1MVEA

Crystal structure of a natural circularly-permutated jellyroll protein: 1,3-1,4-beta-d-glucanase from fibrobacter succinogenes
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
243
structure length
243
Chain Sequence
MVSAKDFSGAELYTLEEVQYGKFEARMKMAAASGTVSSMFLYQNGSEIADGRPWVEVDIEVLGKNPGSFQSNIITGKAGAQKTSEKHHAVSPAADQAFHTYGLEWTPNYVRWTVDGQEVRKTEGGQVSNLTGTQGLRFNLWSSESAAWVGQFDESKLPLFQFINWVKVYKYTPGQGEGGSDFTLDWTDNFDTFDGSRWGKGDWTFDGNRVDLTDKNIYSRDGMLILALTRKGQESFNGQVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Natural Circularly Permuted Jellyroll Protein: 1,3-1,4-beta-D-Glucanase from Fibrobacter succinogenes.
pubmed doi rcsb
source organism Fibrobacter succinogenes
molecule tags Hydrolase
molecule keywords Truncated 1,3-1,4-beta-D-glucanase
total genus 54
structure length 243
sequence length 243
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2002-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1mveA00
1PZ9A 1WLWA 1IKQA 4Y24A 4XJ8A 1AJKA 1FYUA 2W08A 4YZ5A 4FOWA 4XDQA 4ZKTB 3UK9A 1G9CA 2A6VA 1DQ0A 1UMZA 1ULGA 1XQNA 1OFSA 2WT0A 3VKMA 3N7JA 4WVVA 5GALA 3AXDA 3WHUA 2DUPA 2ZAAA 2AGSA 1C1LA 2V73A 1RINA 1A8DA 1AXKA 1D2SA 4DRVA 1FATA 2P2KA 4AYUA 1WBFA 2D44A 1UX6A 3LSEA 2ZHNA 5IK5A 1LOBA 1LU2A 4FPGA 1B09A 1HQLA 1Q8PA 1QU0A 1GKBA 4YW5A 1W6PB 4XHBA 5HCFA 3SNMA 4WV8A 2WSUA 4ZXKA 1IS4A 1KDKA 3D4KA 3OGGA 3PVNA 1J1TA 2D7FA 2GN7A 3ZSLA 4Q27A 4WZFA 3SITA 4YW2A 3W58A 2WLQA 4ISQA 2R16A 3UL2A 5H9PA 2ZHMA 2ES3A 3UJQA 4P14A 2ZZJA 4YM0A 2EIGA 4XILA 4FPLA 5GZCA 1O4ZA 3DUIA 4ISRA 5KXEA 4HL0A 2A6WA 2GMPA 4GWMA 1LTEA 5EWSA 5GZFA 1CR7A 2ZGQA 3AYCA 2W52A 1N1YA 4XTMA 2DU0A 2NZ9A 3IN9A 1H30A 2CL2A 2ZMKA 1SLCA 4YLZA 3QLQA 1V6OA 3FLRA 3NV2A 1IOAA 3WDWA 1DHKB 2GMMA 2ZGMA 4YW3A 1LODA 2GNMA 2UWCA 5T52A 4TYSA 3MW4A 4JC1A 1JYCA 4FOYA 2NMOA 1JYIA 4PCRA 5GLUA 2DURA 3R4SA 1W0PA 3B01A 1LHNA 1UPSA 3V64A 2DWRA 2JJ6A 1V6NA 2SLIA 1Q8QA 1FNYA 1KJRA 3JU9A 4FPCA 4K1ZA 4XJ9A 4YW4A 4Q8KA 3WZ1A 4BLIA 3N35A 4KBBA 1F31A 1WLDA 4YZ4A 4P9WA 4FP3A 3T1MA 4BLJA 1W6QB 2ZGTA 3NWKA 1GNHA 4YG0A 2DV9A 3AP7A 4XE9A 5GLZA 1C4RA 3ILNA 2DVFA 4Y1ZA 2PHWA 1LHUA 2GNBA 3V0AA 2D3PA 3R05A 2OVUA 1MZ5A 2ZGNA 2PHRA 2ZGUA 4UW3A 3Q9OA 3VKLA 2ARXA 3CNAA 5SV8A 1H9PA 1BQPA 3OBTA 2AREA 4FPFA 4FPJA 2DVDA 4ITCA 3VUOA 2EXKA 2DYCA 1KJLA 3RRDA 1AXYA 1S0IA 3PJQA 1SBDA 4YM1A 1N1SA 4FPEA 1CJPA 1DLLA 2ERFA 4FPKA 5JMCA 4DRRA 3FFZA 5JVVA 1LEDA 4GKYA 1G9DA 3AK0A 3ZPYA 5JLVA 4BMBA 1UN1A 5T5LA 3WUCA 2WQZC 3WG1A 4CZSA 4C1XA 1X50A 1A3KA 1DQ2A 5F9TA 2EXJA 4OZXA 4UW6A 2YV8A 4PF5A 3LCPA 5DG2A 3JUUA 4BQ1A 3V0BA 2WKKA 1HQWA 5EYXA 4IQPA 1YO8A 2VW1A 1CQ9A 2A6YA 1Y7BA 3U4XA 4YFZA 4Q1RA 4CTEA 1JHNA 2CNAA 1LHOA 1GZWA 1LOEA 1SCRA 3D6EA 4UW5A 4Y1UA 3N7LA 1D0HA 2PHXA 5JOYA 4LBLA 1UZZA 4XYXA 3WLUA 2D3RA 3ZVXA 2ZHLA 1HKDA 3B69A 2D6LX 3O0XA 4XIOA 3WG4A 4XJUA 4YM3A 4LBNA 1AZDA 2JKBA 3M1HA 2WJSA 3H0OA 1BZWA 1MVEA 2DU1A 2A3WA 2CY6A 2YROA 1MS5A 2R0HA 1JW6A 2PHFA 4MYEA 3M3OA 1LCLA 5DZEA 3RMYA 3WCSA 4AGRA 2D6PA 1MS1A 1N3PA 4H55A 3IKWA 1WCSA 1Q8SA 1GZCA 4K20A 4Y20B 3ZSMA 2JE9A 4PQ9A 1LHWA 2H0BA 1QOSA 4TZDA 1SFYA 1ONAA 5H9RA 1QMJA 1QNWA 2WSVA 2LTNA 2ZA9A 2ZGSA 3V65A 2ZGRA 4FVVA 4FQ4A 4LBOA 2VW0A 3IPVB 3UJOA 3WOGA 1SBEA 1YIFA 1IS3A 2DUQA 1DIWA 4PBOA 4XBQA 4C1WA 3OY8B 4F83A 2E7TA 1F9KA 3WDXA 2JE7A 5DUVA 2AH2A 4Y22A 2E6VA 4K1YA 3B3QE 4FPOB 5GM0A 1LULA 3OBRA 3I8TA 3RMXA 5CAZA 4Q1PA 3WDVA 2A7AA 2NM1A 4AVSA 1AX2A 1QF3A 1CIWA 2D6MA 3M3QA 3ZXFA 4L8QA 1W6NB 1F5FA 3ENRA 1S1AA 4NOTA 3B9CA 2E51A 1MACA 2ZGLA 2AENA 3O0VA 1W6OB 3A0NA 1V6JA 3O5SA 3SH4A 1O4YA 2A3YA 1LOFC 5GLWA 1GNZA 1QGLA 1W6MB 1GSLA 2NYYA 2W39A 4HANA 3B00A 1ULFA 3AYEA 4YW1A 5GJ6A 4FQZA 1G9FA 4AWDA 3M3EA 2FHRA 1LENA 3MW2A 1N1VA 4Y22B 4Y1XA 3FBYA 1SLIA 1YYNA 2A6XA 2V5YA 2EALA 2VUAA 5DUXA 4XZPA 1V6MA 2ZGKA 4XTPA 5GLTA 1MS8A 1SLTA 1U0AA 1CESA 2AYHA 2E53A 2YY1A 3GALA 3NV3A 4AGGA 5T50A 3AXEA 3ZXEA 2P3JA 5T54A 1MS4A 3WDYA 3AZZA 4RL7A 1BKZA 4DPNA 2ZKNA 5IT6A 4LBQB 2W68A 1S0DA 3I4IA 2AR6A 4YGDA 3HN1A 4W65A 1G86A 4XOGA 1YRZA 1JOJA 2EAKA 2Q5TA 4JCKA 1AVBA 2YZ4A 3WG2A 5CB7A 2A75A 3WDTA 1CONA 3RG0A 4XMIA 1CPNA 1C57A 3KQRA 2WT1A 4P9XA 2VXRA 1VAVA 1W6QA 1ZM1A 3ILRA 4LBJA 3PVEA 4Z8BA 5L73A 4LBMA 3VKNA 2VU9A 5IUQA 2WNEA 1V6IA 3V0AB 1RITA 3ZXLA 2ZBJA 3WHTA 2OW4A 5KXCA 1KQRA 1VAMA 4WVWA 1KRIA 5FREA 5HCBA 4R9AA 3MEPA 2I2SA 5IK4A 5E88A 1BJQA 1A78A 2D43A 3AZYA 1DQ4A 3M2MA 3ZXKA 1WUVA 1YI7A 1PZ7A 4M3CF 5JOZA 2DTWA 4GKXA 3BOPA 3AJYA 1N1TA 3AZWA 5GZEA 1LGBA 2JDZA 3DGTA 3O12A 3AZXA 5FRAA 1Q56A 3FLPA 2ZGOA 3HR9A 1WW6A 1G9AA 1WD4A 1S0EA 4YGBA 3VV1A 4BM8A 2XG3A 2CYFA 2R1DA 4DS0A 5LK5A 1W0OA 2R0FA 2NN8A 3WUDA 2UU8A 4P9YA 5IK7A 4NO4A 4Q8LA 1H9WA 1G7YA 4XXAA 5DXDA 3AX4A 3N36A 2YMZA 2A70A 2Z42A 1LJ7A 3AFKA 2RHPA 1ULDA 3MW3A 3WDUA 5KXBA 1NLSA 3AP5A 3USUA 2D6KA 4AVVA 1IKPA 5EYYA 1LESA 4I30A 1S0GA 5T5PA 1W6MA 2C5DA 1DGLA 1ENQA 2A71A 3O0WA 1LU1A 1CVNA 4ATFA 1I3HA 3BIWE 2P37A 1QNYA 4YGCA 2A5ZA 2UWAA 5EXOA 2VW2A 4YGEA 5DZFA 4Y20A 4FOQA 3ZYPA 2DTYA 2SBAA 3IM0A 3SLIA 5T5JA 1R1ZA 2C9AA 1GZ9A 1CN1A 3RS6A 2E7QA 3USUB 1IS6A 4FPYA 1MR5A 1S0CA 1SBFA 3OYWA 2GMEA 4U36A 4AGVA 1MVQA 1FX5A 