1MVHA

Structure of the set domain histone lysine methyltransferase clr4
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
269
structure length
269
Chain Sequence
KLDSYTHLSFYEKRELFRKKLREIEGPEVTLVNEVDDEPCPSLDFQFISQYRLTQGVIPPDPNFQSGCNCSSLGGCDLNNPSRCECLDDLDEPTHFAYDAQGRVRADTGAVIYECNSFCSCSMECPNRVVQRGRTLPLEIFKTKEKGWGVRSLRFAPAGTFITCYLGEVITSAEAAKRDKNYDDDGITYLFDLDMFDDASEYTVDAQNYGDVSRFFNHSCSPNIAIYSAVRNHGFRTIYDLAFFAIKDIQPLEELTFDYAGAKDFSPVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cryptic loci regulator 4
publication title Structure of the SET domain histone lysine methyltransferase Clr4.
pubmed rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 60
structure length 269
sequence length 269
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2002-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 1mvhA00
5KJNA 1N3JA 3CBOA 5CCLA 4E47A 3QWPA 2JV0A 4H12A 3RJWA 3RAYA 2BQZA 2W5ZA 3S7FA 5HI7A 4O6FA 5T5GA 4J8OA 2RFIA 3F9XA 3IHXA 1N6AA 4YNDA 1MT6A 1ML9A 2O8JA 3BO5A 3N71A 3EP0A 4J7IA 4J83A 3S7JA 3S7DA 4QEPA 4JDSA 3PDNA 3DB5A 4WUYA 2G46A 3F9ZA 2IGQA 5HQ8A 3TG5A 3KMTA 3M58A 1ZKKA 5CPRB 3HNAA 4Z4PA 3QWVA 5LSZA 3CBPA 4YNPA 5KJMA 3RIBA 4YPAA 4YPUA 3MO0A 4IJDA 1H3IA 3OOIA 2F69A 1MVHA 3RQ4A 3VUZA 5F6KC 3M54A 4RZ0A 3M57A 3DALA 3QWWA 4BUPA 4I51A 3MEKA 3S7BA 5EG2A 3FPDA 1N6CA 3MO5A 2W5YA 4MI5A 5ARFA 3CBMA 3OXLA 5TTFA 3OXFA 4J7FA 4QENA 1MVXA 3K5KA 5JIYA 4MI0A 5T0KA 5JHNA 5CCMA 3M5AA 5JINA 5EX3A 5KJKA 3KMJA 3M53A 5ARGA 3SW9A 5LSXA 4YPEA 2QPWA 4AU7A 3F9YA 3F9WA 4O30A 4JLGA 4FMUA 1MUFA 5TEGA 5T0MA 1O9SA 3MO2A 3KMAA 5TH7A 5EX0A 5JJ0A 5F6LA 3TG4A 3SWCA 4LDGA 1PEGA 3M55A 4IJ8A 4QEOA 3M56A 4NVQA 3OXGA 4NJ5A 5KJLA 4YNMA 5F5EA 4C1QA 1XQHA 2R3AA 3VV0A 5AYFA 3OPEA 5F59A 3S8PA 3M59A 3OS5A 3RU0A
chains in the Genus database with same CATH superfamily
