1MVHA

Structure of the set domain histone lysine methyltransferase clr4
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
269
structure length
269
Chain Sequence
b'KLDSYTHLSFYEKRELFRKKLREIEGPEVTLVNEVDDEPCPSLDFQFISQYRLTQGVIPPDPNFQSGCNCSSLGGCDLNNPSRCECLDDLDEPTHFAYDAQGRVRADTGAVIYECNSFCSCSMECPNRVVQRGRTLPLEIFKTKEKGWGVRSLRFAPAGTFITCYLGEVITSAEAAKRDKNYDDDGITYLFDLDMFDDASEYTVDAQNYGDVSRFFNHSCSPNIAIYSAVRNHGFRTIYDLAFFAIKDIQPLEELTFDYAGAKDFSPVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cryptic loci regulator 4
molecule tags Transferase
source organism Schizosaccharomyces pombe
publication title Structure of the SET domain histone lysine methyltransferase Clr4.
pubmed rcsb
total genus 60
structure length 269
sequence length 269
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2002-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 1mvhA00
3M59A 3M54A 5KJLA 3KMTA 3F9ZA 5ARGA 3RAYA 5ARFA 3MO0A 4LDGA 3PDNA 3OOIA 3F9WA 2IGQA 3BO5A 3N71A 3M58A 5CCMA 5T0KA 3TG5A 4H12A 4C1QA 4QENA 3M57A 3VUZA 3SW9A 5T0MA 3KMJA 1N6CA 1PEGA 5LSXA 4JLGA 4YPAA 5F5EA 3M53A 3F9YA 3OXFA 1MVHA 3SWCA 3TG4A 4O30A 5T5GA 4IJ8A 3S7BA 2W5ZA 4YPEA 5AYFA 3OS5A 4QEOA 4MI5A 3M56A 1XQHA 2R3AA 4Z4PA 3RIBA 1H3IA 4YPUA 3KMAA 3QWWA 3HNAA 3CBPA 3S7DA 4MI0A 3DALA 3OPEA 1MVXA 3CBMA 3VV0A 3F9XA 5KJKA 2W5YA 5LSZA 5TEGA 2JV0A 3K5KA 3RJWA 5F6LA 1MT6A 4E47A 4YNMA 2F69A 1ML9A 3RU0A 3MO2A 5KJMA 4WUYA 5JIYA 1N3JA 5EG2A 5JJ0A 4RZ0A 3S7JA 5KJNA 4J83A 3EP0A 5CCLA 3MO5A 3S8PA 3M55A 4J7FA 4IJDA 3QWPA 4BUPA 5HI7A 3S7FA 4I51A 5HQ8A 4FMUA 4O6FA 3FPDA 2BQZA 5TTFA 4NVQA 1ZKKA 3DB5A 3RQ4A 4YNPA 2G46A 3M5AA 3MEKA 4QEPA 1O9SA 5F59A 3QWVA 4NJ5A 4J7IA 5EX3A 5F6KC 2O8JA 4J8OA 5CPRB 5JINA 3CBOA 5EX0A 5TH7A 4YNDA 4JDSA 1N6AA 3OXLA 5JHNA 2QPWA 3IHXA 4AU7A 2RFIA 3OXGA 1MUFA
chains in the Genus database with same CATH superfamily