2EXHA 1LEMA 1BYHA 2XB6C 4JRAA 4BPZA 2GALA 4GXLA 2FMDA 4LBKA 2ZHKA 5DZGA 4D69A 4UW4A 5CBLA 4M3CA 3NV1A 4PBPA 1LOCA 3OPZA 1HDKA 2P3KA 4ATEA 2B7YA 2GN3A 4Y1YA 4XHXA 1GLHA 4RA0A 4YG6A 1OKQA 5H9QA 5CA6A 4R9DA 3POYA 3QCWA 4XBLA 1JBCA 2NP0A 4K21A 3WV6A 1ENRA 3INAA 3ZSJA 1UKGA 1VALA 4FPHA 1LECA 1QOOA 2JECA 3OYWB 1AX0A 1EPWA 3AP9A 1OQ1A 3BTAA 1WW7A 2VY0A 4DQAA 1VLNA 2PHUA 2ENRA 5GZGA 1WD3A 3PVOA 4M00A 3WG3A 1ENSA 2LALA 3RSJA 2ZABA 2D6NA 2D3SA 3V0BB 4Y1VA 1ZA4A 3TAYA 1JXNA 3AJZA 4GA9A 1SLBA 1LGNA 4YZ1A 2D6OX 2DVBA 5DG1A 5DUUA 3AZVA 1UL9A 1AF9A 1WLCA 2GDFA 1N47A 1C1FA 3HMYA 3AYDA 4M3CE 1S0JA 5AVAA 1DZQA 1SACA 1QOTA 4YM2A 2HYKA 3A4UA 1N3OA 1G8WA 1S0BA 1MS3A 2DUOA 4LBQA 1GICA 2EXIA 4Q2FA 1WBLA 1ULCA 2OUHA 2P34A 3LSDA 3M3CA 4Y26A 5GZDA 1KITA 5T55A 5T5OA 3W59A 3FLTA 3ZXJA 1V6LA 4YZ2A 1LGCA 3N3HA 1PZ8A 1W6PA 2JD4A 1IS5A 1FNZA 5E89A 3RQ0A 4XJWA 3TB0A 3ILFA 3SH5A 5KXDA 1JN2P 1DQ5A 1NXD1 2ZMNA 3IMNA 1Q8OA 4XJAA 3T1LA 4BMEA 1N3QA 2AUYA 3N7KA 3VKOA 4XBNA 1UZYA 1MZ6A 1MS9A 5F5QA 2DVGA 4YZ3A 1LOAA 1SLAA 1RIRA 2A6ZA 1QDOA 2WT2A 1Z78A 4R9CA 2OUJA 2PELA 3POWA 2EF6A 4ASMB 3C2UA 2P3IA 1AXZA 3PMEA 3VKFC 1YXWA 4CRQA 1DFQA 5JOXA 1FV3A 1Z0HA 2ARBA 4R9BA 1BXHA 1GANA 1W6NA 1UAIA 2NMNA 3APBA 1AJOA 4LBQD 1TEIA 1HLCA 2UWBA 3ZYRA 2ZACA 5HCAA 1FAYA 2TEPA 2KM2A 1KDMA 4M01A 2R49A 4XMAA 2PHTA 3BODA 1WW4A 1DQ6A 2CWMA 2ZGPA 1SCSA 1SLLA 3FUQA 1FV2A 4FOVA 3WNXA 5CNAA 4XIKA 3A0KA 5DUWA 1GV9A 4XJZA 4GWNA 3ASIA 1QKQA 3ATGA 1I1EA 3SH3A 3MPPG 2R1BA 3IPVA 4YFWA 1Q8VA 1CPMA 1GBGA 5BYNA 3T2TA 3OY8A 1DBNA 1GYKA 3KM5A 2GNTA 3FUOA 1WW5A 4BOWA 4AVTA 1S0FA 3AP6A 1V6KA 3N7MA 3GNEA 1APNA 3AP4A 5E8AA 3WCRA 1DYPA 1DQ1A 2ZMLA 2UURA 5JOWA 5IK8A 1AX1A 1ULEA 1W6OA 4U2AA 3OJBA 1VIWB 2DVAA 4FP2A 2GNDA 3R4UA 4XXPA 2G4IA 3POSA 1URXA 4M3CB 4YG3A 1JUIA 1MS0A 1DYKA 3WVJA 1LOGA 3D5OA 1G9BA 5JDBA 2CWSA 2A3XA 1LHVA 1V00A 2YXSA 3NV4A 1GZWB 4Q26A 4SLIA 5H9SA 2VH9A 2CTVA 1LOFA 2BQPA 3SISA 3AYAA 1QDCA 4GALA 4DFSA 3L2YA 3ZSKA 5GLVA
chains in the Genus database with same CATH superfamily
5BUVA 2R071 1O3TA 4MLOA 4O9GA 5KC5A 1HN1A 5LRRA 1IKQA 4QPGC 4AVAA 5EIYB 1XNDA 1FYUA 1XU1A 4ONUA 1VBD1 4FOWA 3ZFGB 2PA7A 4XDQA 1Y9GA 3UGHA 4ARYA 2VNRA 4IERA 5A6YA 1CWPA 1F15A 5LBFA 5BNNA 3CMGA 1RJ8A 2JEMA 4IEUA 1UIJA 2G9GA 2PYTA 3AXDA 3IDBB 2AGSA 2JDUA 4XUPA 2V73A 3MIEA 1OFNA 1RINA 2O1QA 4O61A 5C8CB 5FDBA 1RUNA 4AYUA 1IG3A 2D44A 4Q4W2 4XF1A 2CAUA 3I3EA 5LA0A 5C7GA 1GKBA 5FKCA 5IW0A 1W6PB 4XHBA 5A33A 3U75A 3J4UH 1LKNA 1NKGA 4NHXA 5CKQA 2JDYA 4META 3PVNA 4DZGA 1OF3A 3I49A 3ZSLA 2GN7A 5F3GA 1AYN3 4PI2A 2XLFA 1C5IA 1V70A 3WF2A 3PJYA 1RMU1 1KD7A 4ISQA 1POV1 3UL2A 4Y33A 5H9PA 3VDDC 4AXOA 3A21A 4CDQC 3UKNA 3UJQA 4OQ9A 4P14A 1OHFA 4JTNA 1O4ZA 1H4HA 1ALYA 1ND3B 4HMZA 3CJIA 3X29B 2EVXA 5GZFA 4OUEA 2QTWB 1CR7A 2WZR2 2W52A 2DU0A 5FPXA 4JDMA 1VBE2 2ILMA 2ZMKA 1RJ7A 1SLCA 3OCPA 2RDSA 4YLZA 1ND2A 1GP5A 3GBFA 1V6OA 4AFDA 2RJ2A 3NV2A 2XLAA 2RS51 2XXZA 3MHZA 3WDWA 4E4DX 1LR5A 4W50A 2E31A 2WFPA 4YW3A 2ZX1A 3UESA 3T2QA 2GNMA 2UWCA 3AKTA 1H8TB 1EAH2 4TYSA 5T52A 1ZA7A 3T0DA 1XNTA 5DAPA 4Z07A 2WC2A 3K3NA 4PCRA 1ZZ6A 3KSCA 2GC0A 4HG6B 2RS53 2VMCA 2YC0A 5HI0A 4LE4A 5FY1A 4YW6A 5FZMA 3B01A 2PHLA 4QX2A 2VBPA 5FZCA 1XYOA 4C0BA 1WGPA 1UZVA 5FLIA 4Q8KA 3KGLA 3S7EA 2FD8A 3NRUA 4R4XA 5CADA 1W9TA 4NIHA 1PGW2 2BP6A 3BOWA 4YZ4A 4FP3A 3T1MA 5FLHA 4WVMA 5FPUA 4CDUB 1WMDA 2JDNA 2PHWA 1COV2 4Y1ZA 2VO5A 4NAMA 1PVC2 3R05A 1VR3A 3OGRA 2OVUA 5FLJA 1NAEA 1PNGA 2WFF3 3Q9OA 1MEC2 1O5UA 3RJRA 3CNAA 4QM9A 3OBTA 1BQPA 4FPFA 3N9QA 3E5XA 4ZPIA 1X36A 2BGPA 3KD4A 3RRDA 1AXYA 1QJX1 1MZFA 4CU6A 1N1SA 1U5IA 1ASJ2 2QBXA 4NPMA 5JVVA 1H8VA 4GKYA 3MLKA 5I0UA 1GFF2 3H42B 5I0TA 1UN1A 3JD71 4CZSA 1NYWA 1X50A 1A3KA 1TMF1 5DAQA 5F9TA 1ZRCA 4AEDB 4PF5A 2Q0AA 2QQOA 3JUUA 2XWJB 3CLPA 4CCLA 3W5NA 5EYXA 2ZPXA 1OH4A 2BFUS 3E97A 4Q1RA 5LA1A 2CNAA 3D6EA 4QXBA 5FZ3A 5A6ZA 1D0HA 3MF6A 4Z2WA 1RUF1 1F8VA 4Y4RA 4CE8A 4LBLA 5HXVA 5IVYA 4LO7A 4D94A 1CAXB 5FPVA 3S5AA 3I59B 5FK7A 5FMCA 4XIOA 2B8MA 3VD3A 4LBNA 3I2FA 2D40A 2WJSA 2YROA 5C3QA 2A3WA 5FZHA 4EWDA 4MYEA 4AGRA 4NN0A 2QQUA 1MS1A 3OEBA 2O8QA 4W6XA 4I3PA 3RVHA 2UY8A 3ZSMA 3ZSEA 1LHWA 4GULA 4IE0A 5A32A 2XJVA 1QMJA 1YIPA 4QQ2A 2XL9A 2ZGSA 3BN6A 5K9YA 2WZR1 3WOGA 2VW0A 2BERA 2K0GA 2W9XA 4N43C 3PIGA 3BB6A 4F83A 5FQ0B 1F9KA 4RR3C 4DOUA 5ABJA 1UOGA 2ET7A 3PUQA 2AH2A 4K8FA 4Y22A 5A3UA 1VMJA 2E6VA 3O14A 4JKLA 4BXFA 3ZYHA 5GM0A 1AYM3 2DFCA 1XE7A 3I8TA 1UY1A 1RUG1 3DYOA 1UZWA 4Q1PA 2NM1A 2P3YA 3ZFFA 1EAH1 4AVSA 4R4ZA 4IV3C 5CG9A 4GB33 1W6NB 2WWJA 2JXAA 1PO23 2XR4A 4NHLA 5FZOB 1CX1A 4I0WB 2AENA 1W0NA 3ETPA 1RYYA 1AL0G 2RR13 5GLWA 3VHPA 1GZTA 4CCJA 2UYAA 4HANA 1ZNPA 1RUI1 2OIIA 4YW1A 4QX7A 4AWDA 2FHRA 3VLBB 1PGW1 2RS13 4XQWA 2BGCA 1ACCA 4RGGA 5LB6A 2V5YA 4BE3A 2Q8CA 2BBVA 3IB3A 4XETA 1PX3A 3ES1A 2YB7A 4FTBA 1J3PA 1X9TA 1MS8A 1QJU2 2W92A 1W2UA 2YY1A 3N9LA 4HBNA 4A7KA 5KHJA 4H14A 5JUVA 1FOD3 3AXEA 5CU1A 4CEWB 3D0SA 5T54A 5I8TA 3K51A 2JENA 3WDYA 4DPNA 3E5UA 3FX3A 4H2AA 2IWGB 2ZKNA 1UD1A 2HEVF 5IT6A 2ZX0A 1V9U1 3I4IA 1S0DA 4LBQB 4QX0A 4SBVA 4CUCA 3VL8A 3RI8A 5DAWA 4HN0A 1AVBA 4URTA 5CB7A 5JZGC 2P6CA 2XHNA 3MO4A 3DN7A 5LWBA 4BQ5A 