1MVHA

Structure of the set domain histone lysine methyltransferase clr4
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
269
structure length
269
Chain Sequence
KLDSYTHLSFYEKRELFRKKLREIEGPEVTLVNEVDDEPCPSLDFQFISQYRLTQGVIPPDPNFQSGCNCSSLGGCDLNNPSRCECLDDLDEPTHFAYDAQGRVRADTGAVIYECNSFCSCSMECPNRVVQRGRTLPLEIFKTKEKGWGVRSLRFAPAGTFITCYLGEVITSAEAAKRDKNYDDDGITYLFDLDMFDDASEYTVDAQNYGDVSRFFNHSCSPNIAIYSAVRNHGFRTIYDLAFFAIKDIQPLEELTFDYAGAKDFSPVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cryptic loci regulator 4
publication title Structure of the SET domain histone lysine methyltransferase Clr4.
pubmed rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 60
structure length 269
sequence length 269
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2002-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 1mvhA00
2R3AA 4BUPA 5EX3A 3SWCA 3S7DA 5F5EA 3OXLA 3PDNA 5F6LA 5LSXA 3EP0A 3M54A 3OOIA 2IGQA 3VV0A 3MO5A 4YPUA 2QPWA 3KMJA 4AU7A 3OXGA 3M59A 4H12A 3VUZA 4MI0A 5T5GA 4NVQA 5KJKA 5TH7A 3DB5A 4C1QA 3CBMA 5HI7A 2JV0A 5ARGA 5KJMA 4WUYA 3KMTA 4J83A 3F9ZA 5CCMA 5JJ0A 4O6FA 5KJLA 2F69A 4IJDA 5ARFA 3F9XA 4NJ5A 1ZKKA 3S7FA 3CBOA 4QEOA 3BO5A 3QWVA 3RIBA 3FPDA 3S7JA 3OPEA 1H3IA 3MO2A 1N6CA 2W5YA 5TEGA 5JINA 4YNDA 4QEPA 3RJWA 3MEKA 5LSZA 4Z4PA 2RFIA 1MT6A 1N3JA 3OXFA 3IHXA 5T0MA 5TTFA 3CBPA 4YNPA 3M56A 5JIYA 4IJ8A 3SW9A 3MO0A 3RAYA 1ML9A 3N71A 4JLGA 3M53A 5CPRB 3S8PA 5F6KC 3K5KA 1XQHA 3OS5A 3S7BA 4YNMA 4JDSA 5AYFA 4LDGA 3DALA 5HQ8A 4J8OA 1MVHA 4J7FA 4I51A 4YPEA 3F9YA 3M58A 4E47A 3KMAA 3TG5A 4RZ0A 3M55A 4J7IA 1MVXA 2G46A 2W5ZA 5EG2A 4MI5A 3TG4A 3HNAA 5EX0A 3F9WA 3M57A 2O8JA 5KJNA 4FMUA 1MUFA 2BQZA 4YPAA 3RQ4A 3QWWA 1O9SA 4QENA 1N6AA 3QWPA 5T0KA 1PEGA 5CCLA 4O30A 5F59A 3M5AA 3RU0A 5JHNA
chains in the Genus database with same CATH superfamily