5KJNA 1N3JA 3CBOA 5CCLA 4E47A 3QWPA 2JV0A 4H12A 3RJWA 3RAYA 2BQZA 2W5ZA 3S7FA 5HI7A 4O6FA 5T5GA 4J8OA 2RFIA 3F9XA 3IHXA 1N6AA 4YNDA 1MT6A 1ML9A 2O8JA 3BO5A 3N71A 3EP0A 4J7IA 4J83A 3S7JA 3S7DA 4QEPA 4JDSA 3PDNA 3DB5A 4WUYA 2G46A 3F9ZA 2IGQA 5HQ8A 3TG5A 3KMTA 3M58A 1ZKKA 5CPRB 3HNAA 4Z4PA 3QWVA 5LSZA 3CBPA 4YNPA 5KJMA 3RIBA 4YPAA 4YPUA 3MO0A 4IJDA 1H3IA 3OOIA 2F69A 1MVHA 3RQ4A 3VUZA 5F6KC 3M54A 4RZ0A 3M57A 3DALA 3QWWA 4BUPA 4I51A 3MEKA 3S7BA 5EG2A 3FPDA 1N6CA 3MO5A 2W5YA 4MI5A 5ARFA 3CBMA 3OXLA 5TTFA 3OXFA 4J7FA 4QENA 1MVXA 3K5KA 5JIYA 4MI0A 5T0KA 5JHNA 5CCMA 3M5AA 5JINA 5EX3A 5KJKA 3KMJA 3M53A 5ARGA 3SW9A 5LSXA 4YPEA 2QPWA 4AU7A 3F9YA 3F9WA 4O30A 4JLGA 4FMUA 1MUFA 5TEGA 5T0MA 1O9SA 3MO2A 3KMAA 5TH7A 5EX0A 5JJ0A 5F6LA 3TG4A 3SWCA 4LDGA 1PEGA 3M55A 4IJ8A 4QEOA 3M56A 4NVQA 3OXGA 4NJ5A 5KJLA 4YNMA 5F5EA 4C1QA 1XQHA 2R3AA 3VV0A 5AYFA 3OPEA 5F59A 3S8PA 3M59A 3OS5A 3RU0A
chains in the Genus database with same CATH topology
5KJNA 1N3JA 3CBOA 5CCLA 4E47A 3QWPA 2JV0A 4H12A 3RJWA 3RAYA 2BQZA 2W5ZA 3S7FA 5HI7A 4O6FA 5T5GA 4J8OA 2RFIA 3F9XA 3IHXA 1N6AA 4YNDA 1MT6A 1ML9A 2O8JA 3BO5A 3N71A 3EP0A 4J7IA 4J83A 3S7JA 3S7DA 4QEPA 4JDSA 3PDNA 3DB5A 4WUYA 2G46A 3F9ZA 2IGQA 5HQ8A 3TG5A 3KMTA 3M58A 1ZKKA 5CPRB 3HNAA 4Z4PA 3QWVA 5LSZA 3CBPA 4YNPA 5KJMA 3RIBA 4YPAA 4YPUA 3MO0A 4IJDA 1H3IA 3OOIA 2F69A 1MVHA 3RQ4A 3VUZA 5F6KC 3M54A 4RZ0A 3M57A 3DALA 3QWWA 4BUPA 4I51A 3MEKA 3S7BA 5EG2A 3FPDA 1N6CA 3MO5A 2W5YA 4MI5A 5ARFA 3CBMA 3OXLA 5TTFA 3OXFA 4J7FA 4QENA 1MVXA 3K5KA 5JIYA 4MI0A 5T0KA 5JHNA 5CCMA 3M5AA 5JINA 5EX3A 5KJKA 3KMJA 3M53A 5ARGA 3SW9A 5LSXA 4YPEA 2QPWA 4AU7A 3F9YA 3F9WA 4O30A 4JLGA 4FMUA 1MUFA 5TEGA 5T0MA 1O9SA 3MO2A 3KMAA 5TH7A 5EX0A 5JJ0A 5F6LA 3TG4A 3SWCA 4LDGA 1PEGA 3M55A 4IJ8A 4QEOA 3M56A 4NVQA 3OXGA 4NJ5A 5KJLA 4YNMA 5F5EA 4C1QA 1XQHA 2R3AA 3VV0A 5AYFA 3OPEA 5F59A 3S8PA 3M59A 3OS5A 3RU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJN A;  1N3J A;  3CBO A;  5CCL A;  4E47 A;  3QWP A;  2JV0 A;  4H12 A;  3RJW A;  3RAY A;  2BQZ A;  2W5Z A;  3S7F A;  5HI7 A;  4O6F A;  5T5G A;  4J8O A;  2RFI A;  3F9X A;  3IHX A;  1N6A A;  4YND A;  1MT6 A;  1ML9 A;  2O8J A;  3BO5 A;  3N71 A;  3EP0 