1MVEA

Crystal structure of a natural circularly-permutated jellyroll protein: 1,3-1,4-beta-d-glucanase from fibrobacter succinogenes
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
243
structure length
243
Chain Sequence
MVSAKDFSGAELYTLEEVQYGKFEARMKMAAASGTVSSMFLYQNGSEIADGRPWVEVDIEVLGKNPGSFQSNIITGKAGAQKTSEKHHAVSPAADQAFHTYGLEWTPNYVRWTVDGQEVRKTEGGQVSNLTGTQGLRFNLWSSESAAWVGQFDESKLPLFQFINWVKVYKYTPGQGEGGSDFTLDWTDNFDTFDGSRWGKGDWTFDGNRVDLTDKNIYSRDGMLILALTRKGQESFNGQVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Truncated 1,3-1,4-beta-D-glucanase
publication title Crystal Structure of a Natural Circularly Permuted Jellyroll Protein: 1,3-1,4-beta-D-Glucanase from Fibrobacter succinogenes.
pubmed doi rcsb
source organism Fibrobacter succinogenes
molecule tags Hydrolase
total genus 54
structure length 243
sequence length 243
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2002-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1mveA00
4XHBA 5EXOA 4FPLA 3T1MA 1LEDA 1N1YA 2EXHA 1SBFA 1AF9A 3OJBA 1C1LA 2ZMKA 1G9CA 4K20A 1C4RA 2EXKA 1DQ5A 3NV4A 2P2KA 1CONA 5HCFA 4UW4A 2WSVA 5FRAA 1BQPA 4IQPA 4Q1PA 5HCAA 3N36A 3L2YA 1LECA 4NOTA 2VH9A 2ZHNA 3HR9A 4YFWA 5GLWA 4LBMA 5CNAA 3O0XA 5E89A 4ZKTB 3I4IA 4Q26A 1BKZA 3WDUA 2JDZA 3IN9A 3V0BA 2ZGQA 1LTEA 4YW3A 1CJPA 2CYFA 1GZCA 3WDXA 1W6QB 1QOTA 3ZXJA 4LBOA 1FNYA 3UJOA 2ZHLA 3SISA 3BTAA 1SBDA 1H9PA 1ULDA 3WOGA 3NV2A 5LK5A 3VKLA 3AFKA 2A6WA 2A70A 1MR5A 4XZPA 2AH2A 2GALA 2CL2A 2W08A 1QU0A 1S0GA 4MYEA 4P9WA 2DUPA 1WLWA 4WZFA 1AX2A 5CAZA 3RSJA 1N3QA 5JMCA 2V5YA 1SACA 1Q8PA 1TEIA 3ZXFA 1WLCA 2YXSA 1YRZA 3V65A 3RMYA 2DU0A 3APBA 5T54A 2NN8A 1AXZA 2YY1A 5EWSA 1DYPA 1QGLA 1SLLA 4LBKA 3RMXA 1G9DA 3FLTA 2NP0A 1WD4A 3SNMA 2R1BA 5JOYA 3M3QA 1ENRA 3LSEA 1FATA 4WVVA 3A0NA 2GMEA 4AGVA 1W6QA 1BZWA 1S0IA 2EXJA 5GLUA 1JN2P 1G9FA 2E53A 3OPZA 4JRAA 3ZYRA 3ZSMA 4HANA 1PZ9A 4XTMA 3VKFC 3WCRA 1J1TA 1GZ9A 3ZXEA 3ATGA 1EPWA 4WV8A 3TB0A 2DVFA 4DFSA 1UL9A 2D7FA 4Y24A 1Q8SA 2UURA 5T50A 4HL0A 2YV8A 2DVBA 4SLIA 1DQ4A 1CIWA 2UWAA 5GLVA 2WSUA 4XBNA 1AZDA 5E88A 1JUIA 1JYCA 3KM5A 4Y1XA 1SCRA 4CRQA 2GMPA 4XTPA 2ZGNA 4FPCA 1LOBA 1XQNA 2E7QA 5FREA 2A71A 4YM3A 4ATFA 3H0OA 2JECA 1GNZA 1LHWA 4FPHA 4XBQA 4YLZA 5JOZA 1FV3A 1C1FA 3A4UA 5GZFA 4FPFA 3DUIA 1WLDA 2XG3A 3N35A 2DWRA 4GA9A 5HCBA 1LOFA 2DUQA 5IK5A 2ZZJA 4OZXA 1IKPA 2A6XA 4YM0A 2DVDA 3AYDA 1DQ0A 4ISQA 2P3KA 3AP7A 4YGDA 1WUVA 5GALA 4FVVA 5DUUA 2E7TA 3AP6A 1UN1A 3M2MA 2ZABA 4XMIA 3INAA 3N3HA 1KRIA 1LJ7A 3FUOA 3IKWA 5T55A 1LGBA 3TAYA 3WHUA 3OYWB 1MVQA 2EAKA 2W68A 1LULA 1DIWA 4Q27A 2D3SA 1CVNA 3ENRA 4FQZA 4FOVA 4K21A 3WG1A 5KXDA 1I1EA 4FOWA 2WLQA 2ZGSA 4BLIA 3WG4A 1LGNA 2RHPA 3RS6A 1YYNA 4R9CA 1IS5A 2DYCA 4XJ9A 4M3CE 4XJUA 5T5JA 3IM0A 1H30A 3WVJA 1Q8VA 1SFYA 5T52A 5DUXA 4L8QA 2CTVA 1I3HA 2OW4A 1NLSA 3AYEA 4FP3A 1CESA 5SV8A 2PELA 2AR6A 1ULCA 2EIGA 4GALA 2A6VA 1KDMA 1QNWA 1Y7BA 4YGCA 1W6PB 4ZXKA 3V0BB 1V00A 1A8DA 5IK7A 5DZGA 5E8AA 3T1LA 2HYKA 4XYXA 3AYCA 4YZ3A 5KXBA 3MW3A 2FHRA 4K1YA 4PF5A 4BOWA 2H0BA 3AP5A 3GNEA 3AZVA 3M1HA 1Q8OA 1KJLA 5DZEA 4AWDA 2AENA 3RQ0A 1G86A 2DUOA 1WW5A 4RA0A 2A75A 1RIRA 1V6MA 1WW6A 2GNDA 2YZ4A 4UW3A 4XBLA 5BYNA 3RG0A 4BMEA 1SCSA 3WDTA 1GICA 1RITA 1H9WA 3M3EA 4XHXA 3VV1A 2I2SA 5H9RA 4XJAA 3OGGA 2A3XA 1ULGA 1FX5A 2D6KA 3R4UA 4P9YA 3AZXA 2R16A 1W6PA 1ENSA 3D6EA 3PVNA 4R9AA 2ZGMA 3BIWE 2V73A 2OUHA 4YW2A 2WQZC 1V6KA 4LBJA 3ILNA 1S0CA 4AGRA 2LTNA 1N1SA 3M3OA 3ILRA 1FV2A 1VLNA 3UK9A 1MS0A 1UZYA 2ZGKA 1VALA 1GZWA 2ARBA 4C1XA 1CQ9A 3U4XA 2GNTA 5F9TA 3LSDA 2ZHMA 1BXHA 4AVSA 5DXDA 4AYUA 4K1ZA 3AP4A 2Z42A 4RL7A 2A5ZA 4P9XA 2A3YA 3ILFA 4Q8KA 1F9KA 1D2SA 3PVEA 1W0PA 1DBNA 1AX1A 3SH5A 3WHTA 2BQPA 3BODA 1U0AA 3A0KA 1UKGA 2OUJA 5DZFA 1MS9A 2ENRA 4GWNA 4YW4A 2GN7A 3SH3A 2ZA9A 2ZGUA 1VIWB 1R1ZA 4ISRA 1LCLA 3USUA 3WUCA 4D69A 2ZGTA 1F5FA 2A7AA 4Y1UA 1URXA 3W59A 3SITA 1IKQA 2CNAA 2VW1A 4XMAA 1NXD1 1CPMA 1SBEA 2GDFA 3N7MA 5CB7A 1IS4A 4XIKA 2XB6C 1C57A 4ITCA 2UU8A 1SLCA 4DQAA 2WT0A 1BJQA 1X50A 4BQ1A 3LCPA 2VUAA 5DUVA 5CBLA 1APNA 1UZZA 4YZ1A 1MS3A 4KBBA 5F5QA 4BM8A 3WLUA 4U36A 3AZYA 3WG3A 1GLHA 4YM1A 1DQ6A 4YZ2A 2YMZA 4FOYA 3ASIA 1KQRA 2VU9A 4Y26A 2EALA 3WCSA 1LENA 1LOGA 3WG2A 2DV9A 4Y22A 3JU9A 4YW1A 1HQLA 3OBRA 1PZ8A 1YI7A 3B3QE 3O12A 2WKKA 2ZGOA 3B69A 3WDVA 5EYXA 5IK8A 4M01A 1IS6A 1G9AA 4XOGA 1LODA 1DYKA 2WJSA 5L73A 2VW0A 2VXRA 3Q9OA 1N1VA 1OQ1A 1MS8A 2PHTA 1UAIA 4XIOA 1YXWA 5DG2A 1OFSA 1WCSA 2A3WA 4W65A 3VUOA 3MEPA 4XJWA 3POYA 3OBTA 4U2AA 4YM2A 2ZGRA 4R9DA 4AGGA 4XILA 4YZ4A 2E51A 1JHNA 4UW6A 1O4ZA 1LU1A 1RINA 2ZGPA 1JYIA 4PQ9A 1DQ2A 1S1AA 4Q1RA 4Q2FA 4Y20B 1LOCA 4FP2A 1CN1A 1JW6A 1LOEA 1ENQA 1MACA 1A3KA 5H9SA 5T5OA 1WW4A 3POWA 2GNMA 3WNXA 1DLLA 1ULFA 2D6LX 3C2UA 1GKBA 3FUQA 3RRDA 1AXKA 2ZMNA 3B00A 4YZ5A 4UW5A 1Q8QA 2EF6A 1LHOA 2UWBA 1KITA 3HN1A 3ZSJA 1Z0HA 1VAMA 3R05A 1LHUA 3D4KA 1WD3A 2KM2A 4FPJA 4NO4A 2ZACA 4YG6A 1LU2A 3OY8B 1S0DA 3QLQA 2NYYA 3N7KA 1WW7A 3UL2A 3IPVA 4PBPA 3AZWA 1GZWB 2NMOA 1AXYA 1V6NA 3NV3A 1GV9A 1GYKA 2GNBA 2DVGA 3UJQA 1JXNA 5GZGA 1ULEA 4Q8LA 3AJZA 3T2TA 1QOSA 4LBQD 1QOOA 1WBFA 4Y20A 1FYUA 4YG0A 2VY0A 2Q5TA 1QNYA 3PMEA 