1MV3A

Nmr structure of the tumor suppressor bin1: alternative splicing in melanoma and interaction with c-myc
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
213
structure length
213
Chain Sequence
DGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILSLFEDTFVPEISVTTPSQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKKLEKCRGVFPENFTERVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myc box dependent interacting protein 1
publication title A structure-based model of the c-Myc/Bin1 protein interaction shows alternative splicing of Bin1 and c-Myc phosphorylation are key binding determinants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 15
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2002-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1mv3A01
2FPEA 2F2VA 3PVQA 2DL5A 1AWOA 2DBMA 2L3PA 2JMCA 3C0CA 2L3QA 2EGAA 2FRWA 3I5RA 3H41A 1B3QA 4OMPA 2O9SA 1UG1A 2DA9A 2KXCA 4LE9A 2CH4A 3VS4A 4F17A 1WXTA 4DEXA 2PNIA 2J05A 2X3WD 4CC3A 2DYBA 3QWXX 2AZVA 4OMNA 1KIKA 2FPDA 4J9HA 2RQRA 4D8DA 2W0ZA 4HCKA 1MV0B 2O88A 4AG1C 2AZSA 4WCIA 1YWOA 1NG2A 1U3OA 2KE9A 2LJ0A 2ROLA 1WI7A 1MV3A 5I22A 3NHNA 2DBKA 1PRLC 4J9DA 2EKHA 4F14A 4ORZA 2EGEA 4IIMA 3RBBB 4FSSA 1W6XA 4X1VA 1NLOC 1VYTA 2JT4A 4J9EA 2F2XA 1GFDA 2KGTA 4Z88A 3M0UA 2AKKA 1ZBJA 4IIOA 3VRZA 3PE0A 5IHKA 3EG3A 1I0CA 3NGPA 2GQIA 3VRYA 1X43A 4R0KA 1UECA 2A37A 3UATA 4RTWA 2YUNA 1KJWA 1AOJA 2DX1A 4OMQA 1HD3A 5FW9A 4ESRA 1GBRA 2FG0A 2FO0A 1PKSA 4Z89A 5IH2A 2RPNA 2KROA 2VVKA 2FRYA 2RQUA 2RNAA 1ZX6A 4K11A 4JZ4A 1WXUA 2EGCA 2OI3A 2YDLA 4LUEA 2I0NA 2KYMA 4CC4B 2G6FX 1NEGA 4ZNXA 2CSQA 4OMOA 2KYBA 2KT1A 2DNUA 2HEQA 2KNBB 2VWFA 1QCFA 2HBWA 3LH5A 3ULRB 2HCKA 1SRLA 2DMOA 4M4ZA 5EC7A 1WLPB 3SEMA 2MCNA 1VA7A 3PVLA 1UFFA 4RTUA 5FWCA 3O5ZA 1UE9A 2ED1A 1WX6A 2C0TA 1EFNA 2EVRA 2A08A 2K3BA 3SHWA 2ESWA 2K6DA 3EHQA 1K0XA 1X2KA 1K1ZA 1UTIA 2RF0A 1CSKA 1WIEA 3REAB 3ZL7C 3EHRA 1UUEA 1I07A 4AFUC 1OV3A 4LNPA 1BB9A 1WFWA 1PRMC 2K79A 3M0QA 1UJYA 2D8JA 4CC2A 1BU1A 1PHTA 1ABOA 2KR3A 3EG0A 2LMJA 1K76A 5HCKA 3EG2A 1M27C 1ARKA 1I1JA 4OMMA 2YUPA 1AWXA 3IQLA 1G2BA 1X6GA 2D0NA 2K7AA 4GLMA 2ECZA 2LP5A 2MIOA 2LQWA 1K9AA 1AWWA 1VYUA 2DM1A 1CKAA 2MOXA 2L2PA 3M0RA 1U06A 1X2QA 1ZUYA 3H0FA 2JM9A 2KRNA 2EQIA 1SSHA 2CUDA 2YT6A 1RLQC 2CT4A 1UJ0A 2D1XA 3U23A 1YNZA 4E6RA 2SRCA 1PKTA 1YN8A 4OMLA 1M3AA 2O31A 3RNJA 4RUGA 2DL7A 3I5SA 2DRKA 1TUDA 2CDTA 2SEMA 2D8HA 1HSQA 1RI9A 1Y57A 2DE0X 3QWYA 2LZ6B 2H8HA 1IO6A 1GL5A 1WYXA 1K4US 4Y92A 1SPKA 1JXMA 5GJVB 1QLYA 2AKLA 1ZLMA 4AFSC 1PWTA 2EYWA 2BTTA 2J6FA 1NEBA 2DVJA 1H8KA 1UHFA 1ZUKA 2E5KA 2GTOA 2OJ2A 2LNHB 2J6OA 1W1FA 2ROTA 1U5SA 4RTZA 2CREA 3REBB 2HSPA 4RTXA 2AK5A 2CUBA 2O9VA 4J9IA 4J9BA 5L23A 4AG2C 1TG0A 2BZ8A 2JXBA 2VKNA 2A36A 2IIMA 2GGRA 1WDXA 1SRMA 2FPFA 1SHGA 4J9CA 4DEYA 1NM7A 2C0IA 4RTVA 2ABLA 2ENMA 4Z8AA 1YWPA 4AFZC 2L3SA 3H0HA 3NMZC 1T3LA 3M0TA 1OEBA 1T0JA 3A98A 1RLPC 2GTJA 1YCSB 2YSQA 1MUZA 3THKA 1UDLA 3VS3A 1YP5A 4LN2A 2BZYA 2LJ3A 1JQQA 4LUDA 3TSWA 1S1NA 4EIKA 2EW3A 4JJBA 4HVUA 1H3HA 3H0IA 1AZEA 1QWFA 2JW4A 4RTTA 1SEMA 2ED0A 3UF4A 4JJCA 2JS0A 2M51A 1WXBA 4QT7A 1GCPA 2DILA 2XMFA 3EGUA 1NLPC 2CH4W 3VS6A 3TSZA 2JTEA 2KRSA 1GRIA 2CSIA 2JM8A 2K2MA 1M30A 2C0OA 2KRMA 2EBPA 5IHIA 1UGVA 2RQVA 2RN8A 1JU5C 1T3SA 1OPLA 5IXBA 1N5ZA 2KT8A 2RQTA 1KFZA 1TUCA 2DLPA 2V1RA 1RUWA 2NUZA 2KBTA 2RQWA 2RMOA 1ZUUA 1OPKA 1JO8A 1K0SA 1NYFA 2KEAA 2J6KA 1J3TA 3M0PA 1JXOA 3VS7A 1QKWA 2HDAA 2YUOA 2K9GA 4D8KA 3KFVA 5IXFA 2L0AA 4F16A 2P4RA 1AEYA 4JPBW 1A0NB 1GBQA 3EG1A 1FYNA 2CT3A 2EYXA 3VS0A 2A28A 1AZGB 2QDLA 1OOTA 1QWEA 2PZ1A 2YUQA 2GNCA 1T0HA 1Y0MA 1E7OA 1W70A 2M0YA 4GBQA 4A63B 1FMKA 3CQTA 2V1QA 1BK2A 4HVVA 4CC7A 2EPDA 1SHFA 4AFQC 1G83A 1M3CA 1V1CA 1H92A 1XOVA 1GCQA 1NYGA 1ABQA 2LX7A 1CKBA 4HVWA 3VS1A 4J9FA 1QKXA 5IHNA 1ZSGA 1VYVA 2W10A 2BZXA 1X69A 1M3BA 2JS2A 2DRMA 1X6BA 2DJQA 2DF6A 1JEGA 1WA7A 2LQNA 1B07A 4JZ3A 1M8MA 1E6HA 2NWMA 1BBZA 1E6GA 1AWJA 2PTKA 2GBQA 1AD5A 3R6NA 2FEIA 3FJ5A 2EYZA 1LCKA 1GCQC 3VS5A 1X27A 2DL3A 4J9GA 3JV3A 2J06A 1Z9ZA 3I9QA 3GBQA 2LCSA 5I11A 2KXDA 1HJDA 3NPFA 2J7IA 3VS2A 4JJDA 1KSWA 1AVZC 4RTYA 1GFCA 4KRTA 2B86A 1Z9QA 3I35A 5FWBA 5ECAA 3TVTA 5GJWB 1PNJA 2LJ1A 2OAWA 2DL4A 2X3XD 2EYYA 4HXJA 3M0SA 3UA7A 1UHCA 3UA6A 2JMAA 2DL8A 2F2WA 2O2OA
chains in the Genus database with same CATH superfamily
4E7LA 2FPEA 2DL5A 4NL3A 1AWOA 4MZPA 1VUBA 2DBMA 2JMCA 3LYIA 1VQ4Q 1Q81U 3P8DA 3H41A 4M77B 2VASA 3RMSA 3X20B 2OAUA 2E5QA 1WXTA 3V8JA 4CC3A 3OMGA 2LC4A 3EG9B 5LJ5j 1B34A 3M56A 2AZVA 1KIKA 5FU6B 4HCKA 1IREB 3MP1A 4QVZA 2O88A 1U1TA 4AG1C 1K73U 1RAAB 4OB1B 4M7DA 2NUTA 4FT2A 2VB6A 4E2FB 2GFAA 5I22A 3AHUA 3BW1A 3QBYA 4KUIA 4IIMA 3RBBB 3I55Q 2RI5A 1VQ9A 4HT8A 1NLOC 1WJSA 5GAMd 4J9EA 3X26B 1GFDA 2FB7A 2HD0A 1VQ5A 4FU6A 1ZBJA 4IIOA 4BY6C 1VQ7Q 3HFOA 1UGSB 5IHKA 1Q82R 4ME7A 3URGA 5LJ5g 3CD6T 1VQNT 2YUNA 4HCBA 5GAOn 5FW9A 3G6EA 3OW2P 4BDZA 5IH2A 1KD1C 2RPNA 3FC3A 5FU7B 2RNAA 1N8RU 4K11A 3C12A 1PCXA 3H6ZA 3CCJT 1M8VA 3JCMd 2VGNA 2HKQB 4N4IA 2K57A 4PLLA 1G8XA 2AHJB 2QA4A 1OU9A 5KYYA 4PJOD 2HEQA 2KNBB 3G71T 3LH5A 3OMCA 4II1A 2JNGA 1VA7A 3RR6A 1UFFA 4OGCA 5GAN2 3LH0A 3CMAT 3O5ZA 2QGFB 2EVRA 2A08A 2K3BA 4C8QE 1VQNQ 3SHWA 4PJOC 4FSXA 2EFIA 3REAB 1S72T 1UUEA 3JB9I 5CIUA 3UPUA 5A2QE 1K9MR 3UDCA 1UJYA 1P92A 4CC2A 1VQ8Q 1VIEA 4PJOF 2CP7A 1ABOA 3J80E 3OYGA 5HCKA 1ARKA 1I1JA 1W4SA 2WSFE 4ZGJB 3CCJQ 5EG2A 4ZTFA 3META 5GAOr 3KBGA 3AT1B 4CRIA 1Q86R 3JCMP 2LQWA 2R5MA 1K9AA 1VYUA 1CKAA 2MOXA 5GANj 3CBPA 2RM4A 3G71Q 1Q7YC 2CP5A 2YT6A 2MI6A 1UJ0A 3U23A 1YNZA 1LNXA 2DRKA 2PVGB 5GAN5 3SWNB 3WXMB 2ZAEA 1C6VX 4X9CA 9ATCB 1OYXA 1S72Q 4DOVA 1WYXA 3JCMV 4Y92A 1M5Q1 4M7DD 3X28B 1H3ZA 4VUBA 2LQ8A 3UWNA 1NEBA 3VYHB 1VQLT 4M75G 2XU8A 2GTOA 2E5KA 1M2VB 2EKOA 4C5HA 3OB9A 5GAOl 3E9FA 1U5SA 5KE2A 5LJ3e 2XG8D 3V7RA 2ZZDA 3WVDB 4M7DC 3CCQA 4M7AA 4J6WA 2DZ9A 4XU3A 3SFMA 3JRZA 2O9VA 3ZEHA 4XAXB 2PVOB 2A36A 1B7TA 1IZ6A 2LX9A 4M7DF 3RKXA 4FW1A 3EGXB 3GPLA 4C92A 4RTVA 2L3SA 2IG0A 1WNLA 3G1JA 3L2ZA 1RACB 4FT4A 3M0TA 3QDFA 3CCUT 1FMWA 3A98A 3L2WA 3NTKA 1JB0E 5KCHA 1M90C 2OX7A 1VQMA 2QQ9A 1MMGA 2YSQA 5D6XA 4BE1A 1UDLA 4DBHA 1YP5A 1VQLQ 4LN2A 1VQKT 