;  3KUF A;  4PJO C;  2LNH B;  3P8H A;  4C0D C;  3E2U A;  4C0Z A;  2HKN A;  1YN8 A;  2C0O A;  2CDT A;  2VGN A;  2JOY A;  2KRN A;  4C92 E;  1GCQ A;  1IHV A;  1PC0 A;  3JRZ A;  4KUL A;  2LX7 A;  1AZG B;  1HYO A;  5FU7 B;  4M7A E;  2KK4 A;  1H3H A;  2XI9 A;  2CUD A;  1BYM A;  2A28 A;  4OGC A;  4A53 A;  2HL5 C;  2PTK A;  2FRY A;  3V7C A;  2M0Y A;  2EYY A;  5GAO n;  1EZZ B;  2LTO A;  4OB2 B;  4ZTF A;  2NUP B;  1FMW A;  5GMK h;  1VQN T;  2L3Q A;  1BI2 A;  1KC8 U;  5GAM j;  1KFZ A;  5I22 A;  5GAN j;  2DEQ A;  4LDX A;  4II1 A; 
#chains in the Genus database with same CATH homology
 1BBZ A;  4Z8A A;  3QWX X;  3VS2 A;  2DNU A;  2KGT A;  3M0R A;  2NWM A;  2KRS A;  2IIM A;  1BK2 A;  4J9C A;  2ROL A;  3I5S A;  2BZY A;  3UAT A;  1NEG A;  2HDA A;  1V1C A;  3THK A;  4J9D A;  2RMO A;  4ESR A;  2DL4 A;  1G2B A;  3VRZ A;  4IIM A;  2RNA A;  1GFC A;  2D8H A;  1FYN A;  2HCK A;  1MV3 A;  3RNJ A;  1AWX A;  1WIE A;  1QWF A;  1NLO C;  2VVK A;  4RTZ A;  1K0S A;  1ZX6 A;  1X43 A;  2OI3 A;  5GJW B;  1UGV A;  2KYB A;  3PE0 A;  5IHI A;  2EKH A;  2PNI A;  1ZSG A;  2AKK A;  2DRM A;  4KRT A;  2YUO A;  3H41 A;  1MUZ A;  3I35 A;  4LE9 A;  4JPB W;  4Z88 A;  1W1F A;  3JV3 A;  4QT7 A;  4F16 A;  2FPD A;  4GLM A;  2DF6 A;  2NUZ A;  1NEB A;  1QLY A;  2F2V A;  4J9H A;  2DX1 A;  2MOX A;  1B3Q A;  2DL3 A;  2LQN A;  3CQT A;  1N5Z A;  2P4R A;  2KRM A;  4J9I A;  3VS1 A;  2LQW A;  1NG2 A;  1JQQ A;  1YWO A;  2ED1 A;  3VS4 A;  4LUD A;  1NYF A;  2KXC A;  4E6R A;  1T3S A;  3M0T A;  1SHG A;  2GNC A;  1Z9Q A;  1PHT A;  2JW4 A;  1HSQ A;  3TSW A;  2RPN A;  2X3W D;  2GGR A;  3VS5 A;  1WX6 A;  2J6F A;  2D0N A;  3QWY A;  1WXT A;  4OMN A;  3SHW A;  2CT3 A;  1Z9Z A;  1X27 A;  4IIO A;  3NGP A;  1AWW A;  2AK5 A;  2CSI A;  1NLP C;  1TG0 A;  3PVQ A;  3I5R A;  2W0Z A;  4FSS A;  1JXO A;  3EG2 A;  1KJW A;  2LZ6 B;  1NM7 A;  1ZBJ A;  2KT8 A;  4HVU A;  3M0Q A;  2YT6 A;  1GBQ A;  2BZ8 A;  2GTO A;  1GL5 A;  2ESW A;  4AFU C;  1RI9 A;  2E5K A;  2AKL A;  2LJ0 A;  4CC3 A;  1J3T A;  2A08 A;  2K79 A;  1PRM C;  1YNZ A;  3VS6 A;  1B07 A;  1HD3 A;  2KRO A;  3O5Z A;  4HCK A;  2AZS A;  2EGC A;  2G6F X;  4OMO A;  2JT4 A;  1UFF A;  1TUC A;  2D8J A;  1SEM A;  2RQR A;  3ZL7 C;  1AZE A;  4OMQ A;  2L0A A;  3EGU A;  1VYV A;  1I0C A;  2DL8 A;  1UJY A;  1JO8 A;  2FEI A;  2W10 A;  1WLP B;  4RTU A;  2SRC A;  5IXB A;  4D8K A;  2JM8 A;  4ORZ A;  3A98 A;  2YUQ A;  2J6K A;  4J9B A;  1WI7 A;  1QKW A;  4EIK A;  2ED0 A;  2BTT A;  1QKX A;  2RQV A;  1JU5 C;  1ZUK A;  1IO6 A;  2KYM A;  4AG2 C;  1S1N A;  2OAW A;  1BB9 A;  2JM9 A;  4JZ4 A;  5EC7 A;  5HCK A;  2LJ3 A;  2O88 A;  4AG1 C;  4ZNX A;  4RTY A;  2K2M A;  1U3O A;  2CRE A;  2RF0 A;  4DEY A;  2KNB B;  5L23 A;  3RBB B;  2DL7 A;  3EG0 A;  1E6H A;  1OEB A;  4JZ3 A;  1A0N B;  1SPK A;  2RQT A;  3VRY A;  3GBQ A;  3NPF A;  2O9V A;  1K4U S;  1WDX A;  2VKN A;  4CC4 B;  2MIO A;  1SHF A;  