2DURA 3M3CA 3I8TA 1YIFA 3ZVXA 1DHKB 4AVTA 1N47A 1W0OA 1QF3A 5CA6A 1HQWA 3WUDA 2D6NA 5GZDA 4M3CF 4DRRA 3V0AB 1CPNA 4FPOB 1AVBA 1MS1A 3USUB 4M3CB 3SLIA 2R0HA 4P14A 1N3PA 2P34A 1SLTA 2JKBA 1LESA 3OY8A 1LHNA 1Z78A 3QCWA 2PHWA 2JE7A 2CY6A 1LOFC 1WBLA 2PHXA 2ZGLA 4LBQB 3VKOA 1GNHA 2JJ6A 1D0HA 3ZSKA 5IK4A 4DPNA 2P3IA 1V6IA 2C9AA 2YROA 3IMNA 4BLJA 5JOWA 4Y1VA 1IS3A 1V6LA 3NV1A 4YGBA 2WT1A 2JD4A 2AREA 1JBCA 1V6OA 1W6NA 3R4SA 2CWMA 4PBOA 3V0AA 2D6PA 2W52A 2ZBJA 3ZYPA 1ONAA 4M3CA 1S0BA 3VKNA 1JOJA 2EXIA 5GLZA 4XJ8A 4Y1YA 1GANA 1O4YA 4Y22B 2W39A 4GWMA 3POSA 1V6JA 5GZEA 1CR7A 2A6YA 4LBQA 5H9QA 3AJYA 5T5PA 1W6MB 4TZDA 1G8WA 3N7JA 1HKDA 1S0FA 3AP9A 3N7LA 1DGLA 1MVEA 3ZPYA 2PHFA 4H55A 2D3PA 4BMBA 2DVAA 3AXEA 1ZM1A 1FAYA 4F83A 1HDKA 2PHRA 3B9CA 4Y1ZA 4FPYA 5H9PA 4AVVA 2D6MA 3O0VA 4XXAA 1N3OA 3FLPA 4XDQA 3MW2A 3W58A 5GM0A 3O0WA 2FMDA 4FPEA 4CTEA 1MZ6A 1DFQA 2VW2A 4GXLA 1S0EA 4TYSA 1ZA4A 5IT6A 2WT2A 1QDCA 2R1DA 4LBNA 1DQ1A 2E6VA 3PVOA 5GLTA 1MS5A 1QMJA 2DTYA 5T5LA 4FOQA 1BYHA 2ARXA 1LEMA 1UPSA 3AZZA 1W6OB 1MZ5A 1W6MA 3AYAA 4GKXA 2DU1A 2PHUA 1HLCA 1GSLA 1Q56A 1G9BA 2UWCA 3AX4A 3WZ1A 2R0FA 1AX0A 1UX6A 3FLRA 1OKQA 1A78A 4FPKA 3VKMA 2DTWA 1MS4A 2ZAAA 2AYHA 3BOPA 2D3RA 2G4IA 3ZSLA 5EYYA 3PJQA 3FFZA 4ASMB 4DS0A 1SLIA 2ZHKA 2D6OX 3CNAA 2ZMLA 4XXPA 2TEPA 3IPVB 4M00A 2AGSA 1YO8A 2CWSA 2ERFA 5KXEA 2A6ZA 3ZXKA 3KQRA 3D5OA 1QKQA 1N1TA 3NWKA 1FNZA 1KDKA 1SLAA 3MW4A 4I30A 4DRVA 3AK0A 1W6OA 2P37A 2SLIA 3JUUA 4XE9A 3GALA 4YG3A 5DG1A 5JLVA 1KJRA 1LGCA 1LHVA 2NZ9A 3WDYA 2GN3A 1UMZA 1AJKA 1LOAA 4Z8BA 5KXCA 4CZSA 4BPZA 4JCKA 1G7YA 2NM1A 3O5SA 4FQ4A 2SBAA 3DGTA 1DZQA 2R49A 5JVVA 1QDOA 2P3JA 5DUWA 3V64A 4XJZA 4GKYA 2WNEA 1S0JA 2ZKNA 4C1WA 2D43A 1GBGA 2B7YA 3SH4A 3ZXLA 4ATEA 2JE9A 3FBYA 4FPGA 2C5DA 5GJ6A 4WVWA 2ES3A 1B09A 4LBLA 4PCRA 4YGEA 3AXDA 2LALA 3WDWA 2GMMA 2D44A 1VAVA 2AUYA 1AJOA 1F31A 3WV6A 5GZCA 5AVAA 4YFZA 3HMYA 3B01A 4R9BA 2OVUA 1SLBA 1IOAA 1PZ7A 3OYWA 5JDBA 5IUQA 5JOXA 4JC1A 2NMNA 4YW5A 3MPPG 1W6NB
chains in the Genus database with same CATH superfamily
4OULA 2B42B 2ILMA 3T1MA 3ZFGA 3OBZA 1UWWA 1VBA3 4AHYA 1NZIA 4MV2A 5JSPA 2VOXA 4GH4A 4KWJA 3VBUB 1DQ5A 1AL0G 1XOYA 3CDZB 1JYVA 1CONA 4IEXA 3SMHA 5LB6A 4I01A 4Q1PA 2G9FA 4JKLA 3RFRA 5HCAA 3L2YA 3T0AA 2W95A 2X8KA 4KU7A 4L99A 1MZFA 4P9JA 1Y9GA 4LBMA 5CNAA 5E89A 4ZKTB 1RHI2 5ISLA 1MQTC 3BOWA 3WDUA 3I59A 2Z69A 3MIGA 4UFMA 3V0BA 3SKVA 1LTEA 1WA6X 2QDRA 3O1RA 3PJYA 4Y5SA 3LFIA 1CJPA 2IZWA 4B29A 2CYFA 3KSCA 4FI9A 1W6QB 4CCJA 2ZHLA 3SISA 1D7PM 1H9PA 3WOGA 1DCSA 2ORZA 5FXZA 2XVGA 2PLV3 4OVEA 5DAPA 4D6SA 5AC91 3H50A 4QGLA 2A70A 4XZPA 2GALA 3M3IA 2W08A 4CDXC 4IV3A 4QM8A 1IG0A 2WAAA 5CAZA 1Y4WA 3JD73 3RSJA 4UFKA 4A4AA 4UBHA 1COV3 5C3PA 2VBBA 3ZXFA 2BGOA 5A3UA 3V65A 3RMYA 2NN8A 4E4ZA 1RB8G 3MLJA 5EWSA 4DOUA 2RDSA 2YDEA 3J8F3 2J1RA 1CAXA 5CFDC 2B5HA 1VBB3 2W87A 3I2KA 2DF7A 3AKSA 3M7AA 4HBNA 4AG4A 5JOYA 3POJA 1RUD3 3QH6A 2V72A 2ZPXA 5FMDA 4Q0PA 5GLUA 2CAUA 2ZX1A 1YQ8A 3I2HA 3VKFC 4CU6A 1JYNA 3WCRA 3BYWA 1BEV1 3ACIA 1J1TA 4Q4X1 3ATGA 1EPWA 4WV8A 1JTZX 3H3UA 2WNOA 2D7FA 1WMFA 3TRSB 4HL0A 2FD8A 4SLIA 1NCRA 5GLVA 3P1IA 1V0AA 2PQSA 3MICA 5I0SA 4GIQA 3PURA 2DBIA 2OT7A 2W5FA 4XBNA 5A6QA 3BTZA 5E88A 2OQ6A 3KM5A 4Y1XA 1SCRA 3DPRB 2VNOA 4Q0QA 3LEIA 1BBT2 4K40A 4N43C 3BGAA 4IEVA 3ZMNA 2A71A 4A6SA 4ATFA 2VQAA 3GM8A 4KL1A 3A7QA 2ZZQA 4Q4Y2 2XDVA 3R4DB 1FV3A 4QPWA 5CG9A 1C1FA 5A7WB 2VTXA 2JIGA 4K9SA 4N7IA 1C8M1 1AUYA 3ST7A 2QQLA 2WUHA 4S2DA 2ID4A 1OLMA 1YQ6A 5AFEA 3VBSA 1AR73 2P3KA 1JU4A 3AP7A 4YGDA 4Z82A 2NQYA 2JG9B 1PVC1 3AP6A 3JBG3 1PO22 3M2MA 3INAA 4LOSA 4E9KA 1LJ7A 4CU8A 3IKWA 3J9SA 1J3RA 2QQMA 5FYHA 1SDWA 1MVQA 4L0PA 2EA7A 1AR92 3CJIB 1CVNA 5KXDA 4FOVA 5K4LA 2R061 3N9NA 4HKLA 1D4VB 4BLIA 1AR82 3WY6A 3HN3A 3NJVA 3RS6A 1J1LA 4PI2A 1MPXA 4XDOA 2DYCA 4R8HA 1RUF1 1WCDJ 4XJ9A 3SKJE 4M3CE 3G6JB 3H7YA 2VMFA 3IM0A 1K3IA 3ZN4A 2WQ8A 1SFYA 3ZOIA 4N7UA 1QJFA 2CTVA 2ZEZA 3CZJA 2C6SA 4XURA 2WNVB 4BYYA 5FLIA 4NPRA 4QDQA 4L2NA 4Y33A 5B4XA 4Q4V2 2ORXA 5AVPA 2HWB1 2PELA 4LLOA 5C5UA 4HT1T 1QNWA 1Y7BA 1MEC1 5ANQA 4B4RA 3RVHA 2J1AA 3PUQA 5IK7A 1TMF2 2HWE1 3T1LA 4CXXA 2HYKA 3MW3A 4MHRA 3PUIA 4ZS2A 4EWEA 1AL22 1UU6A 3A21A 4QB1A 4A6OA 5LEKA 2CGPA 1YFUA 3WNLA 3AZVA 1Q8OA 5DZEA 3W5NA 3VZLA 4AWDA 4PLMA 4ES9A 2DUOA 2RMU1 5E16A 3Q8FA 1OFNA 3KVBA 2H6CA 2VZOA 1V6MA 4KH9A 1OKOA 1W8NA 4UW3A 3GJAA 4GB33 4XBLA 3SITA 1ZBE2 4BMEA 1SCSA 3CIHA 1RITA 4LK6A 1LR5A 4L92A 2WNUB 3D0SA 1QQP3 2WLPA 5FZ8A 5ABJC 4UFLA 5FZLA 4M4PA 5FXVA 1ULGA 2CU5A 3AZXA 2R16A 1W6PA 2WO2A 3WX5A 4XFIA 3BIWE 5FR3A 2J42A 1GNYA 3GHNA 1YFWA 2BNOA 1V6KA 2BJSA 4LBJA 4HLTA 4YW2A 2WA3A 2LTNA 5FYMA 1KFUL 1N1SA 3LB9A 3M3OA 3ZFFC 4BQ5A 3LF7A 1FV2A 1NA1A 5A6XA 5D8AA 3U4XA 1JI6A 5L9VA 4AVSA 1BXHA 4AYUA 2VTFA 5DXDA 3IDBB 4ZU5A 2R041 3ES4A 4W6WA 4PF1A 5FY8A 4AEJA 1UY3A 5DAVA 5JR7B 2HLEA 1AYM2 2YC4A 4RL7A 1OI6A 2J1UA 2WS91 1QJU3 3ILFA 3RZLA 3PVEA 3SQOA 1W0PA 3SC7X 1RL3A 5FP7A 1CX1A 3A0KA 2GP3A 2WYSA 1MS9A 2QQVA 4GWNA 2FQPA 2OKXA 3VL8A 3USUA 3WUCA 1K12A 1TNRA 2ZGTA 1NAEA 1XE0A 4UYBA 1R083 5FFOC 5FY9A 1RHI1 2R072 2CNAA 2VW1A 4XQWA 2Y33A 4GWJA 1CAWA 5B4NA 1MQTB 4J6GA 5D21A 3FC0A 