3RG0A 2PAKA 1WA4A 1AL21 4BU2A 4YARA 1TQ5A 1PIV3 4AG4A 2MHFA 3DPRA 5FP8A 4N7IA 2Q4SA 3ILRA 1TMF2 5K7PA 3DPRC 5L73A 2VD7A 4GWJA 4CU7A 4QX1A 5IUQA 1EUUA 3V0AB 3AB0A 3ZXLA 4NE9A 3U11A 4DXTA 5KXCA 4DEVA 2VMIA 2C4XA 4EZHA 1M4WA 4MGIE 4CDXB 5JI9A 5IK4A 2J1SA 1UOFA 3ACGA 5C4WC 3AZYA 1NCRB 1AR71 1WUVA 3KWVA 1ZRRA 4XAEA 1DZTA 4QPYA 4XFHA 3AZWA 4AZZA 5GZEA 1NCQB 2JDZA 4NAOA 3AZXA 3KZ4C 2WR9A 3K46A 5FRAA 1Q56A 5ACA2 1VRH2 3FLPA 4XUQA 3HR9A 4QPWA 1PNFA 1WW6A 1K5MA 5C3SA 5F3EA 1ASJ3 2X10A 1O4TA 3EQEA 3ZFGC 5FYMA 4RHV3 4DIQA 2FDKA 3GBWA 4AEJA 1DG6A 2CYFA 1W9WA 5KHHA 2YDEA 3E5QA 3DCQA 5FXVA 5HPOA 2D93A 3TN93 1XB9A 5CIRA 1EPZA 4XXAA 3SXWA 3IDEA 4HKWA 1YFXA 3VN4A 2CDOA 5C8CC 1PIV1 2Z42A 1LJ7A 3AFKA 2RHPA 3V56A 5FZOA 1S2BA 1UF2C 5FK8A 2D6KA 1TME3 2ZEZA 5EPAA 3E1F1 5FYCA 4P9GA 1W8NA 3OB8A 4XZUG 5LA2A 5AC93 1V9U3 1DGLA 4GQ7A 2VMHA 1RUG2 5CEHA 4HETA 4QDQA 2RM21 5C5TA 1IQAA 3TRSB 5JR2A 3MGUA 3BKZA 2JB8A 5DZFA 4D7TA 2RMU3 2HKXA 2PFWA 3IM0A 5BNNC 1FPN2 1OPMA 1DGRN 5FCCA 3I3MA 5FMOL 5DAVA 2C9AA 2WO7A 2XJUA 3WF4A 4FXKB 1RUI2 2GAUA 2WABA 3FZ3A 5FPBA 5A7WA 5LZ6A 3D3AA 1FX5A 2XB6C 2G9FA 1ND3A 3IIAA 2WN3A 4BPZA 3B5LB 1JYTA 3GZAA 3I2HA 1KFXL 5DZGA 2RR11 5CBLA 2WZEA 4M3CA 5FMBA 1S2EA 3OPZA 2BNMA 1UY3A 5JMOA 1QJY1 5C3RA 3DL3A 2R043 2OQ7A 4YG6A 5H9QA 4CP2A 4R9DA 3POYA 4HK9A 4OHXA 3S57A 2NP0A 4JHTA 4GWIA 4K21A 1V9U2 1ENRA 3ZFEB 3INAA 2E7AA 2Y6FA 4A45A 1LECA 2JECA 2B46X 1QOOA 1AR92 3OYWB 2W0XA 3AP9A 2QZ3A 3BTAA 1XU2A 4UFHA 3FN9A 3P6BA 3O1OA 1L7LA 3SEPA 2EIDA 3UETA 5FY4A 4IGPA 5JCTA 1GOGA 3Q8BA 3WG3A 5ISLA 4BQ4A 1ENSA 1RUE2 3OOXA 2FDFA 2B9UA 2W46A 2D6NA 3OPWA 5BNOA 2QZ2A 4XFAA 3TAYA 3AJZA 4GA9A 1NCRA 2D6OX 2FQPA 2HYXA 2VTXA 2HWD3 2Y34A 4LJHA 1RHI1 5DG1A 3H3ZA 5FY8A 4I01A 4DXSA 1SPPA 3AMNA 3SCHA 3H7JA 4J1XA 4H3WA 3KV9A 2VR4A 2YUEA 1N47A 4CCOA 3SKVA 4JGYA 1CAVA 1NZCA 4PLOA 3WNLA 2H0VA 1N3OA 4OVEA 4CDWA 1O6UA 4Q2FA 1QIQA 2EXIA 4Y26A 3LWCA 4P9LA 2P34A 5T55A 4D7YA 1F2NA 1BMV2 1KITA 1EP0A 1HRV2 3ZXJA 4QGNA 1LGCA 3T3YA 1VP6A 2WUHA 2FCVA 3N3HA 3BGAA 2JD4A 2OPWA 4LQRA 3WF0A 1US3A 2IUWA 4XF4A 4EN6B 4JHZA 4IEPA 2P6HA 1DQ5A 4UFMA 4YYOA 4E9KA 3SCFA 2AUYA 3VKOA 1HXS2 4AEDC 2DVGA 2RDRA 1NT0A 2F17A 5IVCA 1LOAA 2JG9A 3MIGA 2QJVA 1R081 3J8F3 3AM2A 2WT2A 4IEXA 5F5AA 1XSQA 1TMF3 4IE4A 3IAPA 2Y6JA 3KHCA 2W5FA 1XOYA 3OG2A 1PMIA 2WS92 4AFCA 3PMEA 4LHLA 4WBBA 2VC9A 4CRQA 1NXMA 3DYPA 2ARBA 4R9BA 4MV2A 3ST7A 1GUIA 1VBC3 1IG0A 2R041 2VOTA 2J22A 3NNJA 1VBA3 3B9IA 3QOPA 2HH9A 2RM22 1HLCA 1KS4A 2WFF1 1OH3A 1OUSA 1F5JA 1FAYA 1OD5A 2TEPA 4OI4A 5C33A 2PHTA 1WW4A 4GMP1 1DQ6A 2VNOA 3QH6A 4J25A 5LCWL 1SCSA 1SLLA 5F32A 4AE2A 5ACA3 3NJZA 4QAWA 4V2WA 4N7UA 1YFYA 4COUA 5J3UA 4IEYA 5J98B 2WWSA 2XKPA 1TME2 4XJZA 3JB8A 4PQQA 3MPPG 4D6RA 1Q8VA 3AKSA 4CP9A 4RR3B 1GQPA 1OT5A 3MYXA 4QDRA 1GYKA 3ME2A 4QQOA 3MIBA 2WL1A 4DMIA 5ABJB 1HB4A 3VZOA 4AQTA 4UF0B 3FUOA 3KCXA 1WW5A 1GWMA 4IV3B 4R8HA 4RFT0 3WP4A 3RZKA 3ZFFB 2IXLA 2JDAA 3NKGA 3N7MA 4OHWA 4E8DA 1E5IA 1K12A 2J1AA 2Y26A 1APNA 5FYSA 4ARXA 5E8AA 3WCRA 5FZFA 2W2IA 3GBGA 4NIDA 4NWVA 2E9QA 2HJIA 1AX1A 3ZYBA 1GQGA 4JGYC 5I0DA 5CISA 1PK6C 1US2A 1OURA 1VB4A 3R4UA 4GJYA 1OA3A 2OZ6A 4IW3A 5IJRA 2V5DA 1URXA 1CAUB 4YG3A 1JUIA 1MS0A 3RZLA 4ZS2A 1PHMA 5A3TA 3ZFGA 3AC0A 4O65A 3HT2A 1D4M2 1POV3 3KVAA 1REEA 1JYNA 4IL7A 2A3XA 3OF1A 1LHVA 1C3HA 1ZRFA 4EYUA 1DGWX 4CEWC 3RYPA 4QDSA 4LO5B 1HJGA 2XUEA 5CKMA 5H9SA 3KT4A 5K4LA 4B1MA 4F8AA 5LY1A 3AYAA 2WWUA 2XUMA 4GIQA 4UXAA 3JCIA 4E4HA 3HAGA 1BHGA 4PDWB 3T2PA 1X82A 4IESA 5FY0A 3ZIXA 4CEYA 1WLWA 5F2SA 1W90A 4QD2A 4XJ8A 1ODNA 3HQRA 4LHNA 1HW5A 1G9CA 1AR61 3POFA 4R52A 1QQP3 1ULGA 4JZRA 2FCTA 3NAPC 1XQNA 3POEA 4O7XA 3DPRB 4L11A 5GALA 3WHUA 2DUPA 2ZAAA 5LATA 1A8DA 2VE1A 1VBD3 1OUXA 4DRVA 1FATA 2P2KA 4MG2A 4BK4A 3HQXA 4J1WA 4CDXC 2FZ1A 2N7GA 1PX4A 1LOBA 1U12A 2CAVA 5C4WB 1Q8PA 1NCRC 3WD5A 4YW5A 4H7MA 2QVSB 2WSUA 1IS4A 1W28A 3O1PA 1FOD1 2QQJA 1ND2C 5A7PA 2QDNA 4KGGA 4LKEA 3OTFA 1HV0A 4LMFA 4Q27A 4WZFA 1H1MA 1SMVA 1XPWA 4D0QA 4G4FA 1PO22 2ZZJA 1W03A 1K5MB 4IDZA 4XILA 3NKTA 4FPLA 1H1AA 4OZOA 5ERLA 4P02B 4AR2A 3BALA 3GHNA 5CZKA 3C7OA 2GMPA 3VZJA 5EWSA 4NVPA 4NHKA 3ZDVA 5FBJA 5CKNA 2ZGQA 4ASKA 4N9HA 4CSWA 4QB1A 2ARAA 2NZ9A 4QKNA 1H30A 2CL2A 4CYDA 5FAXA 1YC61 1R64A 3EHKA 2VNVA 5BNOC 4XUNA 3FLRA 3T09A 3KF5A 4QX8A 2GMMA 1RXFA 1Y3TA 3CEWA 4A7ZA 2RJKA 1TG7A 3HPNA 3OBZA 1RGSA 1LODA 5AVPA 4K9SA 3MW4A 5FUNA 5FZIA 4LUMA 1JYIA 5GLUA 2VG9A 2VMDA 1PK6A 2PAMA 1YEWA 5A3NA 1UPSA 1YFWA 2Z2SB 4AHWA 4E8CA 1BBT2 2JJ6A 1V6NA 2RG4A 1UOBA 1FNYA 2Z79A 3JU9A 4XJ9A 3WF1A 3GZTB 3HOBA 2XGXA 1F31A 1WLDA 2GP5A 2VMFA 4P9WA 1AHSA 3SCGA 5KHGA 1I6XA 2VZQA 3NWKA 4LUKA 4MO3M 2MNGA 4YG0A 2WRAA 3JQXA 3AL5A 3AP7A 4XE9A 1C4RA 2XVKA 1QJFA 2DVFA 2PMWB 4XF3A 4ZHNA 2GNBA 2V4AA 4A42A 4NR1A 4BISA 4AAPA 2VUDA 2JG9C 4Y3OA 2AREA 4IXLA 4NRQA 1WMEA 2EA7A 2EXKA 2QKDA 3POJA 4LNVA 3AFGA 3VL9A 1SBDA 5FZ1A 3R4DB 3H8OA 4FPEA 1CJPA 2BOJA 3MIFA 1BCXA 1GP4A 2RMU2 3H50A 2GU9A 4QGLA 3WEZA 2BNOA 3VDDB 3ZPYA 5JLVA 1W8UA 2XBO2 3IDCB 4BMBA 2JIJA 2W1SA 3I2JA 3VGIA 4AI2A 2Y6LA 1QY4A 4BQ2A 2EXJA 2VZSA 5A1LA 5C70A 2YBSA 2YV8A 1JU3A 1AR63 1L3JA 2WKKA 4IE5A 1UYZA 1ZZBA 