1MVEA

Crystal structure of a natural circularly-permutated jellyroll protein: 1,3-1,4-beta-d-glucanase from fibrobacter succinogenes
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
243
structure length
243
Chain Sequence
MVSAKDFSGAELYTLEEVQYGKFEARMKMAAASGTVSSMFLYQNGSEIADGRPWVEVDIEVLGKNPGSFQSNIITGKAGAQKTSEKHHAVSPAADQAFHTYGLEWTPNYVRWTVDGQEVRKTEGGQVSNLTGTQGLRFNLWSSESAAWVGQFDESKLPLFQFINWVKVYKYTPGQGEGGSDFTLDWTDNFDTFDGSRWGKGDWTFDGNRVDLTDKNIYSRDGMLILALTRKGQESFNGQVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Truncated 1,3-1,4-beta-D-glucanase
publication title Crystal Structure of a Natural Circularly Permuted Jellyroll Protein: 1,3-1,4-beta-D-Glucanase from Fibrobacter succinogenes.
pubmed doi rcsb
source organism Fibrobacter succinogenes
molecule tags Hydrolase
total genus 54
structure length 243
sequence length 243
ec nomenclature ec 3.2.1.73: Licheninase.
pdb deposition date 2002-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1mveA00
3AP7A 4I30A 1KITA 3D5OA 2DU1A 4NO4A 4CZSA 4XBNA 1IOAA 3WDTA 1Q8QA 3T2TA 1H9WA 1LJ7A 2ZGOA 1BKZA 2D6KA 3ZPYA 4BOWA 4M3CF 5CAZA 1WD4A 4LBNA 2DYCA 2D7FA 3WDUA 1LOEA 2VW0A 3NV3A 4XIKA 3POSA 4LBMA 3WHTA 3OY8A 4Q8LA 2ARBA 3V65A 3INAA 5JOWA 2BQPA 4YZ3A 1QKQA 2UWAA 2CWMA 1LEDA 3N35A 4DFSA 1CPMA 3VV1A 2WQZC 2PHRA 2UWBA 2W52A 3GNEA 3HR9A 3POYA 4WV8A 4XJWA 1RIRA 2A7AA 1BJQA 1Q56A 1SACA 1UMZA 4XOGA 1S0JA 5EWSA 2PHUA 4FPYA 4Y22A 1ENQA 5GLWA 2YY1A 1AJKA 3PJQA 1CIWA 1DYKA 1HQWA 1MS3A 2GDFA 4M01A 3WHUA 3WDVA 2JE9A 2ZKNA 4UW5A 3WG1A 2WT1A 5T55A 1HQLA 2SBAA 5DUWA 1G9BA 1W6MA 4Q26A 1N3QA 3I4IA 2ZGNA 2NMNA 2A3WA 2V73A 4XHXA 1QOOA 5EYXA 1A78A 1HLCA 1A3KA 1BXHA 5DG1A 3WCRA 3WVJA 3WDXA 1W6QB 4FQZA 1UL9A 2JE7A 1SLCA 1EPWA 3SITA 1SLAA 2R0HA 3IN9A 1GBGA 2DVAA 5DUXA 1V00A 4TZDA 1KJRA 1S0EA 2E51A 1MR5A 1QDOA 1BYHA 2E7TA 2ZGTA 4JCKA 4P9YA 5FREA 4YG6A 3WDWA 1LHOA 4FP3A 1YI7A 2ZGMA 1YYNA 1TEIA 3PMEA 2DURA 5E88A 5F5QA 3WUDA 1ONAA 1WD3A 3W58A 4YZ1A 3BTAA 3OY8B 3SH4A 5GJ6A 4U36A 4XJ9A 1AXKA 2YV8A 4LBQD 3NV1A 2B7YA 5GALA 2ERFA 3FLRA 1V6NA 2HYKA 1MACA 4DQAA 2H0BA 1S0CA 1DGLA 3T1MA 3V64A 4R9AA 2ZACA 5E89A 4YW3A 2CNAA 4FPGA 2UU8A 3H0OA 1JYCA 1SBEA 3ZXEA 1YXWA 1BZWA 4FP2A 3MW3A 4Y22B 2DV9A 2CYFA 3C2UA 2AGSA 1BQPA 1N3OA 1RITA 1ULDA 4XMIA 4GXLA 1Q8SA 5L73A 1IS4A 1CVNA 2SLIA 2VW1A 4HANA 4BPZA 4ZKTB 1SLBA 4Y1ZA 5JLVA 2ES3A 1R1ZA 1JYIA 4YG0A 2P2KA 1W6MB 3RMYA 1FV3A 2DU0A 1KDKA 1S0FA 2AR6A 2DVGA 4GA9A 5HCFA 3ZVXA 5DZGA 2GN7A 2Z42A 1UKGA 3VKFC 3SNMA 1AXYA 3AXEA 1A8DA 3VKMA 1N1SA 4AGGA 5GZGA 5KXEA 2GNDA 1CQ9A 1VIWB 1KQRA 1O4ZA 2A5ZA 2A6XA 5IK7A 4ISQA 1JN2P 3KQRA 5H9PA 1V6MA 4K20A 1G8WA 3RQ0A 2DUOA 1B09A 2DVDA 1V6IA 4PQ9A 5T5OA 2ZHNA 4W65A 1AXZA 1UZZA 5H9SA 4H55A 1G9DA 2XG3A 4XTPA 2CL2A 5GLTA 1ENSA 3PVOA 1FNYA 1U0AA 1UPSA 4WZFA 1GZWA 3JU9A 3M3QA 5DUVA 3SISA 1O4YA 4FPFA 1NXD1 3ZYRA 2AREA 4UW3A 3RMXA 4R9BA 1GV9A 2ZGLA 1YIFA 4YM2A 2D3RA 3WG3A 5KXDA 2ZBJA 4AVTA 4FOWA 4LBOA 3WUCA 4P9XA 5H9QA 1MZ5A 1D2SA 1KDMA 1QU0A 2GMMA 3AX4A 5JOZA 1VAMA 2E7QA 1LOCA 2ZMLA 1C57A 4LBJA 3UL2A 2ZHLA 2A75A 3NWKA 1FATA 4Q2FA 1ZA4A 4YW2A 3B3QE 4YM3A 4XE9A 2CTVA 5BYNA 1KRIA 1V6JA 1WUVA 3Q9OA 1ENRA 2ZGKA 1DHKB 2EXHA 1MS1A 3OYWA 4YGDA 1LECA 1S1AA 4SLIA 5GZFA 3DGTA 2D6NA 2ZGRA 2A6VA 2GN3A 4Y1VA 1WBFA 4UW4A 4Y1UA 5T50A 5JDBA 5T5PA 1AX2A 1W6OA 1ULEA 1Q8PA 3FLPA 4AGVA 4YM0A 3SH3A 4FPCA 1LHUA 4GKYA 2AENA 2R49A 1SLLA 3AYAA 4WVWA 4AVSA 4YG3A 1WW6A 3IM0A 4WVVA 3OBTA 5T5JA 3RSJA 4XJ8A 3TB0A 3WCSA 4YZ4A 2JJ6A 4PBPA 1H30A 2A70A 1G86A 2AH2A 4BMEA 5GM0A 1UZYA 2JKBA 2D6OX 1UX6A 4XJAA 5DZFA 3B9CA 4PF5A 1AX0A 1SCRA 1SBDA 5GLVA 4MYEA 2VY0A 3KM5A 4DPNA 1LCLA 1IKPA 1G9AA 2A6WA 1GZWB 3AZXA 1AF9A 3GALA 1LOAA 3VKOA 4FPLA 5T5LA 5HCAA 1URXA 2ZGQA 1CR7A 2GNBA 3AZVA 5FRAA 3SLIA 3FUQA 2R16A 1N47A 1IKQA 1LOBA 2EALA 1SBFA 2V5YA 3AZYA 3PVEA 4TYSA 3ZSKA 5EYYA 5CA6A 4Z8BA 3AK0A 4Y1XA 2ZA9A 4ZXKA 1CPNA 2WSVA 3O0XA 1S0IA 4K1ZA 4GALA 4XBQA 4P14A 2JDZA 2P37A 3O12A 3ATGA 1X50A 3N7KA 3HN1A 1AZDA 4XILA 3VKLA 3POWA 1VLNA 2LALA 3OYWB 4Y20A 4BMBA 1C1FA 1FYUA 1CJPA 1D0HA 3L2YA 2VH9A 2C9AA 4FQ4A 2PELA 1AJOA 2D3SA 1W6NA 2W08A 2WSUA 1SLIA 4RA0A 1W6OB 3N3HA 4CTEA 1DQ0A 3IMNA 4AVVA 3ILNA 3N7LA 3ZSLA 3AJYA 1I1EA 2D43A 1VAVA 4KBBA 3VKNA 2GMPA 3ASIA 2KM2A 3AZWA 3N36A 3OGGA 4JRAA 3AJZA 2UURA 4YGCA 5E8AA 3IPVA 1SCSA 4OZXA 3O0VA 1MVEA 5LK5A 3ENRA 4AWDA 3M2MA 1GZCA 4Y1YA 2D6PA 2TEPA 5F9TA 4DRVA 2G4IA 2DWRA 2EIGA 2R1DA 3V0AA 1DYPA 2GNTA 2ENRA 3HMYA 1LU2A 4XIOA 1AX1A 1DQ2A 1JXNA 2PHXA 1F31A 5JVVA 3O5SA 4BLJA 5JMCA 2NMOA 3R4SA 1GANA 1LODA 1ULFA 4YZ5A 4YM1A 1GICA 2D44A 4ASMB 1DQ6A 5CB7A 4XJUA 1KJLA 3AXDA 3FLTA 4XBLA 3WG4A 2CY6A 2OVUA 4Y24A 1H9PA 4YW4A 2W68A 2A6ZA 1QGLA 1DFQA 2NZ9A 1LULA 4XHBA 1VALA 2XB6C 5JOYA 1UAIA 1QNWA 3MPPG 1W6PA 5AVAA 1CN1A 1PZ7A 4M00A 5DG2A 2DUPA 4AYUA 4YW5A 5DZEA 1SLTA 4DRRA 4Y20B 4YGEA 1LHVA 1N1VA 3AYDA 1S0DA 1DBNA 1QOSA 2YXSA 3JUUA 4FPEA 1W6NB 3WDYA 2ZHMA 3UJOA 1LEMA 3AP4A 5DUUA 3ZSMA 3ZXKA 3OBRA 4XDQA 3W59A 1G9CA 2OUJA 1JHNA 1WW4A 2OUHA 5JOXA 3T1LA 3V0BA 3AYCA 1OKQA 3WZ1A 4AGRA 3B00A 3LSDA 1MVQA 4FOQA 3OJBA 4L8QA 1LGBA 3IPVB 2R1BA 4FPOB 1CESA 1NLSA 2YZ4A 