1MVXA

Structure of the set domain histone lysine methyltransferase clr4
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
269
structure length
269
Chain Sequence
KLDSYTHLSFYEKRELFRKKLREIEGPEVTLVNEVDDEPCPSLDFQFISQYRLTQGVIPPDPNFQSGCNCSSLGGCDLNNPSRCECLDDLDEPTHFAYDAQGRVRADTGAVIYECNSFCSCSMECPNRVVQRGRTLPLEIFKTKEKGWGVRSLRFAPAGTFITCYLGEVITSAEAAKRDKNYDDDGITYLFDLDMFDDASEYTVDAQNYGDVSRFFNHSCSPNIAIYSAVRNHGFRTIYDLAFFAIKDIQPLEELTFDYAGAKDFSPVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the SET domain histone lysine methyltransferase Clr4.
pubmed rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
molecule keywords CRYPTIC LOCI REGULATOR 4
total genus 62
structure length 269
sequence length 269
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2002-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 1mvxA00
5EX3A 5F5EA 2BQZA 3TG4A 2JV0A 3OS5A 5JHNA 5HI7A 1ML9A 4MI0A 5LSZA 4YPAA 5KJMA 2G46A 3MO2A 4NVQA 3EP0A 3K5KA 4BUPA 5CCLA 1N6AA 1MVHA 5HQ8A 5JIYA 3SW9A 3SWCA 1N6CA 3KMAA 1MVXA 4FMUA 3M58A 4YNDA 3OXFA 3S8PA 3CBOA 3DALA 4QEOA 3F9ZA 3MEKA 3VUZA 3MO5A 4E47A 2W5YA 3IHXA 3S7DA 4NJ5A 4YPUA 4JDSA 3M53A 1MT6A 1PEGA 2RFIA 3F9XA 3S7FA 2F69A 3M56A 3M55A 5KJNA 4WUYA 3M54A 4O6FA 3DB5A 4LDGA 3OOIA 3QWPA 4J83A 2R3AA 4AU7A 5EG2A 4J8OA 3RIBA 2IGQA 4YNMA 3TG5A 3RJWA 3KMTA 5T0MA 5CCMA 5JJ0A 1O9SA 5TEGA 3RAYA 3QWVA 4QEPA 5F6KC 4IJDA 4JLGA 4YPEA 3BO5A 3FPDA 5KJKA 1H3IA 3OXGA 4O30A 3OPEA 5ARFA 3QWWA 5CPRB 1XQHA 4IJ8A 4J7IA 5TTFA 5EX0A 4Z4PA 3M59A 4YNPA 5T5GA 4RZ0A 4H12A 3M5AA 4MI5A 3S7JA 3MO0A 3RQ4A 4QENA 4C1QA 4I51A 2QPWA 5TH7A 5JINA 5AYFA 3VV0A 1MUFA 5F59A 5LSXA 3CBPA 3KMJA 3F9WA 2O8JA 3F9YA 3N71A 3PDNA 1N3JA 5KJLA 5F6LA 4J7FA 5T0KA 3CBMA 1ZKKA 3S7BA 3OXLA 3M57A 3RU0A 2W5ZA 5ARGA 3HNAA
chains in the Genus database with same CATH superfamily