4IQPA 1YO8A 2A6YA 3IZOA 3U4XA 1NE4A 1AUYA 1X7NA 4CTEA 4RHV1 1SCRA 1GZWA 3EJKA 4Y1UA 1COV3 5LASA 3VBRC 1VBD2 1STMA 2PHXA 3W9AA 3ZVXA 1VBA2 1HKDA 5FPLA 3O0XA 4CDWC 3CDZB 4JGZC 2Z5WA 4YM3A 3H7YA 4ES8A 2H6BA 2WBKA 4FFHA 2DU1A 2D5HA 2VBBA 2CY6A 4A7YA 4LA2A 1EY2A 1X8MA 3BPSA 3WCSA 4AI9A 3M3OA 5DZEA 5B4XA 2IXJA 1HN0A 1N3PA 4M4RA 1ZZ7A 4IEZA 1GZCA 2RS32 4AFBA 4Y20B 4KNCA 2KA3A 3ACHA 3BVCA 1ST8A 4PQ9A 1QOSA 4TZDA 5EV7A 5LW9A 4IEWA 2HWE3 1R1A3 2I74A 3R0RA 2BPA2 1UQXA 5I0RA 2ZZQA 4A6OA 4I2OA 4LBOA 3IPVB 3VDAA 1IS3A 4IETA 5HCHA 2DCTA 2IFRA 2XDVA 3H1MA 2VOVA 4S2HA 1AL23 3I7DA 5IAXA 1W8TA 2JE7A 4RQPB 2BFUL 5K8SA 3ON7A 4B7KA 2XKOA 4COZA 1LULA 3T2OA 3WDVA 4RFRB 4K3UA 4AW7A 2D6MA 1CIWA 3VHOA 1F5FA 2YGMA 4RS5C 2E51A 4XFIA 4CEWA 4BJ0A 4XACA 5FY9A 1D2QA 1V6JA 4B1LA 1O4YA 4FFFA 5EQUA 1HV1A 1QGLA 5F7UA 1GSLA 4OMDA 1PM7A 3N4MA 4DXRA 3LKJA 3MLJA 3I2GA 3M3EA 1LENA 1N1VA 3NO8A 4XW3A 1SLIA 1YYNA 2RS11 3ZYGA 2Q1MA 4CEYC 3ZXDA 5JSPA 2EALA 4PJYA 3JQWA 4XZPA 4MVTA 2LS6A 2ZGKA 2XJTA 5LK5A 2B9VA 1NLRA 1PGSA 2E53A 5LA9A 4AGGA 5A6XA 1W2OA 2C1FA 5SV5A 2VZRA 4IUGA 1AR72 3AZZA 3U07A 5JSOA 4GB31 4BIFA 5EJ3A 3VD4A 1MZEA 3HN1A 1RUG3 3DYMA 4XOGA 4EJRA 2JICA 3O1VA 3MI8A 2XQRA 4C91A 1PVC1 4OLLA 1CONA 1B35B 3TEXA 2HEWF 2TBVA 2WA3A 1HX6A 4OUMA 3KV6A 2VMGA 2YGLA 3D82A 1W6QA 1ZM1A 4ET7A 4HPKB 2QDRA 4BYYA 2ZKLA 2X09A 5J7MA 2HBTA 1WMXA 5FXWA 2WNEA 4GH4A 4QPIA 3U14A 1PIV2 5FIXA 5A80A 2FBEA 4D6SA 2WIIB 4NRMA 4JVAA 5FREA 5HCBA 1W9SA 3CF6E 4CPBA 4R9AA 1ZRDA 2YPDA 2L9LA 1O7FA 2I2SA 5E88A 1BJQA 2JDHA 3OSDA 3ZXKA 1DQ4A 2HWC2 1PZ7A 2ZTNA 2Y60A 4WM7B 1MEC3 4GKXA 3E6BA 2BW8A 4MUVA 3IIIA 3ZR5A 1CZVA 4PDWC 5L19A 4NHMA 4AI0A 4AI3A 4JAAA 3RPQA 3T4VA 2ZGOA 4HSLA 4LO8A 1FPN1 1NOVA 3USSA 5FYTA 2BDRA 2P17A 1S0EA 2XVLA 5GKAC 3ITQA 1YUDA 5DN2A 2QQVA 4RQPA 4AK3A 1BEV2 2HWB2 3WUDA 2VTXJ 3ZYIB 4CA9A 3NAPA 4NO4A 2HWE2 4JDOA 3M3IA 4Q8LA 3TEZA 3H8XA 2DBNA 4HVRA 2A70A 3IDAA 2MPFA 3MW3A 2ZCWA 2LRPA 4P5HA 2DFBA 3B93A 3WDUA 5DDJ3 4NRPA 1NLSA 5L9VA 2Y6HA 4LA3A 1XNCA 2PQQA 1NUKA 3OGSA 5EYYA 3WT3A 1YI9A 2ZAHA 4IEVA 4TXWA 5T5PA 2A71A 1QJX3 1UU4A 2BEOA 2BVVA 4UBHA 3CJXA 2YPJA 4ATFA 4ZZ5A 2P37A 1QNYA 4UT5A 5EXOA 3OUHA 4FT8A 4YGEA 2VCMA 4TN7A 3M7AA 3ZYPA 2DTYA 5FR3A 3LPGA 3S30A 3L2HA 2WN2A 4Q4W1 4XABA 2VQTA 1GZ9A 1FI2A 1K5MC 2Y38A 3VD9A 5TSWA 1EV11 4ZONA 1IS6A 1D7PM 3USUB 1MR5A 1S0CA 2R32A 1CZTA 3OYWA 4IE6A 4QXHA 4AGVA 1BYHA 2RS12 3O1MA 4O9EA 5FBZA 1JZ7A 1A8MA 5M0TA 4LBKA 2ZHKA 2UYBA 5F5IA 4D69A 1UOJA 3LDBA 4UW4A 1NA1A 2VZOA 1YWKA 1RMU2 5BNOB 5A3MA 2JG8A 2GN3A 1J59A 4GZ9A 1RVF3 3KF3A 1MPXA 1OKQA 4LITA 4YVSA 1HRV1 1JBCA 1X9PA 1H2MA 2HWF2 2I45A 1SPPB 2J1VA 3WV6A 3W5MA 2FDJA 2O8OA 3NNFA 3AKQA 2J42A 1EPWA 1OQEA 1PMHX 2XWBB 1JI6A 2PHUA 3K77A 2ENRA 3RZGA 3UV9A 5GZGA 1XE0A 1GWLA 3RSJA 2ZABA 3POGA 4DQAA 3V0BB 4L97A 4XF9A 3S0MA 1JXNA 3AMQA 5LK7B 1S55A 2WNVA 1R082 1LGNA 4AF9A 5FKBA 1PO13 2VZUA 5F5CA 2CHHA 5DUUA 5FYBA 1QHDA 3AZVA 1UL9A 1AF9A 3H3LA 4E2QA 2FCUA 2PXJA 1W04A 2GDFA 2ZS6B 4ORFA 1O8PA 3HMYA 2TNFA 1RMU3 1IQDC 1DZQA 1S0JA 4I0AA 4IV1C 3WR0A 2JG9B 1S0BA 2VOWA 5EFUA 1WBLA 3K4ZA 2R042 1NY71 2XJPA 3LSDA 2VZ3A 4QU2A 2Y0OA 5FZBA 2WLPA 3GDBA 3LE0A 4YZ2A 1AR73 1V6LA 5JXIA 5IVBA 3RQ0A 1W6PA 4E27A 1IS5A 2WINB 3TB0A 3GXUA 4XDOA 3LOBA 1FMD2 2X05A 3ILFA 1HXS3 3DEMA 4RGKA 1COV1 1JZ3A 1JN2P 1NXD1 3RZZA 5FZKA 4KG0A 4PIXA 1PO11 3FWEA 4XJAA 4BMEA 1ZBE1 4Q29A 4Q4V3 3J8F2 3VDDA 1UZYA 4WM8A 2Q8DA 4Y5SA 5F5QA 4YZ3A 1RB8G 4B3NA 5I0SA 2ETEA 3BPZA 3SHRA 5JXGA 1VPHA 4ZY9A 4Q0QA 3MIDA 3POWA 2IXIA 1J3RA 2GP3A 2K9ZA 3C2UA 2P3IA 5FOBB 3LA7A 1M06G 1AXZA 3VBRB 2KR2A 4MGSA 5IAVA 1YXWA 3QACA 3ECQA 2LM3A 2X5IB 1HRV3 1UMHA 1JTZX 3HN3A 1BXHA 3JBG2 1RVF1 4M4PA 3VHNA 2NMNA 3APBA 4JGZB 1VBB3 2VCCA 4LBQD 1C5HA 4QU1A 5FP3A 1EYBA 5FTTC 5JPNB 1OXCA 4HOOA 2J1RA 3ZYRA 2BV4A 5FO8B 2EAAA 2ZACA 1XNKA 2XBO3 1IHMA 1KDMA 4M01A 5F39A 2BWCA 3NW4A 1BK0A 1OQDA 3BODA 4BWOA 1C8M1 1GWKA 1MQTA 2ZGPA 1Q43A 4RD7A 4XFCA 1VMFA 1EV12 1W2AX 4UYBA 4FOVA 5E1RA 2OKXA 4CCDA 5CNAA 2J7MA 2ATFA 3TEYA 2ADDA 5DUWA 4QWNA 4YW7A 3ASIA 1QKQA 4DB5A 3ATGA 3NJXA 4I0BA 3WQ0A 3AKPA 2WNUA 3HJRA 3IPVA 1HIXA 5JSRA 4RQPC 4DNYA 2YFZA 5J1XA 5JWPA 3TBDA 5JR7B 1CAUA 1IZ3A 2VJXA 1AYM1 2XJSA 1DP0A 3C7EA 4OYUA 2ZX4A 4XUOA 5JI7A 5LY2A 3WW2A 4EROA 5DDJ1 4N9IA 3LDKA 4EWEA 3FHQA 2VCAA 3BTZA 2R7EB 4P08A 4RS5B 1UCXA 2MEV1 4BQYA 1ZYBA 3Q8FA 5K0UB 3I2IA 4RGAA 4PF1A 2ZMLA 2UURA 5L7OA 3AMMA 4U2AA 3U10A 1VIWB 2C6SA 2GNDA 3VD7A 1TZOA 3AMHA 3H1YA 4CEYB 4QQLA 3RZHA 4BDVB 3D5OA 1LAJA 4CUGA 1G9BA 4MXWA 3SMHA 1HB2A 3P3PA 4PLNA 3RWNA 3NV4A 1CIYA 1AR82 1POV0 1QH7A 1YJLA 2HBUA 2VH9A 2CTVA 4HLTA 5HV0A 4JV4A 1OD3A 2D98A 2P4EA 4DFSA 3L2YA 3ZSKA 1RUF3 4M0NA 2Q8OA 5C8WA 1UX7A 3I59A 3WNMA 5GLVA 3BTYA 2YBKA 4NIIA 3TNPB 2YYOA 3IBMA 4Y24A 2W08A 4KWUA 5IWFA 1B35C 2VNGA 5J09A 2KD7A 4W4ZA 3J7MA 2C9KA 4ZKTB 3UKVA 1DQ0A 1RUD2 1UMZA 3U78A 1OFSA 2WT0A 3VKMA 4YPJA 1JZ6A 3LDRA 1TVGA 4MX3A 3T4HB 4CU9A 2QNKA 1CD3G 3I54A 2JE8A 3K4AA 2JDMA 3JD73 4FXGB 2XL7A 2XMLA 4HPKA 3ZM8A 3LEGA 1D2SA 1QJEA 4FSJA 1OPOA 1D4M3 1HJFA 1WBFA 2IVIB 1UX6A 3HBKA 3CO2A 4Q4Y1 1HXS1 1AYN2 1LU2A 5IK5A 2X29A 1Y4WA 4FPGA 4C90A 1HQLA 1QU0A 