2R3AA 4BUPA 5EX3A 3SWCA 3S7DA 5F5EA 3OXLA 3PDNA 5F6LA 5LSXA 3EP0A 3M54A 3OOIA 2IGQA 3VV0A 3MO5A 4YPUA 2QPWA 3KMJA 4AU7A 3OXGA 3M59A 4H12A 3VUZA 4MI0A 5T5GA 4NVQA 5KJKA 5TH7A 3DB5A 4C1QA 3CBMA 5HI7A 2JV0A 5ARGA 5KJMA 4WUYA 3KMTA 4J83A 3F9ZA 5CCMA 5JJ0A 4O6FA 5KJLA 2F69A 4IJDA 5ARFA 3F9XA 4NJ5A 1ZKKA 3S7FA 3CBOA 4QEOA 3BO5A 3QWVA 3RIBA 3FPDA 3S7JA 3OPEA 1H3IA 3MO2A 1N6CA 2W5YA 5TEGA 5JINA 4YNDA 4QEPA 3RJWA 3MEKA 5LSZA 4Z4PA 2RFIA 1MT6A 1N3JA 3OXFA 3IHXA 5T0MA 5TTFA 3CBPA 4YNPA 3M56A 5JIYA 4IJ8A 3SW9A 3MO0A 3RAYA 1ML9A 3N71A 4JLGA 3M53A 5CPRB 3S8PA 5F6KC 3K5KA 1XQHA 3OS5A 3S7BA 4YNMA 4JDSA 5AYFA 4LDGA 3DALA 5HQ8A 4J8OA 1MVHA 4J7FA 4I51A 4YPEA 3F9YA 3M58A 4E47A 3KMAA 3TG5A 4RZ0A 3M55A 4J7IA 1MVXA 2G46A 2W5ZA 5EG2A 4MI5A 3TG4A 3HNAA 5EX0A 3F9WA 3M57A 2O8JA 5KJNA 4FMUA 1MUFA 2BQZA 4YPAA 3RQ4A 3QWWA 1O9SA 4QENA 1N6AA 3QWPA 5T0KA 1PEGA 5CCLA 4O30A 5F59A 3M5AA 3RU0A 5JHNA
chains in the Genus database with same CATH topology
2R3AA 4BUPA 5EX3A 3SWCA 3S7DA 5F5EA 3OXLA 3PDNA 5F6LA 5LSXA 3EP0A 3M54A 3OOIA 2IGQA 3VV0A 3MO5A 4YPUA 2QPWA 3KMJA 4AU7A 3OXGA 3M59A 4H12A 3VUZA 4MI0A 5T5GA 4NVQA 5KJKA 5TH7A 3DB5A 4C1QA 3CBMA 5HI7A 2JV0A 5ARGA 5KJMA 4WUYA 3KMTA 4J83A 3F9ZA 5CCMA 5JJ0A 4O6FA 5KJLA 2F69A 4IJDA 5ARFA 3F9XA 4NJ5A 1ZKKA 3S7FA 3CBOA 4QEOA 3BO5A 3QWVA 3RIBA 3FPDA 3S7JA 3OPEA 1H3IA 3MO2A 1N6CA 2W5YA 5TEGA 5JINA 4YNDA 4QEPA 3RJWA 3MEKA 5LSZA 4Z4PA 2RFIA 1MT6A 1N3JA 3OXFA 3IHXA 5T0MA 5TTFA 3CBPA 4YNPA 3M56A 5JIYA 4IJ8A 3SW9A 3MO0A 3RAYA 1ML9A 3N71A 4JLGA 3M53A 5CPRB 3S8PA 5F6KC 3K5KA 1XQHA 3OS5A 3S7BA 4YNMA 4JDSA 5AYFA 4LDGA 3DALA 5HQ8A 4J8OA 1MVHA 4J7FA 4I51A 4YPEA 3F9YA 3M58A 4E47A 3KMAA 3TG5A 4RZ0A 3M55A 4J7IA 1MVXA 2G46A 2W5ZA 5EG2A 4MI5A 3TG4A 3HNAA 5EX0A 3F9WA 3M57A 2O8JA 5KJNA 4FMUA 1MUFA 2BQZA 4YPAA 3RQ4A 3QWWA 1O9SA 4QENA 1N6AA 3QWPA 5T0KA 1PEGA 5CCLA 4O30A 5F59A 3M5AA 3RU0A 5JHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R3A A;  4BUP A;  5EX3 A;  3SWC A;  3S7D A;  5F5E A;  3OXL A;  3PDN A;  5F6L A;  5LSX A;  3EP0 A;  3M54 A;  3OOI A;  2IGQ A;  3VV0 A;  3MO5 A;  4YPU A;  2QPW A;  3KMJ A;  4AU7 A;  3OXG A;  3M59 A;  4H12 A;  3VUZ A;  4MI0 A;  5T5G A;  4NVQ A;  5KJK