1JRIA 1JQQA 3MEWA 4N0AA 3QJYA 1H3HA 1ZSZA 1QW1A 3HFNA 4C5EA 4OMFB 5LJ5h 1YJNA 4QT7A 2XMFA 3VS6A 3RKWA 2JM8A 3ASKA 3CPFA 4BE0A 1TU0B 3RERA 1M4ZA 2LCLA 2K2VA 1WGSA 2KI7A 5LJ3f 3SB2A 3N5BB 3BDLA 3JCMQ 2V1RA 1MNDA 2F5TX 3QIIA 4XTXA 1ZA2B 2L5QA 3EFOB 2E65A 3SD4A 1JXOA 5LJ3g 2HDAA 4XTZA 3HRTA 4D8KA 1IGUA 4Y91A 1Q81R 5GAN3 4F16A 2M9UA 4XTVA 1YJWT 2HL3A 1OX8A 3CC2T 3OYIA 1W70A 3CCVT 4PFZA 2L89A 4GBQA 5GAOp 4A63B 2CGHA 3CD6A 2EPDA 2MMPA 3CCMT 1Q95G 3HP9A 3S3OA 1G83A 3OBWA 4AT1B 1BCMA 4E7HA 4HCZA 2NUPA 2XDPA 1K73R 3QYHB 4C92G 2LX7A 1KC8R 4AMCA 4C0DB 4ZTJA 1CKBA 4J9FA 4M75B 1ZSGA 4C8QD 4R56A 4KBMB 4BD3A 4EDUA 2K5IA 4EMKA 2JTMA 1QP3A 5KYYB 3CCLT 1WA7A 5GAMj 2G3RA 1B07A 4Y28E 4MMLA 4PJMA 1YI2A 2MK5A 4C8QC 4LDWA 1AWJA 1MGQA 2PTKA 1SKUB 3JB9G 3R6NA 2FEIA 2LVMA 1LCKA 3CC2Q 3GF5A 1X27A 2F5KA 3OS1A 3JV3A 3CCVQ 3RIRA 4C0GA 8AT1B 4XTYA 3I9QA 3GBQA 5CKBA 2KXDA 4C8QF 1N8RR 1ZQ1A 1BCOA 4DQ2A 2J7IA 4JS4A 4JJDA 1KSWA 1K9MU 3OYBA 4RTYA 1Q82C 4F7UG 3WVEB 2RA2A 3TU4K 3I35A 5FWBA 1Y07A 5ECAA 2E4HA 2QG9B 1PNJA 2LJ1A 2OAWA 2EYYA 4HXJA 1TH7A 3M0SA 5GANh 1V29B 2JMAA 2BE9B 2E64A 3CCLQ 4M77G 4J7IA 1LOJA 3CMET 3C0CA 2L3QA 3PMTA 3NTHA 2FRWA 1I4K1 1VOMA 1UG1A 2CH4A 3VS4A 4F17A 3M54A 2PNIA 2X3WD 4KGVB 4WTOB 2FL7A 1W2BS 2JZ2A 4PK4A 3JCMJ 2FPDA 2E6NA 2RQRA 2JTFA 2QQRA 3G6EQ 5C0MA 2VUBA 3ZFJA 1OQKA 6AT1B 1PD0A 3RESA 4E7ZA 4N4GA 2CKKA 5HY6A 2RJDA 4WCIA 4P5NA 1WI7A 3V8LA 5CQYA 3R6OA 3JB9H 1TS9A 4M7AB 2MAMA 4ORZA 3VJPA 2EGEA 2A7YA 4BDYA 4NOYA 1G3YA 4C0FA 3CMEQ 3VYGA 1VYTA 5FLXE 2F2XA 2KGTA 2DXBA 4HKEA 1IHVA 3V7SA 3PE0A 4NL2A 1Q86C 3G4SA 4C92B 2GQIA 4L5GA 2HBPA 4XK8E 4JJNK 4IUUA 3CXCS 4X34A 1X43A 4R0KA 1UECA 4JLIA 1QCOA 1GBRA 4ESRA 2FO0A 2HQXA 1PKSA 1JJ2S 3CCUA 1VQ4T 4LD9K 4IUQA 5LJ3d 2LT1A 4PJOA 1I81A 1C0MA 2DVEA 4JZ4A 4LXCA 1WXUA 4QVCA 2OI3A 4Q5WA 2F69A 2YDLA 2CP3A 1ZSZB 4EMHA 4LUEA 3OYLA 2KYMA 2G6FX 1NEGA 5FU6C 4E47A 1N9RA 2KT1A 4YTLA 4PL6A 5J3BA 1QCFA 2ZPGB 4C0ZA 4F7UB 4M78G 2C0TA 1RAIB 5KYUB 2ESWA 3TCJA 3A8OB 4OB3B 3VV0A 1X2KA 3Q1JA 1K0XA 1BIAA 1UTIA 4JS5A 1D1CA 4QQ6A 1WIEA 2EJFA 3HKSA 1OV3A 2VGMA 1NBEB 1TTHB 1PRMC 1VQ7T 1R8OB 2YLCA 1BU1A 1PD1A 2KR3A 1YJ9A 3EG0A 1NJIU 2LMJA 3L2RA 3EG2A 3A8HB 1M27C 2KK4A 3I56A 3M4GA 3P8HA 1X6GA 4GLMA 2LP5A 1VQPT 1M1KC 2JM9A 1KD1U 1X01A 1MMNA 2EQIA 2YRDA 3CCQQ 3CCET 2O01E 3CXCA 2KSSA 2Y90A 2NUPB 2D1XA 2L3RA 2ZGWA 3CCMA 1OU8A 2B8AA 5D7UA 1KC8U 3A5ZB 2KMTA 3RNJA 4MZTA 4RUGA 3QO3A 3I5SA 2A3LA 1JJ2A 4M75E 3ZBDA 1NE8A 3QYGB 4A4EA 1TUDA 2QDYB 1RI9A 2QAZA 4EMKB 5GAMh 4BI3A 2NLUA 1WJRA 4O5VA 1JXMA 4PJOG 1QCNA 1FMVA 3S3NA 3ME9A 3ER0A 5FRMA 1G3WA 3MP8A 2EYWA 2Z0WA 4IUPA 1UHFA 4EPCA 1RAEB 3BFMA 2OJ2A 2J6OA 2MF2A 3OYCA 2COYA 1YITT 2DD5A 2CREA 4LDXA 2HSPA 1VQPQ 4A54A 3FJPA 2RHXA 1VQ8T 4J9BA 3CCEQ 3PT9A 4AG2C 4UC4A 2JXBA 4IURA 2M02A 4MMKA 3JCMh 2FPFA 4DEYA 3MKDA 1KHIA 5CK9A 2ENMA 5KYXB 3NMZC 2IVWA 1RAFB 1QVGS 2RJFA 2XI9A 1OEBA 2QEXA 4JRKA 3QSUA 1Q7YU 1K73C 4JRIA 1XNIA 2DEUA 1MUZA 3THKA 2BZYA 2LJ3A 4LUDA 3CBMA 1S1NA 2HL5C 2FVUA 2EW3A 1D0XA 4JJBA 4HVUA 5J26A 5DM7R 3H0IA 3CC7A 3CC4A 4RTTA 1YITQ 4FYWB 4M78B 3VKIA 1SEMA 2OTLT 4JJCA 2JS0A 1VQ6T 3MP6A 1WQ7A 2DILA 4BY6B 3INZA 4E7KA 1HXDA 1NLPC 2KRSA 2CSIA 4M7DG 1PM3A 2K2MA 1G3SA 2C0OA 3QKJA 4OVAA 5IHIA 4QW2A 5CKDA 1UGVA 3NFCA 5KYWA 2LCCA 2AT1B 4XU0A 1KFZA 2DLPA 2YRCA 2RB6A 1RADB 1RL2A 3EGDA 2QYZA 2RQWA 2LT4A 3CCRA 1ZUUA 5CKHA 2GQVA 1JO8A 1K0SA 1NYFA 2COWA 2E41A 2A0FB 3M0PA 1QKWA 4JUVA 3E19A 1YIJQ 5KYNA 4XTUA 5GAN7 5IXFA 4FW2A 2P4RA 1AEYA 1A0NB 2QASA 3OYFA 3VS0A 1AZGB 1YHQT 1MMDA 4PNOA 1QWEA 2YUQA 3FEOA 2OTLQ 4GLKA 1E7OA 2M0YA 1VQ6Q 1VIFA 1M90U 1FMKA 3CCSA 2V1QA 4C8QA 1BK2A 4OB2B 3QG1A 1N6AA 4QKUA 2EWNA 2P0KA 2DPPB 1RAHB 1PC0A 2RHUA 3MEAA 4PJOB 2QQAA 1NYGA 1R0BG 8ATCB 1WHHA 1VQ4A 5GANf 5IHNA 2W10A 4DBQA 2BZXA 3D7SB 5IN1A 3RDVA 1X69A 3PMIA 4JRPA 2COZA 2HAXA 2DRMA 1JEGA 1RABB 2DF6A 1D3BB 1EZZB 4JZ3A 2RD1A 1M8MA 2K5LA 1E6HA 4LDYA 2VXEA 2NWMA 2O4XA 4ZGEB 3JB9J 1E6GA 2JOYA 1YHQQ 4A4HA 1VQOT 2GBQA 1OX9A 2EYZA 1GCQC 3VS5A 4BACA 1NZ9A 2OTJQ 3I55A 3NPFA 1WHJA 5LJ3j 1ACMB 3MPUB 1AVZC 3LX7A 4M77E 5CVIA 3H9NA 2B86A 1OI1A 1Z9QA 3HHTB 2DTIA 2JJ9A 3FIFA 1Y96A 1WPYA 3KXTA 2X3XD 4XU1A 3CXCP 3A8GB 1B34B 1BI1A 4BI8B 3UA7A 3UA6A 4QQGA 4HT9A 2DL8A 2WSCE 4MZMA 3JAME 1JJ2P 4M7DB 3SDZA 2NUTB 2HSEB 4M75C 1RAGB 2WACA 3MCAB 2EGAA 2ZPFB 2DKGA 3MO8A 1VQOQ 2KXCA 4LE9A 3H8ZA 3QZ5B 1R77A 4C8QG 2J05A 4O6JA 1BYMA 1QVFS 2DYBA 3QWXX 4PLIA 1IXDA 4OMNA 2EYQA 4J9HA 1NJIR 3DLMA 1AHJB 2W0ZA 4A4GA 3OW2S 2MYSA 4RKUE 4M7AG 2QK0A 5CQXA 2M1HA 1H641 1U3OA 2LJ0A 2DXTA 3OYAA 1MV3A 1VQNA 2CZ6B 3LGLA 3NHNA 1V76A 1KD1R 2DBKA 2DK3A 2EKHA 1N9SA 4XU2A 2KVQG 4X1VA 4ELYC 2EQUA 3EG9A 2ZCFB 4Z88A 3M0UA 4KGXB 2JVVA 3LLRA 2K3XA 3EG3A 1I0CA 3CCJA 3VRYA 2RK1A 1D1AA 2A37A 3UATA 4RTWA 2EQMA 5I2SA 1AOJA 2DX1A 4OMQA 1VQ9T 2X4YA 2FG0A 1OZ2A 3G71A 2EJGA 2L8DA 2KROA 2RI3A 2VVKA 2VYTA 1WHMA 1VQ5T 4L59A 3CMAA 3L1AA 5FRNA 1I5LA 1ZBXA 2ZPBB 2I0NA 2H3JA 4CC4B 4M78E 3I56Q 2CSQA 2PVDB 4OMOA 1M2OA 1S72A 1MMAA 3G6ET 3LGFA 2DNUA 5GMKm 4JRQA 2K5FA 2HBWA 2YXYA 3ULRB 2HCKA 1WHLA 4MDXA 2DMOA 4M4ZA 5FROA 1N27A 3SEMA 2X35A 3PVLA 2HNIA 2K3YA 1QVFA 5FWCA 2E6ZA 5GMKi 1WX6A 2CP6A 1C1AA 1Q7YR 2V26A 2K6DA 5GAMf 1K8AU 2P84A 4R55A 5CAIA 1X75C 7AT1B 4KH0B 2QTVA 2CS7A 3ZL7C 1JBMA 2QA4T 2YHTA 2QTXA 1VQ9Q 3VUBA 3V7CA 2P4TA 3M0QA 1TOVA 4FM4B 1VQ5Q 3BDUA 2DEQA 2D0QB 2FYKA 3EAEA 2CZ1B 5AYFA 3JCMX 1TUGB 3P8BB 3O8VA 2YUPA 4OMMA 1AWXA 3IQLA 4WF2A 2D0NA 2K7AA 5J39A 5DLOA 2DM1A 4C8QB 1U06A 1X2QA 3X24B 2KRNA 1FXXA 3JCMf 3MHXA 1SSHA 5AT1B 3M4YA 1VQLA 4E6RA 4EMGA 2SRCA 1PKTA 1YN8A 2LDMA 4OMLA 1M3AA 2O31A 2DL7A 2Y4XA 1PSEA 1K9MC 1UGPB 2H3EB 3JCMW 2CDTA 2SEMA 2D8HA 1Y57A 2DE0X 2QXFA 2QQBA 2LZ6B 5D6WA 2JUFA 1IO6A 2PUKB 2QA4Q 1K4US 4ZN3A 5GJVB 1QLYA 2AKLA 2RH2A 2LNVA 2QEXQ 1ZLMA 4AFSC 2DETA 4Z02A 1PWTA 5CKEA 2J6FA 4M77D 3EH1A 1BI2A 1H8KA 1ZUKA 5CCAA 1MHNA 2LNHB 1M90R 1W1FA 2ROTA 4B9XA 3REBB 2F1LA 3CC7Q 3CC4Q 5LJ3h 3TEEA 4J9IA 4M77C 4X9DA 2E70A 2DXUA 3OQ5A 2DZCA 3OYNA 2BZ8A 2VKNA 5CO7A 3TREA 2GGRA 4F04B 1WDXA 1UEBA 1VQKA 1U1SA 3FLGA 3OYYA 4J9CA 1NM7A 4KT0E 1Y96B 2E3IA 1YWPA 4AFZC 4M77F 2V8KA 3PGGA 1IB8A 3VU3C 1T3LA 1M1KU 3CCQT 3A1PA 