3M59A 3M54A 5KJLA 3KMTA 3F9ZA 5ARGA 3RAYA 5ARFA 3MO0A 4LDGA 3PDNA 3OOIA 3F9WA 2IGQA 3BO5A 3N71A 3M58A 5CCMA 5T0KA 3TG5A 4H12A 4C1QA 4QENA 3M57A 3VUZA 3SW9A 5T0MA 3KMJA 1N6CA 1PEGA 5LSXA 4JLGA 4YPAA 5F5EA 3M53A 3F9YA 3OXFA 1MVHA 3SWCA 3TG4A 4O30A 5T5GA 4IJ8A 3S7BA 2W5ZA 4YPEA 5AYFA 3OS5A 4QEOA 4MI5A 3M56A 1XQHA 2R3AA 4Z4PA 3RIBA 1H3IA 4YPUA 3KMAA 3QWWA 3HNAA 3CBPA 3S7DA 4MI0A 3DALA 3OPEA 1MVXA 3CBMA 3VV0A 3F9XA 5KJKA 2W5YA 5LSZA 5TEGA 2JV0A 3K5KA 3RJWA 5F6LA 1MT6A 4E47A 4YNMA 2F69A 1ML9A 3RU0A 3MO2A 5KJMA 4WUYA 5JIYA 1N3JA 5EG2A 5JJ0A 4RZ0A 3S7JA 5KJNA 4J83A 3EP0A 5CCLA 3MO5A 3S8PA 3M55A 4J7FA 4IJDA 3QWPA 4BUPA 5HI7A 3S7FA 4I51A 5HQ8A 4FMUA 4O6FA 3FPDA 2BQZA 5TTFA 4NVQA 1ZKKA 3DB5A 3RQ4A 4YNPA 2G46A 3M5AA 3MEKA 4QEPA 1O9SA 5F59A 3QWVA 4NJ5A 4J7IA 5EX3A 5F6KC 2O8JA 4J8OA 5CPRB 5JINA 3CBOA 5EX0A 5TH7A 4YNDA 4JDSA 1N6AA 3OXLA 5JHNA 2QPWA 3IHXA 4AU7A 2RFIA 3OXGA 1MUFA
chains in the Genus database with same CATH topology
3M59A 3M54A 5KJLA 3KMTA 3F9ZA 5ARGA 3RAYA 5ARFA 3MO0A 4LDGA 3PDNA 3OOIA 3F9WA 2IGQA 3BO5A 3N71A 3M58A 5CCMA 5T0KA 3TG5A 4H12A 4C1QA 4QENA 3M57A 3VUZA 3SW9A 5T0MA 3KMJA 1N6CA 1PEGA 5LSXA 4JLGA 4YPAA 5F5EA 3M53A 3F9YA 3OXFA 1MVHA 3SWCA 3TG4A 4O30A 5T5GA 4IJ8A 3S7BA 2W5ZA 4YPEA 5AYFA 3OS5A 4QEOA 4MI5A 3M56A 1XQHA 2R3AA 4Z4PA 3RIBA 1H3IA 4YPUA 3KMAA 3QWWA 3HNAA 3CBPA 3S7DA 4MI0A 3DALA 3OPEA 1MVXA 3CBMA 3VV0A 3F9XA 5KJKA 2W5YA 5LSZA 5TEGA 2JV0A 3K5KA 3RJWA 5F6LA 1MT6A 4E47A 4YNMA 2F69A 1ML9A 3RU0A 3MO2A 5KJMA 4WUYA 5JIYA 1N3JA 5EG2A 5JJ0A 4RZ0A 3S7JA 5KJNA 4J83A 3EP0A 5CCLA 3MO5A 3S8PA 3M55A 4J7FA 4IJDA 3QWPA 4BUPA 5HI7A 3S7FA 4I51A 5HQ8A 4FMUA 4O6FA 3FPDA 2BQZA 5TTFA 4NVQA 1ZKKA 3DB5A 3RQ4A 4YNPA 2G46A 3M5AA 3MEKA 4QEPA 1O9SA 5F59A 3QWVA 4NJ5A 4J7IA 5EX3A 5F6KC 2O8JA 4J8OA 5CPRB 5JINA 3CBOA 5EX0A 5TH7A 4YNDA 4JDSA 1N6AA 3OXLA 5JHNA 2QPWA 3IHXA 4AU7A 2RFIA 3OXGA 1MUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M59 A;  3M54 A;  5KJL A;  3KMT A;  3F9Z A;  5ARG A;  3RAY A;  5ARF A;  3MO0 A;  4LDG A;  3PDN A;  3OOI A;  3F9W A;  2IGQ A;  3BO5 A;  3N71 A;  3M58 A;  5CCM A;  5T0K A;  3TG5 A;  4H12 A;  4C1Q A;  4QEN A;  3M57 A;  3VUZ A;  3SW9 