5EX3A 5F5EA 2BQZA 3TG4A 2JV0A 3OS5A 5JHNA 5HI7A 1ML9A 4MI0A 5LSZA 4YPAA 5KJMA 2G46A 3MO2A 4NVQA 3EP0A 3K5KA 4BUPA 5CCLA 1N6AA 1MVHA 5HQ8A 5JIYA 3SW9A 3SWCA 1N6CA 3KMAA 1MVXA 4FMUA 3M58A 4YNDA 3OXFA 3S8PA 3CBOA 3DALA 4QEOA 3F9ZA 3MEKA 3VUZA 3MO5A 4E47A 2W5YA 3IHXA 3S7DA 4NJ5A 4YPUA 4JDSA 3M53A 1MT6A 1PEGA 2RFIA 3F9XA 3S7FA 2F69A 3M56A 3M55A 5KJNA 4WUYA 3M54A 4O6FA 3DB5A 4LDGA 3OOIA 3QWPA 4J83A 2R3AA 4AU7A 5EG2A 4J8OA 3RIBA 2IGQA 4YNMA 3TG5A 3RJWA 3KMTA 5T0MA 5CCMA 5JJ0A 1O9SA 5TEGA 3RAYA 3QWVA 4QEPA 5F6KC 4IJDA 4JLGA 4YPEA 3BO5A 3FPDA 5KJKA 1H3IA 3OXGA 4O30A 3OPEA 5ARFA 3QWWA 5CPRB 1XQHA 4IJ8A 4J7IA 5TTFA 5EX0A 4Z4PA 3M59A 4YNPA 5T5GA 4RZ0A 4H12A 3M5AA 4MI5A 3S7JA 3MO0A 3RQ4A 4QENA 4C1QA 4I51A 2QPWA 5TH7A 5JINA 5AYFA 3VV0A 1MUFA 5F59A 5LSXA 3CBPA 3KMJA 3F9WA 2O8JA 3F9YA 3N71A 3PDNA 1N3JA 5KJLA 5F6LA 4J7FA 5T0KA 3CBMA 1ZKKA 3S7BA 3OXLA 3M57A 3RU0A 2W5ZA 5ARGA 3HNAA
chains in the Genus database with same CATH topology
5EX3A 5F5EA 2BQZA 3TG4A 2JV0A 3OS5A 5JHNA 5HI7A 1ML9A 4MI0A 5LSZA 4YPAA 5KJMA 2G46A 3MO2A 4NVQA 3EP0A 3K5KA 4BUPA 5CCLA 1N6AA 1MVHA 5HQ8A 5JIYA 3SW9A 3SWCA 1N6CA 3KMAA 1MVXA 4FMUA 3M58A 4YNDA 3OXFA 3S8PA 3CBOA 3DALA 4QEOA 3F9ZA 3MEKA 3VUZA 3MO5A 4E47A 2W5YA 3IHXA 3S7DA 4NJ5A 4YPUA 4JDSA 3M53A 1MT6A 1PEGA 2RFIA 3F9XA 3S7FA 2F69A 3M56A 3M55A 5KJNA 4WUYA 3M54A 4O6FA 3DB5A 4LDGA 3OOIA 3QWPA 4J83A 2R3AA 4AU7A 5EG2A 4J8OA 3RIBA 2IGQA 4YNMA 3TG5A 3RJWA 3KMTA 5T0MA 5CCMA 5JJ0A 1O9SA 5TEGA 3RAYA 3QWVA 4QEPA 5F6KC 4IJDA 4JLGA 4YPEA 3BO5A 3FPDA 5KJKA 1H3IA 3OXGA 4O30A 3OPEA 5ARFA 3QWWA 5CPRB 1XQHA 4IJ8A 4J7IA 5TTFA 5EX0A 4Z4PA 3M59A 4YNPA 5T5GA 4RZ0A 4H12A 3M5AA 4MI5A 3S7JA 3MO0A 3RQ4A 4QENA 4C1QA 4I51A 2QPWA 5TH7A 5JINA 5AYFA 3VV0A 1MUFA 5F59A 5LSXA 3CBPA 3KMJA 3F9WA 2O8JA 3F9YA 3N71A 3PDNA 1N3JA 5KJLA 5F6LA 4J7FA 5T0KA 3CBMA 1ZKKA 3S7BA 3OXLA 3M57A 3RU0A 2W5ZA 5ARGA 3HNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EX3 A;  5F5E A;  2BQZ A;  3TG4 A;  2JV0 A;  3OS5 A;  5JHN A;  5HI7 A;  1ML9 A;  4MI0 A;  5LSZ A;  4YPA A;  5KJM A;  2G46 A;  3MO2 A;  4NVQ A;  3EP0 A;  3K5K A;  4BUP A;  5CCL A;  1N6A A;  1MVH A;  5HQ8 A;  5JIY A;  3SW9 A;  3SWC A;  1N6C A;  3KMA