3MPBA 5ABJC 3SNMA 3JBG1 3NL1A 5FZAA 1TNFA 2P5BA 1E5SA 1KDKA 2QQLA 3OGGA 2GH8A 2D7FA 1NQJA 3W58A 2R16A 3BYWA 3LFMA 4CXWA 2ES3A 4AQ2A 1JZ2A 2K46A 2EIGA 3QH7A 2ET1A 1JHJA 3ETQA 5LEKA 5KXEA 4HL0A 5F6KA 4OHZA 3L9JT 2A6WA 5F6LB 2LUWA 1PK6B 3CQOA 3RGBA 3CZJA 3WX5A 5F3CA 1YQ5A 3AYCA 1UPIA 3CBNA 1QWRA 1N1YA 1W8ZA 3IN9A 3OUIA 5FMDA 2IZWA 3QBQA 2VCBA 1K3IA 1LRHA 2VVFA 4CP0A 1U5YA 4RS5A 3KS7A 2J1UA 4L0PA 2PQSA 2ZGMA 2ADEA 3DECA 5L7OB 4GD4A 1AYM2 4LIVA 2NMOA 3ZYJB 3H1WA 2ORZA 1W0PA 5FY5A 3WW4A 2W3JA 1LHNA 3LD8A 1IPJA 4HZFA 4KBZA 4XPVA 1UWWA 2DWRA 5BXXA 4BK5A 1O59A 2SLIA 1Q8QA 1KJRA 4FPCA 4HKOA 4OQ8A 3WZ1A 1R1A1 1OLME 1VAKA 1VMHA 3KT7A 3N35A 4K7JA 1U5XA 1ZZCA 2HWD2 4CU8A 3LOIA 1EV13 1UYPA 3WNPA 3U37A 1GOFA 5GLZA 3ILNA 3TWIA 3V0AA 5C9AC 4EN7B 3THTA 1MZ5A 2ZGNA 2PHRA 2OPKA 4UW3A 4AI1A 1AR81 1REFA 5SV8A 1H9PA 2JG8B 1VBA1 4FPJA 4ITCA 2EICA 3C7HA 3NMBA 4UOJA 4KU7A 2TUNA 5JZGA 4I09A 5FXZA 3MBWA 3P3NA 1Y9QA 2BU9A 4YM1A 4YVWB 5FO7B 4F3JA 4DRRA 3J26N 3VBFB 1D4M1 3ALQA 3I3BA 2IXHA 1G9DA 5BNPA 2RDQA 1DDLA 3VDBA 1BBT3 2BJSA 4IGOA 2DCJA 5T5LA 2WQZC 4LLOA 3WG1A 3WUCA 1JZ5A 3CHXA 2OYZA 1RL3A 3LCPA 4A41A 4BQ1A 3V0BA 4FTSA 1HQWA 2VW1A 2WNVB 2BTVC 1Y7BA 3N9MA 1AR91 3PUSA 2PAEA 4UW5A 2R073 3N7LA 2H6CA 4B4QA 5IYYA 1AR62 3TOJA 3WLUA 4B4PA 4D8MA 4TLFA 3WG4A 5LBEA 3GHMA 3LEIA 5FP7A 5FZ4A 3T30A 1I5ZA 3M1HA 1UXZA 3ZN6A 1W3VA 1MVEA 4NROA 2PN5A 1MS5A 2PHFA 1LCLA 4MZUA 2D6PA 4LULA 1JOBA 3WNNA 3PIJA 2Z69A 3EBRA 4ZU7A 5FYIA 2CDPA 1W9YA 5FYHA 1ONAA 1RTVA 5H9RA 1ZZ8A 5C8CA 2W94A 2WSVA 4BQ3A 1QQP2 1KGYA 3LEMA 1W39A 3UJOA 5FZGA 2XHKA 3C7GA 1SBEA 1YIFA 4C1WA 2DCZA 4FAGA 2FZ2A 3OY8B 3UNPA 3WDXA 1P8JA 4XFBA 1CZSA 2VQ0A 2X5IC 4FPOB 4GB32 2D97A 2VTFA 3OBRA 5CAZA 1TE1B 1RUJ1 5C71A 2A7AA 2X5IA 5IFPA 1AX2A 1QF3A 3M3QA 1LB2A 2CGPA 4L8QA 4GAZA 1XYNA 3ENRA 1S1AA 4LPLA 1QJY3 4NOTA 4JGZA 2NLRA 4ZS3A 3MV01 1MACA 4JQRA 4LIUA 4B4RA 3MUZ1 2ZJCA 3A0NA 2C0ZA 2A3YA 3ZKYA 3CJIC 3W21A 2W39A 5F2WA 1ULFA 1R1A2 2Y6GA 1H2KA 4FQZA 4KWJA 3KLSA 3VBUB 2QUOA 3VBSC 5FZ7A 3MW2A 4N53A 5FP9A 3FBYA 3OEAA 1MQTB 2W91A 1C8M3 3WXPA 2GC2A 3K4DA 3MIHA 4XTPA 5GLTA 4YVWA 4AVCA 1SLTA 5EZWA 3GALA 1CESA 5GZCA 3NV3A 5EHDA 1PGL1 3NNGA 1PVXA 4BIOA 2RVAA 4D6QA 2XPJA 2EIEA 2AEYA 4A2UA 1JODA 2WNUB 4CP1A 4QX3A 2RM23 4RL7A 1CAVB 3SEEA 3IMMA 1Q5OA 4CDWB 2W68A 5HBAA 4LK6A 2YU2A 1G86A 2UY9A 3WW3A 1YRZA 4COWA 1JOJA 2R062 2Q5TA 4LO4B 4BB3A 4CCEA 1TME1 3B94A 3ELNA 3WDTA 2E63A 4AEMA 4S2FA 1C57A 5B4NA 4P9IA 3KQRA 2WT1A 4P9XA 1NG0A 2OZJA 4LBJA 1SEFA 1BEV1 2HWB1 3MV11 3PVEA 4AFMA 1IGOA 4Z8BA 4FTEA 5CG8A 1RUH3 2VU9A 3OBAA 2HWE1 1J1LA 5DABA 2K2SA 4Q4V1 1OVSA 1V6IA 1RITA 2VMEA 1DGRA 2ZBJA 3WHTA 3RYRA 4AOCA 4KWLA 3O1RA 3WNOA 1KQRA 3ZN6B 2VZTA 4JX0A 4TLGA 2AACA 4LHKA 2Y0IA 1A78A 5BY5A 2D43A 3KB5A 3WQ1A 4UAPA 4M3CF 3KMHA 5D8AB 4B7EA 5JOZA 3WQBA 1ZREA 2DTWA 3EMRA 4Q0PA 1O8SA 1N1TA 1LGBA 3O12A 3PU8A 2XONA 2WO2A 1O5LA 4RHV2 4YSFA 4QHBA 4MHUA 1WD4A 4W8JA 4QGMA 2CSGA 2RS52 1Q3EA 1VRH3 4Q0UA 2O0OA 3FHIB 2XG3A 2R1DA 4BM8A 1HRI2 2LW8A 2R30A 3IT8A 2R0FA 3HNYM 2NN8A 3PURA 4HT1T 5IK7A 3POIA 3HT1A 1H0BA 1CX4A 3WSOA 5CFDB 3LF7A 1H9WA 1G7YA 5DXDA 5E16A 5FWJA 4OFGA 3I2OA 1F4HA 2YMZA 4NMIA 2WAOA 1ULDA 5FZDA 4N90A 1OOPB 1QXRA 5EP9A 5KXBA 3AP5A 3USUA 3GYDA 4NUBA 1IKPA 2PLV2 4QKBA 4CP9B 2C5DA 2HWF1 2XOMA 2VM9A 4JQTA 1ENQA 4NPRA 3UGGA 2ZX2A 3ZLIA 4CXXA 2BWAA 4HVQA 2J1EA 1CVNA 5D2AA 5A1FA 1I3HA 3BIWE 4A44A 4XC9A 1YQ8A 2UWAA 3IWZA 4J6GA 5DAXA 3RMXA 4Z1VA 3ORJA 3GZUC 1YLLA 4QHOA 1HQNA 1W2TA 4MHRA 4KMQA 5FV3A 5T5JA 1L7RA 1W99A 3OPTA 4LKDA 3ZO0B 1CN1A 4W6WA 3NNMA 1IPKA 4Q4X2 3JB4C 3A23A 3BU0A 4GH4C 2VVDA 1UO9A 2GMEA 4QB2A 4QPIC 1MVQA 2EXHA 3I3QA 3T0AA 1H2NA 1RUI3 2GALA 2J1TA 3EYPA 4Q4W3 2FMDA 2OS2A 1JYVA 4LEJA 3O1SA 1FXZA 1QJU3 4INDA 3NV1A 4PBPA 4QXKA 3ABZA 1YQCA 3NVCA 4YRDA 4ATEA 4MADA 2B7YA 4Y1YA 1T6BX 1GLHA 1PO21 3D0JA 4RA0A 1NY72 3NJYA 4AEKA 5IATA 3QCWA 4XBLA 4H7LA 1RUJ3 4WM7C 1FT9A 3M70A 1JS9A 4QQPA 1SDWA 3BI3A 4FPHA 1T2XA 3LA3A 1O91A 1FMD1 3DV8A 4LE3A 4LXLA 4PDWA 5A3WA 2VULA 4HVOA 4OI2A 1WD3A 1OLRA 1R083 3HIFA 3J8F1 2VOKA 1XXNA 2WZR3 2GC1A 3ZXAC 5BNQA 1JYXA 4Y1VA 4V1PA 4HSJA 5FYVA 3LFIA 3D8CA 1SLBA 4Q4X3 5IVFA 2Z4FA 4YZ1A 2W1QA 2DVBA 5LRSA 1Z7S2 3E6CC 3BIEA 4CDQA 2R072 3K2OA 1OSGA 3J7HA 4AFAA 4DY3A 4EZ4A 5C9AB 4P00B 1BVP1 1C1FA 1YQ2A 4BHPA 4WM8B 3AYDA 4EV0A 1ENXA 4YM2A 1KFUL 3I3DA 1UYXA 3A4UA 1G8WA 1OLQA 4LBQA 4YW2A 4AHXA 1GICA 5AFEA 1ULCA 1JUHA 1RVF2 2JG8C 3M3CA 2NQYA 5GZDA 5ANNA 5F3IA 3VHRA 1OLMA 3FLTA 1JMUB 2IC1A 4LOTA 3VBHB 2VVEA 3MLLA 1XNAA 4JRLA 4Q0SA 5E89A 4YVWC 3ES4A 1F35A 1UY4A 4XJWA 3VBRA 4X8PA 4Z92B 3PUIA 5L9BA 3VBFC 3SH5A 5CFDA 1UU6A 4LKSA 5KXDA 5HXMA 3WINE 2IFWA 2ZMNA 4UI9L 3VBFA 4EN9B 1Q8OA 5I8YA 1N3QA 3N7KA 5BNPB 1OOPA 2Y33A 4XBNA 1UXXX 1ULOA 1MZ6A 1VE0A 1EUTA 2R6QA 3ACIA 4GMP0 3QD6A 2A6ZA 3GF6A 1QDOA 1S4CA 1NA1C 2CV6A 4R9CA 2EF6A 2YC2A 2CGOA 4RSUA 5FWEA 3VBOB 4UFIA 3VZMA 1UYYA 4XQDA 4WZCA 1SFPA 1OVPA 4YVSC 4N53C 4GJZA 1DFQA 1FV3A 1Z0HA 1GP6A 5KC6A 3K3OA 4NHYA 1GANA 2KXLA 2QQWA 4BA6A 1HB1A 1DF0A 1UAIA 2AC1A 4NWWA 3SKJE 1AJOA 3MUY1 1Y43B 3PVBB 4HONA 1TEIA 4QT6A 2WQ8A 3M4FA 4QKDA 2YC4A 5I8SA 2VUJA 1QJU1 4FAHA 