1MVXA

Structure of the set domain histone lysine methyltransferase clr4
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
269
structure length
269
Chain Sequence
b'KLDSYTHLSFYEKRELFRKKLREIEGPEVTLVNEVDDEPCPSLDFQFISQYRLTQGVIPPDPNFQSGCNCSSLGGCDLNNPSRCECLDDLDEPTHFAYDAQGRVRADTGAVIYECNSFCSCSMECPNRVVQRGRTLPLEIFKTKEKGWGVRSLRFAPAGTFITCYLGEVITSAEAAKRDKNYDDDGITYLFDLDMFDDASEYTVDAQNYGDVSRFFNHSCSPNIAIYSAVRNHGFRTIYDLAFFAIKDIQPLEELTFDYAGAKDFSPVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRYPTIC LOCI REGULATOR 4
publication title Structure of the SET domain histone lysine methyltransferase Clr4.
pubmed rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 62
structure length 269
sequence length 269
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2002-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 1mvxA00
5EG2A 4YPEA 4YNPA 1N3JA 3F9YA 4MI5A 4J8OA 5JINA 3HNAA 2RFIA 1MT6A 1ML9A 5F6KC 4QEOA 3CBMA 4FMUA 5TEGA 4YNMA 5KJLA 3S7FA 3MO0A 1ZKKA 4I51A 4O30A 4E47A 4RZ0A 5ARFA 2O8JA 5KJMA 5HI7A 4YPUA 5TTFA 3DB5A 1N6AA 3F9WA 3M5AA 1PEGA 5F59A 3RIBA 4O6FA 3K5KA 4NJ5A 5ARGA 1N6CA 3N71A 4JLGA 3SW9A 5EX0A 2BQZA 4J7FA 2G46A 4QEPA 4YPAA 5EX3A 3TG4A 3QWVA 1H3IA 3OXFA 5F6LA 5CPRB 4NVQA 3KMAA 3IHXA 3M58A 3OXLA 3S7DA 3M59A 5JHNA 4H12A 5CCLA 1O9SA 4YNDA 4J83A 2QPWA 4QENA 4J7IA 3KMJA 5KJKA 3F9ZA 2IGQA 3F9XA 2W5YA 4LDGA 3RAYA 3M55A 4WUYA 5T5GA 5CCMA 5LSXA 3RQ4A 2W5ZA 5T0KA 3S8PA 3VV0A 3VUZA 3SWCA 1MVXA 1MUFA 3RU0A 3EP0A 3M53A 3TG5A 3M54A 4IJ8A 3CBPA 5LSZA 3RJWA 5JIYA 3S7JA 3QWPA 5TH7A 3BO5A 3MEKA 4BUPA 3OXGA 4AU7A 3PDNA 2F69A 3M57A 2JV0A 4MI0A 3MO2A 3OS5A 3DALA 3KMTA 1XQHA 3MO5A 5JJ0A 5HQ8A 4JDSA 3M56A 4IJDA 3FPDA 4Z4PA 3S7BA 2R3AA 3OOIA 5AYFA 4C1QA 5KJNA 1MVHA 3QWWA 5T0MA 3OPEA 3CBOA 5F5EA
chains in the Genus database with same CATH superfamily
5EG2A 4YPEA 4YNPA 1N3JA 3F9YA 4MI5A 4J8OA 5JINA 3HNAA 2RFIA 1MT6A 1ML9A 5F6KC 4QEOA 3CBMA 4FMUA 5TEGA 4YNMA 5KJLA 3S7FA 3MO0A 1ZKKA 4I51A 4O30A 4E47A 4RZ0A 5ARFA 2O8JA 5KJMA 5HI7A 4YPUA 5TTFA 3DB5A 1N6AA 3F9WA 3M5AA 1PEGA 5F59A 3RIBA 4O6FA 3K5KA 4NJ5A 5ARGA 1N6CA 3N71A 4JLGA 3SW9A 5EX0A 2BQZA 4J7FA 2G46A 4QEPA 4YPAA 5EX3A 3TG4A 3QWVA 1H3IA 3OXFA 5F6LA 5CPRB 4NVQA 3KMAA 3IHXA 3M58A 3OXLA 3S7DA 3M59A 5JHNA 4H12A 5CCLA 1O9SA 4YNDA 4J83A 2QPWA 4QENA 4J7IA 3KMJA 5KJKA 3F9ZA 2IGQA 3F9XA 2W5YA 4LDGA 3RAYA 3M55A 4WUYA 5T5GA 5CCMA 5LSXA 3RQ4A 2W5ZA 5T0KA 3S8PA 3VV0A 3VUZA 3SWCA 1MVXA 1MUFA 3RU0A 3EP0A 3M53A 3TG5A 3M54A 4IJ8A 3CBPA 5LSZA 3RJWA 5JIYA 3S7JA 3QWPA 5TH7A 3BO5A 3MEKA 4BUPA 3OXGA 4AU7A 3PDNA 2F69A 3M57A 2JV0A 4MI0A 3MO2A 3OS5A 3DALA 3KMTA 1XQHA 3MO5A 5JJ0A 5HQ8A 4JDSA 3M56A 4IJDA 3FPDA 4Z4PA 3S7BA 2R3AA 3OOIA 5AYFA 4C1QA 5KJNA 1MVHA 3QWWA 5T0MA 3OPEA 3CBOA 5F5EA