4XIKA 1FPN1 1UQXA 4NRMA 1SLCA 4OMCA 5LRRA 3BUCA 3GZAA 5DAWA 1R1A2 2GC1A 4XCBA 4Y4RA 4IV1A 3ACGA 4QGMA 5DAXA 3ACFA 3N9LA 4IETA 2VXJA 1H2NA 4BM8A 3U14A 4AQ2A 1W06A 1GLHA 2KA3A 5J7MA 4DY5A 4HPKB 4JV4A 2UYBA 4FOYA 1GOFA 4B4PA 2BWAA 1KQRA 1X9TA 3W9AA 3JU9A 4QU1A 3OBRA 5JCTA 2R32A 5C7GA 3SHRA 3U78A 3VBOA 4WM7C 2CGOA 4XOGA 5FLJA 3C3VA 2QE3A 1T6GC 2GH2A 4Q0UA 4AFDA 4FBFA 3MV01 1R091 3AB0A 3FE5A 1N1VA 4IDZA 1MS8A 2E31A 2XLAA 3S7IA 3ME2A 1W2TA 2YBPA 4UXAA 4XIOA 1WMXA 4HVOA 4FAHA 1OFSA 3VBRC 1W3XA 2QJVA 1KGYA 1UKRA 2JG8C 4QKBA 5JXJA 2CDPA 3ZPOA 3ZXGA 4MXWA 4YZ4A 3OGVA 3H3ZA 2W47A 1JHNA 3IAQA 1LU1A 4EJRA 5JXHA 3BIEA 4ZONA 1BBT1 5F2WA 3NKTA 3KHCA 1JW6A 2JB4A 4IGOA 3K77A 1WW4A 1C5IA 1XE7A 4N43B 3WNXA 4AVCA 1AR62 4BK5A 1XB9A 1XXNA 3RRDA 1AXKA 2ZMNA 5FYVA 2LM3A 3H8UA 3WQBA 1STMA 4LQRA 1BLZA 1Q8QA 2EF6A 1KITA 3HN1A 3ZSJA 3R05A 4CCMA 4D6RA 1WD3A 4FPJA 4CSWA 1LU2A 1JZ4A 3OY8B 1S0DA 3Q8AA 4D8MA 1WW7A 1PO21 3IPVA 4CP9A 5FMBA 2VZSA 2W92A 2HYXA 1GZWB 1Y9QA 2WR9A 3AZWA 3D3AA 3NV3A 3FWEA 2GNBA 1RUG3 4QPIA 1JXNA 3UJQA 3P6BA 1GP5A 1GP4A 1ULEA 4XACA 1QOSA 1D4M1 4MGTA 1DGWX 1AYN2 1FYUA 3DEMA 1OVPA 4GD4A 4MGIE 4NAOA 2Q5TA 4AI2A 2TBVA 1AR81 2CDOA 1I9RA 1YIFA 3ZVXA 1A6CA 4LKSA 1W0OA 2WQ4A 3IIIA 4OUSA 1DYOA 2RS52 4O9EA 1CGPA 1MS1A 4M3CB 5CKNA 4P14A 1N3PA 4NUBA 2P34A 4N53A 2Z4FA 2JKBA 3KQ4B 4AEKA 4ARYA 2PHWA 1U12A 3G7DA 1LOFC 4QAWA 1UY0A 4QDRA 3VKOA 2JJ6A 5IK4A 1TMF1 2KD7A 1PGL2 2W1QA 2JIJA 3A22A 4BLJA 4H14A 5JOWA 1AL21 5FPBA 4Y1VA 1H1AA 2HWD3 1UYPA 3K3OA 2QQKA 2OPWA 5IVVA 2MEV3 3NV1A 3O1OA 2WT1A 2JD4A 2HWF2 1W9WA 1E5HA 3QBQA 4BB3A 2XUMA 5J48A 4YPJA 1V6OA 1YJKA 4I0BA 5BNPA 5J36A 3AKQA 3OTFA 1F5JA 3V0AA 4LTAA 2Q4SA 1ZBE1 3JZVA 3USSA 3VBUA 3ZKYA 1VBD1 2EXIA 3DN7A 2PYTA 3HQXA 4Y1YA 5EP9A 5GKAC 1O4YA 3HT1A 2W39A 1BVVA 1GU3A 2ZTNA 4GWMA 5G05L 2X29A 3POSA 2OPKA 5ABJB 4G3YC 5GZEA 4I0WB 5EV7A 4D6QA 4LBQA 5H9QA 1RUH2 2NLRA 4AL9A 3W5MA 1ZZ9A 4TZDA 4EN7B 2MEV2 4OI1A 2FCVA 3N7LA 2PHFA 2VZRA 4BMBA 2W9XA 1SQ4A 1F35A 4HN0A 2E7AA 2V4VA 4ET7A 1J58A 5DDJ1 2VZPA 2D6MA 3ZFFB 3QACA 1RUJ3 3MW2A 4EN9B 1PM7A 2JXAA 3L2HA 4FPEA 3DKQA 4DINB 4E2SA 2Y6KA 3HPNA 1MZ6A 1DFQA 1DF0A 4QB6A 1Q43A 1ZA4A 1K5MC 4E2QA 2WT2A 1QDCA 1VP6A 2R1DA 2E6VA 4LEJA 3SEEA 5GLTA 4D7TA 4HSJA 4Z92B 4PDWB 1QMJA 2O14A 4CDQA 3VZKA 3PUAA 4E4HA 3S6PA 1X9PA 1MZ5A 5KWRA 1W6MA 2JDKA 1O3QA 5A3MA 3O1SA 3VD4A 2FBEA 1HLCA 1GSLA 5ACA3 1G9BA 1QH6A 5I8YA 3WZ1A 4FPKA 3U10A 1JODA 2ZAAA 1W3VA 4C90A 4CUBA 3BOPA 3LA7A 1S4CA 2WBKA 2VCAA 4AHXA 3KF5A 1RUC3 4KWUA 1GFF2 2BU9A 4ASMB 4DS0A 1ZRCA 4CUAA 4AFCA 2VOVA 2ZMLA 4XXPA 2AGSA 1NUKA 5A70A 5J3UA 1OF4A 1KD7A 1PO13 1R1A1 4AFMA 1QKQA 5EJ1B 1H8TB 1O4TA 2ARCA 1E5IA 1VBE3 1XPWA 4I30A 1ZA7A 3JB8A 3JUUA 4YG3A 2H0VA 3GALA 2RDQA 2ADEA 3K4AA 4Z8BA 1LOAA 3ZM8A 5KXCA 1GP6A 2FDGA 5FQ0B 4JCKA 3ZMOA 3MBWA 2AEZA 3O5SA 5C8CC 3MFCA 4HKWA 2KXLA 5BNNC 2R49A 2XXZA 2YB7A 4YVSA 4XJZA 5A7SA 1JZ3A 2BERA 4HG6B 1GBGA 4OUMA 2WZEA 1ND2C 2XJVA 4F7ZA 2JE9A 4IE6A 3K4DA 4IE7A 2YBKA 1YFYA 4UWDA 1YEWA 4WVWA 4YGEA 5C8WA 1UXXX 3K75B 2UY9A 2LALA 2MNGA 4QPGC 1EV12 2JG9A 2QKDA 1CJDA 5A7QA 1REFA 5L7OA 3GGLA 3HMYA 5AC93 3POIA 1NQJA 1PZ7A 3VBHC 3VBRB 5JDBA 5K8SA 5JOXA 2FZ2A 2J1TA 4JC1A 2JG8B 4QXKA 3VB9A 2Y34A 1ZZBA 3GF6A 5KHJA 1QWRA 3CJIA 4PJYA 1W6NB 1PK6A 3TB0A 4XHBA 5EXOA 4MSVA 4FPLA 3RZZA 3WQ0A 2EXHA 4DXZA 3B94A 1SBFA 2OXBA 1AF9A 2OZ6A 3J7NA 1C4RA 2EXKA 4AQTA 1OA4A 2P2KA 1HRV1 2YYOA 4JDMA 2GAUA 4CEYC 1HJGA 4UW4A 5JI7A 2WSVA 1YQCA 2J1SA 2RVAA 4FXGB 1HB2A 1JH5A 2XOMA 4NWWA 2PHDA 3PU3A 4PIZA 4XEZA 2RS11 1QXJA 4Q26A 1BKZA 2WN2A 2JDZA 1C5HA 1BEV3 1VRH3 3ROUA 2ZGQA 2BOIA 4AE2A 2YHJA 3R6SA 1OMIA 4LO4B 4OQ9A 1RUE1 1US2A 2WO3A 5CZKA 4DNYA 5C9AA 4WBBA 3BTAA 5FZ3A 3FJSA 4NHLA 5LK5A 3VKLA 5FOJB 3AFKA 2B9UA 1VBC3 3KCCA 4PQQA 1J59A 1MR5A 1WA4A 2AH2A 2WFF3 3E6BA 1RXFA 2V5DA 2J7MA 2RDNA 1F2NA 2ADDA 1SACA 1Q8PA 2C1FA 2RS33 2WNUA 2YXSA 3E5QA 2WZR1 3WEZA 1HB4A 2RS51 1FMD2 1DG6A 3APBA 3ITQA 1T6BX 2RG4A 4X8PA 5FYTA 1C8NA 2YY1A 1W28A 1DYPA 1SLLA 4LBKA 4KI5M 3TN92 4XCAA 1W2OA 1QXPA 2D93A 3FLTA 3PUHA 3RYPA 3H8OA 3LPGA 1ENRA 1PVC3 1W9SA 3NJXA 2GMEA 4LIVA 4A42A 1HRI2 2JICA 4NR1A 3MGUA 2EXJA 3VGIA 4COUA 2WN3A 3NAPA 4BZ4A 3TEWA 4HKOA 3OPZA 1QJX3 3RI8A 3ZSMA 5FZHA 3KV9A 5FBJA 5K0UB 5CFCB 2BNMA 5IVJA 2D98A 3ZXEA 3FHIB 2AACA 2UURA 4FFIA 3ZYGA 2DVBA 2GU9A 1WCKA 1CIWA 2UWAA 4O9GA 5F5CA 1XYNA 4MXVA 1RUF3 4BDVB 4AEDA 3L9JT 4BXFA 3FL7A 4LR4A 2XKPA 3FHAA 4CRQA 5CYYA 2ZGNA 2WABA 1LOBA 4CXYA 1ZBA2 1CWPA 1OF3A 2E7QA 2Q8EA 3H0OA 2JECA 1GNZA 1LHWA 5C6CA 3HD8B 2HWB3 1NZCA 1XNAA 4E27A 5GZFA 2WYFA 2XG3A 3PNAA 1NY72 4MX3A 4YNIA 1QJY2 1ASJ1 1MEC3 5FWJA 4E8CA 4GA9A 4BQ4A 2HJIA 2DUQA 2PFWA 2VVEA 2XJRA 2XR4A 4I02A 5JZGC 1NXMA 4YM0A 1OHFA 1RVF3 2ET1A 2Q30A 2VVDA 4I2OA 4ISQA 4L9BA 4CDWC 2FDJA 5EFUA 4CUCA 2W2IA 4KWLA 1NCQC 5FJHA 4XMIA 3RWKX 3N3HA 4OQ8A 1KRIA 2IVIB 1W8FA 3UKVA 4QQOA 3WHUA 5JXIA 4P9IA 3ETQA 1PMJX 5BNPB 1I6XA 3O14A 3BN6A 3OEBA 3K3NA 2D3SA 4DXRA 2HEYF 2WO7A 2VCMA 5C71A 2ZGSA 3FZ3A 1O5LA 3WG4A 4XVHA 2RHPA 3DXTA 4I09A 2BFUS 1TME2 1IS5A 1BK0A 4LE3A 1JYXA 4FT8A 5LZ6A 3IWZA 5T5JA 4I0AA 1Q8VA 1QY4A 5EHDA 4PIYA 3P5BA 2ETEA 3CEWA 4QQPA 