A;  5TH7 A;  3DB5 A;  4C1Q A;  3CBM A;  5HI7 A;  2JV0 A;  5ARG A;  5KJM A;  4WUY A;  3KMT A;  4J83 A;  3F9Z A;  5CCM A;  5JJ0 A;  4O6F A;  5KJL A;  2F69 A;  4IJD A;  5ARF A;  3F9X A;  4NJ5 A;  1ZKK A;  3S7F A;  3CBO A;  4QEO A;  3BO5 A;  3QWV A;  3RIB A;  3FPD A;  3S7J A;  3OPE A;  1H3I A;  3MO2 A;  1N6C A;  2W5Y A;  5TEG A;  5JIN A;  4YND A;  4QEP A;  3RJW A;  3MEK A;  5LSZ A;  4Z4P A;  2RFI A;  1MT6 A;  1N3J A;  3OXF A;  3IHX A;  5T0M A;  5TTF A;  3CBP A;  4YNP A;  3M56 A;  5JIY A;  4IJ8 A;  3SW9 A;  3MO0 A;  3RAY A;  1ML9 A;  3N71 A;  4JLG A;  3M53 A;  5CPR B;  3S8P A;  5F6K C;  3K5K A;  1XQH A;  3OS5 A;  3S7B A;  4YNM A;  4JDS A;  5AYF A;  4LDG A;  3DAL A;  5HQ8 A;  4J8O A;  1MVH A;  4J7F A;  4I51 A;  4YPE A;  3F9Y A;  3M58 A;  4E47 A;  3KMA A;  3TG5 A;  4RZ0 A;  3M55 A;  4J7I A;  1MVX A;  2G46 A;  2W5Z A;  5EG2 A;  4MI5 A;  3TG4 A;  3HNA A;  5EX0 A;  3F9W A;  3M57 A;  2O8J A;  5KJN A;  4FMU A;  1MUF A;  2BQZ A;  4YPA A;  3RQ4 A;  3QWW A;  1O9S A;  4QEN A;  1N6A A;  3QWP A;  5T0K A;  1PEG A;  5CCL A;  4O30 A;  5F59 A;  3M5A A;  3RU0 A;  5JHN A; 
#chains in the Genus database with same CATH topology
 2R3A A;  4BUP A;  5EX3 A;  3SWC A;  3S7D A;  5F5E A;  3OXL A;  3PDN A;  5F6L A;  5LSX A;  3EP0 A;  3M54 A;  3OOI A;  2IGQ A;  3VV0 A;  3MO5 A;  4YPU A;  2QPW A;  3KMJ A;  4AU7 A;  3OXG A;  3M59 A;  4H12 A;  3VUZ A;  4MI0 A;  5T5G A;  4NVQ A;  5KJK A;  5TH7 A;  3DB5 A;  4C1Q A;  3CBM A;  5HI7 A;  2JV0 A;  5ARG A;  5KJM A;  4WUY A;  3KMT A;  4J83 A;  3F9Z A;  5CCM A;  5JJ0 A;  4O6F A;  5KJL A;  2F69 A;  4IJD A;  5ARF A;  3F9X A;  4NJ5 A;  1ZKK A;  3S7F A;  3CBO A;  4QEO A;  3BO5 A;  3QWV A;  3RIB A;  3FPD A;  3S7J A;  3OPE A;  1H3I A;  3MO2 A;  1N6C A;  2W5Y A;  5TEG A;  5JIN A;  4YND A;  4QEP A;  3RJW A;  3MEK A;  5LSZ A;  4Z4P A;  2RFI A;  1MT6 A;  1N3J A;  3OXF A;  3IHX A;  5T0M A;  5TTF A;  3CBP A;  4YNP A;  3M56 A;  5JIY A;  4IJ8 A;  3SW9 A;  3MO0 A;  3RAY A;  1ML9 A;  3N71 A;  4JLG A;  3M53 