3ILRA 1FX5A 2VXRA 3FFZA 3UJQA 4BM8A 3AP5A 4NOTA 1GSLA 1IS5A 3V0AB 2ZGPA 3ZXJA 1ULGA 3AZZA 4Q8KA 3WOGA 1HKDA 5T54A 4ATEA 3WLUA 4YZ2A 2VW2A 2ARXA 3R4UA 1C1LA 1IS3A 5GZEA 3B69A 4YLZA 3RG0A 1YO8A 3N7JA 1HDKA 2DUQA 2ZHKA 3LCPA 4UW6A 1Q8OA 3USUA 2PHFA 1J1TA 1LTEA 3BODA 3M3CA 3NV2A 1QOTA 3A0KA 3LSEA 4XYXA 1WLCA 1Z0HA 4XZPA 3I8TA 5KXCA 4XXAA 1LOFC 1IS6A 3AFKA 1GYKA 1MS0A 1YRZA 3ZXLA 4K21A 4LBQA 4FOVA 1W6PB 4XJZA 1SFYA 2YROA 1JOJA 2A6YA 2ZZJA 1XQNA 2C5DA 2P34A 2PHWA 2VU9A 3FBYA 1QMJA 2Q5TA 1FV2A 4FPHA 2E53A 1DQ4A 4R9CA 4ISRA 1ULCA 3QCWA 5CBLA 1N1TA 1V6KA 3SH5A 5IK4A 3D6EA 4M3CA 5IUQA 2UWCA 1PZ8A 1LHNA 3B01A 4ATFA 2NP0A 3WNXA 3D4KA 5T52A 2I2SA 3V0BB 2DTYA 3M3EA 4M3CE 2PHTA 1S0BA 2A3XA 5IT6A 2VUAA 1MZ6A 4P9WA 1GNHA 3ILFA 2AUYA 2FMDA 3O0WA 1N1YA 2D6MA 5CNAA 3R05A 1S0GA 3AP9A 3AP6A 1LU1A 4C1WA 1DIWA 5DXDA 2CWSA 3FUOA 1LOGA 4Q1PA 1GKBA 2NYYA 4FPKA 3MEPA 1LENA 1LHWA 1I3HA 4GWNA 1LESA 4FVVA 2W39A 1PZ9A 2EF6A 2AYHA 1V6OA 2WT0A 4LBKA 4XTMA 3IKWA 4XMAA 2ZABA 1W0PA 3A0NA 1MS5A 1OFSA 3MW2A 1Q8VA 1DLLA 1Y7BA 1CONA 2R0FA 5EXOA 1RINA 3TAYA 4BQ1A 2GNMA 4YGBA 5SV8A 4C1XA 2P3JA 1WCSA 2LTNA 3PVNA 1FNZA 4Q1RA 5KXBA 3BIWE 1G7YA 1OQ1A 4GKXA 3VUOA 3U4XA 3USUB 1MS4A 1WW7A 3RS6A 4D69A 5GZCA 1F9KA 4F83A 2ZMNA 1JBCA 1WLDA 3QLQA 2JD4A 1GZ9A 4Q27A 1WW5A 2ZGSA 4CRQA 2DTWA 2WLQA 3M1HA 4LBQB 4YFZA 1W0OA 2EAKA 1Z78A 2ZMKA 5GLUA 2ZGUA 5GZDA 3ZSJA 1GLHA 1DQ5A 1WBLA 1QF3A 3NV4A 2NN8A 2OW4A 4PCRA 4DS0A 3AYEA 4JC1A 3OPZA 5IK5A 1MS8A 4YFWA 1C4RA 2NM1A 2RHPA 1AVBA 3BOPA 4PBOA 4U2AA 1QNYA 4M3CB 2E6VA 3A4UA 4HL0A 4XXPA 2JECA 4RL7A 2DVBA 2A3YA 3WV6A 3M3OA 1APNA 2ZAAA 4FPJA 3MW4A 2FHRA 2WNEA 4R9DA 2D6LX 4Y26A 3APBA 3CNAA 2YMZA 2P3IA 3WG2A 5GLZA 3ZXFA 1MS9A 2WT2A 5IK8A 2GMEA 4GWMA 2A71A 1QDCA 3DUIA 2D3PA 2GALA 1JUIA 1FAYA 4YW1A 5HCBA 4LBLA 4IQPA 1N3PA 1DQ1A 2EXKA 2P3KA 1LGNA 4FOYA 3RRDA 5H9RA 1V6LA 1LOFA 1WLWA 1GNZA 1F5FA 1ZM1A 2WKKA 1DZQA 2EXJA 2DVFA 3ZYPA 3UK9A 1UN1A 1W6QA 1LGCA 2EXIA 4ITCA 4K1YA 2WJSA 3N7MA 1G9FA 1JW6A 4BLIA
chains in the Genus database with same CATH superfamily
3AP7A 3MIFA 1VBE2 2WZ8A 4PT6A 2HLEA 2MNGA 4I0BA 4LUMA 2VQTA 5A3TA 5CKNA 3D0SA 3OBAA 3T2TA 4IEVA 1LJ7A 1RJ7A 3GZUC 1OC1A 2ZGOA 1BKZA 2YBPA 5FZOA 5LCWL 1WD4A 2ZKLA 1RVF2 1RUD1 2DYCA 1GWLA 4MHRA 4MGTA 4UBGA 4FAHA 4A4AA 1R1A2 3I3BA 2PXJA 4META 3V65A 2RM21 5JOWA 2H6BA 2JB8A 4S2DA 3N35A 4CCNA 2X5IC 3THDA 5FZ4A 4OYUA 3PUIA 3BIEA 1H8TA 3CLPA 1CPMA 4CDXA 3N9PA 4R52A 2VG9A 1RUH1 3HD8B 1RIRA 3NQHA 1W9SA 1UXXX 4MVTA 2BRTA 4URTA 1RHI3 1UOFA 1AL21 5LASA 5TSWA 2Q8OA 5EJ1B 1HXS1 4XVHA 3T4VA 5JZGC 5IVCA 4QPYA 3POBA 4M01A 1MS3A 4L11A 2RV9A 1AL0G 4PLMA 2JE9A 4O9EA 1AYN2 4CXWA 5C3RA 3WG1A 3K75B 5A32A 1POV3 2WT1A 3H7JA 5BNPC 3AMQA 2QQVA 1W9WA 4AEJA 5FMBA 1W6MA 2ZGNA 1W2AX 2V73A 1WMEA 3QH6A 1XNCA 1WA4A 4BB3A 1BXHA 2VZQA 4FT8A 1PNFA 4CDQB 3BN6A 4RS5B 3WP4A 1C8M2 2QZ3A 4FQZA 3VBOB 1O3SA 2KD7A 3IDCB 1SLCA 1OA2A 3C7EA 2QKDA 4Q4V1 4AI0A 1RUG3 2R0HA 2YHJA 3H1WA 1GBGA 1W03A 4I3GA 5F3CA 4MG2A 2Q8DA 1QDOA 4CDXC 2ZGTA 1XNBA 4LULA 4JKKA 3L2HA 4YG6A 3QOPA 1TMF2 1K12A 4FP3A 4XF9A 3U75A 2ZGMA 2F4PA 3I2KA 4YYOA 1YYNA 5FMOS 3PMEA 1R092 3ZR5A 1D2QA 5BNNB 1RUNA 3W58A 4HZFA 1QQP2 3OY8B 1RUJ2 3SCFA 3OG2A 3K3OA 2EVXA 3VBFB 5FZ6A 5A3WA 2FQPA 3LD8A 3NV1A 5LBEA 2ZS6B 5I0TA 1QEXA 3NNGA 3FLRA 1V6NA 1OLQA 3RFRA 1S0CA 1DGLA 4TLFA 4E4ZA 2GP5A 4HPKB 3EXUA 1GOFA 1QXJA 2QQMA 4YW3A 4IE5A 1QJZA 1SBEA 3LEKA 1CD3G 3ZXEA 1YXWA 3J9SA 3H9AA 4AVAA 4QT6A 3PTRB 4GJYA 4NWVA 4P5YA 3HIFA 4BPZA 1IS4A 2SLIA 4QPIB 4OI1A 1UZWA 1RUI3 2DF7A 3MF6A 3LB9A 4OQ9A 2VTFA 3AVRA 4FAGA 5C3OA 5DMYA 1VBA2 2HWD2 4UFHA 1SZBA 3P1IA 1FV3A 3FFQA 5C70A 1V9U1 1PVC3 4GA9A 1YWKA 5DZGA 1U5IA 1W9TA 5DQ0A 2Z42A 1OPMA 3OD0A 3Q8EA 2Q1MA 3BTYA 4ONUA 5FMDA 3RI8A 4EJRA 2W5FA 2QQWA 4AGGA 4CCEA 4FXKB 2VD7A 5GZGA 1CQ9A 3OUHA 4Q29A 4JGYA 2PAEA 2A5ZA 4AFDA 2BGPA 1F15A 1RMU2 3J8F3 1R083 1XYNA 2DUOA 2TBVA 2WZPP 3RQ0A 1B09A 2D98A 1CIYA 4HBNA 5J1XA 4QQLA 3SEPA 4G9SB 1PIV2 4W8JA 4W65A 3VDDA 5H9SA 5FP4A 2JG9C 2CDPA 5FYTA 5GLTA 2VZPA 1U0AA 3MIDA 1IPSA 4KH9A 2XVKA 3D82A 2R30A 2R072 2ZXQA 1WZXA 1HRV3 4ZU4A 1LRHA 3TN91 4A41A 2V5DA 3N9LA 1K5MC 5JXHA 2OX0A 3K77A 1KGYA 1MPXA 1YIFA 3ZXGA 2ZX3A 4FI9A 1D4M3 3ZFEC 2VMIA 3L9JT 4L99A 4AVTA 3KT7A 2ZEXA 4LBOA 5I8TA 4I2OA 2JWPA 1D2SA 1KDMA 3HQXA 4E8DA 5JOZA 1VAMA 2RMU1 2WO1A 5F8PA 1G6NA 3NWKA 2NPIA 3MUZ1 5FKBA 1RUG1 4JGYC 1HB3A 2VO5A 3Q9OA 4UFIA 1ENRA 5CU1A 4CUGA 2HKXA 1X8EA 4DXRA 1IG0A 3OYWA 3M8LA 3QACA 3LE0A 3OGRA 2F6BA 5ABJA 5GZFA 5FY1A 2WA3A 3AKRA 3HEIA 4RHV2 4Y1VA 4Y1UA 5T50A 3J7HA 2QQOA 4CEYA 1SPPB 2DBIA 1F4AA 2VZTA 5F3IA 2VCCA 4GB32 4AGVA 2HWF1 1BVP1 1O3QA 5DAQA 1AHSA 4UWDA 3UNPA 2R49A 5C3PA 5CEHA 3AYAA 4WVWA 1RUF2 1UU5A 4GJZA 3AMHA 4J25A 3A21A 3T4HB 3IM0A 1LB2A 4QDSA 4UBHA 2I74A 4XQDA 2PA7A 5T5JA 3RSJA 5JAXA 2X5IB 1B35A 1Y3TA 3PNAA 4PBPA 4YZ4A 1H30A 1I5ZA 5GM0A 1XRUA 4G4FA 2D6OX 4KL1A 4N9IA 4CDWA 4RQPA 1FMD2 2C26A 2P3YA 3B9CA 1AX0A 2Y60A 3GCXA 3TEXA 3U4SA 4DPNA 3KM5A 5LA2A 4BQWA 3P3PA 2KXLA 3K48A 5JZGB 1VRH2 4Q4X1 5FP9A 5A33A 1LOAA 4EV0A 1ENXA 3KQ4B 4FPLA 5HCAA 4M4PA 3TRSB 3ZYHA 4LA3A 4XF1A 3SLIA 1K45A 3FUQA 5ABJC 2R16A 1ZZCA 3RYRA 