4BE2A 1T0JA 4DOWA 1YCSB 1W2BA 2FZKB 4BI4A 4DBRA 5GMKe 2AIRB 2DAQA 3A8LB 1TSFA 3TSWA 2EQKA 3L2UA 1AZEA 3OYHA 1QWFA 2JW4A 3EGXA 4JLGA 2ED0A 2FHDA 4KULA 1QP2A 1GCPA 5KCOA 3TSZA 2EJ9A 1GRIA 1VQMT 1M30A 3QJ6A 2EBPA 2VC8A 4KH1B 2XDBA 2RQVA 2RN8A 1O75A 4LDUA 1T3SA 5KH6A 4J83A 2GCXA 1OPLA 3FDRA 5LL6S 1YJWA 5IXBA 1N5ZA 2KT8A 1I5OB 1BI0A 5M9OA 2NUZA 3BE3A 3CC2A 5FU7C 3OYJA 2DERA 2RMOA 4FYXB 5GMKj 3CCVA 1YJNT 2X4WA 2XICA 1KG1A 1OPKA 4RG2A 2KEAA 1J3TA 2XD0A 1U8RA 2C06A 3VS7A 1IHWA 5A0LA 4J5YA 4RCCA 3M9QA 2QGGA 1GBQA 2VV5A 3EG1A 1PG5B 2CT3A 2A28A 3PIOA 4PJNA 4N4HA 2PZ1A 3PFSA 1M1GA 2E12A 2K4YA 5GAN4 4M78D 1HK9A 3JSCA 2GNCA 3PNWC 4IUVA 3DB4A 4BUGA 3OS2A 3OSVA 2I2LA 3HSBA 4CC7A 3EFOA 3CCLA 1VQMQ 1SHFA 4AFQC 1M3CA 1H92A 1GCQA 1KQSS 3M55A 3OYEA 1ABQA 1YFNA 5LJ5f 3EH2A 5CR2A 1FWZA 5GAOq 3E9GA 4M78C 3OYMA 3GNFB 2RHYA 1NPPA 4HVWA 2BKDN 1QKXA 1VYVA 1Q81C 2V8JA 2DXCA 1M1FA 3CPWS 1YJNQ 1NJIC 1M3BA 3CBOA 1QVFP 1RI0A 5L8RE 2JS2A 4ZN1A 3OS5A 4M78F 5GAOm 1X6BA 2RI2A 1QQJA 3EFRA 2XIDA 1YCYA 3C94A 2HMAA 3NTIA 5DLQE 1Y71A 2EQJA 3FJ5A 1DJ7B 5IAYA 4J9GA 5HK0A 2E1HA 1KC8C 1YIJT 4M75A 2LCSA 3LWHA 5HK3A 2MPXC 1LJOA 3SWNC 3CMEA 5A0GA 2RK2A 3PIPA 1YI2T 4ATOA 2RJCA 4OF1A 4GY5A 2DYIA 3TVTA 5GANe 2DL4A 1SF9A 3MEUA 2FZGB 4HCCA 1UHCA 2CZ7B 3CD6Q 3OBYA 1M9SA 3S3MA 2JN0A 5CKFA 2F2VA 3PVQA 3M58A 3GOXA 2ZPEB 1LVKA 2DIGA 3HRUA 5KE3A 2L3PA 1OULA 3QUIA 3J7AF 1KQ2A 4NS5A 1N8RC 3I5RA 2XDDA 1K8AR 2LQKA 1B3QA 4OMPA 5C6SA 2O9SA 2DA9A 4D6WA 4M7AE 2HKNA 1KQSA 4DEXA 3RKYA 3FRNA 3RMQA 4J8OA 4C92E 4D8DA 2GFUA 4A4FA 2X51A 3CPWA 1YI2Q 5IT9E 1MV0B 4OGEA 4FL6A 2AZSA 1YWOA 1NG2A 2KE9A 3A8MB 1KQ1A 3CMAQ 2ROLA 2OTJT 4BB7A 4MDWA 1PRLC 4J9DA 4F14A 1QVGA 4FSSA 1W6XA 1X6OA 4TVRA 3DLLA 2JT4A 5A0DA 3OSSC 2AKKA 2CYZB 5I2MA 3VRZA 3GLXA 3NGPA 1W2BP 2QI2A 2P0PA 2XKOC 2RHZA 1G5VA 4PFPA 5GANg 1KJWA 1NPRA 3CEYA 2E10A 1HD3A 2X9HA 1IGQA 3JCMc 3J81E 1SSFA 4Z89A 3EFSA 4F7UE 2FZCB 2RJEA 2FRYA 2RQUA 1ZX6A 1R0CB 2EGCA 3G4ST 4C5GA 2VXFA 3M53A 1TXQA 1SG5A 1UGQB 4ZNXA 2KYBA 2HQHA 4J6XA 4E7SA 2VWFA 1WJQA 1TWBA 1G3TA 3OA6A 1VQ7A 1SRLA 3JCMb 5EC7A 4B9WA 5DY9A 1WLPB 2MCNA 4M75D 2WSEE 4RTUA 1ZHIA 1UE9A 2ED1A 1EFNA 1M1KR 2XHCA 5GMKh 3EHQA 1O9SA 1VQPA 3S6WA 1K1ZA 2RF0A 1CSKA 4A4KA 1D0YA 3EHRA 4C0DC 1I07A 4AFUC 5LJ5d 4LNPA 3OYKA 1BB9A 3CCEA 2PUOB 1WFWA 1WHGA 2K79A 2D8JA 2EAYA 1BIBA 1PHTA 2ZPHB 2D9TA 1K76A 3G4SQ 3KUFA 3QDRB 1G2BA 4M75F 2ECZA 4F7UA 2MIOA 4E7IA 1AWWA 1WHKA 3C95A 4FYYB 1LPLA 1BI3A 5KYUA 2L2PA 3M0RA 1ZUYA 1EIFA 2Y4YA 3H0FA 2X4JA 3HRSA 1D0ZA 2R5AA 3CCUQ 4XQ3A 2CUDA 1F1BB 2HZYA 3QHSA 1RLQC 2X4XA 2CT4A 2MWOA 1YJ9T 2IPOB 4JDSA 4RMOA 4HA8A 3GP8A 1MNEA 4M77A 1VQKQ 3I56T 2DTHA 3BY7A 1YITA 5GAMe 4FIBA 1Q82U 1HSQA 3QWYA 3QZ9B 4IUTA 2H8HA 2ZPIB 4L6V5 1D09B 1GL5A 1SPKA 3F70A 1VQ8A 4RG8A 2E3HA 2BTTA 2XK0A 2DVJA 4J7FA 4B6MA 1QMCA 3L2VA 2MWPA 1I8FA 1BKBA 3MJXA 3T9NA 4RTZA 4RTXA 3RUXA 2AK5A 2CUBA 2ATCB 4J6YA 2KY9A 3QXEB 4KUDK 5L23A 3JCMe 1YIJA 1TG0A 3M57A 1EX4A 2IIMA 3PTAA 1AT1B 2YLBA 1SRMA 1YJ9Q 1SHGA 4KGZB 2C0IA 2ABLA 4Z8AA 2DO3A 5GAN8 1GXIE 3C4SA 1UGRB 4M7AD 3H0HA 3UT1A 1YJWQ 2R58A 2OTLA 1VQ6A 4ANJA 4IKFA 2GF7A 1RLPC 2LTOA 2GTJA 2DJZA 5KYWB 1XQHA 2PQWA 3LW5E 1KQSP 4C92D 3VS3A 1KK7A 3M59A 3CCMQ 5D6YA 4M7AC 1XTDA 2CP0A 4EIKA 3OY9A 3EGDB 3OW2A 1UB4A 4A53A 3L2QA 3QPHA 3UF4A 5KYXA 3CPWP 2M51A 1WXBA 4PJJA 2QEXT 4M7AF 4C92C 3EGUA 2CH4W 1Q86U 2JTEA 5GANd 5GAMg 2D6FA 1WZOA 3OYDA 2KRMA 3V8KA 2HQEA 3E1SA 1JU5C 1QVGP 4CI0C 3MEVA 2KDSA 1YHQA 3CC7T 3JB9D 4C92F 2RQTA 3CC4T 1TUCA 1RUWA 2M0OA 2KBTA 2YRVA 1Y7XA 4N0AC 4M78A 2J6KA 4PJOE 2OTJA 1ZSZC 3M5AA 3LWIA 2BE7D 2NYSA 2YUOA 3FB9A 2K9GA 2BIVA 2RO0A 2DIQA 2V8IA 3KFVA 4PJLA 5GAN6 4V2SA 2L0AA 3GIBA 4JPBW 2LRQA 1YBYA 1FYNA 2EYXA 3JCMg 2QDLA 2QQSA 2BUDA 1OOTA 3VUZA 1FX7A 2P0QA 1T0HA 4XTWA 1Y0MA 3CCRT 4C5IA 3JB9F 3CQTA 4HVVA 4LDVA 1XJWB 4DBFA 2O4XB 4OP0A 1PSFA 1V1CA 1K8AC 1XOVA 4ELZC 2DD4A 3HTRA 2YWWA 4QQDA 4LD6A 2KAFA 3HPWA 1VQOA 4F7UF 3VS1A 4E7JA 3SWNA 3E2UA 1QVPA 3HL8A 3GNGA 3CCST 1ZA1B 2DJQA 2CP2A 2RHIA 2LQNA 1D1BA 2DTOA 1BBZA 5I21A 1M2VA 2DFUA 5HKCA 1AD5A 4FYVB 4ZGDB 2R57A 1WQWA 3TQ7P 5GMKl 2DL3A 3CCRQ 4DA4A 3DB3A 1KHCA 2J06A 1Z9ZA 2M16A 5I11A 3OS0A 4M7DE 4OB0B 1HJDA 3VS2A 3L42A 4PFOA 3DKMA 1GFCA 3G7ZA 4KRTA 4QVDA 5LJ5e 1D3BA 1HYOA 4FCYA 4EMKC 2PU9B 4PKCC 5GJWB 1OZ3A 2EIFA 2CZ0B 1IRXA 4RCBA 2KQWA 3CCSQ 3I55T 2F2WA 2O2OA 3X25B
chains in the Genus database with same CATH topology
2FPEA 2F2VA 3PVQA 2DL5A 1AWOA 2DBMA 2L3PA 2JMCA 3C0CA 2L3QA 2EGAA 2FRWA 3I5RA 3H41A 1B3QA 4OMPA 2O9SA 1UG1A 2DA9A 2KXCA 4LE9A 2CH4A 3VS4A 4F17A 1WXTA 4DEXA 2PNIA 2J05A 2X3WD 4CC3A 2DYBA 3QWXX 2AZVA 4OMNA 1KIKA 2FPDA 4J9HA 2RQRA 4D8DA 2W0ZA 4HCKA 1MV0B 2O88A 4AG1C 2AZSA 4WCIA 1YWOA 1NG2A 1U3OA 2KE9A 2LJ0A 2ROLA 1WI7A 1MV3A 5I22A 3NHNA 2DBKA 1PRLC 4J9DA 2EKHA 4F14A 4ORZA 2EGEA 4IIMA 3RBBB 4FSSA 1W6XA 4X1VA 1NLOC 1VYTA 2JT4A 4J9EA 2F2XA 1GFDA 2KGTA 4Z88A 3M0UA 2AKKA 1ZBJA 4IIOA 3VRZA 3PE0A 5IHKA 3EG3A 1I0CA 3NGPA 2GQIA 3VRYA 1X43A 4R0KA 1UECA 2A37A 3UATA 4RTWA 2YUNA 1KJWA 1AOJA 2DX1A 4OMQA 1HD3A 5FW9A 4ESRA 1GBRA 2FG0A 2FO0A 1PKSA 4Z89A 5IH2A 2RPNA 2KROA 2VVKA 2FRYA 2RQUA 2RNAA 1ZX6A 4K11A 4JZ4A 1WXUA 2EGCA 2OI3A 2YDLA 4LUEA 2I0NA 2KYMA 4CC4B 2G6FX 1NEGA 4ZNXA 2CSQA 4OMOA 2KYBA 2KT1A 2DNUA 2HEQA 2KNBB 2VWFA 1QCFA 2HBWA 3LH5A 3ULRB 2HCKA 1SRLA 2DMOA 4M4ZA 5EC7A 1WLPB 3SEMA 2MCNA 1VA7A 3PVLA 1UFFA 4RTUA 5FWCA 3O5ZA 1UE9A 2ED1A 1WX6A 2C0TA 1EFNA 2EVRA 2A08A 2K3BA 3SHWA 2ESWA 2K6DA 3EHQA 1K0XA 1X2KA 1K1ZA 1UTIA 2RF0A 1CSKA 1WIEA 3REAB 3ZL7C 3EHRA 1UUEA 1I07A 4AFUC 1OV3A 4LNPA 1BB9A 1WFWA 1PRMC 2K79A 3M0QA 1UJYA 2D8JA 4CC2A 1BU1A 1PHTA 1ABOA 2KR3A 3EG0A 2LMJA 1K76A 5HCKA 3EG2A 1M27C 1ARKA 1I1JA 4OMMA 2YUPA 1AWXA 3IQLA 1G2BA 1X6GA 2D0NA 2K7AA 4GLMA 2ECZA 2LP5A 2MIOA 2LQWA 1K9AA 1AWWA 1VYUA 2DM1A 1CKAA 2MOXA 2L2PA 3M0RA 1U06A 1X2QA 1ZUYA 3H0FA 2JM9A 2KRNA 2EQIA 1SSHA 2CUDA 2YT6A 1RLQC 2CT4A 1UJ0A 2D1XA 3U23A 1YNZA 4E6RA 2SRCA 1PKTA 1YN8A 4OMLA 1M3AA 2O31A 3RNJA 4RUGA 2DL7A 3I5SA 2DRKA 1TUDA 2CDTA 2SEMA 2D8HA 1HSQA 1RI9A 1Y57A 2DE0X 3QWYA 2LZ6B 2H8HA 1IO6A 1GL5A 1WYXA 1K4US 4Y92A 1SPKA 1JXMA 5GJVB 1QLYA 2AKLA 1ZLMA 4AFSC 1PWTA 2EYWA 2BTTA 