chains in the Genus database with same CATH topology
5EG2A 4YPEA 4YNPA 1N3JA 3F9YA 4MI5A 4J8OA 5JINA 3HNAA 2RFIA 1MT6A 1ML9A 5F6KC 4QEOA 3CBMA 4FMUA 5TEGA 4YNMA 5KJLA 3S7FA 3MO0A 1ZKKA 4I51A 4O30A 4E47A 4RZ0A 5ARFA 2O8JA 5KJMA 5HI7A 4YPUA 5TTFA 3DB5A 1N6AA 3F9WA 3M5AA 1PEGA 5F59A 3RIBA 4O6FA 3K5KA 4NJ5A 5ARGA 1N6CA 3N71A 4JLGA 3SW9A 5EX0A 2BQZA 4J7FA 2G46A 4QEPA 4YPAA 5EX3A 3TG4A 3QWVA 1H3IA 3OXFA 5F6LA 5CPRB 4NVQA 3KMAA 3IHXA 3M58A 3OXLA 3S7DA 3M59A 5JHNA 4H12A 5CCLA 1O9SA 4YNDA 4J83A 2QPWA 4QENA 4J7IA 3KMJA 5KJKA 3F9ZA 2IGQA 3F9XA 2W5YA 4LDGA 3RAYA 3M55A 4WUYA 5T5GA 5CCMA 5LSXA 3RQ4A 2W5ZA 5T0KA 3S8PA 3VV0A 3VUZA 3SWCA 1MVXA 1MUFA 3RU0A 3EP0A 3M53A 3TG5A 3M54A 4IJ8A 3CBPA 5LSZA 3RJWA 5JIYA 3S7JA 3QWPA 5TH7A 3BO5A 3MEKA 4BUPA 3OXGA 4AU7A 3PDNA 2F69A 3M57A 2JV0A 4MI0A 3MO2A 3OS5A 3DALA 3KMTA 1XQHA 3MO5A 5JJ0A 5HQ8A 4JDSA 3M56A 4IJDA 3FPDA 4Z4PA 3S7BA 2R3AA 3OOIA 5AYFA 4C1QA 5KJNA 1MVHA 3QWWA 5T0MA 3OPEA 3CBOA 5F5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EG2 A;  4YPE A;  4YNP A;  1N3J A;  3F9Y A;  4MI5 A;  4J8O A;  5JIN A;  3HNA A;  2RFI A;  1MT6 A;  1ML9 A;  5F6K C;  4QEO A;  3CBM A;  4FMU A;  5TEG A;  4YNM A;  5KJL A;  3S7F A;  3MO0 A;  1ZKK A;  4I51 A;  4O30 A;  4E47 A;  4RZ0 A;  5ARF A;  2O8J A;  5KJM A;  5HI7 A;  4YPU A;  5TTF A;  3DB5 A;  1N6A A;  3F9W A;  3M5A A;  1PEG A;  5F59 A;  3RIB A;  4O6F A;  3K5K A;  4NJ5 A;  5ARG A;  1N6C A;  3N71 A;  4JLG A;  3SW9 A;  5EX0 A;  2BQZ A;  4J7F A;  2G46 A;  4QEP A;  4YPA A;  5EX3 A;  3TG4 A;  3QWV A;  1H3I A;  3OXF A;  5F6L A;  5CPR B;  4NVQ A;  3KMA A;  3IHX A;  3M58 A;  3OXL A;  3S7D A;  3M59 A;  5JHN A;  4H12 A;  5CCL A;  1O9S A;  4YND A;  4J83 A;  2QPW A;  4QEN A;  4J7I A;  3KMJ A;  5KJK A;  3F9Z A;  2IGQ A;  3F9X A;  2W5Y A;  4LDG A;  3RAY A;  3M55 A;  4WUY A;  5T5G A;  5CCM A;  5LSX A;  3RQ4 A;  2W5Z A;  5T0K A;  3S8P A;  3VV0 A;  3VUZ A;  3SWC A;  1MVX A;  1MUF A;  3RU0 A;  3EP0 A;  3M53 A;  3TG5 A;  3M54 A;  4IJ8 A;  3CBP A;  5LSZ A;  3RJW A;  5JIY A;  3S7J A;  3QWP A;  5TH7 A;  3BO5 A;  3MEK A;  4BUP A;  3OXG A;  4AU7 A;  3PDN A;  2F69 A;  3M57 A;  2JV0 A;  4MI0 A;  3MO2 A;  3OS5 A;  3DAL A;  3KMT A;  1XQH A;  3MO5 A;  5JJ0 A;  5HQ8 A;  4JDS A;  3M56 A;  4IJD A;  3FPD A;  4Z4P A;  3S7B A;  2R3A A;  3OOI A;  5AYF A;  4C1Q A;  5KJN A;  1MVH A;  3QWW A;  5T0M A;  3OPE A;  3CBO A;  5F5E A; 