2EALA 1SBFA 2OYZA 5BNPB 4CEYC 4LE4A 5L9BA 2ZAHA 3ZSKA 1ZZ6A 4RFT0 2O0OA 5I0RA 3LA7A 3UT0A 2ZA9A 1COV3 4JDNA 5C4WC 5LY1A 3H8XA 3I3QA 3K4AA 3KGZA 4P14A 4XCBA 3ATGA 3MYXA 5FKCA 1NY72 3BVCA 3E5UA 3OGJA 5FZ3A 3J8F1 1R081 3POWA 3AVSA 5F5CA 1B35C 1VLNA 1WKYA 2C1FA 2WFF3 3R4DB 1NZIA 3JB4C 3SEEA 3LDRA 2X10A 2YPJA 1J83A 2BUKA 2WN3A 3WW3A 5FP3A 2WSUA 4RQPC 3KHCA 2VQAA 3PUAA 1CZVA 4BIFA 3BTZA 3IMNA 4D6SA 5CFDA 4ES8A 5JMOA 3J7LA 1JYTA 3AJYA 4EWDA 2Q8CA 4UFKA 5F7UA 3MF9A 2Q1ZB 3ASIA 5HV0A 1O8PA 3AZWA 1AR63 3N36A 3AJZA 1GR3A 2GC1A 2XGXA 3M7AA 4LHKA 4XFAA 4YGCA 5LK5A 1D4M1 1SCSA 2D5HA 2VZSA 1Q3EA 5FZKA 1PHMA 3BTXA 4KG8A 3AKQA 1RGSA 1NLQA 4QHBA 4HVQA 2DWRA 2R062 3GHMA 2R1DA 4YWAA 3E5XA 5LW9A 1BBT2 2QBXA 3S5AA 1YNAA 5JI7A 2PLV3 2PHXA 1H4GA 3RZGA 5L7OC 2HEYF 5IVVA 2BBAA 3EHKA 4FBFA 1WGPA 2Y26A 4LIUA 1JI6A 2XL7A 5BPXA 3CJIA 1DQ6A 5CB7A 4XJUA 2W94A 1KJLA 5LEJA 2VMCA 3C7GA 3AXDA 4XBLA 4KGQA 5FZDA 1HQNA 5CFDC 2G9ZA 3ACIA 5AFBA 4AHYA 1GP5A 5C8CB 4CCJA 4GH4C 1S4CA 3ZN6B 5JOYA 1UAIA 1W6PA 4QPGB 4CDUA 2YDEA 3S6PA 1PZ7A 2RE9A 3EB7A 2WFPA 2Z69A 2ZCWA 1KEXA 1ZBA2 3JQWA 4JTOA 5DZEA 4YW5A 4DRRA 2E33A 2WNUA 2VJXA 4Y20B 3PMSA 1LHVA 5BNOC 2J1TA 1YFXA 4WBBA 1GOHA 1QJX2 1S0DA 2CAVA 2ZHMA 1RXGA 3GJBA 1VBB2 1YIPA 5KHHA 3ZSMA 3DV8A 5DUUA 5FZIA 3ZXKA 3OBRA 2JG9B 3W59A 2WUHA 5IAXA 4RD7A 4BK5A 1WW4A 5FLHA 2IXIA 2OUHA 3V0BA 3AYCA 3WZ1A 3ZPOA 4AGRA 4FOQA 3GXUA 3MZHA 2R043 2PHLA 3CJIC 3BU7A 3IPVB 4UXAA 1XNDA 1K5MB 4ARXA 2YZ4A 4D8MA 1FX5A 2VXRA 2WZR3 4BIOA 1XB9A 4FO9A 3ZFEB 2MHFA 2XJRA 1UPIA 2R6QA 4MGQA 2VCMA 1NKGA 1JZ2A 3ZXJA 1EV12 1ULGA 4CDUC 3AZZA 4Q8KA 3WOGA 5A7WB 5A3MA 5FOBB 3ZYBA 1HKDA 5LWBA 4A7ZA 2ARXA 2WFF1 5FP8A 4BQ3A 2W46A 1IS3A 1DF0A 4YLZA 2VZOA 4UW6A 3GBWA 5FAXA 5LBCA 1RUD2 5FIXA 1DGRA 1OKOA 3RNSA 3WSOA 1J1TA 3LA2A 3EJKA 1W28A 1J59A 1QOTA 3JD72 2VOTA 4XYXA 3VZLA 3I8TA 5FXZA 4XUTA 3AFKA 2C4XA 2YB7A 1EUUA 4K21A 5A80A 4XJZA 4DEQA 2YROA 4HSLA 1JOJA 1XSQA 4AI3A 1XQNA 4I0WB 1XNTA 1AR93 2EAAA 2PHWA 2FMYA 2Y6KA 2Q5TA 2PAMA 3AC0A 4BZ4A 3U0ZA 4FPHA 4GZ9A 4ISRA 1OOPC 4OHZA 3VDAA 3PUSA 3WQ7A 3IDEA 2QQJA 2WABA 4EWEA 5IK4A 4I02A 3THTA 5LK7B 2PLV1 3CDZB 4ATFA 3WNXA 1WWYA 4ZS3A 3B5LB 2I2SA 2WC2A 5LEKA 1IHMA 3R0RA 4QPWA 2HH9A 2RDRA 1SG3A 3I2IA 4X8PA 5E6HA 4IUGA 4XDOA 3VBHC 2D6MA 2YPDA 1QH7A 1RYYA 4BE3A 1VB4A 3AP6A 1LU1A 5FZCA 4CYDA 2RS12 1DIWA 1UX7A 3VBRA 1GKBA 2NYYA 3DN7A 1LAJA 4CEYB 1LENA 2QQPA 3JBG1 1PZ9A 1ND2C 1NE4A 1MEC2 1ZRIA 2Y38A 4IGPA 5DAPA 3ZXAC 2YC2A 4N9HA 3T0DA 5C4WB 1TNRA 2VZ3A 1E5HA 3K4ZA 2XXZA 3BCWA 1DLLA 1Y7BA 4NHLA 2YYOA 5EXOA 3TAYA 2DCKA 5FK8A 3ACLA 2GNMA 5SV8A 5FPLA 4C1XA 4AAPA 1AYM2 4XF0A 1QJEA 1WCSA 2LTNA 3DYPA 1OURA 3KVBA 2DFCA 1YJLA 5KXBA 1F8VA 1UXZA 4GKXA 3VUOA 3U4XA 4EYUA 1WW7A 1TME3 2V4VA 5GZCA 1CJDA 2FDKA 4AI2A 4IE0A 3O1OA 3H8OA 5A6XA 1GZ9A 1ST8A 4CRQA 3KVAA 1RL3A 2DTWA 2WLQA 3M1HA 1VBD3 1ZBE2 3WNKA 2ZGUA 3ZSJA 2J1EA 4XAEA 4HLTA 3I59B 2HWC2 4QB2A 4ZZ5A 1DQ5A 3CEWA 5E16A 4QD2A 1JZ7A 1Y9QA 3NV4A 3DEMA 1CZSA 2NN8A 5FBJA 2AEZA 2JG8C 3AYEA 3DPRA 5IWFA 2BYVE 3ITQA 3BU0A 1AVBA 3CL1A 4MLOA 2E6VA 2Y6JA 3H7YA 4HL0A 2A3YA 1SDWA 5FWEA 4RGGA 1JOPA 2J1VA 4GWIA 1X33A 4QKNA 4N90A 1KFUL 2D6LX 2R7EB 4Y26A 2WBKA 3CNAA 4MADA 2YMZA 3NKGA 5A3NA 5FOJB 5L7OB 2V72A 1HV0A 3AL5A 4RGKA 1POQA 4QQOA 1QHDA 2DCJA 5FPZA 4AL9A 2GMEA 4GWMA 4MH0E 5FZLA 1W3VA 1JH5A 4MGSA 3RVHA 4AF9A 2P1BA 4DXSA 1FAYA 3O1VA 2H0VA 4RSUA 2P3KA 1ODMA 5FTTC 3KGLA 2VMFA 2RJKA 3CJXA 1LOFA 1GNZA 1F5FA 1OSGA 1W3XA 2EXJA 4GH4B 4CEWB 5FPXA 3ZYPA 4CDQA 1NE6A 4RS5A 1UN1A 1Z7S3 3VBOA 4OI4A 4UFJA 4XDPA 1G9FA 3H8UA 1JW6A 1ZX5A 2WINB 4I30A 4QX2A 1RHI2 3DPRC 1KITA 3D5OA 3H8RA 5FYCA 3B93A 1IOAA 2WLPA 2HWE1 4XBNA 3WDTA 5BNOB 4QGMA 3S0MA 4D7SA 3K51A 4M3CF 1VBC1 4PIZA 4LBNA 4YARA 1W99A 5BNNA 2CU5A 3NV3A 5KHKA 3WY6A 5A7PA 5A3PA 3OY8A 4Q8LA 5D2AA 2VMDA 2ARBA 1PGW1 3VBFA 2UWAA 5FUIA 3WW1A 2VQ0A 4QX3A 4IEOA 2CGNA 4HPKA 1HRI1 3ETPA 4FCAA 3WP5A 3WT3A 2Y0OA 4D6QA 2JDPA 3KV5A 4BWOA 1BJQA 1SACA 4QB1A 4QX7A 3UGGA 4CDQC 4CE8A 3W5MA 4RS5C 4URAA 2YY1A 4YRDA 2WS91 4QPIA 1HQWA 2GDFA 2ID4A 3ZN5A 3WDVA 2LUWA 1H6YA 1TME1 2D97A 1ND3B 3KV6A 4GWJA 5T55A 3U10A 2SBAA 5G04L 1VMFA 2RG4A 2WNVB 3UKNA 2O8OA 1BK1A 3ZKUA 3N9MA 3P6BA 2P5BA 1W8ZA 5BNNC 4Q4W2 1A78A 4JGZB 1RUC1 3IB3A 3WQBA 5I91A 4ASKA 2BWCA 3WVJA 3VBFC 3WDXA 4EN7B 3KV9A 4P9GA 3WXPA 5K8SA 1EPWA 2ARCA 4BXFA 3NW4A 2DVAA 2GC3A 1V00A 4IERA 2RM23 4GULA 1KJRA 2BGCA 1S0EA 5AC91 1OT5A 3IZOA 1AR81 2JDKA 1OOPB 2VUCA 2IXKA 3D0JA 1RUI2 1ZA7A 5FY5A 2QCSB 1DP0A 4UT5A 3A22A 3GZEA 2DURA 1A8MA 1UZVA 5E88A 1RUH3 5F5QA 4Z07A 3VD4A 1V70A 4YZ1A 1PVC2 2XBO1 3BTAA 4QPIC 4HMZA 3SH4A 1AL23 4U36A 4EN0A 1HXS3 2YV8A 3JZVA 4LBQD 4PLOA 4D7YA 5GALA 3RGBA 3VBHB 2ERFA 4DQAA 5FZBA 1UY0A 3HNYM 5FYVA 1O3RA 3KWVA 1MZFA 1E57A 3M4FA 4I09A 3I2HA 4R9AA 5FPAA 4OHYA 2ARAA 2CNAA 4FPGA 4Q4Y1 4KWJA 4AQ6A 4PJYA 3J8F2 3H0OA 4XQ4A 1JYCA 1ND2B 2D40A 2BPA2 1BZWA 4KI5M 4Y22B 4DUWA 1BQPA 1N3OA 1RITA 3EYPA 4WVZA 1ULDA 4HT1T 5L73A 2XJUA 4HANA 2ZX4A 4ZKTB 3PUQA 1K42A 2W9XA 3FN9A 3CIHA 4N8MA 5FZGA 4Q4V3 3TWIA 1YQ5A 5APAA 4CCMA 1HRV2 2P2KA 3RMYA 2E32A 2JEMA 2JENA 1KDKA 2AR6A 3ZVXA 5HCFA 2E26A 4LUKA 2PQQA 1SPPA 