A;  1MVX A;  4FMU A;  3M58 A;  4YND A;  3OXF A;  3S8P A;  3CBO A;  3DAL A;  4QEO A;  3F9Z A;  3MEK A;  3VUZ A;  3MO5 A;  4E47 A;  2W5Y A;  3IHX A;  3S7D A;  4NJ5 A;  4YPU A;  4JDS A;  3M53 A;  1MT6 A;  1PEG A;  2RFI A;  3F9X A;  3S7F A;  2F69 A;  3M56 A;  3M55 A;  5KJN A;  4WUY A;  3M54 A;  4O6F A;  3DB5 A;  4LDG A;  3OOI A;  3QWP A;  4J83 A;  2R3A A;  4AU7 A;  5EG2 A;  4J8O A;  3RIB A;  2IGQ A;  4YNM A;  3TG5 A;  3RJW A;  3KMT A;  5T0M A;  5CCM A;  5JJ0 A;  1O9S A;  5TEG A;  3RAY A;  3QWV A;  4QEP A;  5F6K C;  4IJD A;  4JLG A;  4YPE A;  3BO5 A;  3FPD A;  5KJK A;  1H3I A;  3OXG A;  4O30 A;  3OPE A;  5ARF A;  3QWW A;  5CPR B;  1XQH A;  4IJ8 A;  4J7I A;  5TTF A;  5EX0 A;  4Z4P A;  3M59 A;  4YNP A;  5T5G A;  4RZ0 A;  4H12 A;  3M5A A;  4MI5 A;  3S7J A;  3MO0 A;  3RQ4 A;  4QEN A;  4C1Q A;  4I51 A;  2QPW A;  5TH7 A;  5JIN A;  5AYF A;  3VV0 A;  1MUF A;  5F59 A;  5LSX A;  3CBP A;  3KMJ A;  3F9W A;  2O8J A;  3F9Y A;  3N71 A;  3PDN A;  1N3J A;  5KJL A;  5F6L A;  4J7F A;  5T0K A;  3CBM A;  1ZKK A;  3S7B A;  3OXL A;  3M57 A;  3RU0 A;  2W5Z A;  5ARG A;  3HNA A; 
#chains in the Genus database with same CATH topology
 5EX3 A;  5F5E A;  2BQZ A;  3TG4 A;  2JV0 A;  3OS5 A;  5JHN A;  5HI7 A;  1ML9 A;  4MI0 A;  5LSZ A;  4YPA A;  5KJM A;  2G46 A;  3MO2 A;  4NVQ A;  3EP0 A;  3K5K A;  4BUP A;  5CCL A;  1N6A A;  1MVH A;  5HQ8 A;  5JIY A;  3SW9 A;  3SWC A;  1N6C A;  3KMA A;  1MVX A;  4FMU A;  3M58 A;  4YND A;  3OXF A;  3S8P A;  3CBO A;  3DAL A;  4QEO A;  3F9Z A;  3MEK A;  3VUZ A;  3MO5 A;  4E47 A;  2W5Y A;  3IHX A;  3S7D A;  4NJ5 A;  4YPU A;  4JDS A;  3M53 A;  1MT6 A;  1PEG A;  2RFI A;  3F9X A;  3S7F A;  2F69 A;  3M56 A;  3M55 A;  5KJN A;  4WUY A;  3M54 A;  4O6F A;  3DB5 A;  4LDG A;  3OOI A;  3QWP A;  4J83 A;  2R3A A;  4AU7 A;  5EG2 A;  4J8O A;  3RIB A;  2IGQ A;  4YNM A;  3TG5 A;  3RJW A;  3KMT A;  5T0M A;  5CCM A;  5JJ0 A;  1O9S A;  5TEG A;  3RAY A;  3QWV A;  4QEP A;  5F6K C;  4IJD A;  4JLG A;  4YPE A;  3BO5 A;  3FPD