1I3HA 4J25A 4K3UA 2X5IC 2OW4A 3AYEA 1SEFA 1VR3A 2Y26A 3THCA 4YW1A 3SCGA 1UYZA 1CESA 3F2ZA 4JGYB 5FYZA 5SV8A 3TNPB 1ULCA 4GALA 4LKDA 3U4SA 1VB4A 2A6VA 2CV6A 2QVSB 3DV8A 3MLLA 3IBMA 2BBAA 4LO5B 5A7PA 5SV5A 3I2JA 2R043 3GZTB 4YZ3A 1POQA 3ZSEA 5IFPA 2XBO3 3Q8CA 2Q8DA 4K1YA 3MIEA 5G04L 2Y6LA 2H0BA 3AP5A 3GNEA 1O6UA 4KG0A 5FMOL 2WS93 3H1WA 2AENA 1UOFA 3RQ0A 1L7QA 3I2DA 3ZIXA 1MZEA 4ONUA 2FZ1A 1FOD2 4G4FA 3RG0A 2X10A 3MV11 3TEYA 2H6BA 1HIXA 4NPLA 5I0TA 3LD8A 4D7SA 1FX5A 3R4UA 4IE5A 5C8CB 4IE0A 5BNNB 2YU1A 4QHBA 3D6EA 3PVNA 4R9AA 4QXBA 2ZGMA 2W1SA 1VBA2 1FPN3 4FSJA 1W8WA 3ILNA 5A6ZA 3VDDC 5C33A 3WP3A 1ND2B 4H3WA 5IVCA 3IIAA 1VLNA 3UK9A 1MS0A 2C26A 3UT0A 4QXHA 3UESA 4LO7A 1GZWA 3ETPA 1CQ9A 1S55A 1UCXA 3QD6A 4QPGB 4XFAA 1OH4A 2FCTA 5J1XA 2VMDA 1W8UA 1O59A 4W6YA 4IERA 1OH3A 3OPTA 4Q4W1 2V09A 3LEKA 3VBHB 4KMQA 4CE8A 3N9PA 1POV0 1DZTA 2FMYA 2F4LA 4WZCA 3PIGA 1DBNA 1PGW2 2QQPA 4IEOA 2BQPA 1EAH1 1U0AA 4HK9A 2VCCA 5DZFA 3OUJA 2QQOA 5LK7B 2PLV2 4CEYB 1VIWB 3M8LA 4ISRA 1LCLA 1I5ZA 4DIQA 1R093 1RGSA 3FFQA 1JUHA 3AC0A 4JX0A 5C3QA 4K7JA 1IKQA 3EHKA 4IESA 4O7XA 2RR13 1LNSA 4UF0B 1SFNA 3JD72 4XMAA 5I93A 1COV2 1SBEA 2ZEWA 5CB7A 3N7MA 4Q0SA 3VN4A 1OOPC 3WW2A 3HNBM 5FKCA 4ITCA 5BNOA 1IPJA 3LQCA 4GULA 5C4WA 1C3HA 4CP2A 1X50A 2DCZA 3J8F2 3A23A 3RPQA 4BQ1A 3LAGA 5JIUA 1NG0A 1VBB2 5CBLA 1RUI3 1X82A 2EIBA 1UZZA 2UY8A 5CG8A 4HXCA 4KBBA 4NIHA 5CKQA 1RUD2 3NW4A 1GOHA 3AZYA 1XRUA 4XUTA 1DQ6A 2R7EB 4RR3A 4YM1A 4CCLA 2JD9A 2VOTA 1KS5A 1O7FA 4WM8C 4CCEA 2VU9A 2QTWB 4Y26A 4Y5TA 5FZAA 1VMFA 2V4AA 5KHIA 1LOGA 3WG2A 2FDIA 4GH4C 4HOOA 1HQLA 4HN1A 2XH6A 3B3QE 3ALQA 1JMUB 3O12A 2ZGOA 3B69A 4QX7A 5EYXA 4CP0A 2JDHA 4RGAA 5F32A 5I0UA 1IS6A 1G9AA 3LIGA 2OX0A 2RM23 3PHMA 1YQ2A 4TN7A 3WR0A 5IFTA 1HRI1 4N90A 3BCWA 1HXS1 1HN1A 3Q9OA 4L11A 4URAA 1JZ2A 2W46A 2PHTA 2X53S 2YFZA 3RWNA 3RYKA 1KFXL 4FFGA 1JYWA 3VBFC 4NIDA 1YXWA 5DG2A 3R0RA 1WCSA 1D4M3 3LZZA 3M4FA 3WW1A 2HWC1 2VZ3A 4CYDA 1JYTA 1DGRN 2E32A 1E5RA 4XJWA 1TE1B 4DMIA 3BI3A 3GHMA 2ZGRA 4R9DA 4AGGA 1ND3B 1LAJA 2MHFA 2Q8OA 1AR72 3RZKA 1C28A 4UW6A 4K8FA 2ZGPA 3NNLA 1JYIA 4KNCA 1D2QA 4PDWA 4PQ9A 1DQ2A 1S1AA 4Q1RA 4Q2FA 4LA2A 4XFBA 1SPPB 1GWLA 1ZBA1 2I07B 2IFRA 3JBG2 1OLRA 4FP2A 5FZIA 4QDSA 3CBNA 2GNMA 5C3SA 4AK3A 5HPOA 4XQ4A 1DLLA 1NY71 2D40A 2J22A 2ZKLA 5EJZB 5FPZA 4B7KA 3NRUA 3KS7A 3B00A 3HAGA 1NLRA 5FJKA 1LHOA 3VDBA 3AVSA 2HKXA 2Z79A 4XETA 5JZGB 1YC61 4OI0A 4NO4A 2ZACA 2IC1A 2NYYA 4P5HA 4CDWB 3UL2A 4HVQA 1W8HA 2Y8KA 3V56A 4X6RB 3U0ZA 1NCQB 4Y4YA 3WF3A 3KGLA 4IW3A 5GZGA 3WNPA 1Y43B 1H8TA 1CAUB 4Q8LA 3VD9A 4Y20A 1VBD3 5FIXA 4DUVA 1OPOA 3CZUA 2F4PA 1NCRC 4M0NA 3AL6A 3TNQA 3PMEA 2DURA 1WWYA 2RJLA 2Y60A 1DHKB 4AOCA 3KV4A 4IEWA 5FQ0A 3NO8A 4O65A 4LO6B 5A7NA 3WUDA 4QXCA 1F8VA 2HEWF 4DO0A 1CPNA 4S2HA 4FPOB 2ET7A 5CISA 3TBDA 3KB5A 1SLTA 2BUKA 2X5IB 4GB32 5DDJ3 4CEWA 2JE7A 4EN6B 1CD3G 2RE9A 1H1MA 1OLME 1WBLA 2PHXA 2PQQA 4E2GA 1QQP2 4S2FA 5F3EA 3T2QA 2C9AA 5KHKA 3K51A 3KMHA 5DQ0A 2I45A 4IEUA 4KU8A 4TLFA 3AKRA 2ZOEB 3FN9A 4MOAA 3CMGA 4ZU7A 4XUOA 4YGBA 2JG8A 2AREA 2Q1FA 5FPLA 1W6NA 5LASA 1PVXA 1UU5A 5A33B 3OOXA 1FOD1 4NE9A 4W6XA 3O1UA 1YI9A 2WFPA 4HK8A 1RC6A 1JOBA 5F39A 1ZVFA 3O1VA 3N4MA 4XJ8A 5FPUA 1GANA 2WAOA 3KV6A 4IGPA 2PN5A 2B46X 3POEA 3SCFA 1V6JA 2WC2A 2DCTA 1WLTA 2A6YA 3AJYA 5T5PA 1VBA1 1OPMA 1QJU2 1HKDA 3AP9A 3ELNA 3OF1A 1DGLA 1MVEA 2JDYA 2ZS6B 2JDUA 2Y64A 1ODNA 3BPZA 3DF0A 5FY7A 4ZY9A 3VDDB 3B9CA 2B4KA 2IUWA 4FPYA 5FZ7A 4AVVA 4XXAA 2YUEA 5EJ3A 5F3GA 4CU7A 3IDEA 3NNJA 3PU8A 1R082 4CTEA 2VW2A 4AHZA 2W91A 4CDXB 1UZWA 3MI8A 4LBNA 2VMEA 5FTTC 3PVOA 1H8VA 3WNKA 4XZUG 3ZYJB 2EICA 5FAXA 4FOQA 4LOTA 1IPSA 1LEMA 1UPSA 2WA4A 1UD1A 3AYAA 3D8CA 4GKXA 2DU1A 4LNVA 2DBNA 2Q1MA 4UFIA 4EWDA 1PIV3 2PLV1 5CFDB 2A73B 3AX4A 4QD2A 4QWNA 5FY1A 4CCOA 4DUXA 3KCXA 3VKMA 1SFPA 1YIPA 2VMCA 3EQEA 5FY4A 3B02A 4LLFA 5J09A 5BUVA 4HZFA 3FFZA 1COV1 4OHZA 5LY1A 4BXSV 1L7RA 2D6OX 4A3ZA 4IEQA 5K0UA 2CHHA 2TEPA 5I91A 1YO8A 1OT5A 5CFCA 2ERFA 3J8F1 5KXEA 1NA1C 2XQRA 3I97A 3KQRA 1VBB1 1UOBA 1FNZA 1KDKA 1WGPA 3NWKA 5D8AC 4BISA 2D5FA 4NROA 3QH7A 3PMSA 1RUD1 3AK0A 1UPIA 3T3YA 4DRVA 1W6OA 1HRV3 4Q4Y1 1JU3A 4D3WA 5DG1A 5FY5A 5KHGA 2VOWA 1OA2A 4TSVA 3WDYA 1B35A 2GN3A 3IAPA 5FZCA 1US3A 2EIEA 4WM8B 2WWUA 4CCCA 2K9ZA 3DGTA 1DZQA 2RS13 2XJUA 5JVVA 2VQUA 4JKMA 1QDOA 2P3JA 2E26A 1V9U3 2G19A 4GH4B 1OUSA 3TOJA 4K8RB 3V64A 4AR2A 1RJ7A 2ZKNA 5DMYA 4QX3A 3WF0A 2B7YA 3SH4A 4YYOA 3FBYA 4FPGA 1RUE3 1YWKA 2IXLA 2ARAA 1CAVA 3P3NA 4LBLA 4PCRA 3AXDA 3WDWA 3ECQA 3ZO0B 2D44A 5JMOA 1VAVA 4JVAA 1AJOA 4OCTA 4JGZA 1AR91 5GZCA 5IATA 5AVAA 4YFZA 3I59B 1IGOA 3B01A 4R9BA 2OVUA 3VBFB 1K42A 4XF1A 1OSGA 3ZFEA 4V1PA 3UKNA 1IHMA 4YW5A 1PNFA 3T4VA 3KLSA 3IB3A 4IV1C 3GBWA 2WZR3 4HMZA 4CDUC 1Z7S3 1N1YA 3KZ4C 1LB2A 3K48A 3OJBA 2ZMKA 3JBG1 4JZRA 1G9CA 3NV4A 4DZGA 2YU2A 4Q4V1 1RUG2 1S2BA 5HCFA 5FZOA 4E8DA 2Q0AA 1BQPA 4IQPA 4RS5A 3H1YA 3N36A 4LPLA 4OFGA 4PI0A 5HV4A 1LECA 2DCJA 3HR9A 2ZHNA 3J7HA 4YFWA 1HB1A 5GLWA 4JDOA 3O0XA 1YHFA 4JGYA 4PLNA 3VBOC 5A6YA 3I4IA 1REDA 1VMHA 3NNGA 1W8ZA 5F6LB 3S5AA 3TEXA 3LEGA 1VMJA 1CIYA 4W4ZA 4HSLA 2K0GA 3OPWA 4QX0A 3OCPA 1CAXB 2Y6JA 4KBZA 1W99A 