2GN7A 4E27A 5FO9B 3I54A 5KWRA 2WYSA 4QQPA 3AXEA 5CYYA 5J98B 4KQ7A 1UU6A 3LF7A 1VIWB 2BEOA 5BNQA 3RJRA 3SCHA 5IVJA 4HN0A 5IK7A 3IIIA 1JN2P 3KQRA 2PYTA 4IE6A 2VULA 2JG8B 2X5IA 4PQ9A 4QXKA 3UKVA 1JZ5A 1QXPA 2XLFA 3T2OA 1CAVB 1LR5A 3FZ3A 5FYYA 4UI9L 4XTPA 3VL9A 4JAAA 2CL2A 4B29A 1ENSA 1L7RA 1T6GC 1UPSA 3TOJA 5JZGA 1WMXA 4ZZ8A 3MLJA 1CAUB 5DPNA 1O4YA 1NXD1 3LEMA 4RR3A 1ASJ3 3RMXA 4OI2A 4R9BA 5F5AA 1UY4A 2BOJA 4P9LA 4CPBD 5IJRA 5BNPA 1H4HA 4XFGA 5BV6A 3WW2A 1H1AA 1PNGA 4P9XA 4ZONA 1UOGA 5H9QA 4EZ4A 3AX4A 3H50A 1V9U3 4LBJA 1C57A 1FOD1 3UL2A 5I93A 4ET7A 1L7LA 1SMVA 1YEWA 1I9RA 3FHIB 3POFA 4YM3A 3O1RA 1R64A 2CTVA 3Q8BA 4JHZA 5BYNA 4LO6B 2XHNA 1E5SA 2ZGKA 3WX5A 4F3JA 3LPGA 3DPRB 1YHFA 4SLIA 4C91A 2D6NA 3OUIA 2ZGRA 2A6VA 3ETQA 4LLOA 2IWGB 1A34A 1YQ8A 2FCVA 2Q0AA 4OCTA 5FYSA 2WYFA 3LEGA 2J42A 4YM0A 1CAXB 2CHHA 4IXLA 1L7QA 2Q30A 2P6CA 4LOSA 1D7PM 3MUY1 4RR3C 4BXSV 4WVVA 1PX4A 1COV2 4PIXA 3LOIA 4QXBA 1D4VB 4LHNA 3NVCA 3TN93 3WCSA 3TB0A 2C6SA 2JJ6A 3ORJA 3KCYA 2A70A 4NJ4A 3VHRA 1PMJX 1J84A 1UZYA 2JKBA 4IV1B 1YFWA 5A7SA 1UX6A 1GMMA 4XJAA 2WAAA 5DZFA 5GLVA 1SCRA 5EHDA 4DY5A 4A3XA 2VY0A 2VR4A 1LCLA 1US2A 2FZ1A 2RMU3 4MZUA 1Y4WA 4QDQA 4QGLA 1G9AA 1GZWB 3AZXA 4CU7A 1AF9A 3E6BA 3POEA 3U14A 1VMHA 1KS4A 2AACA 4FTBA 4A3ZA 4Z1VA 3AZVA 1J3RA 3WW4A 4LEJA 5C5TA 1W05A 4CU9A 4BQ2A 1IKQA 4PF1A 1YQ2A 3AZYA 2XMLA 3VBUB 1ZNPA 1AR62 3JQXA 4TYSA 5CA6A 4KGGA 1FI2A 3WD5A 4XUPA 2XJPA 5C8CA 2PMWB 2OA2A 2LROA 4JKLA 2WSVA 1NYWA 3ZN6A 2P37A 4QPGA 1X50A 2HWF3 2JD9A 2FDIA 3E97A 1GQGA 1AZDA 3ECQA 3HJRA 3UGFA 4QQ2A 3I3DA 1PMIA 3HBKA 4Y20A 4BMBA 1QXRA 2PLV2 3IDAA 1CJPA 1D0HA 3L2YA 2JDAA 2XLAA 2VH9A 4FQ4A 2PELA 1AJOA 1SLIA 2QTWB 4CP2A 4I01A 1PVXA 1W6OB 3ABZA 2JG9A 3NNMA 4TLGA 4AVVA 3ILNA 2F17A 3N7LA 2PTMA 4LT5A 5IVEA 4BJ0A 4WM8B 1VAVA 4HXCA 4GIQA 3VKNA 1ASJ1 1OLMA 2Y0IA 1QWRA 1PO11 1WA6X 3WP6A 5JIAA 4Q4X3 2VCAA 5B4XA 3SQOA 3IPVA 2FZ2A 1MVEA 1K5MA 2E9QA 3RWKX 2ZX2A 1OH3A 2VNGA 4Y1YA 1PGL1 1RXFA 4IEXA 3FHQA 4DRVA 3ZFEA 2BWAA 2CV6A 4AE2A 5C8CC 3PU8A 4LO8A 4DB5A 1DYPA 5HPOA 2ENRA 3B7MA 1QJY1 4LK6A 1AX1A 4QPGC 3WQ1A 4DO0A 4S2FA 5CG8A 5A7WA 1JXNA 3SCGA 3ZYJB 4DUXA 5AFEA 1NCQB 1F31A 1PX3A 1H2KA 5DDJ1 3NJVA 1GANA 1LODA 4NN0A 1ULFA 4CP1A 4YM1A 4H14A 3PIJA 2D44A 4ASMB 1AR73 3I2FA 3ZX7A 3ALQA 5B4NA 1PO22 2R042 3S5QA 1FPN1 3I49A 2OVUA 4Y24A 2W68A 2ET7A 2CDOA 1H2LA 2VAUA 2VC9A 2WZR2 1XSRA 5LA0A 4IEQA 4D7TA 3OGVA 4CCLA 4HKLA 2XVLA 2XJTA 3TNQA 1CX1A 4XFBA 1SLTA 4AI9A 1XU2A 2B9UA 2GP3A 5KR7A 3DXUA 2K9ZA 3POIA 3DXTA 3WF1A 4LKEA 1W6NB 5L9VA 4XW3A 2XUMA 1GU3A 4XDQA 1G9CA 2OXBA 2OUJA 2PHDA 4CCDA 1S2EA 4Z2WA 2O14A 2XL9A 4S2HA 4DEVA 4A44A 2WO7A 3A23A 4FFGA 5F6LB 1W2TA 1HV1A 4Q0QA 2MEV2 5F2WA 4L8QA 1OH4A 4LHSA 3F95A 1NLSA 2XR4A 1EY2A 1RC6A 3ILRA 3MFAA 2BOIA 3JCIA 3LIHA 1W0NA 4BM8A 4E8CA 1AR92 4BHPA 3GDBA 1IS5A 2IXCA 2ZGPA 4QQHA 1UQXA 3H1MA 3N4MA 1S2KA 3C7OA 4QB6A 2OZ6A 2JIGA 2B45X 2GZWA 5LBBA 3OD4A 5FY7A 5C4WA 2Q8EA 1O5UA 4ATEA 1DG6A 3WINE 3WLUA 4YZ2A 1V0AA 5JIUA 1C1LA 4AZZA 4H2AA 1YJKA 3NJZA 1BCXA 5F6KA 5M0TA 1HDKA 1QJU3 4W6WA 2VTXA 4GQ7A 3TEWA 2FBEA 1LTEA 4QWNA 2W91A 2FCTA 3ZLIA 5KBFA 4R4ZA 4XXAA 1UYZA 2UY8A 4XEZA 1IS6A 1GYKA 2JKXA 2RR11 4FOVA 4YVSC 3RJ2X 4NHMA 3D3AA 1JZ6A 2A6YA 3BKZA 4OHXA 1E5RA 2C5DA 3I59A 4KU8A 4RR3B 5D8AB 2GC0A 5EIYB 1FV2A 5C6CA 2JE8A 3IDBB 5K7PA 4R9CA 3VB9A 1ULCA 2YFUA 5ERLA 2X53S 2BVBA 4MHUA 4HG6B 4E4SA 4L2NA 5IHRA 3PL0A 5FZMA 2VNVA 1XOYA 4OLLA 5J48A 4IE7A 2VZVA 1PZ8A 3MFCA 1TME2 3WR0A 2D93A 3LPFA 5T52A 2QUOA 4FFIA 1Q5OA 3LEIA 2A3XA 2IVIB 2RS51 2BU9A 2YC4A 4P9WA 4UOJA 4AQTA 5L7OA 3DF0A 1GOGA 3O0WA 1NQJA 1AR71 1VBD2 5CNAA 3AP9A 2HEVF 2G9GA 4C1WA 3I3EA 1Q43A 5ACA1 4E4HA 2VXJA 2W1WA 3FWEA 1LOGA 4Q1PA 3LIGA 5K0UB 5L36A 3MEPA 4KG0A 3KMHA 1I3HA 1S55A 5AVAA 1XPWA 4N43B 4XTMA 2G19A 1GP4A 1W0PA 3A0NA 1HB4A 1OFSA 4QX1A 4GH4A 4CEWA 1Q8VA 4LR4A 1AYN3 2JIJA 2B5HA 3H1YA 1GUIA 4S2GA 1OXCA 2P3JA 3J26N 1ZRFA 1HJGA 2VVEA 2YFZA 3E6CC 1RUE1 3FHAA 4Q1RA 1OLME 3KV4A 1OQ1A 2B39A 4NR1A 5BNOA 2J22A 4D6RA 4LPLA 2VUJA 5CIRA 2ZMNA 1M4WA 3HVDA 1JYNA 4BCUA 1WW5A 2BDRA 4LBQB 1UY3A 2ZMKA 3WNOA 1UYPA 2UYAA 5GZDA 4AFMA 4E4DX 1UW8A 2LW8A 2BNNA 4A7KA 1KD7A 1DCSA 4ZXEA 1WBLA 1TMF3 4DY3A 2LRPA 2OW4A 2WZEA 4AEMA 2C9KA 3OPZA 1Z7S2 5A3UA 5IK5A 5DN2A 1C4RA 1X9TA 2RHPA 2RJLA 1O91A 1IPKA 1YC61 3BOPA 1QNYA 3CBNA 3E1F1 4QKDA 5L9RA 1RUJ3 3A4UA 3JBG3 3POGA 4RL7A 4CEWC 1SQ4A 1BMV1 3AM2A 5LATA 1H1IA 3MW4A 2WNEA 5IYYA 5FY9A 4R9DA 5JI9A 1L3JA 5DAWA 1QJU1 5JPMB 3WG2A 1H0BA 4AEKA 3ZXFA 2XUEA 4YVWB 5IK8A 4Z92B 1ND3A 2QQNA 3RDIA 3BI3A 3DUIA 2D3PA 3OOXA 3C3VA 4XC9A 2GALA 2GU9A 5LB6A 4YW1A 2WNVA 4IQPA 1TE1B 4LBLA 1N3PA 3QD6A 3S7EA 3ZFFC 3WF3A 2QVSB 1LGNA 5C3QA 3RRDA 5H9RA 1WLWA 3MIBA 4JGZA 1XC6A 2E63A 1PMHX 2YG0A 2HEWF 3UK9A 4AOCA 2QNKA 4K1YA 5I0UA 1OQDA 3KS7A 4DS0A 3N7MA 4XABA 1VAKA 5FV3A 5FZ7A 4A2UA 4GAZA 3I7DA 4ZY9A 4V2WA 1RVF1 3GZAA 2DU1A 4NO4A 4CZSA 4EN9B 1IG3A 3V56A 1OOPA 2QFEA 4ZU7A 1BVVA 1R1A1 1UOJA 2IVJA 2WWJA 3LFMA 3ZPYA 3OPTA 5CAZA 4AI8A 3JB8A 4ARYA 1PK6C 3POSA 3POJA 1NCRC 4LBMA 1FT9A 2WNOA 4IEPA 4LKFA 3T2PA 3URFA 3WHTA 1QY4A 3WNPA 4YZ3A 1ND3C 1QKQA 4HONA 3VBHA 2CWMA 1LEDA 2K0GA 