A;  5CPR B;  3S8P A;  5F6K C;  3K5K A;  1XQH A;  3OS5 A;  3S7B A;  4YNM A;  4JDS A;  5AYF A;  4LDG A;  3DAL A;  5HQ8 A;  4J8O A;  1MVH A;  4J7F A;  4I51 A;  4YPE A;  3F9Y A;  3M58 A;  4E47 A;  3KMA A;  3TG5 A;  4RZ0 A;  3M55 A;  4J7I A;  1MVX A;  2G46 A;  2W5Z A;  5EG2 A;  4MI5 A;  3TG4 A;  3HNA A;  5EX0 A;  3F9W A;  3M57 A;  2O8J A;  5KJN A;  4FMU A;  1MUF A;  2BQZ A;  4YPA A;  3RQ4 A;  3QWW A;  1O9S A;  4QEN A;  1N6A A;  3QWP A;  5T0K A;  1PEG A;  5CCL A;  4O30 A;  5F59 A;  3M5A A;  3RU0 A;  5JHN A; 
#chains in the Genus database with same CATH homology
 2R3A A;  4BUP A;  5EX3 A;  3SWC A;  3S7D A;  5F5E A;  3OXL A;  3PDN A;  5F6L A;  5LSX A;  3EP0 A;  3M54 A;  3OOI A;  2IGQ A;  3VV0 A;  3MO5 A;  4YPU A;  2QPW A;  3KMJ A;  4AU7 A;  3OXG A;  3M59 A;  4H12 A;  3VUZ A;  4MI0 A;  5T5G A;  4NVQ A;  5KJK A;  5TH7 A;  3DB5 A;  4C1Q A;  3CBM A;  5HI7 A;  2JV0 A;  5ARG A;  5KJM A;  4WUY A;  3KMT A;  4J83 A;  3F9Z A;  5CCM A;  5JJ0 A;  4O6F A;  5KJL A;  2F69 A;  4IJD A;  5ARF A;  3F9X A;  4NJ5 A;  1ZKK A;  3S7F A;  3CBO A;  4QEO A;  3BO5 A;  3QWV A;  3RIB A;  3FPD A;  3S7J A;  3OPE A;  1H3I A;  3MO2 A;  1N6C A;  2W5Y A;  5TEG A;  5JIN A;  4YND A;  4QEP A;  3RJW A;  3MEK A;  5LSZ A;  4Z4P A;  2RFI A;  1MT6 A;  1N3J A;  3OXF A;  3IHX A;  5T0M A;  5TTF A;  3CBP A;  4YNP A;  3M56 A;  5JIY A;  4IJ8 A;  3SW9 A;  3MO0 A;  3RAY A;  1ML9 A;  3N71 A;  4JLG A;  3M53 A;  5CPR B;  3S8P A;  5F6K C;  3K5K A;  1XQH A;  3OS5 A;  3S7B A;  4YNM A;  4JDS A;  5AYF A;  4LDG A;  3DAL A;  5HQ8 A;  4J8O A;  1MVH A;  4J7F A;  4I51 A;  4YPE A;  3F9Y A;  3M58 A;  4E47 A;  3KMA A;  3TG5 A;  4RZ0 A;  3M55 A;  4J7I A;  1MVX A;  2G46 A;  2W5Z A;  5EG2 A;  4MI5 A;  3TG4 A;  3HNA A;  5EX0 A;  3F9W A;  3M57 A;  2O8J A;  5KJN A;  4FMU A;  1MUF A;  2BQZ A;  4YPA A;  3RQ4 A;  3QWW A;  1O9S A;  4QEN A;  1N6A A;  3QWP A;  5T0K A;  1PEG A;  5CCL A;  4O30 A;  5F59 A;  3M5A A;  3RU0 A;  5JHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...