4R4XA 1GZCA 4YVWA 3ZXJA 1FNYA 2QQJA 1ULDA 1RXGA 5FYSA 4BJ0A 3NV2A 2QUOA 3HEIA 1BCXA 5LBFA 3U07A 2QQUA 3EBRA 2A6WA 3U1XA 5HXVA 1H2MA 2CL2A 4MGYE 1QU0A 4YW6A 3VDCA 4MYEA 2DUPA 4WZFA 3OSDA 1N3QA 2V5YA 3HQUA 1ASJ3 1H6YA 1RMU3 2HWD2 5A3TA 1YRZA 4JQRA 4EZ4A 4EN0A 5K0UC 1UOJA 4EQVA 1BHGA 3P3PA 3U11A 1Y9MA 3UKTA 1QGLA 2VR4A 4AHWA 1ZX5A 3RMXA 2QQIA 2OYZA 3MF9A 4GB31 4UOJA 3SNMA 2R1BA 3ZDVA 3M3QA 4E4DX 3LSEA 4AGVA 4WVVA 3A0NA 4AI1A 4Y5Z0 1W6QA 1ZZ7A 3I3QA 3RZHA 1BZWA 1ND2A 1QQP1 1S0IA 4XQDA 2B39A 4JRAA 4XF4A 3RYRA 3ZYRA 5FZ9A 4HANA 4QKFA 1PZ9A 2VMGA 3DYMA 4GQ7A 1POV3 1AYM1 4B4QA 3VDAA 4N8MA 5KHHA 4DFSA 2ZX3A 4P9GA 1Q8SA 4Y24A 5T50A 1TG7A 4A41A 3AMPA 4QPIC 3J7LA 4QQ2A 2Z5WA 1AZDA 3BU0A 1KS4A 3AMNA 3SXWA 4XTPA 4FPCA 3GDBA 3PLQA 4EN8B 1RUJ2 4YM3A 5IAVA 1ENXA 4XF9A 4RGGA 4XBQA 2R071 4FPHA 3WSOA 2BVVA 3A4UA 2W3JA 4CEYA 4FPFA 3DUIA 1WLDA 2ZCWA 5FPVA 4TWTA 4RHV3 3S5QA 2IXIA 5HCBA 5CEHA 5HCHA 5IK5A 2ZZJA 4OZXA 3VHOA 1YUDA 1XC6A 2A6XA 4N53C 5HI0A 3BTYA 3AYDA 3NSTA 5JR2A 5T3NA 5J37A 3E6DA 5LA1A 1WUVA 2EAAA 2CGNA 2Y0OA 4FVVA 4A3XA 5JWPA 4ZPIA 2E7TA 4QGNA 5DUUA 3WF4A 5ACA2 3FUOA 5I8TA 3TAYA 3LGRA 5FKBA 1W0NA 2GC3A 3DPRA 1IPKA 2EAKA 2VNVA 1LULA 1RUC2 3ENRA 4FQZA 4K21A 4ZS3A 1I1EA 2VM9A 2WLQA 1UNBA 5L9BA 5BNPC 1ZYBA 5A7WA 4R9CA 4BA6A 3E97A 5KBFA 2VNGA 2VZ1A 1IQAA 3NJYA 5FZKA 3E5XA 1EUUA 2OQ7A 4XJUA 1PO12 3VBUC 1H30A 1NKGA 4RN5A 4UAPA 5FP4A 4A7ZA 4WM7B 5T52A 3H8XA 1W8TA 1VBE2 2IVJA 5CU1A 4NIAA 1NLSA 1O91A 4FP3A 3QOPA 3B93A 1L3JA 3O7OA 3I3EA 4NIIA 1H1IA 1OQEA 4YGCA 4ZXKA 1W6PB 1GQGA 3X29B 1V00A 4B8EA 1A8DA 5E8AA 4XYXA 3KT7A 5FYYA 3AFGA 4Q4W3 4P08A 2FHRA 4PF5A 4Z07A 4BOWA 5C70A 2XKOA 1JZ7A 2RJ2A 3TYJA 2HH9A 2LW8A 3OGSA 1ND3A 1G86A 1NA1B 4RSUA 3AMHA 2VCBA 1UZVA 5D8AB 3OGRA 1WW5A 1E57A 4RA0A 1EAH3 4MGSA 1RIRA 2GNDA 1WW6A 2YZ4A 3C8XA 1AR61 5IVEA 2B45X 3OB8A 3DCQA 1SPPA 5FV3A 3WDTA 2WNVA 1H9WA 3M3EA 5FMCA 5AC92 4CDQC 3KGZA 4A7KA 2BZDA 2GC0A 1EY2A 3OGGA 4XJAA 2D6KA 3NJZA 4AAXA 4Q4X3 3S30A 4OZOA 2BTVC 1ENSA 4BQWA 4DEVA 3I7DA 2P1BA 2OUHA 1CZSA 3E5UA 2WQZC 1ZZ8A 4LUMA 1S0CA 4AGRA 5F7UA 1U5ZA 4XF0A 2ZEYA 2JE8A 4MUVA 4NHKA 5A7OA 1RUNA 3ILRA 3TEZA 3MUY1 1X8EA 5FP3A 2ZGKA 1UX7A 4C1XA 1OQDA 1AYN1 2WO1A 5F9TA 1OURA 4EROA 4NIGA 4K1ZA 4GMP1 4I3GA 3LOBA 2DDUA 3ZN6B 5LEJA 3THDA 4AAPA 2GC2A 3AP4A 1BEV2 1C8M3 2JX9A 2Z42A 1VRH2 4COYA 3VHPA 2A5ZA 2BDRA 2XWBB 4P9XA 4TLGA 3UGFA 1F9KA 3E1F1 2VQTA 4UI9L 1WCQA 4CDUB 1O8SA 4MHUA 2FDFA 1GR3A 1H2KA 3SH5A 3POGA 5APAA 1T2XA 2I74A 4D94A 1RUG1 1UKGA 2P3YA 3RJ2X 2PAEA 2ENRA 2YC0A 4ASLA 5BV6A 3SH3A 3MO4A 5AFBA 1R1ZA 4D0QA 1VBC2 1HXS3 1F5FA 4RQPC 2Q8CA 3WD5A 4D69A 4BK4A 1PGL1 2WFF2 4JKKA 4OYUA 3W59A 4LMFA 4YVSC 3H8RA 2XL7A 4LXLA 2JKXA 1NXD1 2HWC3 4QHZA 3VBOB 1XJAA 2GDFA 2RS32 2R063 1L7LA 3F95A 5FDBA 2JDPA 4CCKA 5FXWA 1TNFA 3KV5A 4IXLA 1C57A 2HWF1 4C0HA 2WIIB 5FZ4A 5D1IA 3WNOA 4DQAA 5DABA 2JG9C 1DLCA 4UFJA 1UY1A 4AI0A 1HX6A 3LCPA 5L7OC 4AF9A 3MIDA 5F5IA 2O1QA 1MS3A 1PVC2 5F5QA 3MLKA 1IG3A 5A32B 2W94A 3I3BA 5F6KA 4XAEA 5A3OA 5A33A 1GQPA 4YZ2A 3CJIC 4LKEA 1QJX2 1PK6C 2YMZA 3ASIA 4RD7A 4XFGA 4F8AA 5FP9A 2EALA 4QM9A 2HWD1 1RUH1 2DV9A 2HWE3 4MO3M 2BPA2 1PZ8A 2CSGA 1YLLA 2MEV1 3CF6E 4GZ9A 5TSWA 3WDVA 5IK8A 4M01A 2YFUA 1MQTA 1RUF2 4WVMB 1D0GA 5DAQA 3O1PA 1LODA 1DYKA 1ULOA 2WJSA 5IVYA 1VE0A 2Y6GA 5F3CA 2RMU3 2VW0A 2C9KA 3C7GA 1SHWB 1UAIA 4DXSA 4L97A 3WNNA 5A1FA 2HWB2 2A3WA 4LITA 4Y3OA 3VUOA 3LDKA 3MEPA 1JOPA 2WDBA 3THTA 1NYWA 3OBTA 1MEC2 2VUCA 4U2AA 4YM2A 5C9AC 1K5MB 5KC5A 2L9LA 4HPKA 5FZEA 5FZBA 3N9QA 5EZWA 2LS6A 2AC1A 2R30A 1RVF2 4MVTA 2E51A 2JDAA 3D0JA 3IDAA 3AMMA 4LHSA 4CDXA 1DDLA 1O4ZA 2PA7A 3AL5A 2QQNA 4QPIB 3LKJA 5CADA 1JZ6A 1CN1A 1LOEA 5FZMA 2VBPA 1A3KA 3WQ1A 3POWA 3GCWA 1NX9A 1JHJA 5JPMB 4KWKA 1FI2A 5CFDA 1XNTA 1ULFA 1GKBA 1QEXA 5FLHA 5LBCA 4B1LA 1UF2C 5FO7B 4A44A 4YZ5A 4UW5A 2WRAA 1ZZCA 1Z0HA 2QZ3A 1LHUA 2HBTA 2JDNA 4K6BA 1UYYA 4YG6A 2C0ZA 4N53B 5FZ1A 4H7MA 3HWJA 3QLQA 1X8MA 5FBZA 2XJQA 3NAPC 4AI9A 5IYYA 3UV9A 2NMOA 5E6HA 3ZN5A 5FCCA 1GV9A 2XJPA 4V2WA 2YBSA 2YPDA 5FXXA 2JB8A 5IHRA 4P9LA 3HOBA 4JDNA 2YGMA 3AJZA 4IE4A 4LBQD 3T2TA 3UGHA 3WF2A 1WBFA 4COWA 1QH7A 1XU1A 3VHNA 1RUC1 4QKNA 2VY0A 3GJBA 4N43A 1RHI3 4IEPA 1QNYA 2R042 4IEZA 4TTGA 1XSRA 3I8TA 3AVRA 4AEDC 4DB5A 2BBVA 2XBO2 4AVTA 1GWMA 3NVCA 2VZQA 5CA6A 5ERLA 1PO11 4QU2A 1CX4A 2YC2A 4DRRA 1OC1A 3V0AB 2WS92 2E33A 4CPBD 4DXTA 1AVBA 1K45A 1VBE1 1W03A 5BY5A 4LA3A 2LROA 3LFMA 1ZRIA 1LESA 1PGSA 2EIDA 3OY8A 1EV11 2ZXQA 4QHOA 3QCWA 1OXCA 2BW8A 4LKFA 3CJXA 4QQLA 1U5XA 2CY6A 4FAGA 3B9IA 3I49A 4LBQB 4NRQA 3ZSKA 5K7PA 3RZGA 4DPNA 3I2FA 1V6IA 3IT8A 1Q5OA 4SBVA 4DEQA 3VBFA 1W39A 1W9TA 3MIFA 1V6LA 1FPN2 1X36A 5FYCA 5EPAA 4MGZE 1HV1A 3R4SA 4XFHA 1V70A 4XDPA 3H1MA 4PBOA 4NHYA 2YPJA 1JS9A 4URTA 2ZBJA 3ZYPA 1O3TA 4M3CA 3VKNA 4MGKE 1JOJA 3HJRA 3ZYIB 3EXUA 3HNYM 1YQ5A 2BGCA 2JEMA 4Y22B 4OHVA 3LDRA 4CDQB 4UFHA 1CR7A 2WZPP 1W6MB 2BV4A 4UT5A 1H2LA 4D7YA 1G8WA 3N7JA 2XJTA 4P02B 5C5TA 3MYXA 2CAVA 3ZDSA 2XJSA 3ZPYA 2D3PA 1UMIA 2DVAA 3AXEA 3WP6A 1FAYA 4AEMA 2VGDA 3KD4A 1JZ5A 2AZ5A 3WINE 5FOBB 3JCIA 5H9PA 1KEXA 1BBT3 2DFCA 4ORFA 4XUPA 1N3OA 4XDQA 3LA3A 1DZRA 5GM0A 1R092 2FMDA 