2VZ1A 4XUQA 5EZWA 3S30A 4DFSA 4PIYA 2WNVC 5CZKA 2NLRA 2WRAA 2W87A 3VV1A 1XNAA 2WQZC 3POYA 2W52A 3GNEA 2Y34A 4JKMA 4WV8A 4XJWA 3SMHA 3ZYIB 4C8DA 2RM22 4JGZC 3NJXA 2A7AA 1ND2A 1AYN1 2VBDA 3BGAA 5C9AA 2VBBA 1UMZA 2J1RA 2YGLA 1GNYA 3HNMA 2PHUA 4FPYA 4XOGA 4Y22A 5EWSA 4AXOA 1W8NA 2XKOA 2O1QA 1DYKA 3HAGA 5A7NA 1RUH2 2ZKNA 4NIDA 4XFFA 4BQ4A 1AL22 1HQLA 1HXS2 1C8M1 4K9SA 2HWE3 3MV11 4B1LA 1C8NA 2NMNA 3ACFA 4XHXA 1QOOA 1HLCA 4O9GA 1VBC3 4YVSB 3MGUA 5BXXA 1NA1B 3WCRA 3Q8FA 1ZREA 1TMF1 3ZXDA 4LKDA 2JE7A 4L9BA 1SLAA 4R8HA 4RHV3 3SITA 1R091 3IN9A 5DUXA 3NSTA 1MR5A 1W2UA 1BYHA 2E7TA 2OKXA 2JG8A 4JCKA 1QQP1 3OEAA 4NPMA 1RUJ1 4FFHA 2FDGA 5J96B 1LHOA 1YI7A 1CAVA 1DZTA 5C33A 1HRI3 4Q4V2 1RUF3 5C9AC 1P8JA 3UV9A 4LO7A 1ONAA 1T2XA 1WD3A 1I6XA 4LLFA 3RYKA 2V4AA 4XJ9A 1AXKA 1CAUA 1RTVA 2B7YA 3CZJA 1OLRA 2WS93 5FMOL 2HYKA 5FZ9A 1MACA 3WQ0A 4NIIA 3T08A 2H0BA 2VOKA 4Y3OA 2JX9A 2ZACA 3ST7A 4GMP0 2QQLA 4W6XA 4FP2A 1VBA1 3MW3A 2HWD1 1XXNA 2DV9A 3B94A 1Y9MA 2EIEA 2XQRA 2ZX0A 1RUC3 2AGSA 4LORA 4BH9A 5HCHA 3P3NA 4XMIA 3MHZA 1CVNA 2P4EA 3PVBB 4MSVA 4Y1ZA 4ASLA 4FTEA 1TQ5A 4XQWA 2XH6A 2TNFA 2MPFA 2ILMA 4X6RB 4YG0A 5ISLA 5AC93 2K46A 4O61A 5JXGA 1ZYBA 3T0BA 3U37A 2DU0A 1AR83 1S0FA 4UF0B 1UYYA 5FY0A 3U1XA 3U78A 3VZMA 3IAPA 1NZCA 1OD3A 4YSFA 1UKGA 3VKFC 3SNMA 5FJKA 1VB2A 3VKMA 1A8DA 1CAXA 5KXEA 2BP6A 2GNDA 4I0AA 3VZJA 1PIV1 4Z82A 1KQRA 2W1UA 5FPBA 1V9U2 3O1PA 2XBO3 4XUOA 5LZ6A 1DDLA 5H9PA 3LWCA 4GMP1 1V6MA 4K20A 3ZSEA 1G8WA 3S57A 3RZJA 1XE8A 2FD8A 1V6IA 3PJYA 2DCZA 2R071 4OUMA 4LXLA 4UFMA 4Y4RA 2ZHNA 1AXZA 4IV1A 5F32A 4H55A 4AQ2A 1YUDA 2LM3A 1G9DA 1DU3D 1U5ZA 4QM8A 2XG3A 1CZTA 4Q4Y3 4XACA 5IFPA 4HFSA 3PVOA 4N7IA 1FNYA 1UYXA 4QX8A 2HBUA 1GZWA 3JU9A 3M3QA 5DUVA 2PQSA 1ZZ8A 2WWUA 2AREA 1IQDC 4UW3A 1W8TA 2I45A 2RS33 3I97A 1GV9A 3HWJA 3BB6A 4CCOA 2D3RA 5KXDA 2ZBJA 4BDVB 4FOWA 3VBUA 3I2JA 4CP0A 1MZ5A 2GMMA 3TN92 1M06G 2E7QA 3ZFFB 1I5PA 2ZMLA 4EN8B 2A75A 1FATA 4Q2FA 1ZA4A 4YW2A 4B1MA 4RHV1 4XE9A 3UGHA 1AUYA 4KWUA 4XF4A 1KRIA 1T6BX 2QQIA 1ZZ7A 3NAPC 1DHKB 4NRPA 2RMU2 4GB31 5FYIA 4IL7A 4PLNA 1LECA 3VD3A 4IV1C 4H3WA 1XE7A 4LO5B 5LBFA 3FJSA 1OFNA 1RUF1 1RUG2 4XAAA 3UKTA 1W04A 1WBFA 4UW4A 1YCIA 2YU1A 4CCKA 4PDWB 1W6OA 4N53B 2EICA 1Q8PA 4MGIE 4M0HA 1OPOA 2ZTNA 4DMIA 3SH3A 2DCYA 1PK6B 5FYZA 2AENA 5FZAA 4WM8A 1SLLA 4AVSA 1NCRB 2QDNA 1GFF2 1WW6A 2JXAA 2BERA 1FMD1 2Y8KA 4MX3A 1F35A 2DBNA 3WF0A 2HWF2 2VPVA 3VBUC 4BMEA 3TEYA 1VRH1 1IQAA 4IV3C 1OA3A 4CA9A 2PFWA 4CXYA 4X6QB 1CGPA 5I0DA 1OVSA 5A1LA 1SBDA 5C3SA 4MYEA 1W8OA 1IKPA 1FOD3 3OSDA 4JRLA 2A6WA 4Q0VA 1QIQA 1WCKA 1NCQA 3VKOA 4UYBA 5T5LA 1QJFA 1VE0A 2ZGQA 1H2MA 2GNBA 2QQKA 5FRAA 3N9QA 1SFPA 3CQOA 3UYJA 2V5YA 4OULA 3PURA 4UAPA 4KWKA 1NY71 3PVEA 4Q4X2 5EYYA 4Z8BA 5LRSA 2WIIB 3Q8CA 4D94A 4IEZA 1YFYA 1C5HA 2CAUA 2ORZA 3FL7A 4I3PA 1OQEA 1CPNA 1BEV3 1C3HA 1S0IA 3O0XA 4K1ZA 4WM8C 2JB4A 4XBQA 3RI9A 1GWKA 1H2NA 1U5YA 4CCCA 4P5HA 3HN1A 4ZPIA 2VL4A 5JXJA 3OF1A 1SFNA 2Q4SA 2ADEA 3VDBA 1FYUA 4XUNA 3DL3A 5F1RA 2VQUA 4KMQA 1W6NA 2ATFA 1J1LA 3G6JB 3B02A 1R082 4E2SA 4Y4YA 5C9AB 5KC6A 3N3HA 4CTEA 5JPNB 1YFUA 4QX0A 4CU6A 1W8FA 1OBNA 1I1EA 1NCQC 3CZUA 4QHOA 2VZUA 4KBBA 4NHKA 5FXXA 2JICA 3IWZA 4QU1A 3TYJA 2RS31 2R061 2B9VA 3OGGA 5FFOC 4LQRA 1BBT1 1MZEA 3AFGA 3O0VA 4L97A 4AVCA 3M2MA 1MQTB 1GZCA 5IFTA 2TEPA 3BPZA 2G4IA 1NQDA 4P02B 4CVUA 3VBSA 2OPKA 4DNYA 1VR3A 2GNTA 3HQRA 4NHXA 3HMYA 1D4M2 1NOVA 4H7LA 2DDUA 2Y6HA 4RFRB 4AAXA 1DQ2A 4TTGA 5JVVA 3O5SA 4BLJA 5JMCA 2NMOA 3LAGA 4XZUG 3VGIA 2YC0A 4C0BA 4EWAA 5I0SA 2AC1A 5C8WA 2HJIA 4A45A 5HXMA 5HBAA 4HK8A 3FLTA 3PUHA 1ZBA1 4YW4A 1H9PA 2OQ7A 1NG0A 2A6ZA 3KCCA 3OB8A 1QGLA 5BY5A 2NZ9A 1LULA 3CO2A 1VALA 2XB6C 1QJX1 2N7GA 3U07A 3MPPG 3WEZA 2HWB3 1CN1A 1LNSA 5ANNA 1VBB1 2XONA 4M00A 2DUPA 4BA6A 3FMGA 3OPWA 5D8AA 4MGYE 2B4KA 1PO13 4PI2A 1N1VA 3AYDA 4J1WA 4COYA 1DBNA 4QGNA 1QOSA 2VNRA 3JUUA 4FPEA 3VBSC 1UF2C 5K9YA 1BMV2 2X8KA 2GH2A 1GZTA 1LEMA 3S7IA 3GBGA 4EQVA 2X09A 2ZOEB 3NKTA 4OHVA 2HWC3 3LOBA 1JHNA 3J7NA 4HETA 2OIIA 2YGMA 4CUAA 5JOXA 4BQ1A 1NT0A 1C28A 1QJY3 1W8UA 2VOVA 5A6YA 1JOBA 4DIQA 4OUEA 2DCTA 3MDPA 4MGKE 2W3JA 3OJBA 1EV11 4QMAA 5DDJ3 4AEDB 4FPOB 3LKJA 3VD5A 2VGDA 4QHZA 1UWWA 5LA9A 3UJQA 4MXWB 5K0UA 3AP5A 1UZ0A 3NMBA 1GSLA 1YLLA 2R32A 2P17A 3V0AB 1BEV1 1BLZA 1ZRDA 3ZYGA 1FPN3 4MXVA 4K3UA 4N43A 3HPNA 4UFLA 5EFUA 4RGAA 3ZYFA 1TZOA 5T54A 1EYBA 2BW8A 3JD71 3QH7A 3NJYA 5D8AC 3I2DA 2WN2A 4WM7B 1J3PA 3NAPB 2ZHKA 5IVBA 5CG9A 3LCPA 4LA2A 3KCXA 1IZ3A 5HXVA 1Q8OA 4MV2A 5A7OA 3NV2A 3M3CA 3A0KA 3LSEA 2UY9A 4JQRA 5ANQA 1WLCA 1Z0HA 2WFF2 5FZEA 1WCDJ 4A6SA 1JU3A 3N9OA 4IE4A 5FZFA 4BYYA 1YRZA 3RZZA 4AK3A 4LBQA 3IMMA 1KS5A 2W1QA 1QH6A 5FXVA 1OUXA 2ZZJA 5FBZA 1E5IA 5A7QA 4AHWA 3FBYA 1QMJA 3AMMA 2WA4A 4M4RA 4CSWA 2E53A 1DQ4A 4BISA 4DOUA 5K0UC 3MIEA 5KC5A 1RJ8A 3EQEA 1D0GA 3QCWA 1EUTA 3ZN4A 1DLCA 5CBLA 1V6KA 5IVYA 4N43C 4Y33A 4IV3B 5EJZB 5FQ0B 2HBTA 4O65A 2A1XA 1LHNA 2RS11 4DXZA 3M70A 1JMUB 1ULPA 3EMRA 4OHWA 1JYVA 3IBMA 2NP0A 2XWJB 4DZGA 3M3EA 4M3CE 5F2SA 4BQXA 2PHTA 1S0BA 5IT6A 2VUAA 1GNHA 3ILFA 2AUYA 2ETEA 5J36A 1UNBA 1MEC1 5FPVA 3RWNA 1NUKA 1W8WA 4YVWA 2VECA 1GP6A 1H8TC 3FUOA 2BVVA 2BTVC 2RDNA 