A;  4J7I A;  4J83 A;  3S7J A;  3S7D A;  4QEP A;  4JDS A;  3PDN A;  3DB5 A;  4WUY A;  2G46 A;  3F9Z A;  2IGQ A;  5HQ8 A;  3TG5 A;  3KMT A;  3M58 A;  1ZKK A;  5CPR B;  3HNA A;  4Z4P A;  3QWV A;  5LSZ A;  3CBP A;  4YNP A;  5KJM A;  3RIB A;  4YPA A;  4YPU A;  3MO0 A;  4IJD A;  1H3I A;  3OOI A;  2F69 A;  1MVH A;  3RQ4 A;  3VUZ A;  5F6K C;  3M54 A;  4RZ0 A;  3M57 A;  3DAL A;  3QWW A;  4BUP A;  4I51 A;  3MEK A;  3S7B A;  5EG2 A;  3FPD A;  1N6C A;  3MO5 A;  2W5Y A;  4MI5 A;  5ARF A;  3CBM A;  3OXL A;  5TTF A;  3OXF A;  4J7F A;  4QEN A;  1MVX A;  3K5K A;  5JIY A;  4MI0 A;  5T0K A;  5JHN A;  5CCM A;  3M5A A;  5JIN A;  5EX3 A;  5KJK A;  3KMJ A;  3M53 A;  5ARG A;  3SW9 A;  5LSX A;  4YPE A;  2QPW A;  4AU7 A;  3F9Y A;  3F9W A;  4O30 A;  4JLG A;  4FMU A;  1MUF A;  5TEG A;  5T0M A;  1O9S A;  3MO2 A;  3KMA A;  5TH7 A;  5EX0 A;  5JJ0 A;  5F6L A;  3TG4 A;  3SWC A;  4LDG A;  1PEG A;  3M55 A;  4IJ8 A;  4QEO A;  3M56 A;  4NVQ A;  3OXG A;  4NJ5 A;  5KJL A;  4YNM A;  5F5E A;  4C1Q A;  1XQH A;  2R3A A;  3VV0 A;  5AYF A;  3OPE A;  5F59 A;  3S8P A;  3M59 A;  3OS5 A;  3RU0 A; 
#chains in the Genus database with same CATH topology
 5KJN A;  1N3J A;  3CBO A;  5CCL A;  4E47 A;  3QWP A;  2JV0 A;  4H12 A;  3RJW A;  3RAY A;  2BQZ A;  2W5Z A;  3S7F A;  5HI7 A;  4O6F A;  5T5G A;  4J8O A;  2RFI A;  3F9X A;  3IHX A;  1N6A A;  4YND A;  1MT6 A;  1ML9 A;  2O8J A;  3BO5 A;  3N71 A;  3EP0 A;  4J7I A;  4J83 A;  3S7J A;  3S7D A;  4QEP A;  4JDS A;  3PDN A;  3DB5 A;  4WUY A;  2G46 A;  3F9Z A;  2IGQ A;  5HQ8 A;  3TG5 A;  3KMT A;  3M58 A;  1ZKK A;  5CPR B;  3HNA A;  4Z4P A;  3QWV A;  5LSZ A;  3CBP A;  4YNP A;  5KJM A;  3RIB A;  4YPA A;  4YPU A;  3MO0 A;  4IJD A;  1H3I A;  3OOI A;  2F69 A;  1MVH A;  3RQ4 A;  3VUZ A;  5F6K C;  3M54 A;  4RZ0 A;  3M57 A;  3DAL A;  3QWW A;  4BUP A;  4I51 A;  3MEK A;  3S7B A;  5EG2 A;  3FPD A;  1N6C A;  3MO5 A;  2W5Y A;  4MI5 A;  5ARF A;  3CBM A;  3OXL A;  5TTF A;  3OXF A;  4J7F A;  4QEN A;  1MVX A;  3K5K A;  5JIY