4Q4Y3 1G6NA 2WZ8A 2D5HA 4XFCA 2BYVE 2F17A 4GXLA 2W1WA 1F4AA 1S0EA 3CU7A 2RR12 3B7MA 3ZFGC 2P4EA 5IT6A 1VRH1 2WWSA 1EP0A 2HEVF 4YRDA 3SEPA 1FMD1 1GUIA 5M0TA 2YGLA 1MS5A 4XC9A 3GBFA 2YG0A 1ST8A 5ABJA 5T5LA 2QDNA 1YCIA 3TN91 4GWIA 3FMGA 5BPXA 3T30A 4CU9A 1TVGA 4OMDA 4FTEA 2C24A 2JWPA 4Q29A 3WNMA 5K9YA 2EVXA 1PO23 1RUI2 3M70A 4FO9A 4LIUA 2BWCA 2J1EA 2K2SA 1VBC1 2UWCA 2Q1ZB 1UIKA 3POBA 4OHWA 3FLRA 1OKQA 1A78A 2WFF1 2DTWA 1MS4A 1IQDC 2VZUA 4ZU4A 2VECA 4RQPB 4B7EA 1AR93 3ABZA 5F5AA 3ZFFA 1HN0A 2AEYA 3PJQA 4YVSB 2RS31 2ZHKA 5LRSA 2Y6HA 3U75A 1AR83 1SZBA 4Z2WA 1JZ8A 5FP8A 4AI3A 3H3LA 2GH8A 4S2GA 2CWSA 4FFHA 4AFBA 4O61A 2BFUL 2RM22 3D5OA 3PTRB 2IWGB 3VL9A 1SLAA 3RI9A 1QJEA 3NKGA 5L7OB 4XFFA 4IV3C 5FYUA 2P37A 2SLIA 4Q4V3 4XE9A 4EZHA 3PDQA 1KJRA 1LGCA 1QJX1 2NZ9A 2ZX2A 3N9OA 5JLVA 1UMZA 1AJKA 1D4M2 1QJY1 4CZSA 2D97A 2VOKA 4NAMA 1UZ0A 1G7YA 1PK6B 4BIOA 1TMF3 5E1RA 3I3DA 4JHZA 1PX4A 5FZ6A 3AKTA 3RZMA 5FZFA 3RDIA 2QNKA 5DUWA 3T2OA 1AL23 1W90A 1QIQA 1RUOA 1BMV2 2WNEA 1S0JA 4C1WA 2D43A 3LEMA 3I2OA 4LUKA 4NWVA 1HQNA 4HFSA 3KT4A 1XYOA 3K4ZA 4NN0A 3C7HA 1QHDA 3T0BA 3H9AA 2GMMA 1ZBE3 2AUYA 3WV6A 4PHZA 1SLBA 5BNOC 1IOAA 3LPFA 1XNDA 3DYPA 5C4WC 4XABA 3MDPA 1TME1 5C9AB 1RVF1 3MPPG 2P6CA 1UOGA 1LEDA 1EUTA 1OD3A 1C1LA 5IVBA 1HW5A 4K20A 4RR3C 1ALYA 4HETA 4BWOA 2VMIA 1SG3A 1W2UA 4WM7A 5FRAA 1FXZA 3S7EA 3WT3A 1VBD2 4NOTA 4DUWA 2VH9A 2VUJA 2ZAHA 4QX5A 3VBSC 2BOJA 3EB7A 1GWKA 1AYM3 1XNCA 3IN9A 4YW7A 5FYIA 3CKHA 3GBGA 3VBRA 1H4HA 4YW3A 3DYOA 1EPZA 4CXWA 4FTBA 2DFBA 3WDXA 1QOTA 4LBOA 1VJ2A 3UJOA 1SBDA 3NAPB 4W50A 3I3MA 3OBAA 5DDJ2 3ZYFA 4AVBA 3BU7A 3IDCB 1WCUA 4P5YA 3T4HB 5EQUA 2O8OA 1S0GA 1VRBA 2R073 4IUGA 4P9WA 1WLWA 1AX2A 4FTSA 2XBO1 1E5SA 5JMCA 4H2AA 3DKWA 1O3RA 1TEIA 3GZUC 4PDWC 1S2EA 1WLCA 4AEDB 2HBUA 3ZIWA 5F3IA 4X8NA 3VZNA 2DU0A 5T54A 3HIFA 1AXZA 1W2NA 3HVDA 5FZ0A 5I0DA 1G9DA 3I54A 5JPNB 3ZX7A 1R1A3 2NP0A 1WD4A 1K5JA 4XF3A 1VPHA 4KGQA 1FATA 4LHKA 3KVAA 5FK7A 1J83A 2OIIA 4HONA 1XSQA 4QQHA 1UMHA 1JN2P 1G9FA 2E53A 2VVFA 4META 3C7EA 3JB4C 4XTMA 3ZKUA 1REEA 4DY3A 4BQ3A 2ATFA 4LHLA 1GZ9A 4W8JA 2PHLA 4QT6A 2DVFA 1UL9A 3J4UH 3Q8EA 3ZYBA 2YV8A 3ZN6A 1DQ4A 4YSFA 1PGW1 2WSUA 3OG2A 5LBBA 4XUNA 5FY0A 1H8TC 5IWFA 1JUIA 1JYCA 3J7MA 5FK8A 4BH9A 2W0XA 1RYYA 5LW9A 4NPMA 2E63A 2GMPA 3Q8BA 4J1WA 4MLOA 3VZOA 1XQNA 4CDUA 5FREA 3I2IA 4YLZA 5JOZA 3VD5A 2VULA 3GYDA 2K46A 2GZWA 5F37A 3JD71 5BXXA 1PX3A 5J96B 1QJZA 2XHKA 2IXKA 3N35A 1I5PA 1OVSA 2DWRA 4B1MA 1LOFA 5FO9B 3W20A 1O8PA 1IKPA 2DVDA 5C3RA 1OOPB 1TZOA 4JTNA 1DQ0A 4CEWC 1DU3D 1QXRA 3GZEA 5GALA 2VAUA 1SDDB 4QX2A 3IMMA 5IAXA 2XQXA 4OLLA 1PIV2 1UN1A 4IGQA 5JSOA 2ZABA 1FT9A 5A1LA 5LA0A 5T55A 1LGBA 4JRLA 1IZ3A 3OYWB 3O1TA 3EO6A 1AR63 2W68A 3T08A 3SCHA 1DIWA 4Q27A 2RR11 1HV0A 2FDKA 5A32A 4LHNA 3WG1A 4LT5A 2JDMA 4NMIA 4FOWA 3ZFGB 2X09A 5HBAA 1LGNA 2WL1A 1YYNA 5FZDA 2DCKA 3WVJA 3OD0A 2B9VA 2E9QA 4QPYA 3URFA 4EE2A 3FX3A 1UO9A 1CZTA 1RUI1 3HQRA 4XUQA 5DUXA 4L8QA 3BKZA 2PAMA 4EWAA 2F6BA 4NHXA 4WVMA 3DXUA 3E6CC 1HRV2 4M0HA 2FDHA 1ACCA 1OD5A 2PAKA 2AR6A 2VQ0A 4Z2AA 2EIGA 4N9HA 1KDMA 2RDRA 1ZRRA 1AYN3 4RYDA 3V0BB 4X6QB 5DZGA 2FCUA 2VUDA 4GMP3 5LA9A 2BNNA 3AYCA 2RS12 5KXBA 1J3QA 1V9U2 1AR71 2XLGA 1HB3A 2BGPA 2RM21 1K5MA 3M1HA 2B8MA 3ON7A 1KJLA 2RS53 2RV9A 1O5UA 3DECA 5FUPA 1A8MA 1GMMA 1RUE2 2IXHA 3WF1A 1DGWA 2A75A 1NOVA 1ZZ6A 4Q0VA 5BYNA 4IV3B 4R52A 2QQWA 1GICA 4XHXA 2BVBA 4Z1VA 3VV1A 4FXKB 2I2SA 5H9RA 3CHXA 5L36A 2VZTA 2A3XA 1UW8A 1XU2A 3GXUA 1DP0A 3LWCA 4OUEA 4P9YA 2XLFA 3ZYHA 5IVFA 1BMV1 5FO8B 1X7NA 2WZR2 2V73A 1Z7S2 1OA3A 1RTVA 2KR2A 2HWF3 4XW3A 2VE1A 5F2SA 3C7FA 4IL7A 4Q5OA 5DPNA 1XNKA 5JIAA 2GP5A 1UZYA 4RFT0 4ZZ8A 1Q3EA 3EMRA 2ARBA 1VALA 5FUIA 2GNTA 1ULPA 1WMDA 2JENA 2ZHMA 3LSDA 5I8SA 5LA2A 2OA2A 3VZJA 3WXPA 4BQXA 5CFCC 5LWBA 1X33A 1NCRB 2DCYA 3PL0A 4A2UA 4CCNA 5BNOB 5JI9A 5C4WB 5L19A 3LE0A 4R4ZA 1RUH3 4XAAA 1U5IA 2A3YA 4Q8KA 4G9SB 1D2SA 5C8CA 1UY4A 1AX1A 2MPFA 5BNNA 4KQ7A 5HXMA 3WHTA 1B35C 3BODA 4QMAA 3OEAA 4C91A 2OUJA 3WP4A 4RR3B 5A80A 4YW4A 2GN7A 2VNRA 2ZA9A 2ZGUA 3KWVA 2XHNA 3AM2A 4JAAA 4BCUA 2Y0IA 4AQSA 2A7AA 2OS2A 1URXA 3D82A 3JXSA 3NQHA 4Y1UA 3RZJA 1NT0A 4P00B 2VTXJ 4LJHA 3VBSB 1CPMA 3KF3A 4QPGA 4OI4A 1ASJ2 1Y3TA 1RMU2 2QFEA 2ZJCA 1IS4A 4RFRB 1F4HA 2XB6C 3UYJA 1M06G 3VBHA 1S2KA 2UU8A 2W1UA 2WT0A 4N9IA 4B3NA 1BJQA 4QKDA 3K46A 4JGZC 2VZVA 4F3JA 2VUAA 2RJKA 4NRPA 5DUVA 2PTMA 4MADA 4QX1A 1APNA 3POFA 4M4RA 4YZ1A 5KC6A 1XE8A 3WLUA 5B2GB 5D2AA 3ZFEC 3KT1A 4CPBA 4U36A 3KHBA 1M4WA 1OLQA 4I3PA 4MZUA 4GJZA 3GCXA 3VLBB 5A3WA 2XL9A 4GJYA 3WG3A 5JUVA 3WCSA 3ACHA 1LENA 4Y22A 3OGJA 3ZR6A 1QJU1 5I0RA 1YI7A 4UF0A 2WKKA 1PNGA 4JHTA 4ZHNA 5BNQA 2VL4A 2BEOA 3RNSA 3O1MA 1YJLA 4RS5C 2WINB 4BQ2A 1ZRDA 3S0MA 3DL3A 3CQOA 5LY2A 3MF6A 5L73A 4JGYC 2TUNA 1NE6A 2VXRA 1OQ1A 1R081 2A1XA 1P8JA 1SMVA 2IFWA 3ACLA 4W65A 5LBEA 2XPJA 3PIJA 2R6QA 3POYA 2TNFA 4RHV2 4COVA 4YVWC 5LATA 4XILA 4AFAA 3VHRA 3VD3A 4OI2A 1UIJA 3AKPA 1LKNA 1W05A 4GAZA 4C8DA 1RINA 3HT2A 5IJRA 2IXCA 4Y20B 3PTYA 1LOCA 3BB6A 5FWEA 3LDBA 3VD7A 1ZRFA 1ENQA 1MACA 3IZOA 5H9SA 5T5OA 4C0BA 4AZZA 1EV13 3FBMA 4MH0E 5IW0A 1VAKA 4LE4A 3N9MA 3C2UA 2D6LX 3H42B 3W21A 