2PAKA 4MGZE 4CP9B 4WVMB 5FPUA 3X29B 1W2NA 1LHWA 3W5NA 3BPSA 1AYM1 4GWNA 3GM8A 5IAVA 4XMAA 4LBKA 4CUBA 2AYHA 1V6OA 3SC7X 2HWB1 3IKWA 2RVAA 3MW2A 2R0FA 2YUEA 3U11A 2RR13 3LZZA 1WLTA 4EZHA 1ZRRA 2OZJA 5F37A 3JBG2 1W9YA 4K7JA 1EP0A 1SEFA 4XF3A 2X29A 5A1FA 3DKWA 1ZBE1 3HT2A 3ZKYA 3FC0A 3USUB 4D69A 4Q4W3 1OF3A 1ULOA 2ORXA 5KHGA 2HWC1 5FWJA 1ALYA 1C5IA 3QBQA 4D3WA 1WLDA 5JSOA 4X8NA 2XJQA 2CGOA 4YFZA 1W0OA 2EAKA 5GLUA 3NRUA 5A1AA 1X9PA 2Q1FA 4COZA 3H3UA 3SKVA 4YVWC 4CPBA 2RS53 4AFCA 3ON7A 4AFBA 1ZVFA 1O59A 1MS8A 2VBPA 3WNLA 3J7MA 5ACA3 1POV0 4PBOA 3PHMA 1GQPA 3RZHA 4NPLA 4OMCA 4M3CB 3K3NA 3KD4A 4MO3M 2JECA 5EV7A 3JXSA 2DVBA 3WV6A 2VMGA 2ZAAA 3M3OA 3IT8A 1EAH3 1VPHA 2QJVA 3KZ4C 5FLIA 2FHRA 3T3YA 3MIHA 1ACCA 3APBA 1F5JA 3RPQA 4JV4A 5GLZA 4ORFA 4K8RB 1KXGA 3BUCA 1MS9A 3KSCA 3GJAA 1RUE3 3DCQA 2A71A 2VMHA 2YBSA 4NROA 4XFCA 3MPBA 4JQTA 3RZMA 5D1IA 1UY2A 4GD4A 1JUIA 4W4ZA 5HCBA 2EXKA 1JZ4A 3ZMNA 2EA7A 1RHI1 4FOYA 4D0QA 2WR9A 1V6LA 3KLSA 2WKKA 4NVPA 4YW6A 1XBFA 1ZM1A 3A7QA 2H6CA 3THPA 2DVFA 3VZKA 2VE1A 3OGSA 4YVSA 1NA1A 5J09A 4A7YA 2FDFA 1LGCA 2Z5WA 2WJSA 4RN5A 2J1SA 4C0HA 1JHJA 2LS6A 4HKWA 4K40A 5G05L 1POV1 1CAWB 5FZHA 3ZO0B 1Q8QA 2XHKA 5CFCB 1H9WA 3ES4A 3EO6A 3VBSB 3ZM8A 3NO8A 5LA1A 2D6KA 5A70A 5LY2A 2XDVA 4HN1A 4BOWA 3AKSA 2AZ5A 2VCBA 3AMPA 1U5XA 3BOWA 3HBZA 1PGSA 2D7FA 3ELNA 1LOEA 2VW0A 4NHYA 2HWE2 4XIKA 3T30A 3WDUA 3PIGA 2FCUA 4QAWA 3CMGA 3DYMA 4INDA 1XE0A 1YQ6A 1W90A 3INAA 5FYUA 2BQPA 3I2OA 1VBC2 3RZKA 5JSPA 4AI1A 4J6GA 1O3TA 3VDDC 1JTZX 2E31A 2PHRA 2UWBA 3AL6A 3HR9A 1PGW2 2EIDA 4AR2A 4HOOA 2XPJA 3OCPA 1Q56A 4J1XA 1NA1C 1VBE3 1S0JA 4YW7A 2C0ZA 4B7KA 5GLWA 1ENQA 2BBVA 1AJKA 3PJQA 5J3UA 1CIWA 1HRI2 4IGQA 4TSVA 3FX3A 1A6CA 3GHNA 4HVRA 4Y5TA 4QM9A 4Q4W1 3WHUA 4JX0A 3KF5A 4AW7A 1FXZA 2XWBB 4NUBA 4UW5A 3VN4A 2IUWA 2OQ6A 1RVF3 4KWLA 5FY8A 1G9BA 4Q26A 1N3QA 3O1MA 3I4IA 2W0XA 2WS92 4UF0A 4MUVA 1YQCA 1JS9A 1R1A3 2A3WA 4COVA 1UIKA 5EYXA 1US3A 1X36A 1A3KA 1PM7A 5A6ZA 5DG1A 3N9NA 1W6QB 1RUI1 1J58A 1UL9A 4NIAA 1UIJA 2W92A 4HVOA 2W1SA 2Y6FA 5FXWA 4TZDA 2E51A 1RUC2 1HB2A 2ZX1A 1VMJA 1U12A 4O7XA 3VZOA 3W20A 3LGRA 1PVC1 2Y33A 4P9YA 1REDA 2KA3A 5FREA 3W21A 5JXIA 3WDWA 5EJ3A 4OI0A 4MOAA 3UETA 3KT4A 1TEIA 1EAH1 5FZOB 1OMIA 5AC92 1TNFA 1O7FA 3WUDA 1LKNA 2IXLA 1AR82 5FZ1A 5GJ6A 1HB1A 4OMDA 2IC1A 3O14A 2D5FA 4XPVA 2J1UA 3T0AA 3O1TA 2Z79A 5FO7B 5C7GA 3O1SA 1UD1A 1YI9A 4HSJA 3T1MA 1H8TB 3GGLA 3V64A 4CDXB 2XBO2 4OFGA 5E89A 2IFRA 3F2ZA 4M0NA 4CDWC 1C8M3 3C7HA 2UU8A 4LO4B 3ZFFA 2V09A 4TWTA 4IEYA 5DABA 3Q8AA 4G3YC 2CYFA 3C2UA 5JUVA 1HRV1 1OA4A 2DFBA 4FXGB 4GXLA 1Q8SA 2ZZQA 2VW1A 5JLVA 3WNMA 1SLBA 2G9FA 4Q4Y2 4BK4A 2ES3A 2NQYA 3O1UA 1R1ZA 5SV5A 1JUHA 1X7NA 4NIGA 5A32B 1NLRA 1R093 4KBZA 2QZ2A 1JYIA 5J37A 1F2NA 5D21A 1W6MB 4BQ5A 5FLJA 2DVGA 2Y64A 1QQP3 3GCWA 2RS32 1XJAA 3HQUA 4PDWA 1XYOA 4N53A 4DINB 4TN7A 1RB8G 1AXYA 1N1SA 4FSJA 1STMA 1PK6A 5A3OA 4QXCA 1NCRA 1O4ZA 1ZRCA 2A6XA 3KB5A 4ISQA 2JDNA 3AB0A 2CSGA 3ZFGA 2DVDA 2BFUL 1DZRA 3DECA 2B42B 5T5OA 4BQYA 3IIAA 3K2OA 3THCA 1UZZA 5FY4A 4AHZA 1VBE1 1HN1A 3GYDA 4TXWA 5FJHA 5E1RA 1SHWB 1GWMA 3VDCA 4RYDA 3HN3A 5JR7B 2GSYA 3LFIA 2VMEA 1VBA3 4DUVA 4WZFA 2HWD3 3OBZA 4K6BA 3SISA 5FDBA 3SHRA 4NIHA 1WMDA 5FO8B 4DXTA 4FPFA 2VM9A 3ZYRA 4A42A 2BNOA 1UCXA 2ZGLA 1DGRN 4YM2A 3T2QA 3WG3A 3ZDSA 1OUSA 2L9LA 3K4DA 2GC2A 3H42B 3WUCA 4EN6B 4PDWC 4F7ZA 3TEZA 4N53C 4NAMA 1QU0A 3HT1A 1LOCA 3ZIWA 3M3IA 5DAVA 4OQ8A 2ZHLA 1PM4A 2VNOA 1BK0A 4N7UA 2FDHA 4P9IA 1RMU3 3B3QE 4IESA 4B3NA 3MBWA 3MO4A 1UOBA 1UO9A 1F4HA 1TVGA 1V6JA 1WUVA 3BYWA 1PIV3 1W9FA 1PO23 2EXHA 2XLGA 3LDKA 4PQQA 3ZFGC 1MS1A 1FOD2 3MICA 4NRQA 4YGDA 1REEA 4LNVA 1H6XA 1S1AA 4GMP3 5FP7A 1JYXA 3DGTA 3CKHA 2GN3A 4JZRA 4P00B 5JDBA 2HYXA 1COV1 2R073 5FUNA 1AX2A 2WDBA 2OPWA 5T5PA 4ZHNA 1ULEA 4LITA 1WMFA 4Z2AA 3FLPA 3H3LA 3VL8A 5FUPA 4FPCA 1LHUA 4GKYA 4QXHA 3VD7A 1JZ8A 3ZIXA 1HN0A 2QDRA 4YG3A 4JGYB 4KU7A 2FDJA 2WNUC 5CVRA 1GQHA 1BEV2 3OBTA 4B8EA 1XU1A 4XJ8A 4Q0UA 1CX4A 1MQTA 1G86A 1VRBA 2AH2A 2PN5A 1SDDB 1X82A 5K4LA 2VOXA 3VDDB 5DAXA 3PU3A 3KT1A 4PF5A 3MIGA 2JDUA 2ZEWA 2MEV3 1W8HA 4KNCA 1J3QA 4OVEA 3PLQA 1IGOA 1AR61 2VTXJ 3GALA 1HW5A 4W50A 1S2BA 1URXA 1CR7A 4K8FA 3WF4A 1NXMA 3EBRA 1N47A 1LOBA 4GB33 2WAOA 1Y9GA 2WQ4A 2I07B 4JVAA 3AK0A 4Y1XA 4CUCA 3AKPA 5A3LA 1JU4A 4ZXKA 4AQSA 1W06A 2BJSA 3NNJA 4GALA 2JDZA 3O12A 3OEBA 4Y5Z0 3O7OA 2WO3A 3N7KA 4XILA 3VKLA 5LRRA 1WCUA 4IETA 2WO2A 2LALA 2XJVA 3OYWB 2B46X 1C1FA 1FMD3 1MQTC 4V2VA 2W95A 5ABJB 2C9AA 2OS2A 2D3SA 4JDMA 2W08A 4NE9A 4P9JA 4CXXA 5KHIA 4RA0A 1OF4A 1VRH3 2Y6GA 5FZ8A 1DQ0A 1DYOA 3ZSLA 3LA3A 2D43A 2AEYA 2GMPA 2QQUA 2KM2A 5EQUA 4JRAA 4AHXA 2BV4A 4JTNA 1TG7A 2UURA 2VUDA 3MI8A 5E8AA 4OZXA 4AEDA 4AWDA 2HWB2 1B35B 1DGWA 3ENRA 3ME2A 4FFFA 1JODA 5BUVA 5JR2A 1JZ3A 3RYPA 2D6PA 4MXWA 3ZMOA 5F9TA 1VP6A 4QKBA 4EROA 1ASJ2 3ZR6A 4CDWB 2EIGA 3D8CA 4RQPB 1PO12 5CISA 3V0AA 1RMU1 5JCTA 1LU2A 4XIOA 3VZNA 3G7DA 4IGOA 2WWSA 4LK7A 1PGL2 1PO21 2R041 5A33B 3DYOA 5EP9A 1K3IA 3AKTA 3FBMA 2IXHA 3R4SA 2XOMA 3E6DA 4WM7A 1HX6A 2F4LA 3ZOIA 1GICA 2WZR1 3NAPA 4YZ5A 3CHXA 1QJY2 3VBRC 3PDQA 2Y6LA 3CU7A 2WQ8A 4V1PA 4OUSA 3GZTB 4B7EA 3WG4A 1RUOA 