5A3OA 3WNKA 5JIUA 3NSTA 2WZPP 1YCIA 2X8KA 3FUQA 3WNXA 2CGNA 2RDNA 5K0UA 4GWNA 2VZ1A 1E5RA 2VAUA 4OHVA 1I1EA 4K40A 2R1BA 2E32A 4YFWA 1CPMA 4IV1B 4XURA 5I93A 3FL7A 3OY8A 2HWF3 1WCDJ 3EXUA 5AC91 5B2GB 3GJAA 1SDDB 2RE9A 4BOWA 4FFGA 4AVTA 4CUAA 1DYOA 5KWRA 2XH6A 1V6KA 3EB7A 4KGQA 4COYA 2WA4A 1W8WA 1VJ2A 2XJQA 1DYPA 4CDQB 2JX9A 5KR7A 1QXJA 2W1WA 5A7WB 3S6PA 3H8UA 3G7DA 1REDA 1RUD1 4ZU5A 5C9AA 4LORA 1ND3C 4FP2A 3ACFA 3S5QA 4Y5Z0 2LROA 1MQTC 4XCBA 2IXCA 2G4IA 3VBUA 4M3CB 2F6BA 2B4KA 1W05A 3KVBA 5ACA1 1ASJ1 2B5HA 4QMAA 3WVJA 4GMP3 5A3PA 1LOGA 3LAGA 1XJAA 3ZXGA 4PT6A 5JDBA 1E5HA 3DKWA 3H9AA 1QEXA 3RI9A 5ANQA 1AYN1 2YXSA 3K48A 4MGYE 3LB9A 5JIAA 1GZWB 3Q8CA 3JD72 2WNUC 3ZFEA 1LOFA 1W2NA 2Q1FA 2Y8KA 1H8TC 1QDCA 4GALA 1K45A 3U4SA 4NPLA 4C0HA 1WCQA 2QFEA 1VBC1 1T6GC 4Q4Y3 1PZ9A 2OX0A 3TNQA 1UMIA 1AJKA 3RWKX 2DCYA 5DQ0A 4YZ5A 3VBSA 4K6BA 2VBDA 2YU1A 4XDPA 3UK9A 1RUF2 2A6VA 5BV6A 1BEV3 2HWB3 3SQOA 1OA2A 5AFBA 5JXJA 3N7JA 2A1XA 3OGVA 1NQDA 2Y64A 4WVVA 1RUC2 3SC7X 4Y4YA 2Q8EA 5J96B 3KCCA 4A3XA 1BLZA 1C1LA 4OI0A 4CDUC 4UWDA 5IFTA 1AXKA 3PMSA 1XE8A 2WS93 1W9FA 5J48A 5FMOS 3N9NA 3ZKUA 2X53S 3LSEA 1YHFA 1ZBE2 2ZHNA 4HN1A 4XCAA 3THPA 3H8RA 2BOIA 3ZOIA 1B09A 1Z7S3 4AHYA 5F8PA 3CL1A 5HCFA 4WV8A 1VBB2 4ZXKA 4AVBA 1K42A 4BZ4A 1F4AA 1ULPA 3D4KA 1J1TA 2RR12 1CAWB 5APAA 3HBZA 3SITA 1GNYA 4X6RB 5JPMB 3VZLA 2WLQA 5T3NA 5K0UC 1WCUA 3RYKA 4OUSA 2ZHMA 4CCNA 4LKFA 4XFGA 4YM0A 3MICA 4FO9A 2WAAA 2OA2A 1H6YA 3DUIA 4ISRA 4L9BA 1RHI3 4G9SB 2HWD1 2HEYF 1RUH2 1LTEA 4GWMA 2JDPA 4LO6B 2XQXA 4TTGA 2WDBA 2GZWA 2IVJA 1OI6A 2YFUA 5J37A 5A33B 2YHJA 4XTMA 3GCWA 4MGTA 1E57A 5A3LA 1XBFA 3QLQA 1OOPC 5FJKA 3J9SA 5FYUA 4A4AA 3HNBM 1RXGA 4KU8A 1IOAA 4Q5OA 1DHKB 1FMD3 1RC6A 3O1TA 1SG3A 1W3XA 5AC92 4JC1A 1JYCA 4FOYA 1DLCA 3HEIA 1UU5A 3FFQA 2Q30A 2VZVA 2DURA 3DKQA 3GCXA 4LT5A 4CCCA 5L9RA 5F37A 1UZ0A 2JWPA 2JKXA 3R4SA 3NJVA 2QQIA 3JXSA 3V64A 3ZPOA 5A7OA 4YW4A 4AQSA 4K1ZA 2OXBA 4DUVA 2VUCA 3FE5A 1VBE3 1NX9A 1X33A 2BRTA 4BLIA 4KBBA 2B45X 3UYJA 2VOXA 2OQ6A 2PTMA 4BLJA 1A34A 1W6QB 2ZGTA 3VZKA 1GNHA 2VECA 1ZZ9A 3EO6A 5DDJ2 2DCKA 4KQ7A 4N8MA 1H8TA 4UFJA 4DEQA 2DV9A 4NIAA 2ZOEB 2MEV2 5FZEA 4RR3A 1KEXA 1LHUA 2P1BA 3VDCA 2D3PA 2V09A 5FO9B 1AL22 4JDNA 2ZGUA 2DBIA 2BGOA 4UF0A 3VKLA 2ARXA 4IV3A 1NZIA 2DVDA 4I3GA 3ZMNA 3VUOA 2DYCA 1KJLA 1OBNA 1ZX5A 3GJBA 2BNNA 5C3OA 1S0IA 3PJQA 3U0ZA 1DLLA 1HRI3 2ERFA 2IXKA 4FPKA 1VBC2 5JMCA 3AVRA 2OT7A 3FFZA 4WM7A 1LEDA 4UFKA 1AR93 3OD4A 5G05L 2WS91 4CDUA 3AK0A 3TEWA 2ZX3A 1XSRA 3I2DA 4LLFA 1I9RA 1OC1A 4UBGA 1DQ2A 4OULA 4XVHA 4C1XA 4OZXA 1JH5A 1XRUA 2B42B 4UW6A 5DG2A 2QQNA 3TN91 3T0BA 1QQP1 4N43A 2WFF2 4QPGA 2XJRA 1CQ9A 4Y5TA 4YFZA 2NPIA 4BH9A 5FY7A 5KHKA 1VRH1 1WCKA 1JHNA 1LHOA 1LOEA 5JXHA 3Q8AA 4OCTA 3CU7A 5FZ9A 1CAWA 1D4VB 4OMCA 4ZXEA 1WLTA 5JOYA 1UZZA 4XYXA 1RUJ2 2D3RA 1L7QA 2ZHLA 5L7OC 3CZUA 3THCA 3B69A 2D6LX 4C8DA 4XJUA 3VBHC 1QJX2 3ZDSA 1AZDA 5KHIA 2JKBA 3LEKA 3H0OA 1BZWA 4XAAA 2V72A 3VBHA 3RJ2X 3RNSA 2R0HA 2RS33 5LBCA 3ZN5A 1JW6A 4DXZA 3RMYA 4KG8A 2ZEXA 3WY6A 4EE2A 4H55A 5FZ6A 3IKWA 4L99A 4Q4Y2 1WCSA 1W8FA 1SQ4A 1Q8SA 3C3VA 4K20A 5DPNA 4NJ4A 3RZJA 2JE9A 4UFLA 4AI8A 2H0BA 1SFYA 3A22A 1X8EA 1RUH1 3O1UA 1QNWA 2ZA9A 1DU3D 2DF7A 2LTNA 1RUD3 1H2LA 2XLGA 5A7QA 3V65A 1K5JA 2ZGRA 4FVVA 4FQ4A 5CFCB 4JKMA 3PTRB 1QH6A 4FBFA 2DUQA 4PBOA 1DIWA 4XBQA 1XC6A 5C4WA 2E7TA 5DUVA 3LGRA 5FZLA 3FMGA 4PHZA 1PO12 1W06A 4N53B 2VPVA 3VBOA 4K1YA 3B3QE 3ZX7A 3MFCA 3R6SA 4AAXA 1V0AA 3MDPA 3F95A 3E6DA 5A32B 2JDKA 3W20A 3ZXFA 4CCKA 5IVJA 1NCQC 2B39A 1QJZA 3TYJA 3B9CA 5IVVA 2RJLA 1C28A 3MFAA 3O0VA 2ZGLA 1W6OB 1YNAA 3O5SA 3SH4A 1LOFC 1GNZA 1W6MB 2NYYA 4ES9A 5GJ6A 3B00A 3AYEA 4XFFA 2G9ZA 1G9FA 1WKYA 2WZ8A 1ZBA2 2YBPA 4Y22B 4Y1XA 3URFA 2A6XA 3MF9A 3OUJA 1R093 1U5ZA 4URAA 4HXCA 1JZ4A 1DZRA 2WNVC 4OI1A 2VUAA 5IVEA 4HKLA 5DUXA 2FDHA 1V6MA 3C8XA 5I91A 1U0AA 2AYHA 1BVVA 4FCAA 4MGZE 5T50A 3ZXEA 2P3JA 1MS4A 5L36A 1CGPA 1C8M2 3WW1A 4KWKA 4OHYA 1BKZA 3ZYFA 4WVZA 5EJ1B 2FDGA 4KL1A 4E4SA 4D3WA 4I02A 4YGDA 2AR6A 4W65A 3ZN4A 4CCMA 4D7SA 3P5BA 2EAKA 4JCKA 1ZRIA 2BVBA 3VB9A 2WNOA 2YZ4A 3WG2A 3FBMA 3RZMA 2A75A 3GZEA 4G3YC 3HD8B 4QPGB 3OGJA 5FYYA 3WQ7A 3LQCA 4HK8A 3KHBA 4XMIA 5BNNB 1CPNA 5D8AA 1UNBA 2ZEYA 5EJZB 2VXRA 1KXGA 1VAVA 1OA4A 3DXTA 4PIYA 5FZ8A 3GM8A 4LBMA 3TN92 3VKNA 4B29A 4DINB 1FOD2 3M8LA 3JZVA 5FPAA 1OF4A 1UY2A 5E6HA 5D21A 2OW4A 5J36A 2E33A 1VAMA 4WVWA 1KRIA 1GMMA 3MEPA 2PLV1 2XVGA 1GOHA 3KGZA 3M2MA 4B8EA 3PUHA 1J58A 1YI7A 4Z82A 1XYPA 4KH9A 3BTXA 1O3RA 2JIGA 3POBA 3BOPA 3OD0A 3AJYA 3ZFEC 4X6QB 2JD9A 3DGTA 3KQ4B 4IEOA 1NE6A 4M0HA 4QX5A 2BYVE 4E2SA 5CFCA 4DY5A 4YNIA 3S7IA 1G9AA 1JOPA 1JYWA 3KCYA 3CJIB 5JAXA 4YGBA 3VV1A 4ZU4A 3P1IA 4DS0A 1PM4A 4CDXA 4Q4X1 3VBUC 4AL9A 3VBSB 1W0OA 1WA6X 2UU8A 4P9YA 4ASLA 3ROUA 4IEQA 3IAQA 3LPFA 3AX4A 3N36A 4F7ZA 5A70A 2VQUA 4V2VA 1DGWA 4FFIA 1BBT1 1GU3A 4P5YA 4QHZA 3PL0A 3BUCA 2CU5A 1OKOA 1PVC3 2AEZA 4AVVA 3I97A 5D1IA 2G1MA 1SFNA 3KV4A 3UT0A 1LESA 2E26A 1S0GA 4I30A 1W6MA 3THDA 2W1UA 3O0WA 1LU1A 2W95A 4PI0A 5IHRA 3C7FA 2QQKA 4A6SA 3PDQA 4YGCA 2A5ZA 3LZZA 1AR83 2C26A 1J83A 2YG0A 2VW2A 5A6QA 5HV4A 4Y20A 4FOQA 3FHAA 2JB4A 2SBAA 