3T0DA 4BQYA 3FUQA 4CCDA 5A3PA 2UWBA 4LO8A 4RQPA 2QZ2A 4ASKA 1VAMA 2P17A 5CKMA 5EIYB 3D4KA 2KM2A 3MUZ1 3CO2A 4AQ6A 5J98B 1PIV1 3N7KA 3JQXA 4CEWB 1W9FA 4PBPA 1AXYA 1V6NA 1F15A 2GSYA 3AMQA 4PLOA 1PM4A 1GYKA 2XVKA 4CA9A 2DVGA 3BTXA 1U5YA 3S57A 2X05A 1QOOA 5FPXA 2BP6A 4OHYA 3H7JA 3ZXAC 2VO5A 4YG0A 5ANNA 3ZR5A 4AVAA 1BVP1 1NE4A 3M3CA 3NMBA 4Q4W2 5CVRA 3LIHA 5FMOS 1N47A 4KGGA 1QF3A 2ZX0A 4TXWA 1HQWA 1XYPA 1NQDA 1YNAA 1WKYA 2D6NA 4M3CF 5GZDA 1XNBA 2WWJA 3MZHA 4ES8A 4QB2A 3USUB 5JZGA 3SLIA 2R0HA 2O8QA 3WW3A 2VPVA 1EAH2 2VJXA 1LHNA 1Z78A 3NL1A 4CDWA 4MG2A 3UETA 3UGGA 1EYBA 3WP5A 1CAWB 2ZGLA 1GZTA 1WZXA 1GNHA 1NCQA 1D0HA 2Y6FA 4JTOA 4WVZA 2P3IA 2XGXA 3OD4A 1CAUA 1HJFA 4A45A 3ORJA 2YROA 1V9U1 3IMNA 3VZMA 4Q4X2 5JAXA 1IS3A 1BK1A 1H4GA 2VBDA 1FMD3 3HBKA 3WW4A 2IXJA 3ES1A 4IV1B 3J26N 1GOGA 3DPRC 1JBCA 3TN93 4NHMA 1VB2A 2CWMA 2OZJA 2XUEA 2O0OA 2D6PA 4INDA 3T09A 2G1MA 2W52A 4AW7A 4ZZ5A 1ONAA 1W8OA 5JSRA 1HRI3 1S0BA 5GLZA 5HV0A 2XONA 1PMIA 3B5LB 3LOIA 3PVBB 3BPSA 1UY2A 2QBXA 2X5IA 4AXOA 5FYBA 1PMHX 2XMLA 1A34A 3U37A 2G9GA 5C3OA 1C8M2 4CVUA 4V2VA 1Z7S1 2Y38A 3ZXDA 1ZREA 1W04A 4BIFA 4JQTA 1S0FA 5L9RA 3RJRA 4H55A 2UYAA 5FUNA 1ZM1A 4F83A 4BHPA 1HDKA 1UU4A 2PHRA 2VD7A 4J1XA 4UBGA 4Y1ZA 3HNMA 4YWAA 1ZBA3 3O0VA 4NJ4A 3W58A 3FLPA 4A7YA 1WMEA 3O0WA 1HXS2 1RJ8A 4H7LA 4EYUA 4MXWB 3ZLIA 4TYSA 1NLQA 1QJY3 5CIRA 1AHSA 2HWC2 3PUSA 3WQ7A 3MIHA 1DQ1A 1ND3C 2R062 1ODMA 2NPIA 1OBNA 4QX8A 5LCWL 1TQ5A 2DTYA 1OUXA 1BYHA 2ARXA 5JXGA 2ZX4A 3AZZA 1W6OB 3CLPA 4LORA 4PIXA 4IEYA 4ZXEA 1XBFA 2WNVC 5FZGA 1H0BA 2PHUA 3OUHA 3THPA 1PHMA 3OUIA 4EV0A 1B35B 1Q56A 4FFFA 4LULA 3I2GA 2R0FA 1AX0A 1J84A 1UX6A 1ZNPA 3NNMA 3VDDA 4HVRA 2LRPA 3MPBA 3HBZA 3MFAA 4YARA 2AYHA 2N7GA 2D3RA 2G4IA 3ZSLA 3KCYA 5EYYA 3RGBA 1UYXA 4PT6A 1SLIA 1W2AX 1RMU1 3CNAA 2G9ZA 2HWE2 2P5BA 2P6HA 4GMP0 2VMHA 4COZA 3IPVB 4CP9B 1TME3 3UNPA 4M00A 3FHQA 2XWJB 1CAVB 2XVLA 1O3SA 2A6ZA 2PMWB 3ZXKA 3T2PA 1N1TA 3NNFA 2VC9A 3MW4A 4BU2A 4JGZB 4XPVA 1H6XA 2RMU2 1R64A 1RUJ1 5F1RA 1W9YA 2WNUC 1LHVA 1LRHA 2C4XA 3JQWA 4MGQA 2ZEXA 3BVCA 3ZFEB 5DN2A 1POV1 1J3PA 5FPAA 4BPZA 4FCAA 4NVPA 1UXZA 2NM1A 3BALA 2SBAA 1KXGA 1YFXA 3K2OA 4FQ4A 1CZVA 4CUGA 1GQHA 2J1VA 3LA2A 4GKYA 4LK7A 3TWIA 4AI8A 4OHXA 5F8PA 5FZOB 3ZXLA 2VG9A 4ATEA 4ARXA 4RGKA 2C5DA 5ACA1 4RS5B 1OOPA 2Z2SB 5GJ6A 3C7OA 2LUWA 2PXJA 2ES3A 1B09A 4CP1A 3CL1A 1FOD3 4BE3A 5A3NA 2QCSB 5A1AA 1F31A 1DGRA 2BRTA 3OYWA 4RHV1 5IUQA 5KR7A 4KG8A 3MIBA 4E4SA 3EJKA 3MHZA 2NMNA 5A3LA 3EYPA 4YVWB 4WM8A
chains in the Genus database with same CATH topology
4OULA 2B42B 2ILMA 3T1MA 3ZFGA 5JSPA 1VBA3 4AHYA 4MV2A 2VOXA 4GH4A 4KWJA 3VBUB 1DQ5A 1AL0G 1CONA 4IEXA 3SMHA 4I01A 4Q1PA 2G9FA 5HCAA 3L2YA 2X8KA 4KU7A 4L99A 1MZFA 4P9JA 4LBMA 5CNAA 5E89A 4ZKTB 1RHI2 1MQTC 3BOWA 3WDUA 3I59A 2Z69A 3MIGA 3V0BA 1LTEA 2QDRA 3PJYA 1CJPA 2IZWA 4B29A 2CYFA 3KSCA 1W6QB 2ZHLA 3SISA 1H9PA 3WOGA 2XVGA 2PLV3 4OVEA 5AC91 3H50A 4QGLA 2A70A 4XZPA 2GALA 3M3IA 2W08A 4CDXC 4IV3A 4QM8A 5CAZA 3JD73 3RSJA 4UBHA 1COV3 3ZXFA 3V65A 3RMYA 2NN8A 4E4ZA 1RB8G 3MLJA 5EWSA 4DOUA 2YDEA 3J8F3 1CAXA 5CFDC 2B5HA 1VBB3 2DF7A 3AKSA 3M7AA 4HBNA 4AG4A 5JOYA 1RUD3 3QH6A 2ZPXA 4Q0PA 5GLUA 2CAUA 2ZX1A 3VKFC 3WCRA 1BEV1 1J1TA 4Q4X1 3ATGA 1EPWA 4WV8A 1JTZX 3H3UA 2D7FA 1WMFA 3TRSB 4HL0A 4SLIA 1NCRA 5GLVA 3MICA 5I0SA 4GIQA 4XBNA 5E88A 3KM5A 4Y1XA 1SCRA 3DPRB 2VNOA 4Q0QA 1BBT2 4K40A 4N43C 3ZMNA 4IEVA 2A71A 4ATFA 2VQAA 4KL1A 4Q4Y2 2ZZQA 3R4DB 1FV3A 5CG9A 1C1FA 4N7IA 4K9SA 1C8M1 1AUYA 3ST7A 4S2DA 5AFEA 3VBSA 1AR73 2P3KA 3AP7A 4YGDA 4Z82A 2NQYA 2JG9B 1PVC1 3AP6A 3JBG3 1PO22 3M2MA 3INAA 4E9KA 1LJ7A 3IKWA 3J9SA 1J3RA 1SDWA 1MVQA 2EA7A 1AR92 3CJIB 1CVNA 5KXDA 4FOVA 2R061 4HKLA 1D4VB 4BLIA 1AR82 3WY6A 3RS6A 1J1LA 2DYCA 4R8HA 1RUF1 1WCDJ 4XJ9A 4M3CE 3G6JB 3H7YA 3IM0A 3ZN4A 1SFYA 4N7UA 2CTVA 2WNVB 4BYYA 5FLIA 4NPRA 4L2NA 4Q4V2 5AVPA 2HWB1 2PELA 4LLOA 4HT1T 1QNWA 1Y7BA 1MEC1 4B4RA 5IK7A 1TMF2 2HWE1 3T1LA 2HYKA 3MW3A 4EWEA 1AL22 1UU6A 5LEKA 2CGPA 1YFUA 3AZVA 1Q8OA 5DZEA 3VZLA 4AWDA 4PLMA 4ES9A 2DUOA 2RMU1 5E16A 1OFNA 2H6CA 1V6MA 4KH9A 4UW3A 4XBLA 4GB33 1ZBE2 4BMEA 1SCSA 1RITA 1LR5A 4L92A 2WNUB 3D0SA 1QQP3 2WLPA 5ABJC 1ULGA 3AZXA 2R16A 1W6PA 3WX5A 4XFIA 3BIWE 3GHNA 4YW2A 1YFWA 2BNOA 1V6KA 4LBJA 4HLTA 2WA3A 2LTNA 1KFUL 1N1SA 3LB9A 3M3OA 3ZFFC 1FV2A 1NA1A 5D8AA 3U4XA 4AVSA 1BXHA 4AYUA 5DXDA 3IDBB 4ZU5A 2R041 3ES4A 4W6WA 4AEJA 5JR7B 1AYM2 4RL7A 1OI6A 2WS91 1QJU3 3ILFA 3PVEA 1W0PA 1RL3A 3A0KA 1MS9A 4GWNA 2FQPA 3VL8A 3WUCA 3USUA 5FFOC 1TNRA 2ZGTA 1R083 1RHI1 2R072 2CNAA 2VW1A 4XQWA 1CAWA 1MQTB 4J6GA 3FC0A 4XIKA 1FPN1 1SLCA 5LRRA 3GZAA 1R1A2 2GC1A 4IV1A 4QGMA 4IETA 1H2NA 4BM8A 4AQ2A 1GLHA 2KA3A 5J7MA 4DY5A 4HPKB 4JV4A 2UYBA 4FOYA 4B4PA 2BWAA 1KQRA 3W9AA 3JU9A 3OBRA 5JCTA 2R32A 3SHRA 3VBOA 4WM7C 2CGOA 4XOGA 5FLJA 3C3VA 2QE3A 1T6GC 2GH2A 4Q0UA 4AFDA 4FBFA 1R091 3AB0A 3FE5A 1N1VA 1MS8A 2XLAA 3S7IA 3ME2A 4XIOA 4UXAA 4HVOA 4FAHA 1OFSA 3VBRC 2QJVA 1UKRA 2JG8C 3ZXGA 4MXWA 4YZ4A 3H3ZA 1JHNA 1LU1A 4EJRA 1BBT1 3NKTA 1JW6A 1WW4A 1C5IA 1XE7A 4N43B 3WNXA 4AVCA 1AR62 1XXNA 3RRDA 1AXKA 2ZMNA 2LM3A 3H8UA 1Q8QA 2EF6A 1KITA 3HN1A 3ZSJA 3R05A 1WD3A 4FPJA 1LU2A 