A;  5T0M A;  3KMJ A;  1N6C A;  1PEG A;  5LSX A;  4JLG A;  4YPA A;  5F5E A;  3M53 A;  3F9Y A;  3OXF A;  1MVH A;  3SWC A;  3TG4 A;  4O30 A;  5T5G A;  4IJ8 A;  3S7B A;  2W5Z A;  4YPE A;  5AYF A;  3OS5 A;  4QEO A;  4MI5 A;  3M56 A;  1XQH A;  2R3A A;  4Z4P A;  3RIB A;  1H3I A;  4YPU A;  3KMA A;  3QWW A;  3HNA A;  3CBP A;  3S7D A;  4MI0 A;  3DAL A;  3OPE A;  1MVX A;  3CBM A;  3VV0 A;  3F9X A;  5KJK A;  2W5Y A;  5LSZ A;  5TEG A;  2JV0 A;  3K5K A;  3RJW A;  5F6L A;  1MT6 A;  4E47 A;  4YNM A;  2F69 A;  1ML9 A;  3RU0 A;  3MO2 A;  5KJM A;  4WUY A;  5JIY A;  1N3J A;  5EG2 A;  5JJ0 A;  4RZ0 A;  3S7J A;  5KJN A;  4J83 A;  3EP0 A;  5CCL A;  3MO5 A;  3S8P A;  3M55 A;  4J7F A;  4IJD A;  3QWP A;  4BUP A;  5HI7 A;  3S7F A;  4I51 A;  5HQ8 A;  4FMU A;  4O6F A;  3FPD A;  2BQZ A;  5TTF A;  4NVQ A;  1ZKK A;  3DB5 A;  3RQ4 A;  4YNP A;  2G46 A;  3M5A A;  3MEK A;  4QEP A;  1O9S A;  5F59 A;  3QWV A;  4NJ5 A;  4J7I A;  5EX3 A;  5F6K C;  2O8J A;  4J8O A;  5CPR B;  5JIN A;  3CBO A;  5EX0 A;  5TH7 A;  4YND A;  4JDS A;  1N6A A;  3OXL A;  5JHN A;  2QPW A;  3IHX A;  4AU7 A;  2RFI A;  3OXG A;  1MUF A; 
#chains in the Genus database with same CATH topology
 3M59 A;  3M54 A;  5KJL A;  3KMT A;  3F9Z A;  5ARG A;  3RAY A;  5ARF A;  3MO0 A;  4LDG A;  3PDN A;  3OOI A;  3F9W A;  2IGQ A;  3BO5 A;  3N71 A;  3M58 A;  5CCM A;  5T0K A;  3TG5 A;  4H12 A;  4C1Q A;  4QEN A;  3M57 A;  3VUZ A;  3SW9 A;  5T0M A;  3KMJ A;  1N6C A;  1PEG A;  5LSX A;  4JLG A;  4YPA A;  5F5E A;  3M53 A;  3F9Y A;  3OXF A;  1MVH A;  3SWC A;  3TG4 A;  4O30 A;  5T5G A;  4IJ8 A;  3S7B A;  2W5Z A;  4YPE A;  5AYF A;  3OS5 A;  4QEO A;  4MI5 A;  3M56 A;  1XQH A;  2R3A A;  4Z4P A;  3RIB A;  1H3I A;  4YPU A;  3KMA A;  3QWW A;  3HNA A;  3CBP A;  3S7D A;  4MI0 A;  3DAL A;  3OPE A;  1MVX A;  3CBM A;  3VV0 A;  3F9X A;  5KJK A;  2W5Y A;  5LSZ A;  5TEG A;  2JV0 A;  3K5K A;  3RJW A;  5F6L A;  1MT6 A;  4E47 A;  4YNM A;  2F69 A;  1ML9 A;  3RU0 A;  3MO2 A;  5KJM A;  4WUY A;  5JIY A;  1N3J A;  5EG2 