A;  4MI0 A;  5T0K A;  5JHN A;  5CCM A;  3M5A A;  5JIN A;  5EX3 A;  5KJK A;  3KMJ A;  3M53 A;  5ARG A;  3SW9 A;  5LSX A;  4YPE A;  2QPW A;  4AU7 A;  3F9Y A;  3F9W A;  4O30 A;  4JLG A;  4FMU A;  1MUF A;  5TEG A;  5T0M A;  1O9S A;  3MO2 A;  3KMA A;  5TH7 A;  5EX0 A;  5JJ0 A;  5F6L A;  3TG4 A;  3SWC A;  4LDG A;  1PEG A;  3M55 A;  4IJ8 A;  4QEO A;  3M56 A;  4NVQ A;  3OXG A;  4NJ5 A;  5KJL A;  4YNM A;  5F5E A;  4C1Q A;  1XQH A;  2R3A A;  3VV0 A;  5AYF A;  3OPE A;  5F59 A;  3S8P A;  3M59 A;  3OS5 A;  3RU0 A; 
#chains in the Genus database with same CATH homology
 5KJN A;  1N3J A;  3CBO A;  5CCL A;  4E47 A;  3QWP A;  2JV0 A;  4H12 A;  3RJW A;  3RAY A;  2BQZ A;  2W5Z A;  3S7F A;  5HI7 A;  4O6F A;  5T5G A;  4J8O A;  2RFI A;  3F9X A;  3IHX A;  1N6A A;  4YND A;  1MT6 A;  1ML9 A;  2O8J A;  3BO5 A;  3N71 A;  3EP0 A;  4J7I A;  4J83 A;  3S7J A;  3S7D A;  4QEP A;  4JDS A;  3PDN A;  3DB5 A;  4WUY A;  2G46 A;  3F9Z A;  2IGQ A;  5HQ8 A;  3TG5 A;  3KMT A;  3M58 A;  1ZKK A;  5CPR B;  3HNA A;  4Z4P A;  3QWV A;  5LSZ A;  3CBP A;  4YNP A;  5KJM A;  3RIB A;  4YPA A;  4YPU A;  3MO0 A;  4IJD A;  1H3I A;  3OOI A;  2F69 A;  1MVH A;  3RQ4 A;  3VUZ A;  5F6K C;  3M54 A;  4RZ0 A;  3M57 A;  3DAL A;  3QWW A;  4BUP A;  4I51 A;  3MEK A;  3S7B A;  5EG2 A;  3FPD A;  1N6C A;  3MO5 A;  2W5Y A;  4MI5 A;  5ARF A;  3CBM A;  3OXL A;  5TTF A;  3OXF A;  4J7F A;  4QEN A;  1MVX A;  3K5K A;  5JIY A;  4MI0 A;  5T0K A;  5JHN A;  5CCM A;  3M5A A;  5JIN A;  5EX3 A;  5KJK A;  3KMJ A;  3M53 A;  5ARG A;  3SW9 A;  5LSX A;  4YPE A;  2QPW A;  4AU7 A;  3F9Y A;  3F9W A;  4O30 A;  4JLG A;  4FMU A;  1MUF A;  5TEG A;  5T0M A;  1O9S A;  3MO2 A;  3KMA A;  5TH7 A;  5EX0 A;  5JJ0 A;  5F6L A;  3TG4 A;  3SWC A;  4LDG A;  1PEG A;  3M55 A;  4IJ8 A;  4QEO A;  3M56 A;  4NVQ A;  3OXG A;  4NJ5 A;  5KJL A;  4YNM A;  5F5E A;  4C1Q A;  1XQH A;  2R3A A;  3VV0 A;  5AYF A;  3OPE A;  5F59 A;  3S8P A;  3M59 A;  3OS5 A;  3RU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...