3J7LA 4QM8A 1GQHA 2F4LA 5FUIA 1R1ZA 3SLIA 2VQAA 4RN5A 4IE7A 1JZ8A 3RS6A 2E7QA 2VGDA 1YFUA 4EN0A 1R091 2WYSA 4FPYA 1SBFA 1ZBA1 4U36A 4JRAA 4LHSA 1LEMA 5BPXA 4GXLA 3VZNA 3HNMA 4PIZA 2RMU1 3AVSA 3WP5A 2ID4A 1JU4A 1KS5A 2FMYA 4QXCA 1LOCA 3Q8EA 3UKTA 1HDKA 1H6XA 2P3KA 2QE3A 5FZ0A 4XHXA 3N9PA 4MXVA 4QKFA 4MXWB 5CA6A 4A3ZA 3HQUA 5D8AC 3ZIWA 4BXSV 2VXJA 3FC0A 4L2NA 3RDIA 1WWYA 1XNBA 3ZSJA 1UKGA 1VALA 1UIKA 1BK1A 1S2KA 4Z2AA 3J7NA 1AX0A 5FXXA 1TNRA 4S2GA 1OQ1A 2C24A 1WW7A 2G19A 2Q1ZB 2VY0A 4LK7A 1VLNA 4QB6A 2EIBA 4CPBD 1PGL2 3PVOA 2BBAA 4M00A 4AEDA 1DCSA 2ORXA 1WMFA 1QXPA 3PTYA 1H1IA 2LALA 2BUKA 4X8NA 3KT1A 3NNLA 2D3SA 3K75B 1ZA4A 1RUE3 4EN8B 1ZBE3 4XQ4A 5CFDC 2R061 5CVRA 2DDUA 2F4PA 4DUWA 3B7MA 2V4VA 4L92A 1RUOA 1WLCA 2ZEWA 3I2KA 4M3CE 2RS31 5AVAA 2WYFA 1SACA 1CAXA 1QOTA 3WP6A 2HYKA 1QJY2 2DUOA 1MS3A 1VB2A 5LBBA 1W8OA 3ZMOA 2OUHA 4MGQA 4COVA 4E2GA 5T5OA 3W59A 1O3SA 1ZVFA 4Q4V2 3JBG3 1PZ8A 4W6YA 4IGQA 1FNZA 3KV5A 3CKHA 1I5PA 4MH0E 4XF0A 1B35A 3ZFFC 5C6CA 5LEJA 4AHZA 3PHMA 4CUBA 3F2ZA 2WQ4A 5KBFA 1O3QA 2HLEA 2R063 2VZPA 4TSVA 1POQA 4P9JA 3IMNA 4Q0VA 3T1LA 3ZR6A 5FOJB 1RUE1 4YWAA 5FUPA 1ODMA 4JGYB 4JTOA 1MS9A 4TWTA 4GH4B 3DF0A 4QPIB 4EWAA 2Y6KA 3UGFA 1SLAA 1RIRA 3T08A 4S2DA 3ACLA 1LNSA 3WF3A 3AKRA 5FQ0A 1RHI2 1Z78A 2OUJA 2PELA 4N43B 1OMIA 4ASMB 3GGLA 1SHWB 1C8NA 3U1XA 2GSYA 2ZXQA 4XEZA 5FFOC 3VKFC 5JOXA 1HRI1 4MOAA 1G6NA 4MSVA 1W6NA 2QQMA 4QQHA 1BMV1 4BCUA 4LR4A 1J3QA 2W87A 3HWJA 2UWBA 4BQWA 1YQ6A 4IV1A 1IPSA 4DUXA 1WZXA 5HCAA 2KM2A 3BCWA 4AQ6A 2R49A 1D0GA 4XUTA 2O14A 4XMAA 4CVUA 4RYDA 2CWMA 1ZBA3 3A7QA 1UY0A 2GC3A 3NAPB 5FYZA 1FV2A 1R092 3WP3A 5C3PA 5C5UA 4HFSA 1YJKA 4XIKA 3A0KA 2W47A 4LTAA 1RUC3 4NIGA 5CFCC 1VBE1 1GV9A 5A1AA 2HWC3 1W8HA 2VL4A 4KI5M 3G6JB 4PLMA 3SH3A 2WO1A 5G04L 5FP4A 3LA2A 3PU3A 4WM8C 1J84A 1GBGA 2I07B 3NQHA 5BYNA 3T2TA 2MEV3 4JKKA 1DBNA 3LIHA 1EAH3 2PHDA 3KM5A 3PUAA 2GH2A 3H3UA 2GNTA 2RV9A 5A7SA 1SZBA 3VD5A 2A73B 2QCSB 4E4ZA 1ND2B 1S0FA 3AP6A 5JZGB 3PNAA 3GNEA 3AP4A 1A6CA 3B02A 3DXUA 3O7OA 2FDIA 1DQ1A 3CIHA 3AL6A 3FJSA 5JOWA 4LOSA 1Y9MA 5BNPC 1ULEA 1W6OA 5IK8A 2HWC1 3RFRA 3OJBA 2DVAA 1RUC1 3HVDA 4DO0A 4XXPA 1GR3A 1NLQA 1PMJX 1VRBA 1NA1B 4FI9A 3POSA 2WO3A 1FPN3 1DYKA 2BZDA 2QQPA 5DMYA 3LIGA 1UW8A 1HB3A 3VBOC 4EQVA 2CWSA 1H4GA 1CJDA 5A7NA 3MZHA 3N9OA 1V00A 2XBO1 4YVSB 5F1RA 1MEC1 4BQXA 4Q26A 3BU7A 2D5FA 5FJHA 5CYYA 4SLIA 3SISA 1NCQA 2AZ5A 1VBB1 2BQPA 4WVMB 3PLQA 1UKRA 4ZZ8A 4K8RB 2PLV3 3AMPA 5FPZA 4CXYA 1Z7S1 2ARCA 4MGKE
chains in the Genus database with same CATH topology
5BUVA 2R071 1O3TA 4MLOA 4O9GA 5KC5A 5LRRA 1IKQA 4QPGC 4AVAA 1XNDA 1FYUA 1XU1A 4ONUA 1VBD1 4FOWA 3ZFGB 2PA7A 4XDQA 2VNRA 4IERA 5BNNA 1RJ8A 2JEMA 4IEUA 1UIJA 2G9GA 2PYTA 3AXDA 3IDBB 2AGSA 2V73A 3MIEA 1OFNA 1RINA 2O1QA 5C8CB 5FDBA 1RUNA 4AYUA 2D44A 4Q4W2 4XF1A 2CAUA 1GKBA 5A33A 1W6PB 4XHBA 3J4UH 1LKNA 4META 3PVNA 4DZGA 3ZSLA 2GN7A 1AYN3 2XLFA 1C5IA 1V70A 3PJYA 1RMU1 1KD7A 4ISQA 1POV1 3UL2A 3VDDC 5H9PA 4CDQC 4AXOA 3UKNA 3UJQA 4P14A 1OHFA 4JTNA 1O4ZA 1H4HA 1ALYA 1ND3B 4HMZA 3CJIA 3X29B 2EVXA 5GZFA 1CR7A 2WZR2 2W52A 2DU0A 5FPXA 4JDMA 1VBE2 2ILMA 2ZMKA 1RJ7A 1SLCA 3OCPA 4YLZA 1ND2A 3GBFA 1V6OA 4AFDA 3NV2A 2XLAA 2RS51 3WDWA 4E4DX 1LR5A 4YW3A 2WFPA 2ZX1A 2GNMA 2UWCA 3AKTA 1H8TB 1EAH2 4TYSA 5T52A 4Z07A 2WC2A 4PCRA 1ZZ6A 3KSCA 2GC0A 2RS53 2YC0A 5HI0A 4LE4A 3B01A 2PHLA 1XYOA 4C0BA 1WGPA 5FLIA 4Q8KA 3KGLA 3S7EA 4R4XA 5CADA 1PGW2 3BOWA 4YZ4A 4FP3A 3T1MA 5FLHA 4WVMA 4CDUB 1WMDA 4Y1ZA 2PHWA 1COV2 1PVC2 3R05A 1VR3A 2OVUA 5FLJA 1PNGA 2WFF3 3Q9OA 1MEC2 1O5UA 3RJRA 3CNAA 4QM9A 3OBTA 1BQPA 4FPFA 3E5XA 1X36A 3RRDA 3KD4A 1AXYA 1QJX1 1MZFA 1N1SA 1U5IA 1ASJ2 5JVVA 1H8VA 4GKYA 3MLKA 5I0UA 1GFF2 5I0TA 1UN1A 3JD71 4CZSA 1NYWA 1X50A 1A3KA 1TMF1 5F9TA 1ZRCA 4AEDB 4PF5A 2Q0AA 3JUUA 2XWJB 3CLPA 5EYXA 2ZPXA 2BFUS 3E97A 4Q1RA 2CNAA 3D6EA 1D0HA 3MF6A 4Z2WA 1RUF1 1F8VA 4LBLA 5HXVA 4LO7A 4D94A 1CAXB 3I59B 4XIOA 2B8MA 4LBNA 2D40A 2WJSA 2YROA 2A3WA 4EWDA 4MYEA 4AGRA 4NN0A 1MS1A 2O8QA 4W6XA 4I3PA 2UY8A 3ZSMA 3ZSEA 1LHWA 4GULA 5A32A 2XJVA 1QMJA 1YIPA 4QQ2A 2XL9A 2ZGSA 5K9YA 2WZR1 3WOGA 2VW0A 2K0GA 4N43C 4F83A 3BB6A 5FQ0B 1F9KA 4RR3C 4DOUA 5ABJA 2ET7A 4K8FA 2AH2A 4Y22A 3O14A 2E6VA 5GM0A 1AYM3 2DFCA 1XE7A 3I8TA 3RMXA 1RUG1 4Q1PA 3ZFFA 2NM1A 4AVSA 1EAH1 4R4ZA 4IV3C 5CG9A 4GB33 1W6NB 2JXAA 1PO23 4NHLA 4I0WB 2AENA 1AL0G 2RR13 5GLWA 3VHPA 2UYAA 4HANA 1ZNPA 1RUI1 2OIIA 4YW1A 4AWDA 2FHRA 3VLBB 1PGW1 2RS13 4XQWA 2BGCA 4RGGA 2V5YA 4BE3A 2BBVA 4XETA 3ES1A 4FTBA 1MS8A 1J3PA 2YY1A 1QJU2 1W2UA 4HBNA 4A7KA 5KHJA 4H14A 1FOD3 3AXEA 5CU1A 4CEWB 3D0SA 5T54A 5I8TA 3K51A 2JENA 3WDYA 4DPNA 3E5UA 3FX3A 2IWGB 2ZKNA 1UD1A 2HEVF 5IT6A 2ZX0A 1V9U1 3I4IA 1S0DA 4LBQB 4SBVA 3VL8A 4HN0A 1AVBA 4URTA 5CB7A 5JZGC 3DN7A 3RG0A 2PAKA 1WA4A 1AL21 4YARA 1TQ5A 1PIV3 4AG4A 2MHFA 3DPRA 4N7IA 2Q4SA 3ILRA 1TMF2 5K7PA 3DPRC 5L73A 5IUQA 3V0AB 3AB0A 3ZXLA 3U11A 5KXCA 2VMIA 1M4WA 4MGIE 4CDXB 5JI9A 5IK4A 5C4WC 3AZYA 1NCRB 1AR71 1WUVA 1ZRRA 1DZTA 4QPYA 4XFHA 3AZWA 5GZEA 1NCQB 2JDZA 3AZXA 3KZ4C 5FRAA 5ACA2 1Q56A 1VRH2 3FLPA 3HR9A 1PNFA 1WW6A 1K5MA 1ASJ3 1O4TA 3EQEA 3ZFGC 4RHV3 3GBWA 4AEJA 1DG6A 2CYFA 