1UG1 A;  2GQI A;  2L3P A;  3PVL A;  1OV3 A;  1LCK A;  1VYU A;  2YDL A;  3VS7 A;  2FO0 A;  1EFN A;  3KFV A;  2M51 A;  2XMF A;  2I0N A;  2DA9 A;  2V1Q A;  1AD5 A;  2CH4 W;  4R0K A;  4J9G A;  1WXU A;  2EYX A;  4D8D A;  1AOJ A;  1QCF A;  4RTW A;  2KE9 A;  4CC7 A;  1M3C A;  2HEQ A;  2GTJ A;  2BZX A;  4RTV A;  1HJD A;  2ECZ A;  1K9A A;  4HXJ A;  1CKB A;  1YCS B;  2DBK A;  3UA6 A;  2DLP A;  2LJ1 A;  1RLQ C;  5FWB A;  5IXF A;  1TUD A;  1AWO A;  1ABO A;  2O2O A;  4JJD A;  2GBQ A;  3REB B;  4HVW A;  2JXB A;  2O9S A;  1E7O A;  2J6O A;  1M3B A;  1U06 A;  2PZ1 A;  2J7I A;  3H0H A;  3C0C A;  1Y57 A;  4AFQ C;  2EQI A;  1RUW A;  3NHN A;  1U5S A;  1VA7 A;  2DE0 X;  1UTI A;  1FMK A;  1UJ0 A;  1ZUU A;  2J06 A;  4CC2 A;  1NYG A;  4Z89 A;  3R6N A;  1AEY A;  3UA7 A;  1OOT A;  3ULR B;  2CT4 A;  4F17 A;  4OMP A;  1UDL A;  4M4Z A;  3U23 A;  1KSW A;  2FG0 A;  1WYX A;  5IHN A;  1QWE A;  1WFW A;  2EVR A;  1KIK A;  2O31 A;  2EYZ A;  3UF4 A;  2DIL A;  2A37 A;  1ABQ A;  2SEM A;  3REA B;  2RQW A;  2K7A A;  2YUP A;  3EG1 A;  1ZUY A;  1AVZ C;  1AWJ A;  3H0F A;  3LH5 A;  2K9G A;  3H0I A;  1X69 A;  2KT1 A;  1JXM A;  4JJB A;  3IQL A;  2K3B A;  1SRL A;  1T0J A;  2A36 A;  3EHQ A;  2EBP A;  5FWC A;  4OMM A;  2EGA A;  2B86 A;  1WXB A;  4Y92 A;  2YUN A;  2EGE A;  2LMJ A;  1Y0M A;  3FJ5 A;  3M0P A;  2EPD A;  4HVV A;  2CH4 A;  1X6G A;  1T0H A;  2C0T A;  2DYB A;  1CSK A;  2EW3 A;  4OML A;  1K1Z A;  2KXD A;  1M3A A;  2DVJ A;  1ARK A;  2F2W A;  1W6X A;  1UHF A;  4LN2 A;  1JEG A;  2JMA A;  3VS3 A;  4J9F A;  1YWP A;  2LCS A;  2L2P A;  2DMO A;  4A63 B;  3M0U A;  2DRK A;  1GBR A;  1T3L A;  3VS0 A;  1H8K A;  5GJV B;  2RQU A;  1WA7 A;  2QDL A;  4RUG A;  1X6B A;  2D1X A;  1X2K A;  1W70 A;  2HBW A;  2YSQ A;  1BU1 A;  4RTT A;  1CKA A;  2CUB A;  1M27 C;  2DJQ A;  2DM1 A;  1UEC A;  2JTE A;  1MV0 B;  2X3X D;  3EG3 A;  2AZV A;  4DEX A;  5I11 A;  4K11 A;  5IHK A;  1OPK A;  4LUE A;  1VYT A;  2JMC A;  2MCN A;  4AFS C;  1YP5 A;  1I07 A;  1RLP C;  1GRI A;  2C0I A;  1UHC A;  2CSQ A;  2KBT A;  2V1R A;  5IH2 A;  2ROT A;  2ENM A;  1GCP A;  1M8M A;  4AFZ C;  1SSH A;  2J05 A;  4X1V A;  1GFD A;  4JJC A;  2LNH B;  2FRW A;  1SRM A;  2DL5 A;  3M0S A;  4WCI A;  1PRL C;  2HSP A;  3EHR A;  3TSZ A;  1K0X A;  1YN8 A;  2LP5 A;  2C0O A;  2K6D A;  4GBQ A;  2CDT A;  1ZLM A;  1PWT A;  2KRN A;  1UUE A;  1GCQ A;  2F2X A;  1K76 A;  2ABL A;  1GCQ C;  2DBM A;  2LX7 A;  5ECA A;  1AZG B;  5FW9 A;  1I1J A;  4F14 A;  1PNJ A;  2FPE A;  1H3H A;  4J9E A;  1PKS A;  2JS2 A;  2OJ2 A;  2CUD A;  2A28 A;  1UE9 A;  2EYW A;  1E6G A;  2RN8 A;  2PTK A;  2KR3 A;  1X2Q A;  2FRY A;  4LNP A;  3I9Q A;  3SEM A;  2M0Y A;  2EYY A;  4RTX A;  2KEA A;  3TVT A;  1H92 A;  1G83 A;  2L3Q A;  1XOV A;  2H8H A;  1M30 A;  2VWF A;  1KFZ A;  5I22 A;  1OPL A;  1PKT A;  2L3S A;  3NMZ C;  2FPF A;  2JS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...