A;  5KJK A;  1H3I A;  3OXG A;  4O30 A;  3OPE A;  5ARF A;  3QWW A;  5CPR B;  1XQH A;  4IJ8 A;  4J7I A;  5TTF A;  5EX0 A;  4Z4P A;  3M59 A;  4YNP A;  5T5G A;  4RZ0 A;  4H12 A;  3M5A A;  4MI5 A;  3S7J A;  3MO0 A;  3RQ4 A;  4QEN A;  4C1Q A;  4I51 A;  2QPW A;  5TH7 A;  5JIN A;  5AYF A;  3VV0 A;  1MUF A;  5F59 A;  5LSX A;  3CBP A;  3KMJ A;  3F9W A;  2O8J A;  3F9Y A;  3N71 A;  3PDN A;  1N3J A;  5KJL A;  5F6L A;  4J7F A;  5T0K A;  3CBM A;  1ZKK A;  3S7B A;  3OXL A;  3M57 A;  3RU0 A;  2W5Z A;  5ARG A;  3HNA A; 
#chains in the Genus database with same CATH homology
 5EX3 A;  5F5E A;  2BQZ A;  3TG4 A;  2JV0 A;  3OS5 A;  5JHN A;  5HI7 A;  1ML9 A;  4MI0 A;  5LSZ A;  4YPA A;  5KJM A;  2G46 A;  3MO2 A;  4NVQ A;  3EP0 A;  3K5K A;  4BUP A;  5CCL A;  1N6A A;  1MVH A;  5HQ8 A;  5JIY A;  3SW9 A;  3SWC A;  1N6C A;  3KMA A;  1MVX A;  4FMU A;  3M58 A;  4YND A;  3OXF A;  3S8P A;  3CBO A;  3DAL A;  4QEO A;  3F9Z A;  3MEK A;  3VUZ A;  3MO5 A;  4E47 A;  2W5Y A;  3IHX A;  3S7D A;  4NJ5 A;  4YPU A;  4JDS A;  3M53 A;  1MT6 A;  1PEG A;  2RFI A;  3F9X A;  3S7F A;  2F69 A;  3M56 A;  3M55 A;  5KJN A;  4WUY A;  3M54 A;  4O6F A;  3DB5 A;  4LDG A;  3OOI A;  3QWP A;  4J83 A;  2R3A A;  4AU7 A;  5EG2 A;  4J8O A;  3RIB A;  2IGQ A;  4YNM A;  3TG5 A;  3RJW A;  3KMT A;  5T0M A;  5CCM A;  5JJ0 A;  1O9S A;  5TEG A;  3RAY A;  3QWV A;  4QEP A;  5F6K C;  4IJD A;  4JLG A;  4YPE A;  3BO5 A;  3FPD A;  5KJK A;  1H3I A;  3OXG A;  4O30 A;  3OPE A;  5ARF A;  3QWW A;  5CPR B;  1XQH A;  4IJ8 A;  4J7I A;  5TTF A;  5EX0 A;  4Z4P A;  3M59 A;  4YNP A;  5T5G A;  4RZ0 A;  4H12 A;  3M5A A;  4MI5 A;  3S7J A;  3MO0 A;  3RQ4 A;  4QEN A;  4C1Q A;  4I51 A;  2QPW A;  5TH7 A;  5JIN A;  5AYF A;  3VV0 A;  1MUF A;  5F59 A;  5LSX A;  3CBP A;  3KMJ A;  3F9W A;  2O8J A;  3F9Y A;  3N71 A;  3PDN A;  1N3J A;  5KJL A;  5F6L A;  4J7F A;  5T0K A;  3CBM A;  1ZKK A;  3S7B A;  3OXL A;  3M57 A;  3RU0 A;  2W5Z A;  5ARG A;  3HNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...