2J6FA 1NEBA 2DVJA 1H8KA 1UHFA 1ZUKA 2E5KA 2GTOA 2OJ2A 2LNHB 2J6OA 1W1FA 2ROTA 1U5SA 4RTZA 2CREA 3REBB 2HSPA 4RTXA 2AK5A 2CUBA 2O9VA 4J9IA 4J9BA 5L23A 4AG2C 1TG0A 2BZ8A 2JXBA 2VKNA 2A36A 2IIMA 2GGRA 1WDXA 1SRMA 2FPFA 1SHGA 4J9CA 4DEYA 1NM7A 2C0IA 4RTVA 2ABLA 2ENMA 4Z8AA 1YWPA 4AFZC 2L3SA 3H0HA 3NMZC 1T3LA 3M0TA 1OEBA 1T0JA 3A98A 1RLPC 2GTJA 1YCSB 2YSQA 1MUZA 3THKA 1UDLA 3VS3A 1YP5A 4LN2A 2BZYA 2LJ3A 1JQQA 4LUDA 3TSWA 1S1NA 4EIKA 2EW3A 4JJBA 4HVUA 1H3HA 3H0IA 1AZEA 1QWFA 2JW4A 4RTTA 1SEMA 2ED0A 3UF4A 4JJCA 2JS0A 2M51A 1WXBA 4QT7A 1GCPA 2DILA 2XMFA 3EGUA 1NLPC 2CH4W 3VS6A 3TSZA 2JTEA 2KRSA 1GRIA 2CSIA 2JM8A 2K2MA 1M30A 2C0OA 2KRMA 2EBPA 5IHIA 1UGVA 2RQVA 2RN8A 1JU5C 1T3SA 1OPLA 5IXBA 1N5ZA 2KT8A 2RQTA 1KFZA 1TUCA 2DLPA 2V1RA 1RUWA 2NUZA 2KBTA 2RQWA 2RMOA 1ZUUA 1OPKA 1JO8A 1K0SA 1NYFA 2KEAA 2J6KA 1J3TA 3M0PA 1JXOA 3VS7A 1QKWA 2HDAA 2YUOA 2K9GA 4D8KA 3KFVA 5IXFA 2L0AA 4F16A 2P4RA 1AEYA 4JPBW 1A0NB 1GBQA 3EG1A 1FYNA 2CT3A 2EYXA 3VS0A 2A28A 1AZGB 2QDLA 1OOTA 1QWEA 2PZ1A 2YUQA 2GNCA 1T0HA 1Y0MA 1E7OA 1W70A 2M0YA 4GBQA 4A63B 1FMKA 3CQTA 2V1QA 1BK2A 4HVVA 4CC7A 2EPDA 1SHFA 4AFQC 1G83A 1M3CA 1V1CA 1H92A 1XOVA 1GCQA 1NYGA 1ABQA 2LX7A 1CKBA 4HVWA 3VS1A 4J9FA 1QKXA 5IHNA 1ZSGA 1VYVA 2W10A 2BZXA 1X69A 1M3BA 2JS2A 2DRMA 1X6BA 2DJQA 2DF6A 1JEGA 1WA7A 2LQNA 1B07A 4JZ3A 1M8MA 1E6HA 2NWMA 1BBZA 1E6GA 1AWJA 2PTKA 2GBQA 1AD5A 3R6NA 2FEIA 3FJ5A 2EYZA 1LCKA 1GCQC 3VS5A 1X27A 2DL3A 4J9GA 3JV3A 2J06A 1Z9ZA 3I9QA 3GBQA 2LCSA 5I11A 2KXDA 1HJDA 3NPFA 2J7IA 3VS2A 4JJDA 1KSWA 1AVZC 4RTYA 1GFCA 4KRTA 2B86A 1Z9QA 3I35A 5FWBA 5ECAA 3TVTA 5GJWB 1PNJA 2LJ1A 2OAWA 2DL4A 2X3XD 2EYYA 4HXJA 3M0SA 3UA7A 1UHCA 3UA6A 2JMAA 2DL8A 2F2WA 2O2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FPE A;  2F2V A;  3PVQ A;  2DL5 A;  1AWO A;  2DBM A;  2L3P A;  2JMC A;  3C0C A;  2L3Q A;  2EGA A;  2FRW A;  3I5R A;  3H41 A;  1B3Q A;  4OMP A;  2O9S A;  1UG1 A;  2DA9 A;  2KXC A;  4LE9 A;  2CH4 A;  3VS4 A;  4F17 A;  1WXT A;  4DEX A;  2PNI A;  2J05 A;  2X3W D;  4CC3 A;  2DYB A;  3QWX X;  2AZV A;  4OMN A;  1KIK A;  2FPD A;  4J9H A;  2RQR A;  4D8D A;  2W0Z A;  4HCK A;  1MV0 B;  2O88 A;  4AG1 C;  2AZS A;  4WCI A;  1YWO A;  1NG2 A;  1U3O A;  2KE9 A;  2LJ0 A;  2ROL A;  1WI7 A;  1MV3 A;  5I22 A;  3NHN A;  2DBK A;  1PRL C;  4J9D A;  2EKH A;  4F14 A;  4ORZ A;  2EGE A;  4IIM A;  3RBB B;  4FSS A;  1W6X A;  4X1V A;  1NLO C;  1VYT A;  2JT4 A;  4J9E A;  2F2X A;  1GFD A;  2KGT A;  4Z88 A;  3M0U A;  2AKK A;  1ZBJ A;  4IIO A;  3VRZ A;  3PE0 A;  5IHK A;  3EG3 A;  1I0C A;  3NGP A;  2GQI A;  3VRY A;  1X43 A;  4R0K A;  1UEC A;  2A37 A;  3UAT A;  4RTW A;  2YUN A;  1KJW A;  1AOJ A;  2DX1 A;  4OMQ A;  1HD3 A;  5FW9 A;  4ESR A;  1GBR A;  2FG0 A;  2FO0 A;  1PKS A;  4Z89 A;  5IH2 A;  2RPN A;  2KRO A;  2VVK A;  2FRY A;  2RQU A;  2RNA A;  1ZX6 A;  4K11 A;  4JZ4 A;  1WXU A;  2EGC A;  2OI3 A;  2YDL A;  4LUE A;  2I0N A;  2KYM A;  4CC4 B;  2G6F X;  1NEG A;  4ZNX A;  2CSQ A;  4OMO A;  2KYB A;  2KT1 A;  2DNU A;  2HEQ A;  2KNB B;  2VWF A;  1QCF A;  2HBW A;  3LH5 A;  3ULR B;  2HCK A;  1SRL A;  2DMO A;  4M4Z A;  5EC7 A;  1WLP B;  3SEM A;  2MCN A;  1VA7 A;  3PVL A;  1UFF A;  4RTU A;  5FWC A;  3O5Z A;  1UE9 A;  2ED1 A;  1WX6 A;  2C0T A;  1EFN A;  2EVR A;  2A08 A;  2K3B A;  3SHW A;  2ESW A;  2K6D A;  3EHQ A;  1K0X A;  1X2K A;  1K1Z A;  1UTI A;  2RF0 A;  1CSK A;  1WIE A;  3REA B;  3ZL7 C;  3EHR A;  1UUE A;  1I07 A;  4AFU C;  1OV3 A;  4LNP A;  1BB9 A;  1WFW A;  1PRM C;  2K79 A;  3M0Q A;  1UJY A;  2D8J A;  4CC2 A;  1BU1 A;  1PHT A;  1ABO A;  2KR3 A;  3EG0 A;  2LMJ A;  1K76 A;  5HCK A;  3EG2 A;  1M27 C;  1ARK A;  1I1J A;  4OMM A;  2YUP A;  1AWX A;  3IQL A;  1G2B A;  1X6G A;  2D0N A;  2K7A A;  4GLM A;  2ECZ A;  2LP5 A;  2MIO A;  2LQW A;  1K9A A;  1AWW A;  1VYU A;  2DM1 A;  1CKA A;  2MOX A;  2L2P A;  3M0R A;  1U06 A;  1X2Q A;  1ZUY A;  3H0F A;  2JM9 A;  2KRN A;  2EQI A;  1SSH A;  2CUD A;  2YT6 A;  1RLQ C;  2CT4 A;  1UJ0 A;  2D1X A;  3U23 A;  1YNZ A;  4E6R A;  2SRC A;  1PKT A;  1YN8 A;  4OML A;  1M3A A;  2O31 A;  3RNJ A;  4RUG A;  2DL7 A;  3I5S A;  2DRK A;  1TUD A;  2CDT A;  2SEM A;  2D8H A;  1HSQ A;  1RI9 A;  1Y57 A;  2DE0 X;  3QWY A;  2LZ6 B;  2H8H A;  1IO6 A;  1GL5 A;  1WYX A;  1K4U S;  4Y92 A;  1SPK A;  1JXM A;  5GJV B;  1QLY A;  2AKL A;  1ZLM A;  4AFS C;  1PWT A;  2EYW A;  2BTT A;  2J6F A;  1NEB A;  2DVJ A;  1H8K A;  1UHF A;  1ZUK A;  2E5K A;  2GTO A;  2OJ2 A;  2LNH B;  2J6O A;  1W1F A;  2ROT A;  1U5S A;  4RTZ A;  2CRE A;  3REB B;  2HSP A;  4RTX A;  2AK5 A;  2CUB A;  2O9V A;  4J9I A;  4J9B A;  5L23 A;  4AG2 C;  1TG0 A;  2BZ8 A;  2JXB A;  2VKN A;  2A36 A;  2IIM A;  2GGR A;  1WDX A;  1SRM A;  2FPF A;  1SHG A;  4J9C A;  4DEY A;  1NM7 A;  2C0I A;  4RTV A;  2ABL A;  2ENM A;  4Z8A A;  1YWP A;  4AFZ C;  2L3S A;  3H0H A;  3NMZ C;  1T3L A;  3M0T A;  1OEB A;  1T0J A;  3A98 A;  1RLP C;  2GTJ A;  1YCS B;  2YSQ A;  1MUZ A;  3THK A;  1UDL A;  3VS3 A;  1YP5 A;  4LN2 A;  2BZY A;  2LJ3 A;  1JQQ A;  4LUD A;  3TSW A;  1S1N A;  4EIK A;  2EW3 A;  4JJB A;  4HVU A;  1H3H A;  3H0I A;  1AZE A;  1QWF A;  2JW4 A;  4RTT A;  1SEM A;  2ED0 A;  3UF4 A;  4JJC A;  2JS0 A;  2M51 A;  1WXB A;  4QT7 A;  1GCP A;  2DIL A;  2XMF A;  3EGU A;  1NLP C;  2CH4 W;  3VS6 A;  3TSZ A;  2JTE A;  2KRS A;  1GRI A;  2CSI A;  2JM8 A;  2K2M A;  1M30 A;  2C0O A;  2KRM A;  2EBP A;  5IHI A;  1UGV A;  2RQV A;  2RN8 A;  1JU5 C;  1T3S A;  1OPL A;  5IXB A;  1N5Z A;  2KT8 A;  2RQT A;  1KFZ A;  1TUC A;  2DLP A;  2V1R A;  1RUW A;  2NUZ A;  2KBT A;  2RQW A;  2RMO A;  1ZUU A;  1OPK A;  1JO8 A;  1K0S A;  1NYF A;  2KEA A;  2J6K A;  1J3T A;  3M0P A;  1JXO A;  3VS7 A;  1QKW A;  2HDA A;  2YUO A;  2K9G A;  4D8K A;  3KFV A;  5IXF A;  2L0A A;  4F16 A;  2P4R A;  1AEY A;  4JPB W;  1A0N B;  1GBQ A;  3EG1 A;  1FYN A;  2CT3 A;  2EYX A;  3VS0 A;  2A28 A;  1AZG B;  2QDL A;  1OOT A;  1QWE A;  2PZ1 A;  2YUQ A;  2GNC A;  1T0H A;  1Y0M A;  1E7O A;  1W70 A;  2M0Y A;  4GBQ A;  4A63 B;  1FMK A;  3CQT A;  2V1Q A;  1BK2 A;  4HVV A;  4CC7 A;  2EPD A;  1SHF A;  4AFQ C;  1G83 A;  1M3C A;  1V1C A;  1H92 A;  1XOV A;  1GCQ A;  1NYG A;  1ABQ A;  2LX7 A;  1CKB A;  4HVW A;  3VS1 A;  4J9F A;  1QKX A;  5IHN A;  1ZSG A;  1VYV A;  2W10 A;  2BZX A;  1X69 A;  1M3B A;  2JS2 A;  2DRM A;  1X6B A;  2DJQ A;  2DF6 A;  1JEG A;  1WA7 A;  2LQN A;  1B07 A;  4JZ3 A;  1M8M A;  1E6H A;  2NWM A;  1BBZ A;  1E6G A;  1AWJ A;  2PTK A;  2GBQ A;  1AD5 A;  3R6N A;  2FEI A;  3FJ5 A;  2EYZ A;  1LCK A;  1GCQ C;  3VS5 A;  1X27 A;  2DL3 A;  4J9G A;  3JV3 A;  2J06 A;  1Z9Z A;  3I9Q A;  3GBQ A;  2LCS A;  5I11 A;  2KXD A;  1HJD A;  3NPF A;  2J7I A;  3VS2 A;  4JJD A;  1KSW A;  1AVZ C;  4RTY A;  1GFC A;  4KRT A;  2B86 A;  1Z9Q A;  3I35 A;  5FWB A;  5ECA A;  3TVT A;  5GJW B;  1PNJ A;  2LJ1 A;  2OAW A;  2DL4 A;  2X3X D;  2EYY A;  4HXJ A;  3M0S A;  3UA7 A;  1UHC A;  3UA6 A;  2JMA A;  2DL8 A;  2F2W A;  2O2O A; 