2CY6A 4WZCA 5HI0A 5DDJ2 4L0PA 4YNIA 4ZS2A 5A6QA 5J7MA 1DFQA 4XHBA 1IPJA 3I3MA 2BZDA 1CWPA 1QNWA 3VHNA 5EPAA 2K2SA 3TBDA 5DG2A 4AYUA 3WF2A 1FPN2 4XFIA 3WP3A 4AEDC 1OD5A 3CF6E 2R063 4IDZA 4YGEA 2TUNA 2OT7A 2ZPXA 1BBT3 5F5IA 2YXSA 4Q0PA 2G1MA 3WDYA 1BHGA 3UJOA 3AP4A 4IV3A 5FQ0A 2MEV1 4NAOA 5CKQA 3VLBB 2ZEYA 5CFDB 4QX5A 4SBVA 3TNPB 3T1LA 2QE3A 3K46A 1AR91 2IZWA 1OKQA 4LTAA 5JSRA 3VD9A 3B00A 3LSDA 1MVQA 4WM7C 1UU4A 4LOTA 3B9IA 2UYBA 1LGBA 2R1BA 1CESA 3HNBM 3UESA 3ROUA 3FFZA 4ES9A 1Y43B 4NOTA 4WVMA 4CP9A 2CGPA 1JYWA 5I8SA 4E2QA 4LE3A 1ZBA3 1O6UA 3USSA 1REFA 4Q5OA 4ZU5A 4E9KA 1HIXA 4W6YA 2JDYA 2RDQA 3ACHA 3ZDVA 1WCQA 5FCCA 1K5JA 1QJX3 5FZ0A 2VW2A 3BALA 3R4UA 4IW3A 4B4RA 4LHLA 1XYPA 3B69A 5F39A 5GZEA 1VBB3 1YO8A 3RG0A 3N7JA 3I2GA 2DUQA 3ES1A 3ZFGB 3CJIB 5HV4A 4FTSA 3USUA 2PHFA 3BODA 2P6HA 3MV01 4JDOA 3T09A 2GAUA 4XZPA 5KXCA 3OTFA 1LOFC 3HOBA 4H7MA 3ZXLA 1MS0A 1O5LA 5C5UA 5FK7A 5F3GA 2KR2A 1W6PB 2E7AA 2IXJA 4CDUB 1SFYA 5FR3A 3VBOC 2VU9A 2P34A 2VVDA 5IW0A 2X05A 4F8AA 2WNUB 2W47A 3GF6A 4LKSA 3IAQA 3DKQA 1EV13 2RR12 4NPRA 5FYMA 3R6SA 5FYHA 5KHJA 1N1TA 5JWPA 3C7FA 5B2GB 3H3ZA 3SH5A 1VBD1 3D6EA 4M3CA 5CKMA 5IUQA 4AVBA 2JDHA 2UWCA 2XJSA 3B01A 2ADDA 2EIBA 3D4KA 2ZJCA 3V0BB 4QDRA 2DTYA 4QKFA 3ACGA 1ODNA 4XFHA 1RUD3 4CU8A 2VVFA 1MZ6A 1XNKA 4IEUA 2O8QA 2FMDA 2ZEZA 3JD73 1N1YA 2WL1A 4LMFA 3R05A 1W2OA 1S0GA 4YPJA 4BU2A 1VJ2A 2XKPA 3MLLA 2A73B 4NRMA 5DXDA 1NAEA 5T3NA 2VOWA 2CWSA 4FPKA 2RS52 1LESA 4FVVA 2W39A 2EF6A 2WT0A 1AR72 2ZABA 1MS5A 5ACA2 3MLKA 2YBKA 4AFAA 5F3EA 1CONA 4L92A 1RINA 2W2IA 1O8SA 4YGBA 1H1MA 2J1AA 4NWWA 4PI0A 3PVNA 1FNZA 1EAH2 3BIWE 1CAWA 1G7YA 5L19A 4XCAA 1MS4A 5FYBA 2BGOA 3RS6A 5CFCA 1F9KA 3KF3A 3OUJA 4PHZA 4F83A 3NNLA 1HJFA 1EPZA 4HKOA 1JBCA 3QLQA 4EE2A 2JD4A 1O4TA 1RUE2 4Q27A 2ZGSA 1X8MA 4QU2A 4B4QA 1Z78A 4Q0SA 1Z7S1 4COUA 4NMIA 3AMNA 2RS13 1UKRA 2C24A 3PTYA 3SXWA 4C90A 2XQXA 4XETA 5AVPA 1GLHA 5FMCA 1QF3A 1OHFA 2YU2A 5GKAC 4PCRA 4IEWA 1MEC3 3NL1A 3W9AA 4JC1A 2XVGA 3FE5A 4OZOA 4YFWA 5IVFA 2ET1A 2NM1A 4U2AA 1DGWX 3KHBA 1W39A 4A6OA 1ZZ9A 4XXPA 4B4PA 1AYM3 3VHOA 1UMHA 1APNA 2JDMA 1ZZBA 4LJHA 2BFUS 1KFXL 4HK9A 4FPJA 1UMIA 2BNMA 1OI6A 3SKJE 3E5QA 3WNNA 4COWA 2P3IA 5IATA 4Y5SA 2RDSA 2WT2A 2GH8A 4P08A 5CFCC 1QDCA 1H8VA 2Z4FA 3VBRB 2J7MA 1ZBE3 3LQCA 3NNFA 3RZLA 4E2GA 3VHPA 1QJU2 2Z2SB 1DQ1A 4R4XA 3C8XA 2VZRA 3LDBA 4AG4A 1UY1A 1OVPA 2IFWA 3GBFA 2B8MA 1DZQA 2RJ2A 5CADA 4LIVA 3J4UH 5I8YA 1W6QA 2EXIA 4JHTA 4ITCA 5C71A 5DUWA 4XURA 3P5BA 4BLIA 1NX9A
chains in the Genus database with same CATH topology
3AP7A 3MIFA 1VBE2 2MNGA 4I0BA 4LUMA 3D0SA 3T2TA 4IEVA 1LJ7A 1RJ7A 3GZUC 2ZGOA 1BKZA 1WD4A 2ZKLA 1RVF2 1RUD1 2DYCA 4UBGA 4FAHA 1R1A2 4META 3V65A 2RM21 5JOWA 2H6BA 4S2DA 3N35A 2X5IC 1H8TA 3CLPA 1CPMA 4CDXA 4R52A 2VG9A 1RUH1 3HD8B 1RIRA 4MVTA 4URTA 1RHI3 1AL21 5TSWA 2Q8OA 1HXS1 5JZGC 4QPYA 4M01A 1MS3A 4L11A 1AL0G 4PLMA 2JE9A 4O9EA 1AYN2 3WG1A 5A32A 1POV3 2WT1A 3H7JA 5BNPC 3AMQA 4AEJA 1W6MA 2ZGNA 2V73A 1WMEA 3QH6A 1XNCA 1WA4A 1BXHA 4FT8A 1PNFA 4CDQB 4RS5B 3WP4A 1C8M2 2QZ3A 4FQZA 3VBOB 1O3SA 3IDCB 1SLCA 1OA2A 2QKDA 4Q4V1 4AI0A 1RUG3 2R0HA 2YHJA 3H1WA 1GBGA 4I3GA 1QDOA 4CDXC 2ZGTA 1XNBA 4LULA 3L2HA 4YG6A 3QOPA 1TMF2 4COUA 4FP3A 4XF9A 2ZGMA 2F4PA 4YYOA 1YYNA 5FMOS 3PMEA 1R092 1D2QA 5BNNB 1RUNA 3W58A 4HZFA 1QQP2 3OY8B 1RUJ2 3SCFA 2EVXA 3VBFB 2FQPA 3NV1A 2ZS6B 5I0TA 3FLRA 1V6NA 1OLQA 1S0CA 1DGLA 4TLFA 4E4ZA 4HPKB 3EXUA 1QXJA 4YW3A 1QJZA 1SBEA 1CD3G 3ZXEA 1YXWA 3J9SA 3H9AA 4AVAA 4QT6A 4NWVA 3HIFA 4BPZA 1IS4A 2SLIA 4QPIB 4OI1A 1RUI3 2DF7A 3MF6A 3LB9A 4FAGA 1VBA2 2HWD2 1FV3A 3FFQA 1V9U1 1PVC3 4GA9A 1YWKA 5DZGA 1U5IA 2Z42A 1OPMA 3OD0A 2Q1MA 4ONUA 3RI8A 4EJRA 4AGGA 5GZGA 4FXKB 1CQ9A 4Q29A 4JGYA 2PAEA 2A5ZA 4AFDA 1RMU2 3J8F3 1R083 1XYNA 2DUOA 2TBVA 2WZPP 3RQ0A 1B09A 2D98A 4HBNA 4QQLA 4G9SB 1PIV2 4W65A 3VDDA 5H9SA 2JG9C 5GLTA 1U0AA 3MIDA 4KH9A 2XVKA 3D82A 2R30A 2R072 4ZU4A 1HRV3 1LRHA 3TN91 1K5MC 1YIFA 3ZXGA 2ZX3A 1D4M3 3ZFEC 2VMIA 3L9JT 4L99A 4AVTA 3KT7A 4LBOA 5I8TA 4I2OA 1D2SA 1KDMA 3HQXA 5JOZA 1VAMA 2RMU1 1G6NA 3NWKA 2NPIA 1RUG1 4JGYC 3Q9OA 5CU1A 1ENRA 2HKXA 1X8EA 3OYWA 3M8LA 3QACA 2F6BA 5ABJA 5GZFA 2WA3A 3AKRA 4RHV2 4Y1VA 4Y1UA 5T50A 4CEYA 4GB32 4AGVA 2HWF1 1BVP1 1O3QA 1AHSA 2R49A 3AYAA 4WVWA 1RUF2 1UU5A 3AMHA 1LB2A 3IM0A 4UBHA 2I74A 4XQDA 2PA7A 5T5JA 3RSJA 5JAXA 2X5IB 1B35A 1Y3TA 3PNAA 4PBPA 4YZ4A 1H30A 1I5ZA 5GM0A 1XRUA 4G4FA 2D6OX 4KL1A 4N9IA 4CDWA 4RQPA 1FMD2 3B9CA 1AX0A 4DPNA 3KM5A 3P3PA 2KXLA 3K48A 5JZGB 1VRH2 4Q4X1 5A33A 4EV0A 1LOAA 5HCAA 1ENXA 4FPLA 3TRSB 4LA3A 4XF1A 3SLIA 3FUQA 5ABJC 2R16A 1ZZCA 3RYRA 2EALA 1SBFA 2OYZA 5BNPB 4CEYC 4LE4A 2ZAHA 3ZSKA 1ZZ6A 4RFT0 2O0OA 5I0RA 3LA7A 2ZA9A 1COV3 4JDNA 5C4WC 3KGZA 4P14A 3ATGA 3MYXA 1NY72 3E5UA 3OGJA 3J8F1 1R081 3POWA 1B35C 1VLNA 2C1FA 2WFF3 3R4DB 3JB4C 2YPJA 2BUKA 3WW3A 2WSUA 4RQPC 2VQAA 4BIFA 3IMNA 5CFDA 4ES8A 3AJYA 4EWDA 3MF9A 2Q1ZB 3ASIA 3AZWA 1AR63 3N36A 3AJZA 1GR3A 2GC1A 2XGXA 3M7AA 4LHKA 4XFAA 4YGCA 5LK5A 1D4M1 1SCSA 2D5HA 4CZSA 1Q3EA 4EN9B 1PHMA 4KG8A 3AKQA 1RGSA 4QHBA 4HVQA 2DWRA 2R062 3GHMA 2R1DA 3E5XA 1BBT2 1YNAA 5JI7A 2PLV3 2PHXA 1H4GA 5L7OC 2HEYF 3EHKA 