3OY8B 1S0DA 1WW7A 1PO21 3IPVA 3AZWA 1GZWB 1Y9QA 3NV3A 3FWEA 2GNBA 1RUG3 4QPIA 1JXNA 3UJQA 1ULEA 1QOSA 1D4M1 1DGWX 1AYN2 1FYUA 4MGIE 4AI2A 2Q5TA 2TBVA 1AR81 1I9RA 1YIFA 3ZVXA 1A6CA 1W0OA 2WQ4A 4OUSA 2RS52 4O9EA 1CGPA 1MS1A 4M3CB 4P14A 1N3PA 2P34A 4N53A 2JKBA 4AEKA 2PHWA 1U12A 3G7DA 1LOFC 3VKOA 5IK4A 2JJ6A 1TMF1 1PGL2 4BLJA 4H14A 5JOWA 1AL21 4Y1VA 1H1AA 2HWD3 2MEV3 3NV1A 2WT1A 2JD4A 2HWF2 3QBQA 5J48A 2XUMA 5BNPA 1V6OA 1YJKA 4I0BA 5J36A 3AKQA 3OTFA 1F5JA 3V0AA 4LTAA 2Q4SA 1ZBE1 3JZVA 3USSA 3VBUA 1VBD1 2EXIA 3DN7A 2PYTA 3HQXA 4Y1YA 5GKAC 1O4YA 3HT1A 2W39A 1BVVA 2ZTNA 4GWMA 2X29A 3POSA 2OPKA 5ABJB 4G3YC 5GZEA 4I0WB 5EV7A 4LBQA 5H9QA 1RUH2 2NLRA 4TZDA 1ZZ9A 4EN7B 2MEV2 4OI1A 3N7LA 2PHFA 4BMBA 1SQ4A 4HN0A 2E7AA 1J58A 5DDJ1 2D6MA 3ZFFB 3QACA 1RUJ3 3MW2A 4EN9B 1PM7A 2JXAA 3L2HA 4FPEA 4DINB 4E2SA 1MZ6A 1DFQA 1DF0A 1Q43A 1ZA4A 1K5MC 4E2QA 2WT2A 1QDCA 1VP6A 2R1DA 2E6VA 4LEJA 5GLTA 4D7TA 4HSJA 4Z92B 4PDWB 1QMJA 4CDQA 3VZKA 3S6PA 1MZ5A 5KWRA 1W6MA 1O3QA 5A3MA 2FBEA 1HLCA 1GSLA 5ACA3 1G9BA 1QH6A 5I8YA 3WZ1A 4FPKA 3U10A 2ZAAA 4C90A 3BOPA 3LA7A 4AHXA 1RUC3 1GFF2 4ASMB 4DS0A 1ZRCA 4AFCA 2VOVA 2ZMLA 4XXPA 2AGSA 5J3UA 1KD7A 1PO13 1R1A1 4AFMA 1QKQA 1H8TB 1O4TA 1VBE3 4I30A 3JB8A 3JUUA 4YG3A 2H0VA 3GALA 4Z8BA 1LOAA 5KXCA 5FQ0B 4JCKA 3ZMOA 3O5SA 5C8CC 3MFCA 4HKWA 2KXLA 5BNNC 2R49A 4YVSA 4XJZA 1GBGA 4OUMA 1ND2C 2XJVA 4F7ZA 2JE9A 1YFYA 4WVWA 5C8WA 4YGEA 2UY9A 2LALA 2MNGA 4QPGC 1EV12 2JG9A 2QKDA 1CJDA 1REFA 5L7OA 3HMYA 5AC93 1NQJA 1PZ7A 3VBHC 3VBRB 5JDBA 5K8SA 5JOXA 2FZ2A 4QXKA 4JC1A 2JG8B 3GF6A 1ZZBA 5KHJA 1QWRA 3CJIA 4PJYA 1W6NB 1PK6A 3TB0A 4XHBA 5EXOA 4MSVA 4FPLA 3RZZA 3WQ0A 2EXHA 4DXZA 3B94A 1SBFA 1AF9A 2OZ6A 4AQTA 1C4RA 2EXKA 1OA4A 2P2KA 1HRV1 2YYOA 4JDMA 2GAUA 4CEYC 4UW4A 5JI7A 2WSVA 4FXGB 1JH5A 4NWWA 2PHDA 4PIZA 4XEZA 2RS11 1QXJA 4Q26A 1BKZA 2JDZA 1C5HA 1BEV3 1VRH3 3ROUA 2ZGQA 4AE2A 2YHJA 3R6SA 1OMIA 4LO4B 1RUE1 5C9AA 4DNYA 4WBBA 3BTAA 3FJSA 4NHLA 5LK5A 3VKLA 5FOJB 3AFKA 2B9UA 1VBC3 3KCCA 1J59A 1MR5A 1WA4A 2AH2A 2WFF3 3E6BA 1F2NA 2WNUA 1SACA 1Q8PA 2C1FA 2RS33 2YXSA 3E5QA 2WZR1 2RS51 1FMD2 1DG6A 3APBA 4X8PA 1C8NA 2YY1A 1DYPA 1SLLA 4LBKA 3TN92 1QXPA 2D93A 3FLTA 3RYPA 1ENRA 1PVC3 2GMEA 1HRI2 2JICA 4NR1A 3MGUA 2EXJA 3VGIA 4COUA 3NAPA 4BZ4A 4HKOA 3OPZA 1QJX3 3RI8A 3ZSMA 5K0UB 5CFCB 2BNMA 2D98A 3ZXEA 3FHIB 2UURA 3ZYGA 2DVBA 2GU9A 1WCKA 1CIWA 2UWAA 4O9GA 1XYNA 4MXVA 1RUF3 4AEDA 3L9JT 4LR4A 2XKPA 4CRQA 2ZGNA 1LOBA 1ZBA2 2E7QA 3H0OA 2JECA 1GNZA 1LHWA 5C6CA 3HD8B 2HWB3 1NZCA 4E27A 5GZFA 2XG3A 3PNAA 1NY72 4MX3A 4YNIA 1QJY2 1ASJ1 1MEC3 4GA9A 2HJIA 2DUQA 2PFWA 2VVEA 2XJRA 5JZGC 4I02A 1NXMA 4YM0A 1OHFA 1RVF3 2ET1A 2Q30A 2VVDA 4I2OA 4ISQA 4L9BA 4CDWC 5EFUA 4KWLA 1NCQC 4XMIA 3N3HA 1KRIA 3UKVA 4QQOA 3WHUA 4P9IA 3ETQA 5BNPB 1I6XA 3O14A 2D3SA 2HEYF 2ZGSA 3FZ3A 1O5LA 3WG4A 2RHPA 4LE3A 4I09A 2BFUS 1TME2 1IS5A 4FT8A 3IWZA 5T5JA 4I0AA 1Q8VA 1QY4A 4PIYA 2ETEA 3CEWA 4QQPA 1I3HA 4K3UA 2X5IC 2OW4A 3AYEA 1SEFA 1VR3A 2Y26A 3SCGA 4JGYB 1CESA 5SV8A 3TNPB 1ULCA 4GALA 2QVSB 1VB4A 2A6VA 2CV6A 3DV8A 3MLLA 3IBMA 4LO5B 5SV5A 2R043 3GZTB 4YZ3A 3ZSEA 2XBO3 4K1YA 3MIEA 2H0BA 3AP5A 3GNEA 4KG0A 5FMOL 2WS93 3H1WA 2AENA 3RQ0A 3I2DA 3ZIXA 1MZEA 4ONUA 2FZ1A 1FOD2 4G4FA 3RG0A 2H6BA 1HIXA 5I0TA 4D7SA 1FX5A 3R4UA 5C8CB 5BNNB 4QHBA 3D6EA 3PVNA 4R9AA 2ZGMA 1VBA2 1FPN3 4FSJA 3ILNA 3VDDC 5C33A 3WP3A 1ND2B 4H3WA 3IIAA 1VLNA 3UK9A 1MS0A 4LO7A 1GZWA 1CQ9A 1S55A 1UCXA 3QD6A 4QPGB 4XFAA 4W6YA 4IERA 4Q4W1 2V09A 3VBHB 1POV0 1DZTA 2FMYA 4WZCA 1DBNA 1PGW2 2QQPA 4IEOA 2BQPA 1EAH1 1U0AA 4HK9A 5DZFA 5LK7B 2PLV2 4CEYB 1VIWB 3M8LA 4ISRA 1LCLA 1I5ZA 1R093 1RGSA 3FFQA 1JUHA 4K7JA 1IKQA 3EHKA 4IESA 4XMAA 2RR13 3SITA 1SFNA 3JD72 5I93A 1COV2 1SBEA 5CB7A 3N7MA 4Q0SA 3VN4A 1OOPC 3WW2A 4ITCA 5BNOA 1IPJA 4GULA 5C4WA 1C3HA 4CP2A 1X50A 2DCZA 3J8F2 3RPQA 4BQ1A 3LAGA 5JIUA 1NG0A 1VBB2 5CBLA 1RUI3 1X82A 2UY8A 1UZZA 5CG8A 4KBBA 1RUD2 3NW4A 3AZYA 1XRUA 4YM1A 1DQ6A 4RR3A 4WM8C 1KS5A 1O7FA 2VU9A 4Y26A 5KHIA 1LOGA 3WG2A 4GH4C 4YW1A 1HQLA 4HN1A 2XH6A 3B3QE 3ALQA 3O12A 2ZGOA 3B69A 4CP0A 5EYXA 4RGAA 5I0UA 1IS6A 1G9AA 3PHMA 2RM23 3WR0A 1HRI1 4N90A 3BCWA 1HXS1 3Q9OA 4L11A 3RWNA 2PHTA 2X53S 3RYKA 1KFXL 3VBFC 1YXWA 5DG2A 3R0RA 1WCSA 1D4M3 3LZZA 3M4FA 3WW1A 2HWC1 4CYDA 1DGRN 4XJWA 4DMIA 1TE1B 3GHMA 2ZGRA 4R9DA 4AGGA 1ND3B 2MHFA 2Q8OA 1AR72 1C28A 4UW6A 4K8FA 2ZGPA 1JYIA 4KNCA 1D2QA 4PDWA 4PQ9A 1DQ2A 1S1AA 4Q1RA 4Q2FA 4LA2A 4XFBA 3JBG2 1ZBA1 2I07B 2IFRA 1OLRA 4FP2A 2GNMA 4AK3A 4XQ4A 1DLLA 1NY71 2D40A 5FPZA 2ZKLA 4B7KA 3KS7A 3B00A 3HAGA 1NLRA 1LHOA 2HKXA 2Z79A 4XETA 5JZGB 4OI0A 4NO4A 2ZACA 2IC1A 2NYYA 4P5HA 4CDWB 3UL2A 4HVQA 3V56A 4X6RB 3U0ZA 1NCQB 4Y4YA 5GZGA 3KGLA 1Y43B 1H8TA 1CAUB 4Q8LA 4Y20A 1VBD3 1OPOA 2F4PA 1NCRC 4M0NA 3TNQA 3PMEA 2DURA 2RJLA 1DHKB 4IEWA 5FQ0A 3NO8A 3WUDA 4LO6B 1F8VA 2HEWF 1CPNA 4S2HA 4FPOB 2ET7A 3TBDA 3KB5A 1SLTA 2BUKA 2X5IB 4GB32 5DDJ3 4CEWA 2JE7A 4EN6B 1CD3G 2RE9A 1H1MA 1WBLA 2PHXA 2PQQA 4E2GA 1QQP2 4S2FA 2C9AA 5KHKA 3K51A 3KMHA 2I45A 4IEUA 4KU8A 4TLFA 3AKRA 2ZOEB 4ZU7A 4YGBA 2JG8A 2AREA 1W6NA 1PVXA 1UU5A 5A33B 1FOD1 4W6XA 1YI9A 2WFPA 4HK8A 1RC6A 1ZVFA 3N4MA 4XJ8A 1GANA 2PN5A