#chains in the Genus database with same CATH topology
 4E7L A;  2FPE A;  2DL5 A;  4NL3 A;  1AWO A;  4MZP A;  1VUB A;  2DBM A;  2JMC A;  3LYI A;  1VQ4 Q;  1Q81 U;  3P8D A;  3H41 A;  4M77 B;  2VAS A;  3RMS A;  3X20 B;  2OAU A;  2E5Q A;  1WXT A;  3V8J A;  4CC3 A;  3OMG A;  2LC4 A;  3EG9 B;  5LJ5 j;  1B34 A;  3M56 A;  2AZV A;  1KIK A;  5FU6 B;  4HCK A;  1IRE B;  3MP1 A;  4QVZ A;  2O88 A;  1U1T A;  4AG1 C;  1K73 U;  1RAA B;  4OB1 B;  4M7D A;  2NUT A;  4FT2 A;  2VB6 A;  4E2F B;  2GFA A;  5I22 A;  3AHU A;  3BW1 A;  3QBY A;  4KUI A;  4IIM A;  3RBB B;  3I55 Q;  2RI5 A;  1VQ9 A;  4HT8 A;  1NLO C;  1WJS A;  5GAM d;  4J9E A;  3X26 B;  1GFD A;  2FB7 A;  2HD0 A;  1VQ5 A;  4FU6 A;  1ZBJ A;  4IIO A;  4BY6 C;  1VQ7 Q;  3HFO A;  1UGS B;  5IHK A;  1Q82 R;  4ME7 A;  3URG A;  5LJ5 g;  3CD6 T;  1VQN T;  2YUN A;  4HCB A;  5GAO n;  5FW9 A;  3G6E A;  3OW2 P;  4BDZ A;  5IH2 A;  1KD1 C;  2RPN A;  3FC3 A;  5FU7 B;  2RNA A;  1N8R U;  4K11 A;  3C12 A;  1PCX A;  3H6Z A;  3CCJ T;  1M8V A;  3JCM d;  2VGN A;  2HKQ B;  4N4I A;  2K57 A;  4PLL A;  1G8X A;  2AHJ B;  2QA4 A;  1OU9 A;  5KYY A;  4PJO D;  2HEQ A;  2KNB B;  3G71 T;  3LH5 A;  3OMC A;  4II1 A;  2JNG A;  1VA7 A;  3RR6 A;  1UFF A;  4OGC A;  5GAN 2;  3LH0 A;  3CMA T;  3O5Z A;  2QGF B;  2EVR A;  2A08 A;  2K3B A;  4C8Q E;  1VQN Q;  3SHW A;  4PJO C;  4FSX A;  2EFI A;  3REA B;  1S72 T;  1UUE A;  3JB9 I;  5CIU A;  3UPU A;  5A2Q E;  1K9M R;  3UDC A;  1UJY A;  1P92 A;  4CC2 A;  1VQ8 Q;  1VIE A;  4PJO F;  2CP7 A;  1ABO A;  3J80 E;  3OYG A;  5HCK A;  1ARK A;  1I1J A;  1W4S A;  2WSF E;  4ZGJ B;  3CCJ Q;  5EG2 A;  4ZTF A;  3MET A;  5GAO r;  3KBG A;  3AT1 B;  4CRI A;  1Q86 R;  3JCM P;  2LQW A;  2R5M A;  1K9A A;  1VYU A;  1CKA A;  2MOX A;  5GAN j;  3CBP A;  2RM4 A;  3G71 Q;  1Q7Y C;  2CP5 A;  2YT6 A;  2MI6 A;  1UJ0 A;  3U23 A;  1YNZ A;  1LNX A;  2DRK A;  2PVG B;  5GAN 5;  3SWN B;  3WXM B;  2ZAE A;  1C6V X;  4X9C A;  9ATC B;  1OYX A;  1S72 Q;  4DOV A;  1WYX A;  3JCM V;  4Y92 A;  1M5Q 1;  4M7D D;  3X28 B;  1H3Z A;  4VUB A;  2LQ8 A;  3UWN A;  1NEB A;  3VYH B;  1VQL T;  4M75 G;  2XU8 A;  2GTO A;  2E5K A;  1M2V B;  2EKO A;  4C5H A;  3OB9 A;  5GAO l;  3E9F A;  1U5S A;  5KE2 A;  5LJ3 e;  2XG8 D;  3V7R A;  2ZZD A;  3WVD B;  4M7D C;  3CCQ A;  4M7A A;  4J6W A;  2DZ9 A;  4XU3 A;  3SFM A;  3JRZ A;  2O9V A;  3ZEH A;  4XAX B;  2PVO B;  2A36 A;  1B7T A;  1IZ6 A;  2LX9 A;  4M7D F;  3RKX A;  4FW1 A;  3EGX B;  3GPL A;  4C92 A;  4RTV A;  2L3S A;  2IG0 A;  1WNL A;  3G1J A;  3L2Z A;  1RAC B;  4FT4 A;  3M0T A;  3QDF A;  3CCU T;  1FMW A;  3A98 A;  3L2W A;  3NTK A;  1JB0 E;  5KCH A;  1M90 C;  2OX7 A;  1VQM A;  2QQ9 A;  1MMG A;  2YSQ A;  5D6X A;  4BE1 A;  1UDL A;  4DBH A;  1YP5 A;  1VQL Q;  4LN2 A;  1VQK T;  1JRI A;  1JQQ A;  3MEW A;  4N0A A;  3QJY A;  1H3H A;  1ZSZ A;  1QW1 A;  3HFN A;  4C5E A;  4OMF B;  5LJ5 h;  1YJN A;  4QT7 A;  2XMF A;  3VS6 A;  3RKW A;  2JM8 A;  3ASK A;  3CPF A;  4BE0 A;  1TU0 B;  3RER A;  1M4Z A;  2LCL A;  2K2V A;  1WGS A;  2KI7 A;  5LJ3 f;  3SB2 A;  3N5B B;  3BDL A;  3JCM Q;  2V1R A;  1MND A;  2F5T X;  3QII A;  4XTX A;  1ZA2 B;  2L5Q A;  3EFO B;  2E65 A;  3SD4 A;  1JXO A;  5LJ3 g;  2HDA A;  4XTZ A;  3HRT A;  4D8K A;  1IGU A;  4Y91 A;  1Q81 R;  5GAN 3;  4F16 A;  2M9U A;  4XTV A;  1YJW T;  2HL3 A;  1OX8 A;  3CC2 T;  3OYI A;  1W70 A;  3CCV T;  4PFZ A;  2L89 A;  4GBQ A;  5GAO p;  4A63 B;  2CGH A;  3CD6 A;  2EPD A;  2MMP A;  3CCM T;  1Q95 G;  3HP9 A;  3S3O A;  1G83 A;  3OBW A;  4AT1 B;  1BCM A;  4E7H A;  4HCZ A;  2NUP A;  2XDP A;  1K73 R;  3QYH B;  4C92 G;  2LX7 A;  1KC8 R;  4AMC A;  4C0D B;  4ZTJ A;  1CKB A;  4J9F A;  4M75 B;  1ZSG A;  4C8Q D;  4R56 A;  4KBM B;  4BD3 A;  4EDU A;  2K5I A;  4EMK A;  2JTM A;  1QP3 A;  5KYY B;  3CCL T;  1WA7 A;  5GAM j;  2G3R A;  1B07 A;  4Y28 E;  4MML A;  4PJM A;  1YI2 A;  2MK5 A;  4C8Q C;  4LDW A;  1AWJ A;  1MGQ A;  2PTK A;  1SKU B;  3JB9 G;  3R6N A;  2FEI A;  2LVM A;  1LCK A;  3CC2 Q;  3GF5 A;  1X27 A;  2F5K A;  3OS1 A;  3JV3 A;  3CCV Q;  3RIR A;  4C0G A;  8AT1 B;  4XTY A;  3I9Q A;  3GBQ A;  5CKB A;  2KXD A;  4C8Q F;  1N8R R;  1ZQ1 A;  1BCO A;  4DQ2 A;  2J7I A;  4JS4 A;  4JJD A;  1KSW A;  1K9M U;  3OYB A;  4RTY A;  1Q82 C;  4F7U G;  3WVE B;  2RA2 A;  3TU4 K;  3I35 A;  5FWB A;  1Y07 A;  5ECA A;  2E4H A;  2QG9 B;  1PNJ A;  2LJ1 A;  2OAW A;  2EYY A;  4HXJ A;  1TH7 A;  3M0S A;  5GAN h;  1V29 B;  2JMA A;  2BE9 B;  2E64 A;  3CCL Q;  4M77 G;  4J7I A;  1LOJ A;  3CME T;  3C0C A;  2L3Q A;  3PMT A;  3NTH A;  2FRW A;  1I4K 1;  1VOM A;  1UG1 A;  2CH4 A;  3VS4 A;  4F17 A;  3M54 A;  2PNI A;  2X3W D;  4KGV B;  4WTO B;  2FL7 A;  1W2B S;  2JZ2 A;  4PK4 A;  3JCM J;  2FPD A;  2E6N A;  2RQR A;  2JTF A;  2QQR A;  3G6E Q;  5C0M A;  2VUB A;  3ZFJ A;  1OQK A;  6AT1 B;  1PD0 A;  3RES A;  4E7Z A;  4N4G A;  2CKK A;  5HY6 A;  2RJD A;  4WCI A;  4P5N A;  1WI7 A;  3V8L A;  5CQY A;  3R6O A;  3JB9 H;  1TS9 A;  4M7A B;  2MAM A;  4ORZ A;  3VJP A;  2EGE A;  2A7Y A;  4BDY A;  4NOY A;  1G3Y A;  4C0F A;  3CME Q;  3VYG A;  1VYT A;  5FLX E;  2F2X A;  2KGT A;  2DXB A;  4HKE A;  1IHV A;  3V7S A;  3PE0 A;  4NL2 A;  1Q86 C;  3G4S A;  4C92 B;  2GQI A;  4L5G A;  2HBP A;  4XK8 E;  4JJN K;  4IUU A;  3CXC S;  4X34 A;  1X43 A;  4R0K A;  1UEC A;  4JLI A;  1QCO A;  1GBR A;  4ESR A;  2FO0 A;  2HQX A;  1PKS A;  1JJ2 S;  3CCU A;  