4FBFA 1WGPA 2Y26A 2XL7A 5BPXA 3CJIA 1DQ6A 5CB7A 4XJUA 1KJLA 5LEJA 3AXDA 4XBLA 4KGQA 1HQNA 5CFDC 5C8CB 5AFBA 4AHYA 4GH4C 3ZN6B 5JOYA 1UAIA 1W6PA 4QPGB 4CDUA 2YDEA 3S6PA 1PZ7A 2RE9A 2WFPA 2Z69A 2ZCWA 1ZBA2 3JQWA 4JTOA 5DZEA 4YW5A 4DRRA 2WNUA 4Y20B 3PMSA 1LHVA 5BNOC 1YFXA 4WBBA 1QJX2 1S0DA 2CAVA 2ZHMA 1VBB2 1YIPA 5KHHA 3ZSMA 3DV8A 5DUUA 3ZXKA 3OBRA 2JG9B 3W59A 4RD7A 1WW4A 5FLHA 2IXIA 2OUHA 3V0BA 3AYCA 3WZ1A 4AGRA 4FOQA 3MZHA 2R043 2PHLA 3CJIC 3BU7A 3IPVB 4UXAA 1XNDA 1K5MB 2YZ4A 1FX5A 2VXRA 2WZR3 4BIOA 4FO9A 3ZFEB 2MHFA 2XJRA 1UPIA 2R6QA 3ZXJA 1EV12 1ULGA 4CDUC 3AZZA 4Q8KA 3WOGA 5FOBB 5A3MA 1HKDA 4A7ZA 2ARXA 2WFF1 1IS3A 1DF0A 4YLZA 4UW6A 3GBWA 5FAXA 1RUD2 1DGRA 3RNSA 1J1TA 3LA2A 3EJKA 1J59A 1QOTA 3JD72 4XYXA 3VZLA 3I8TA 3AFKA 4K21A 4XJZA 2YROA 4HSLA 1JOJA 4AI3A 1XQNA 4I0WB 1AR93 2EAAA 2PHWA 2FMYA 4BZ4A 2Q5TA 2PAMA 3U0ZA 4FPHA 4ISRA 1OOPC 4OHZA 3WQ7A 3IDEA 4EWEA 5IK4A 4I02A 3THTA 5LK7B 2PLV1 4ATFA 3WNXA 3B5LB 2I2SA 2WC2A 5LEKA 1IHMA 3R0RA 4X8PA 3VBHC 2D6MA 4BE3A 1QH7A 1VB4A 3AP6A 1LU1A 4CYDA 2RS12 1DIWA 3VBRA 1GKBA 2NYYA 3DN7A 4CEYB 1LENA 2QQPA 3JBG1 1PZ9A 1ND2C 1NE4A 1MEC2 2Y38A 3ZXAC 4N9HA 5C4WB 1TNRA 3BCWA 5EXOA 1DLLA 1Y7BA 4NHLA 2YYOA 3TAYA 4BQ1A 2DCKA 3ACLA 2GNMA 5SV8A 4C1XA 1AYM2 4XF0A 1WCSA 2LTNA 5KXBA 2DFCA 1YJLA 1F8VA 4GKXA 3VUOA 3U4XA 1WW7A 1TME3 5GZCA 1CJDA 4AI2A 1GZ9A 4CRQA 1RL3A 2DTWA 2WLQA 3M1HA 1VBD3 1ZBE2 2ZGUA 3ZSJA 4HLTA 3I59B 2HWC2 1DQ5A 3CEWA 5E16A 4QD2A 1Y9QA 3NV4A 2NN8A 2JG8C 3AYEA 3DPRA 2BYVE 1AVBA 3CL1A 4MLOA 2E6VA 3H7YA 4HL0A 2A3YA 1SDWA 4RGGA 1X33A 4N90A 1KFUL 2D6LX 4Y26A 5L7OB 3CNAA 5FOJB 2YMZA 3NKGA 1HV0A 4QQOA 1QHDA 2DCJA 5FPZA 2GMEA 4GWMA 4MH0E 1JH5A 4AF9A 1FAYA 2H0VA 4RSUA 2P3KA 5FTTC 3KGLA 2RJKA 3CJXA 1LOFA 1GNZA 1F5FA 1OSGA 4GH4B 2EXJA 4CEWB 5FPXA 3ZYPA 4CDQA 1NE6A 4RS5A 1UN1A 1Z7S3 3VBOA 4OI4A 1G9FA 3H8UA 1JW6A 1ZX5A 2WINB 4I30A 1RHI2 3DPRC 1KITA 3D5OA 3B93A 1IOAA 2WLPA 2HWE1 4XBNA 3WDTA 5BNOB 4QGMA 3S0MA 4D7SA 3K51A 4M3CF 1VBC1 4PIZA 4LBNA 4YARA 5BNNA 3NV3A 5KHKA 3WY6A 3OY8A 4Q8LA 2ARBA 1PGW1 3VBFA 2UWAA 3WW1A 2VQ0A 4IEOA 2CGNA 4HPKA 1HRI1 4FCAA 3WP5A 3WT3A 2Y0OA 4BWOA 1BJQA 1SACA 4CDQC 4RS5C 2YY1A 4YRDA 2WS91 4QPIA 1HQWA 2GDFA 3ZN5A 3WDVA 2LUWA 1TME1 2D97A 1ND3B 5T55A 3U10A 2SBAA 2WNVB 3UKNA 2O8OA 1BK1A 5BNNC 4Q4W2 1A78A 4JGZB 1RUC1 5I91A 2BWCA 3WVJA 3VBFC 3WDXA 4EN7B 4P9GA 3WXPA 5K8SA 1EPWA 3NW4A 2DVAA 2GC3A 1V00A 4IERA 2RM23 4GULA 1KJRA 1S0EA 2BGCA 5AC91 1AR81 1OOPB 2IXKA 3D0JA 1RUI2 2QCSB 2DURA 1A8MA 5E88A 1RUH3 5F5QA 4Z07A 1V70A 4YZ1A 1PVC2 2XBO1 3BTAA 4QPIC 4HMZA 3SH4A 1AL23 4U36A 4EN0A 1HXS3 2YV8A 3JZVA 4LBQD 4PLOA 4D7YA 5GALA 3VBHB 2ERFA 4DQAA 1O3RA 1MZFA 1E57A 3M4FA 4I09A 4R9AA 4OHYA 2CNAA 4FPGA 4Q4Y1 4KWJA 4AQ6A 4PJYA 3J8F2 3H0OA 4XQ4A 1JYCA 1ND2B 2D40A 2BPA2 1BZWA 4Y22B 1BQPA 1N3OA 1RITA 4WVZA 1ULDA 4HT1T 5L73A 2XJUA 4HANA 2ZX4A 4ZKTB 4Q4V3 3TWIA 1HRV2 2P2KA 3RMYA 2JEMA 2JENA 1KDKA 2AR6A 3ZVXA 5HCFA 4LUKA 2PQQA 2GN7A 4E27A 5FO9B 3I54A 5KWRA 4QQPA 3AXEA 5J98B 4KQ7A 1UU6A 1VIWB 2BEOA 5BNQA 3RJRA 3SCHA 4HN0A 5IK7A 1JN2P 3KQRA 2PYTA 2X5IA 2VULA 2JG8B 4PQ9A 4QXKA 3UKVA 1QXPA 2XLFA 1CAVB 1LR5A 3FZ3A 4XTPA 3VL9A 4JAAA 2CL2A 4B29A 1ENSA 1T6GC 1UPSA 3TOJA 5JZGA 3MLJA 1CAUB 1O4YA 1NXD1 4RR3A 1ASJ3 3RMXA 4OI2A 4R9BA 4P9LA 5BNPA 1H4HA 4XFGA 5BV6A 3WW2A 1H1AA 1PNGA 4P9XA 5H9QA 3AX4A 3H50A 1V9U3 4LBJA 1C57A 1FOD1 3UL2A 5I93A 1SMVA 1I9RA 3FHIB 4YM3A 2CTVA 5BYNA 4LO6B 2ZGKA 3WX5A 4F3JA 3DPRB 1YHFA 4SLIA 4C91A 2D6NA 2ZGRA 2A6VA 3ETQA 4LLOA 2IWGB 2Q0AA 4YM0A 1CAXB 4IXLA 2Q30A 4RR3C 4WVVA 4PIXA 1COV2 3LOIA 1D4VB 4LHNA 3NVCA 3TN93 3WCSA 3TB0A 2JJ6A 3KCYA 2A70A 3VHRA 1UZYA 2JKBA 4IV1B 1YFWA 1UX6A 4XJAA 5DZFA 5GLVA 1SCRA 4DY5A 4A3XA 2VY0A 1LCLA 2FZ1A 2RMU3 4MZUA 4QGLA 1G9AA 1GZWB 3AZXA 1AF9A 3E6BA 1KS4A 4FTBA 4Z1VA 3AZVA 1J3RA 3WW4A 4LEJA 1IKQA 3AZYA 3VBUB 1ZNPA 1AR62 3JQXA 4TYSA 5CA6A 4KGGA 1FI2A 3WD5A 2XJPA 5C8CA 2OA2A 2WSVA 1NYWA 3ZN6A 2P37A 4QPGA 1X50A 2HWF3 3E97A 1GQGA 1AZDA 3ECQA 4QQ2A 1PMIA 4Y20A 4BMBA 1QXRA 2PLV2 1CJPA 1D0HA 3L2YA 2XLAA 2VH9A 4FQ4A 2PELA 1AJOA 1SLIA 4CP2A 4I01A 1PVXA 1W6OB 2JG9A 4AVVA 3ILNA 3N7LA 2PTMA 4LT5A 4WM8B 1VAVA 4GIQA 3VKNA 1ASJ1 2Y0IA 1QWRA 1PO11 3WP6A 5JIAA 4Q4X3 3IPVA 2FZ2A 1MVEA 1K5MA 2E9QA 2ZX2A 2VNGA 4Y1YA 1PGL1 4IEXA 4DRVA 3ZFEA 2BWAA 2CV6A 4AE2A 5C8CC 4LO8A 4DB5A 1DYPA 2ENRA 3B7MA 1QJY1 1AX1A 4QPGC 3WQ1A 5CG8A 4S2FA 1JXNA 3SCGA 3ZYJB 5AFEA 1NCQB 1F31A 1H2KA 5DDJ1 1GANA 1LODA 4NN0A 1ULFA 4CP1A 4YM1A 4H14A 2D44A 4ASMB 1AR73 3ZX7A 3ALQA 1PO22 2R042 1FPN1 2OVUA 4Y24A 2W68A 2ET7A 1H2LA 2WZR2 4IEQA 4D7TA 4HKLA 2XVLA 2XJTA 3TNQA 4XFBA 1SLTA 1XU2A 2B9UA 2K9ZA 1W6NB 4XW3A 2XUMA 4XDQA 1G9CA 2OUJA 2PHDA 4Z2WA 2XL9A 4S2HA 5F6LB 1HV1A 4Q0QA 2MEV2 4L8QA 3MFAA 1NLSA 1EY2A 1RC6A 3ILRA 3JCIA 4BM8A 1AR92 4BHPA 1IS5A 2IXCA 2ZGPA 4QQHA 3H1MA 3N4MA 1S2KA 2OZ6A 2B45X 2GZWA 3OD4A 5C4WA 1O5UA 4ATEA 1DG6A 3WINE 3WLUA 4YZ2A 5JIUA 1C1LA 1YJKA 3NJZA 1BCXA 5F6KA 1HDKA 1QJU3 4W6WA 4GQ7A 2FBEA 1LTEA 5KBFA 4R4ZA 4XXAA 4XEZA 2UY8A 1IS6A 1GYKA 2RR11 4FOVA 4YVSC 3RJ2X 4NHMA 2A6YA 4OHXA 2C5DA 4RR3B 3I59A 4KU8A 5D8AB 2GC0A 1FV2A 5C6CA 3IDBB 5K7PA 4R9CA 1ULCA 2X53S 2BVBA