A;  5JJ0 A;  4RZ0 A;  3S7J A;  5KJN A;  4J83 A;  3EP0 A;  5CCL A;  3MO5 A;  3S8P A;  3M55 A;  4J7F A;  4IJD A;  3QWP A;  4BUP A;  5HI7 A;  3S7F A;  4I51 A;  5HQ8 A;  4FMU A;  4O6F A;  3FPD A;  2BQZ A;  5TTF A;  4NVQ A;  1ZKK A;  3DB5 A;  3RQ4 A;  4YNP A;  2G46 A;  3M5A A;  3MEK A;  4QEP A;  1O9S A;  5F59 A;  3QWV A;  4NJ5 A;  4J7I A;  5EX3 A;  5F6K C;  2O8J A;  4J8O A;  5CPR B;  5JIN A;  3CBO A;  5EX0 A;  5TH7 A;  4YND A;  4JDS A;  1N6A A;  3OXL A;  5JHN A;  2QPW A;  3IHX A;  4AU7 A;  2RFI A;  3OXG A;  1MUF A; 
#chains in the Genus database with same CATH homology
 3M59 A;  3M54 A;  5KJL A;  3KMT A;  3F9Z A;  5ARG A;  3RAY A;  5ARF A;  3MO0 A;  4LDG A;  3PDN A;  3OOI A;  3F9W A;  2IGQ A;  3BO5 A;  3N71 A;  3M58 A;  5CCM A;  5T0K A;  3TG5 A;  4H12 A;  4C1Q A;  4QEN A;  3M57 A;  3VUZ A;  3SW9 A;  5T0M A;  3KMJ A;  1N6C A;  1PEG A;  5LSX A;  4JLG A;  4YPA A;  5F5E A;  3M53 A;  3F9Y A;  3OXF A;  1MVH A;  3SWC A;  3TG4 A;  4O30 A;  5T5G A;  4IJ8 A;  3S7B A;  2W5Z A;  4YPE A;  5AYF A;  3OS5 A;  4QEO A;  4MI5 A;  3M56 A;  1XQH A;  2R3A A;  4Z4P A;  3RIB A;  1H3I A;  4YPU A;  3KMA A;  3QWW A;  3HNA A;  3CBP A;  3S7D A;  4MI0 A;  3DAL A;  3OPE A;  1MVX A;  3CBM A;  3VV0 A;  3F9X A;  5KJK A;  2W5Y A;  5LSZ A;  5TEG A;  2JV0 A;  3K5K A;  3RJW A;  5F6L A;  1MT6 A;  4E47 A;  4YNM A;  2F69 A;  1ML9 A;  3RU0 A;  3MO2 A;  5KJM A;  4WUY A;  5JIY A;  1N3J A;  5EG2 A;  5JJ0 A;  4RZ0 A;  3S7J A;  5KJN A;  4J83 A;  3EP0 A;  5CCL A;  3MO5 A;  3S8P A;  3M55 A;  4J7F A;  4IJD A;  3QWP A;  4BUP A;  5HI7 A;  3S7F A;  4I51 A;  5HQ8 A;  4FMU A;  4O6F A;  3FPD A;  2BQZ A;  5TTF A;  4NVQ A;  1ZKK A;  3DB5 A;  3RQ4 A;  4YNP A;  2G46 A;  3M5A A;  3MEK A;  4QEP A;  1O9S A;  5F59 A;  3QWV A;  4NJ5 A;  4J7I A;  5EX3 A;  5F6K C;  2O8J A;  4J8O A;  5CPR B;  5JIN A;  3CBO A;  5EX0 A;  5TH7 A;  4YND A;  4JDS A;  1N6A A;  3OXL A;  5JHN A;  2QPW A;  3IHX A;  4AU7 A;  2RFI A;  3OXG A;  1MUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...