1VQ4 T;  4LD9 K;  4IUQ A;  5LJ3 d;  2LT1 A;  4PJO A;  1I81 A;  1C0M A;  2DVE A;  4JZ4 A;  4LXC A;  1WXU A;  4QVC A;  2OI3 A;  4Q5W A;  2F69 A;  2YDL A;  2CP3 A;  1ZSZ B;  4EMH A;  4LUE A;  3OYL A;  2KYM A;  2G6F X;  1NEG A;  5FU6 C;  4E47 A;  1N9R A;  2KT1 A;  4YTL A;  4PL6 A;  5J3B A;  1QCF A;  2ZPG B;  4C0Z A;  4F7U B;  4M78 G;  2C0T A;  1RAI B;  5KYU B;  2ESW A;  3TCJ A;  3A8O B;  4OB3 B;  3VV0 A;  1X2K A;  3Q1J A;  1K0X A;  1BIA A;  1UTI A;  4JS5 A;  1D1C A;  4QQ6 A;  1WIE A;  2EJF A;  3HKS A;  1OV3 A;  2VGM A;  1NBE B;  1TTH B;  1PRM C;  1VQ7 T;  1R8O B;  2YLC A;  1BU1 A;  1PD1 A;  2KR3 A;  1YJ9 A;  3EG0 A;  1NJI U;  2LMJ A;  3L2R A;  3EG2 A;  3A8H B;  1M27 C;  2KK4 A;  3I56 A;  3M4G A;  3P8H A;  1X6G A;  4GLM A;  2LP5 A;  1VQP T;  1M1K C;  2JM9 A;  1KD1 U;  1X01 A;  1MMN A;  2EQI A;  2YRD A;  3CCQ Q;  3CCE T;  2O01 E;  3CXC A;  2KSS A;  2Y90 A;  2NUP B;  2D1X A;  2L3R A;  2ZGW A;  3CCM A;  1OU8 A;  2B8A A;  5D7U A;  1KC8 U;  3A5Z B;  2KMT A;  3RNJ A;  4MZT A;  4RUG A;  3QO3 A;  3I5S A;  2A3L A;  1JJ2 A;  4M75 E;  3ZBD A;  1NE8 A;  3QYG B;  4A4E A;  1TUD A;  2QDY B;  1RI9 A;  2QAZ A;  4EMK B;  5GAM h;  4BI3 A;  2NLU A;  1WJR A;  4O5V A;  1JXM A;  4PJO G;  1QCN A;  1FMV A;  3S3N A;  3ME9 A;  3ER0 A;  5FRM A;  1G3W A;  3MP8 A;  2EYW A;  2Z0W A;  4IUP A;  1UHF A;  4EPC A;  1RAE B;  3BFM A;  2OJ2 A;  2J6O A;  2MF2 A;  3OYC A;  2COY A;  1YIT T;  2DD5 A;  2CRE A;  4LDX A;  2HSP A;  1VQP Q;  4A54 A;  3FJP A;  2RHX A;  1VQ8 T;  4J9B A;  3CCE Q;  3PT9 A;  4AG2 C;  4UC4 A;  2JXB A;  4IUR A;  2M02 A;  4MMK A;  3JCM h;  2FPF A;  4DEY A;  3MKD A;  1KHI A;  5CK9 A;  2ENM A;  5KYX B;  3NMZ C;  2IVW A;  1RAF B;  1QVG S;  2RJF A;  2XI9 A;  1OEB A;  2QEX A;  4JRK A;  3QSU A;  1Q7Y U;  1K73 C;  4JRI A;  1XNI A;  2DEU A;  1MUZ A;  3THK A;  2BZY A;  2LJ3 A;  4LUD A;  3CBM A;  1S1N A;  2HL5 C;  2FVU A;  2EW3 A;  1D0X A;  4JJB A;  4HVU A;  5J26 A;  5DM7 R;  3H0I A;  3CC7 A;  3CC4 A;  4RTT A;  1YIT Q;  4FYW B;  4M78 B;  3VKI A;  1SEM A;  2OTL T;  4JJC A;  2JS0 A;  1VQ6 T;  3MP6 A;  1WQ7 A;  2DIL A;  4BY6 B;  3INZ A;  4E7K A;  1HXD A;  1NLP C;  2KRS A;  2CSI A;  4M7D G;  1PM3 A;  2K2M A;  1G3S A;  2C0O A;  3QKJ A;  4OVA A;  5IHI A;  4QW2 A;  5CKD A;  1UGV A;  3NFC A;  5KYW A;  2LCC A;  2AT1 B;  4XU0 A;  1KFZ A;  2DLP A;  2YRC A;  2RB6 A;  1RAD B;  1RL2 A;  3EGD A;  2QYZ A;  2RQW A;  2LT4 A;  3CCR A;  1ZUU A;  5CKH A;  2GQV A;  1JO8 A;  1K0S A;  1NYF A;  2COW A;  2E41 A;  2A0F B;  3M0P A;  1QKW A;  4JUV A;  3E19 A;  1YIJ Q;  5KYN A;  4XTU A;  5GAN 7;  5IXF A;  4FW2 A;  2P4R A;  1AEY A;  1A0N B;  2QAS A;  3OYF A;  3VS0 A;  1AZG B;  1YHQ T;  1MMD A;  4PNO A;  1QWE A;  2YUQ A;  3FEO A;  2OTL Q;  4GLK A;  1E7O A;  2M0Y A;  1VQ6 Q;  1VIF A;  1M90 U;  1FMK A;  3CCS A;  2V1Q A;  4C8Q A;  1BK2 A;  4OB2 B;  3QG1 A;  1N6A A;  4QKU A;  2EWN A;  2P0K A;  2DPP B;  1RAH B;  1PC0 A;  2RHU A;  3MEA A;  4PJO B;  2QQA A;  1NYG A;  1R0B G;  8ATC B;  1WHH A;  1VQ4 A;  5GAN f;  5IHN A;  2W10 A;  4DBQ A;  2BZX A;  3D7S B;  5IN1 A;  3RDV A;  1X69 A;  3PMI A;  4JRP A;  2COZ A;  2HAX A;  2DRM A;  1JEG A;  1RAB B;  2DF6 A;  1D3B B;  1EZZ B;  4JZ3 A;  2RD1 A;  1M8M A;  2K5L A;  1E6H A;  4LDY A;  2VXE A;  2NWM A;  2O4X A;  4ZGE B;  3JB9 J;  1E6G A;  2JOY A;  1YHQ Q;  4A4H A;  1VQO T;  2GBQ A;  1OX9 A;  2EYZ A;  1GCQ C;  3VS5 A;  4BAC A;  1NZ9 A;  2OTJ Q;  3I55 A;  3NPF A;  1WHJ A;  5LJ3 j;  1ACM B;  3MPU B;  1AVZ C;  3LX7 A;  4M77 E;  5CVI A;  3H9N A;  2B86 A;  1OI1 A;  1Z9Q A;  3HHT B;  2DTI A;  2JJ9 A;  3FIF A;  1Y96 A;  1WPY A;  3KXT A;  2X3X D;  4XU1 A;  3CXC P;  3A8G B;  1B34 B;  1BI1 A;  4BI8 B;  3UA7 A;  3UA6 A;  4QQG A;  4HT9 A;  2DL8 A;  2WSC E;  4MZM A;  3JAM E;  1JJ2 P;  4M7D B;  3SDZ A;  2NUT B;  2HSE B;  4M75 C;  1RAG B;  2WAC A;  3MCA B;  2EGA A;  2ZPF B;  2DKG A;  3MO8 A;  1VQO Q;  2KXC A;  4LE9 A;  3H8Z A;  3QZ5 B;  1R77 A;  4C8Q G;  2J05 A;  4O6J A;  1BYM A;  1QVF S;  2DYB A;  3QWX X;  4PLI A;  1IXD A;  4OMN A;  2EYQ A;  4J9H A;  1NJI R;  3DLM A;  1AHJ B;  2W0Z A;  4A4G A;  3OW2 S;  2MYS A;  4RKU E;  4M7A G;  2QK0 A;  5CQX A;  2M1H A;  1H64 1;  1U3O A;  2LJ0 A;  2DXT A;  3OYA A;  1MV3 A;  1VQN A;  2CZ6 B;  3LGL A;  3NHN A;  1V76 A;  1KD1 R;  2DBK A;  2DK3 A;  2EKH A;  1N9S A;  4XU2 A;  2KVQ G;  4X1V A;  4ELY C;  2EQU A;  3EG9 A;  2ZCF B;  4Z88 A;  3M0U A;  4KGX B;  2JVV A;  3LLR A;  2K3X A;  3EG3 A;  1I0C A;  3CCJ A;  3VRY A;  2RK1 A;  1D1A A;  2A37 A;  3UAT A;  4RTW A;  2EQM A;  5I2S A;  1AOJ A;  2DX1 A;  4OMQ A;  1VQ9 T;  2X4Y A;  2FG0 A;  1OZ2 A;  3G71 A;  2EJG A;  2L8D A;  2KRO A;  2RI3 A;  2VVK A;  2VYT A;  1WHM A;  1VQ5 T;  4L59 A;  3CMA A;  3L1A A;  5FRN A;  1I5L A;  1ZBX A;  2ZPB B;  2I0N A;  2H3J A;  4CC4 B;  4M78 E;  3I56 Q;  2CSQ A;  2PVD B;  4OMO A;  1M2O A;  1S72 A;  1MMA A;  3G6E T;  3LGF A;  2DNU A;  5GMK m;  4JRQ A;  2K5F A;  2HBW A;  2YXY A;  3ULR B;  2HCK A;  1WHL A;  4MDX A;  2DMO A;  4M4Z A;  5FRO A;  1N27 A;  3SEM A;  2X35 A;  3PVL A;  2HNI A;  2K3Y A;  1QVF A;  5FWC A;  2E6Z A;  5GMK i;  1WX6 A;  2CP6 A;  1C1A A;  1Q7Y R;  2V26 A;  2K6D A;  5GAM f;  1K8A U;  2P84 A;  4R55 A;  5CAI A;  1X75 C;  7AT1 B;  4KH0 B;  2QTV A;  2CS7 A;  3ZL7 C;  1JBM A;  2QA4 T;  2YHT A;  2QTX A;  1VQ9 Q;  3VUB A;  3V7C A;  2P4T A;  3M0Q A;  1TOV A;  4FM4 B;  1VQ5 Q;  3BDU A;  2DEQ A;  2D0Q B;  2FYK A;  3EAE A;  2CZ1 B;  5AYF A;  3JCM X;  1TUG B;  3P8B B;  3O8V A;  2YUP A;  4OMM A;  1AWX A;  3IQL A;  4WF2 A;  2D0N A;  2K7A A;  5J39 A;  5DLO A;  2DM1 A;  4C8Q B;  1U06 A;  1X2Q A;  3X24 B;  2KRN A;  1FXX A;  3JCM f;  3MHX A;  1SSH A;  5AT1 B;  3M4Y A;  1VQL A;  4E6R A;  4EMG A;  2SRC A;  1PKT A;  1YN8 A;  2LDM A;  4OML A;  1M3A A;  2O31 A;  2DL7 A;  2Y4X A;  1PSE A;  1K9M C;  1UGP B;  2H3E B;  3JCM W;  2CDT A;  2SEM A;  2D8H A;  1Y57 A;  2DE0 X;  2QXF A;  2QQB A;  2LZ6 B;  5D6W A;  2JUF A;  1IO6 A;  2PUK B;  2QA4 Q;  1K4U S;  4ZN3 A;  5GJV B;  1QLY A;  2AKL A;  2RH2 A;  2LNV A;  2QEX Q;  1ZLM A;  4AFS C;  2DET A;  4Z02 A;  1PWT A;  5CKE A;  2J6F A;  4M77 D;  3EH1 A;  1BI2 