5KHHA 2YDEA 3E5QA 2D93A 3TN93 5CIRA 1EPZA 4XXAA 3SXWA 3IDEA 4HKWA 1YFXA 3VN4A 5C8CC 1PIV1 3AFKA 1LJ7A 2Z42A 2RHPA 3V56A 1S2BA 1UF2C 2D6KA 1TME3 4FBFA 4P9GA 5AC93 1V9U3 1DGLA 4GQ7A 2VMHA 1RUG2 4HETA 2RM21 1IQAA 3TRSB 3MGUA 5DZFA 4D7TA 2RMU3 2HKXA 2PFWA 3IM0A 5BNNC 1FPN2 1OPMA 1DGRN 5FCCA 5FMOL 2C9AA 2XJUA 4FXKB 1RUI2 2GAUA 3FZ3A 1FX5A 2XB6C 2G9FA 1ND3A 3IIAA 4BPZA 3B5LB 3GZAA 1KFXL 5DZGA 2RR11 5CBLA 4M3CA 3OPZA 2BNMA 1QJY1 3DL3A 2R043 4YG6A 5H9QA 4CP2A 4R9DA 3POYA 4HK9A 4OHXA 2NP0A 4K21A 1V9U2 1ENRA 3ZFEB 3INAA 2E7AA 1LECA 2JECA 2B46X 1QOOA 1AR92 3OYWB 2W0XA 3AP9A 2QZ3A 3BTAA 1XU2A 5JCTA 3WG3A 1ENSA 1RUE2 2B9UA 2D6NA 5BNOA 2QZ2A 4XFAA 3TAYA 3AJZA 4GA9A 1NCRA 2D6OX 2FQPA 2HWD3 5DG1A 1RHI1 3H3ZA 4I01A 3AMNA 3SCHA 3H7JA 4J1XA 4H3WA 2YUEA 1N47A 4JGYA 1CAVA 1NZCA 4PLOA 2H0VA 1N3OA 4OVEA 4CDWA 4Q2FA 2EXIA 4Y26A 3LWCA 4P9LA 2P34A 5T55A 4D7YA 1F2NA 1BMV2 1KITA 1EP0A 1HRV2 3ZXJA 4QGNA 1LGCA 1VP6A 3N3HA 2JD4A 4XF4A 4EN6B 4IEPA 1DQ5A 4YYOA 4E9KA 3SCFA 2AUYA 3VKOA 1HXS2 4AEDC 2DVGA 1LOAA 2JG9A 3MIGA 2QJVA 1R081 3J8F3 3AM2A 2WT2A 4IEXA 1TMF3 1PMIA 2WS92 4AFCA 3PMEA 4LHLA 4WBBA 4CRQA 1NXMA 2ARBA 4R9BA 4MV2A 3ST7A 1VBC3 2R041 1VBA3 3B9IA 3QOPA 2RM22 1HLCA 1KS4A 2WFF1 1F5JA 1FAYA 1OD5A 2TEPA 4OI4A 5C33A 2PHTA 1WW4A 4GMP1 1DQ6A 2VNOA 3QH6A 1SCSA 1SLLA 5ACA3 4AE2A 3NJZA 4N7UA 1YFYA 4COUA 5J3UA 4IEYA 5J98B 2WWSA 2XKPA 1TME2 4XJZA 3JB8A 3MPPG 1Q8VA 3AKSA 4RR3B 3MYXA 1GYKA 3ME2A 4QQOA 3MIBA 2WL1A 4DMIA 5ABJB 3VZOA 4AQTA 3FUOA 3KCXA 1WW5A 4IV3B 4R8HA 4RFT0 3WP4A 3ZFFB 2IXLA 3NKGA 3N7MA 4OHWA 2Y26A 1APNA 5E8AA 3WCRA 3GBGA 4NWVA 2E9QA 2HJIA 1AX1A 1GQGA 4JGYC 1PK6C 1VB4A 3R4UA 1OA3A 2OZ6A 1URXA 1CAUB 4YG3A 1JUIA 1MS0A 1PHMA 3ZFGA 3HT2A 1D4M2 1POV3 1REEA 4IL7A 2A3XA 3OF1A 1LHVA 1C3HA 1ZRFA 1DGWX 4CEWC 3RYPA 4LO5B 5H9SA 3KT4A 4F8AA 3AYAA 2XUMA 4GIQA 4UXAA 3JCIA 3HAGA 4PDWB 1X82A 4IESA 3ZIXA 4CEYA 1WLWA 4QD2A 4XJ8A 4LHNA 1HW5A 1G9CA 1AR61 4R52A 1QQP3 1ULGA 3NAPC 1XQNA 3DPRB 4L11A 5GALA 3WHUA 2DUPA 2ZAAA 1A8DA 1VBD3 4DRVA 1FATA 2P2KA 3HQXA 4J1WA 4CDXC 2FZ1A 2N7GA 1LOBA 1U12A 2CAVA 5C4WB 1Q8PA 1NCRC 3WD5A 4YW5A 4H7MA 2QVSB 2WSUA 1IS4A 1FOD1 1ND2C 2QDNA 4KGGA 3OTFA 1HV0A 4Q27A 4WZFA 1H1MA 1SMVA 4G4FA 1PO22 2ZZJA 1K5MB 4XILA 3NKTA 4FPLA 1H1AA 3BALA 3GHNA 2GMPA 3VZJA 5EWSA 4NVPA 4NHKA 2ZGQA 4N9HA 2NZ9A 4CYDA 1H30A 2CL2A 5FAXA 3EHKA 5BNOC 3FLRA 2GMMA 1Y3TA 3CEWA 4A7ZA 2RJKA 5AVPA 1RGSA 1LODA 4K9SA 3MW4A 4LUMA 1JYIA 5GLUA 2VG9A 1PK6A 2PAMA 1UPSA 1YFWA 2Z2SB 4AHWA 1BBT2 2JJ6A 1V6NA 3JU9A 1FNYA 2Z79A 4XJ9A 3GZTB 2XGXA 1F31A 1WLDA 3SCGA 4P9WA 1AHSA 5KHGA 1I6XA 3NWKA 4LUKA 4YG0A 2MNGA 3JQXA 3AP7A 4XE9A 1C4RA 2XVKA 2DVFA 4XF3A 2GNBA 4NR1A 2JG9C 2AREA 4IXLA 1WMEA 2EA7A 2EXKA 2QKDA 4LNVA 3AFGA 3VL9A 1SBDA 3R4DB 4FPEA 1CJPA 3MIFA 1BCXA 3H50A 2RMU2 4QGLA 2GU9A 2BNOA 3VDDB 3ZPYA 5JLVA 2XBO2 4BMBA 3IDCB 3VGIA 4AI2A 1QY4A 2EXJA 2YV8A 1AR63 1L3JA 2WKKA 1ZZBA 4IQPA 1YO8A 2A6YA 3U4XA 1NE4A 1AUYA 1X7NA 4CTEA 4RHV1 1SCRA 1GZWA 3EJKA 4Y1UA 1COV3 3VBRC 1VBD2 2PHXA 3W9AA 3ZVXA 1VBA2 1HKDA 3O0XA 4CDWC 4JGZC 2Z5WA 4YM3A 3H7YA 4ES8A 2H6BA 2DU1A 2D5HA 4A7YA 2CY6A 4LA2A 1EY2A 1X8MA 3WCSA 3M3OA 5DZEA 2IXJA 1N3PA 1ZZ7A 4IEZA 1GZCA 2RS32 4AFBA 4Y20B 4KNCA 2KA3A 4PQ9A 1QOSA 4TZDA 5EV7A 4IEWA 2HWE3 1R1A3 2I74A 3R0RA 2BPA2 5I0RA 2ZZQA 4I2OA 4LBOA 3IPVB 1IS3A 4IETA 2DCTA 2IFRA 3H1MA 4S2HA 2VOVA 1AL23 3I7DA 2JE7A 4RQPB 2BFUL 5K8SA 4B7KA 2XKOA 4COZA 1LULA 3WDVA 4K3UA 4AW7A 2D6MA 1CIWA 3VHOA 1F5FA 2YGMA 4RS5C 2E51A 4XFIA 4CEWA 1D2QA 1V6JA 1O4YA 1HV1A 1QGLA 1GSLA 1PM7A 3N4MA 3LKJA 3MLJA 3M3EA 1LENA 1N1VA 3NO8A 4XW3A 1SLIA 1YYNA 2RS11 3ZYGA 2Q1MA 4CEYC 3ZXDA 5JSPA 2EALA 4PJYA 3JQWA 4XZPA 4MVTA 2ZGKA 5LK5A 2XJTA 1NLRA 1PGSA 2E53A 4AGGA 2C1FA 5SV5A 1AR72 3AZZA 3U07A 5JSOA 4GB31 5EJ3A 1MZEA 3HN1A 1RUG3 4XOGA 4EJRA 2JICA 3MI8A 4C91A 1PVC1 4OLLA 1CONA 1B35B 2HEWF 2TBVA 2WA3A 1HX6A 4OUMA 2VMGA 2YGLA 3D82A 1W6QA 1ZM1A 4HPKB 2QDRA 4BYYA 2ZKLA 5J7MA 2WNEA 4GH4A 4QPIA 1PIV2 2FBEA 2WIIB 4JVAA 5FREA 5HCBA 3CF6E 4R9AA 1ZRDA 1O7FA 2I2SA 5E88A 1BJQA 3ZXKA 1DQ4A 2HWC2 1PZ7A 2ZTNA 4WM7B 1MEC3 4GKXA 3E6BA 2BW8A 4MUVA 4PDWC 5L19A 4NHMA 4AI0A 4AI3A 4JAAA 3RPQA 2ZGOA 4HSLA 4LO8A 1FPN1 1NOVA 3USSA 2P17A 1S0EA 2XVLA 5GKAC 1YUDA 4RQPA 4AK3A 1BEV2 2HWB2 3WUDA 3ZYIB 3NAPA 4NO4A 2HWE2 4JDOA 3M3IA 4Q8LA 4HVRA 2A70A 2MPFA 3MW3A 2ZCWA 4P5HA 2DFBA 3B93A 3WDUA 5DDJ3 1NLSA 4LA3A 1XNCA 2PQQA 5EYYA 3WT3A 1YI9A 2ZAHA 4IEVA 5T5PA 2A71A 1QJX3 1UU4A 2BEOA 2BVVA 4UBHA 3CJXA 2YPJA 4ATFA 2P37A 1QNYA 5EXOA 4FT8A 4YGEA 3M7AA 3ZYPA 2DTYA 3S30A 3L2HA 4Q4W1 1GZ9A 1FI2A 1K5MC 2Y38A 5TSWA 1EV11 3USUB 1IS6A 1MR5A 1S0CA 2R32A 3OYWA 4AGVA 1BYHA 2RS12 4O9EA 5FBZA 1A8MA 4LBKA 2ZHKA 2UYBA 4D69A 4UW4A 1NA1A 1YWKA 1RMU2 5BNOB 5A3MA 2JG8A 2GN3A 1J59A 1RVF3 1OKQA 4YVSA 1HRV1 1JBCA 2I45A 1H2MA 2HWF2 3WV6A 2O8OA 3AKQA 1EPWA 1OQEA 2XWBB 2PHUA 2ENRA 3UV9A 5GZGA 3RSJA 2ZABA 3V0BB 4L97A 4XF9A 3S0MA 1JXNA 3AMQA 5LK7B 1S55A 2WNVA 1R082 1LGNA 4AF9A 1PO13 5DUUA 1QHDA 3AZVA 1UL9A 1AF9A 4E2QA 2GDFA 2ZS6B 4ORFA 3HMYA 2TNFA 1RMU3 1S0JA 1DZQA 4I0AA 4IV1C 3WR0A 2JG9B 2VOWA 1S0BA 5EFUA 1WBLA 4BIFA 2R042 1NY71 2XJPA 3LSDA 4QU2A 5HBAA