A;  1H8K A;  1ZUK A;  5CCA A;  1MHN A;  2LNH B;  1M90 R;  1W1F A;  2ROT A;  4B9X A;  3REB B;  2F1L A;  3CC7 Q;  3CC4 Q;  5LJ3 h;  3TEE A;  4J9I A;  4M77 C;  4X9D A;  2E70 A;  2DXU A;  3OQ5 A;  2DZC A;  3OYN A;  2BZ8 A;  2VKN A;  5CO7 A;  3TRE A;  2GGR A;  4F04 B;  1WDX A;  1UEB A;  1VQK A;  1U1S A;  3FLG A;  3OYY A;  4J9C A;  1NM7 A;  4KT0 E;  1Y96 B;  2E3I A;  1YWP A;  4AFZ C;  4M77 F;  2V8K A;  3PGG A;  1IB8 A;  3VU3 C;  1T3L A;  1M1K U;  3CCQ T;  3A1P A;  4BE2 A;  1T0J A;  4DOW A;  1YCS B;  1W2B A;  2FZK B;  4BI4 A;  4DBR A;  5GMK e;  2AIR B;  2DAQ A;  3A8L B;  1TSF A;  3TSW A;  2EQK A;  3L2U A;  1AZE A;  3OYH A;  1QWF A;  2JW4 A;  3EGX A;  4JLG A;  2ED0 A;  2FHD A;  4KUL A;  1QP2 A;  1GCP A;  5KCO A;  3TSZ A;  2EJ9 A;  1GRI A;  1VQM T;  1M30 A;  3QJ6 A;  2EBP A;  2VC8 A;  4KH1 B;  2XDB A;  2RQV A;  2RN8 A;  1O75 A;  4LDU A;  1T3S A;  5KH6 A;  4J83 A;  2GCX A;  1OPL A;  3FDR A;  5LL6 S;  1YJW A;  5IXB A;  1N5Z A;  2KT8 A;  1I5O B;  1BI0 A;  5M9O A;  2NUZ A;  3BE3 A;  3CC2 A;  5FU7 C;  3OYJ A;  2DER A;  2RMO A;  4FYX B;  5GMK j;  3CCV A;  1YJN T;  2X4W A;  2XIC A;  1KG1 A;  1OPK A;  4RG2 A;  2KEA A;  1J3T A;  2XD0 A;  1U8R A;  2C06 A;  3VS7 A;  1IHW A;  5A0L A;  4J5Y A;  4RCC A;  3M9Q A;  2QGG A;  1GBQ A;  2VV5 A;  3EG1 A;  1PG5 B;  2CT3 A;  2A28 A;  3PIO A;  4PJN A;  4N4H A;  2PZ1 A;  3PFS A;  1M1G A;  2E12 A;  2K4Y A;  5GAN 4;  4M78 D;  1HK9 A;  3JSC A;  2GNC A;  3PNW C;  4IUV A;  3DB4 A;  4BUG A;  3OS2 A;  3OSV A;  2I2L A;  3HSB A;  4CC7 A;  3EFO A;  3CCL A;  1VQM Q;  1SHF A;  4AFQ C;  1M3C A;  1H92 A;  1GCQ A;  1KQS S;  3M55 A;  3OYE A;  1ABQ A;  1YFN A;  5LJ5 f;  3EH2 A;  5CR2 A;  1FWZ A;  5GAO q;  3E9G A;  4M78 C;  3OYM A;  3GNF B;  2RHY A;  1NPP A;  4HVW A;  2BKD N;  1QKX A;  1VYV A;  1Q81 C;  2V8J A;  2DXC A;  1M1F A;  3CPW S;  1YJN Q;  1NJI C;  1M3B A;  3CBO A;  1QVF P;  1RI0 A;  5L8R E;  2JS2 A;  4ZN1 A;  3OS5 A;  4M78 F;  5GAO m;  1X6B A;  2RI2 A;  1QQJ A;  3EFR A;  2XID A;  1YCY A;  3C94 A;  2HMA A;  3NTI A;  5DLQ E;  1Y71 A;  2EQJ A;  3FJ5 A;  1DJ7 B;  5IAY A;  4J9G A;  5HK0 A;  2E1H A;  1KC8 C;  1YIJ T;  4M75 A;  2LCS A;  3LWH A;  5HK3 A;  2MPX C;  1LJO A;  3SWN C;  3CME A;  5A0G A;  2RK2 A;  3PIP A;  1YI2 T;  4ATO A;  2RJC A;  4OF1 A;  4GY5 A;  2DYI A;  3TVT A;  5GAN e;  2DL4 A;  1SF9 A;  3MEU A;  2FZG B;  4HCC A;  1UHC A;  2CZ7 B;  3CD6 Q;  3OBY A;  1M9S A;  3S3M A;  2JN0 A;  5CKF A;  2F2V A;  3PVQ A;  3M58 A;  3GOX A;  2ZPE B;  1LVK A;  2DIG A;  3HRU A;  5KE3 A;  2L3P A;  1OUL A;  3QUI A;  3J7A F;  1KQ2 A;  4NS5 A;  1N8R C;  3I5R A;  2XDD A;  1K8A R;  2LQK A;  1B3Q A;  4OMP A;  5C6S A;  2O9S A;  2DA9 A;  4D6W A;  4M7A E;  2HKN A;  1KQS A;  4DEX A;  3RKY A;  3FRN A;  3RMQ A;  4J8O A;  4C92 E;  4D8D A;  2GFU A;  4A4F A;  2X51 A;  3CPW A;  1YI2 Q;  5IT9 E;  1MV0 B;  4OGE A;  4FL6 A;  2AZS A;  1YWO A;  1NG2 A;  2KE9 A;  3A8M B;  1KQ1 A;  3CMA Q;  2ROL A;  2OTJ T;  4BB7 A;  4MDW A;  1PRL C;  4J9D A;  4F14 A;  1QVG A;  4FSS A;  1W6X A;  1X6O A;  4TVR A;  3DLL A;  2JT4 A;  5A0D A;  3OSS C;  2AKK A;  2CYZ B;  5I2M A;  3VRZ A;  3GLX A;  3NGP A;  1W2B P;  2QI2 A;  2P0P A;  2XKO C;  2RHZ A;  1G5V A;  4PFP A;  5GAN g;  1KJW A;  1NPR A;  3CEY A;  2E10 A;  1HD3 A;  2X9H A;  1IGQ A;  3JCM c;  3J81 E;  1SSF A;  4Z89 A;  3EFS A;  4F7U E;  2FZC B;  2RJE A;  2FRY A;  2RQU A;  1ZX6 A;  1R0C B;  2EGC A;  3G4S T;  4C5G A;  2VXF A;  3M53 A;  1TXQ A;  1SG5 A;  1UGQ B;  4ZNX A;  2KYB A;  2HQH A;  4J6X A;  4E7S A;  2VWF A;  1WJQ A;  1TWB A;  1G3T A;  3OA6 A;  1VQ7 A;  1SRL A;  3JCM b;  5EC7 A;  4B9W A;  5DY9 A;  1WLP B;  2MCN A;  4M75 D;  2WSE E;  4RTU A;  1ZHI A;  1UE9 A;  2ED1 A;  1EFN A;  1M1K R;  2XHC A;  5GMK h;  3EHQ A;  1O9S A;  1VQP A;  3S6W A;  1K1Z A;  2RF0 A;  1CSK A;  4A4K A;  1D0Y A;  3EHR A;  4C0D C;  1I07 A;  4AFU C;  5LJ5 d;  4LNP A;  3OYK A;  1BB9 A;  3CCE A;  2PUO B;  1WFW A;  1WHG A;  2K79 A;  2D8J A;  2EAY A;  1BIB A;  1PHT A;  2ZPH B;  2D9T A;  1K76 A;  3G4S Q;  3KUF A;  3QDR B;  1G2B A;  4M75 F;  2ECZ A;  4F7U A;  2MIO A;  4E7I A;  1AWW A;  1WHK A;  3C95 A;  4FYY B;  1LPL A;  1BI3 A;  5KYU A;  2L2P A;  3M0R A;  1ZUY A;  1EIF A;  2Y4Y A;  3H0F A;  2X4J A;  3HRS A;  1D0Z A;  2R5A A;  3CCU Q;  4XQ3 A;  2CUD A;  1F1B B;  2HZY A;  3QHS A;  1RLQ C;  2X4X A;  2CT4 A;  2MWO A;  1YJ9 T;  2IPO B;  4JDS A;  4RMO A;  4HA8 A;  3GP8 A;  1MNE A;  4M77 A;  1VQK Q;  3I56 T;  2DTH A;  3BY7 A;  1YIT A;  5GAM e;  4FIB A;  1Q82 U;  1HSQ A;  3QWY A;  3QZ9 B;  4IUT A;  2H8H A;  2ZPI B;  4L6V 5;  1D09 B;  1GL5 A;  1SPK A;  3F70 A;  1VQ8 A;  4RG8 A;  2E3H A;  2BTT A;  2XK0 A;  2DVJ A;  4J7F A;  4B6M A;  1QMC A;  3L2V A;  2MWP A;  1I8F A;  1BKB A;  3MJX A;  3T9N A;  4RTZ A;  4RTX A;  3RUX A;  2AK5 A;  2CUB A;  2ATC B;  4J6Y A;  2KY9 A;  3QXE B;  4KUD K;  5L23 A;  3JCM e;  1YIJ A;  1TG0 A;  3M57 A;  1EX4 A;  2IIM A;  3PTA A;  1AT1 B;  2YLB A;  1SRM A;  1YJ9 Q;  1SHG A;  4KGZ B;  2C0I A;  2ABL A;  4Z8A A;  2DO3 A;  5GAN 8;  1GXI E;  3C4S A;  1UGR B;  4M7A D;  3H0H A;  3UT1 A;  1YJW Q;  2R58 A;  2OTL A;  1VQ6 A;  4ANJ A;  4IKF A;  2GF7 A;  1RLP C;  2LTO A;  2GTJ A;  2DJZ A;  5KYW B;  1XQH A;  2PQW A;  3LW5 E;  1KQS P;  4C92 D;  3VS3 A;  1KK7 A;  3M59 A;  3CCM Q;  5D6Y A;  4M7A C;  1XTD A;  2CP0 A;  4EIK A;  3OY9 A;  3EGD B;  3OW2 A;  1UB4 A;  4A53 A;  3L2Q A;  3QPH A;  3UF4 A;  5KYX A;  3CPW P;  2M51 A;  1WXB A;  4PJJ A;  2QEX T;  4M7A F;  4C92 C;  3EGU A;  2CH4 W;  1Q86 U;  2JTE A;  5GAN d;  5GAM g;  2D6F A;  1WZO A;  3OYD A;  2KRM A;  3V8K A;  2HQE A;  3E1S A;  1JU5 C;  1QVG P;  4CI0 C;  3MEV A;  2KDS A;  1YHQ A;  3CC7 T;  3JB9 D;  4C92 F;  2RQT A;  3CC4 T;  1TUC A;  1RUW A;  2M0O A;  2KBT A;  2YRV A;  1Y7X A;  4N0A C;  4M78 A;  2J6K A;  4PJO E;  2OTJ A;  1ZSZ C;  3M5A A;  3LWI A;  2BE7 D;  2NYS A;  2YUO A;  3FB9 A;  2K9G A;  2BIV A;  2RO0 A;  2DIQ A;  2V8I A;  3KFV A;  4PJL A;  5GAN 6;  4V2S A;  2L0A A;  3GIB A;  4JPB W;  2LRQ A;  1YBY A;  1FYN A;  2EYX A;  3JCM g;  2QDL A;  2QQS A;  2BUD A;  1OOT A;  3VUZ A;  1FX7 A;  2P0Q A;  1T0H A;  4XTW A;  1Y0M A;  3CCR T;  4C5I A;  3JB9 F;  3CQT A;  4HVV A;  4LDV A;  1XJW B;  4DBF A;  2O4X B;  4OP0 A;  1PSF A;  1V1C A;  1K8A C;  1XOV A;  4ELZ C;  2DD4 A;  3HTR A;  2YWW A;  4QQD A;  4LD6 A;  2KAF A;  3HPW A;  1VQO A;  4F7U F;  3VS1 A;  4E7J A;  3SWN A;  3E2U A;  1QVP A;  3HL8 A;  3GNG A;  3CCS T;  1ZA1 B;  2DJQ A;  2CP2 A;  2RHI A;  2LQN A;  1D1B A;  2DTO A;  1BBZ A;  5I21 A;  1M2V A;  2DFU A;  5HKC A;  1AD5 A;  4FYV B;  4ZGD B;  2R57 A;  1WQW A;  3TQ7 P;  5GMK l;  2DL3 A;  3CCR Q;  4DA4 A;  3DB3 A;  1KHC A;  2J06 A;  1Z9Z A;  2M16 A;  5I11 A;  3OS0 A;  4M7D E;  4OB0 B;  1HJD A;  3VS2 A;  3L42 A;  4PFO A;  3DKM A;  1GFC A;  3G7Z A;  4KRT A;  4QVD A;  5LJ5 e;  1D3B A;  1HYO A;  4FCY A;  4EMK C;  2PU9 B;  4PKC C;  5GJW B;  1OZ3 A;  2EIF A;  2CZ0 B;  1IRX A;  4RCB A;  2KQW A;  3CCS Q;  3I55 T;  2F2W A;  2O2O A;  3X25 B; 
#chains in the Genus database with same CATH homology
 2FPE A;  2F2V A;  3PVQ A;  2DL5 A;  1AWO A;  2DBM A;  2L3P A;  2JMC A;  3C0C A;  2L3Q A;  2EGA A;  2FRW A;  3I5R A;  3H41 A;  1B3Q A;  4OMP A;  2O9S A;  1UG1 A;  2DA9 A;  2KXC A;  4LE9 A;  2CH4 A;  3VS4 A;  4F17 A;  1WXT A;  4DEX A;  2PNI A;  2J05 A;  2X3W D;  4CC3 A;  2DYB A;  3QWX X;  2AZV A;  4OMN A;  1KIK A;  2FPD A;  4J9H A;  2RQR A;  4D8D A;  2W0Z A;  4HCK A;  1MV0 B;  2O88 A;  4AG1 C;  2AZS A;  4WCI A;  1YWO A;  1NG2 A;  1U3O A;  2KE9 A;  2LJ0 A;  2ROL A;  1WI7 A;  1MV3 A;  5I22 A;  3NHN A;  2DBK A;  1PRL C;  4J9D A;  2EKH A;  4F14 A;  4ORZ A;  2EGE A;  4IIM A;  3RBB B;  4FSS A;  1W6X A;  4X1V A;  1NLO C;  1VYT A;  2JT4 A;  4J9E A;  2F2X A;  1GFD A;  2KGT A;  4Z88 A;  3M0U A;  2AKK A;  1ZBJ A;  4IIO A;  3VRZ A;  3PE0 A;  5IHK A;  3EG3 A;  1I0C A;  3NGP A;  2GQI A;  3VRY A;  1X43 A;  4R0K A;  1UEC A;  2A37 A;  3UAT A;  4RTW A;  2YUN A;  1KJW A;  1AOJ A;  2DX1 A;  4OMQ A;  1HD3 A;  5FW9 A;  4ESR A;  1GBR A;  2FG0 A;  2FO0 A;  1PKS A;  4Z89 A;  5IH2 A;  2RPN A;  2KRO A;  2VVK A;  2FRY A;  2RQU A;  2RNA A;  1ZX6 A;  4K11 A;  4JZ4 A;  1WXU A;  2EGC A;  2OI3 A;  2YDL A;  4LUE A;  2I0N A;  2KYM A;  4CC4 B;  2G6F X;  1NEG A;  4ZNX A;  2CSQ A;  4OMO A;  2KYB A;  2KT1 A;  2DNU A;  2HEQ A;  2KNB B;  2VWF A;  1QCF A;  2HBW A;  3LH5 A;  3ULR B;  2HCK A;  1SRL A;  2DMO A;  4M4Z A;  5EC7 A;  1WLP B;  3SEM A;  2MCN A;  1VA7 A;  3PVL A;  1UFF A;  4RTU A;  5FWC A;  3O5Z A;  1UE9 A;  2ED1 A;  1WX6 A;  2C0T A;  1EFN A;  2EVR A;  2A08 A;  2K3B A;  3SHW A;  2ESW A;  2K6D A;  3EHQ A;  1K0X A;  1X2K A;  1K1Z A;  1UTI A;  2RF0 A;  1CSK A;  1WIE A;  3REA B;  3ZL7 C;  3EHR A;  1UUE A;  1I07 A;  4AFU C;  1OV3 A;  4LNP A;  1BB9 A;  1WFW A;  1PRM C;  2K79 A;  3M0Q A;  1UJY A;  2D8J A;  4CC2 A;  1BU1 A;  1PHT A;  1ABO A;  2KR3 A;  3EG0 A;  2LMJ A;  1K76 A;  5HCK A;  3EG2 A;  1M27 C;  1ARK A;  1I1J A;  4OMM A;  2YUP A;  1AWX A;  3IQL A;  1G2B A;  1X6G A;  2D0N A;  2K7A A;  4GLM A;  2ECZ A;  2LP5 A;  2MIO A;  2LQW A;  1K9A A;  1AWW A;  1VYU A;  2DM1 A;  1CKA A;  2MOX A;  2L2P A;  3M0R A;  1U06 A;  1X2Q A;  1ZUY A;  3H0F A;  2JM9 A;  2KRN A;  2EQI A;  1SSH A;  2CUD A;  2YT6 A;  1RLQ C;  2CT4 A;  1UJ0 A;  2D1X A;  3U23 A;  1YNZ A;  4E6R A;  2SRC A;  1PKT A;  1YN8 A;  4OML A;  1M3A A;  2O31 A;  3RNJ A;  4RUG A;  2DL7 A;  3I5S A;  2DRK A;  1TUD A;  2CDT A;  2SEM A;  2D8H A;  1HSQ A;  1RI9 A;  1Y57 A;  2DE0 X;  3QWY A;  2LZ6 B;  2H8H A;  1IO6 A;  1GL5 A;  1WYX A;  1K4U S;  4Y92 A;  1SPK A;  1JXM A;  5GJV B;  1QLY A;  2AKL A;  1ZLM A;  4AFS C;  1PWT A;  2EYW A;  2BTT A;  2J6F A;  1NEB A;  2DVJ A;  1H8K A;  1UHF A;  1ZUK A;  2E5K A;  2GTO A;  2OJ2 A;  2LNH B;  2J6O A;  1W1F A;  2ROT A;  1U5S A;  4RTZ A;  2CRE A;  3REB B;  2HSP A;  4RTX A;  2AK5 A;  2CUB A;  2O9V A;  4J9I A;  4J9B A;  5L23 A;  4AG2 C;  1TG0 A;  2BZ8 A;  2JXB A;  2VKN A;  2A36 A;  2IIM A;  2GGR A;  1WDX A;  1SRM A;  2FPF A;  1SHG A;  4J9C A;  4DEY A;  1NM7 A;  2C0I A;  4RTV A;  2ABL A;  2ENM A;  4Z8A A;  1YWP A;  4AFZ C;  2L3S A;  3H0H A;  3NMZ C;  1T3L A;  3M0T A;  1OEB A;  1T0J A;  3A98 A;  1RLP C;  2GTJ A;  1YCS B;  2YSQ A;  1MUZ A;  3THK A;  1UDL A;  3VS3 A;  1YP5 A;  4LN2 A;  2BZY A;  2LJ3 A;  1JQQ A;  4LUD A;  3TSW A;  1S1N A;  4EIK A;  2EW3 A;  4JJB A;  4HVU A;  1H3H A;  3H0I A;  1AZE A;  1QWF A;  2JW4 A;  4RTT A;  1SEM A;  2ED0 A;  3UF4 A;  4JJC A;  2JS0 A;  2M51 A;  1WXB A;  4QT7 A;  1GCP A;  2DIL A;  2XMF A;  3EGU A;  1NLP C;  2CH4 W;  3VS6 A;  3TSZ A;  2JTE A;  2KRS A;  1GRI A;  2CSI A;  2JM8 A;  2K2M A;  1M30 A;  2C0O A;  2KRM A;  2EBP A;  5IHI A;  1UGV A;  2RQV A;  2RN8 A;  1JU5 C;  1T3S A;  1OPL A;  5IXB A;  1N5Z A;  2KT8 A;  2RQT A;  1KFZ A;  1TUC A;  2DLP A;  2V1R A;  1RUW A;  2NUZ A;  2KBT A;  2RQW A;  2RMO A;  1ZUU A;  1OPK A;  1JO8 A;  1K0S A;  1NYF A;  2KEA A;  2J6K A;  1J3T A;  3M0P A;  1JXO A;  3VS7 A;  1QKW A;  2HDA A;  2YUO A;  2K9G A;  4D8K A;  3KFV A;  5IXF A;  2L0A A;  4F16 A;  2P4R A;  1AEY A;  4JPB W;  1A0N B;  1GBQ A;  3EG1 A;  1FYN A;  2CT3 A;  2EYX A;  3VS0 A;  2A28 A;  1AZG B;  2QDL A;  1OOT A;  1QWE A;  2PZ1 A;  2YUQ A;  2GNC A;  1T0H A;  1Y0M A;  1E7O A;  1W70 A;  2M0Y A;  4GBQ A;  4A63 B;  1FMK A;  3CQT A;  2V1Q A;  1BK2 A;  4HVV A;  4CC7 A;  2EPD A;  1SHF A;  4AFQ C;  1G83 A;  1M3C A;  1V1C A;  1H92 A;  1XOV A;  1GCQ A;  1NYG A;  1ABQ A;  2LX7 A;  1CKB A;  4HVW A;  3VS1 A;  4J9F A;  1QKX A;  5IHN A;  1ZSG A;  1VYV A;  2W10 A;  2BZX A;  1X69 A;  1M3B A;  2JS2 A;  2DRM A;  1X6B A;  2DJQ A;  2DF6 A;  1JEG A;  1WA7 A;  2LQN A;  1B07 A;  4JZ3 A;  1M8M A;  1E6H A;  2NWM A;  1BBZ A;  1E6G A;  1AWJ A;  2PTK A;  2GBQ A;  1AD5 A;  3R6N A;  2FEI A;  3FJ5 A;  2EYZ A;  1LCK A;  1GCQ C;  3VS5 A;  1X27 A;  2DL3 A;  4J9G A;  3JV3 A;  2J06 A;  1Z9Z A;  3I9Q A;  3GBQ A;  2LCS A;  5I11 A;  2KXD A;  1HJD A;  3NPF A;  2J7I A;  3VS2 A;  4JJD A;  1KSW A;  1AVZ C;  4RTY A;  1GFC A;  4KRT A;  2B86 A;  1Z9Q A;  3I35 A;  5FWB A;  5ECA A;  3TVT A;  5GJW B;  1PNJ A;  2LJ1 A;  2OAW A;  2DL4 A;  2X3X D;  2EYY A;  4HXJ A;  3M0S A;  3UA7 A;  1UHC A;  3UA6 A;  2JMA A;  2DL8 A;  2F2W A;  2O2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...