#chains in the Genus database with same CATH topology
 5EG2 A;  4YPE A;  4YNP A;  1N3J A;  3F9Y A;  4MI5 A;  4J8O A;  5JIN A;  3HNA A;  2RFI A;  1MT6 A;  1ML9 A;  5F6K C;  4QEO A;  3CBM A;  4FMU A;  5TEG A;  4YNM A;  5KJL A;  3S7F A;  3MO0 A;  1ZKK A;  4I51 A;  4O30 A;  4E47 A;  4RZ0 A;  5ARF A;  2O8J A;  5KJM A;  5HI7 A;  4YPU A;  5TTF A;  3DB5 A;  1N6A A;  3F9W A;  3M5A A;  1PEG A;  5F59 A;  3RIB A;  4O6F A;  3K5K A;  4NJ5 A;  5ARG A;  1N6C A;  3N71 A;  4JLG A;  3SW9 A;  5EX0 A;  2BQZ A;  4J7F A;  2G46 A;  4QEP A;  4YPA A;  5EX3 A;  3TG4 A;  3QWV A;  1H3I A;  3OXF A;  5F6L A;  5CPR B;  4NVQ A;  3KMA A;  3IHX A;  3M58 A;  3OXL A;  3S7D A;  3M59 A;  5JHN A;  4H12 A;  5CCL A;  1O9S A;  4YND A;  4J83 A;  2QPW A;  4QEN A;  4J7I A;  3KMJ A;  5KJK A;  3F9Z A;  2IGQ A;  3F9X A;  2W5Y A;  4LDG A;  3RAY A;  3M55 A;  4WUY A;  5T5G A;  5CCM A;  5LSX A;  3RQ4 A;  2W5Z A;  5T0K A;  3S8P A;  3VV0 A;  3VUZ A;  3SWC A;  1MVX A;  1MUF A;  3RU0 A;  3EP0 A;  3M53 A;  3TG5 A;  3M54 A;  4IJ8 A;  3CBP A;  5LSZ A;  3RJW A;  5JIY A;  3S7J A;  3QWP A;  5TH7 A;  3BO5 A;  3MEK A;  4BUP A;  3OXG A;  4AU7 A;  3PDN A;  2F69 A;  3M57 A;  2JV0 A;  4MI0 A;  3MO2 A;  3OS5 A;  3DAL A;  3KMT A;  1XQH A;  3MO5 A;  5JJ0 A;  5HQ8 A;  4JDS A;  3M56 A;  4IJD A;  3FPD A;  4Z4P A;  3S7B A;  2R3A A;  3OOI A;  5AYF A;  4C1Q A;  5KJN A;  1MVH A;  3QWW A;  5T0M A;  3OPE A;  3CBO A;  5F5E A; 
#chains in the Genus database with same CATH homology
 5EG2 A;  4YPE A;  4YNP A;  1N3J A;  3F9Y A;  4MI5 A;  4J8O A;  5JIN A;  3HNA A;  2RFI A;  1MT6 A;  1ML9 A;  5F6K C;  4QEO A;  3CBM A;  4FMU A;  5TEG A;  4YNM A;  5KJL A;  3S7F A;  3MO0 A;  1ZKK A;  4I51 A;  4O30 A;  4E47 A;  4RZ0 A;  5ARF A;  2O8J A;  5KJM A;  5HI7 A;  4YPU A;  5TTF A;  3DB5 A;  1N6A A;  3F9W A;  3M5A A;  1PEG A;  5F59 A;  3RIB A;  4O6F A;  3K5K A;  4NJ5 A;  5ARG A;  1N6C A;  3N71 A;  4JLG A;  3SW9 A;  5EX0 A;  2BQZ A;  4J7F A;  2G46 A;  4QEP A;  4YPA A;  5EX3 A;  3TG4 A;  3QWV A;  1H3I A;  3OXF A;  5F6L A;  5CPR B;  4NVQ A;  3KMA A;  3IHX A;  3M58 A;  3OXL A;  3S7D A;  3M59 A;  5JHN A;  4H12 A;  5CCL A;  1O9S A;  4YND A;  4J83 A;  2QPW A;  4QEN A;  4J7I A;  3KMJ A;  5KJK A;  3F9Z A;  2IGQ A;  3F9X A;  2W5Y A;  4LDG A;  3RAY A;  3M55 A;  4WUY A;  5T5G A;  5CCM A;  5LSX A;  3RQ4 A;  2W5Z A;  5T0K A;  3S8P A;  3VV0 A;  3VUZ A;  3SWC A;  1MVX A;  1MUF A;  3RU0 A;  3EP0 A;  3M53 A;  3TG5 A;  3M54 A;  4IJ8 A;  3CBP A;  5LSZ A;  3RJW A;  5JIY A;  3S7J A;  3QWP A;  5TH7 A;  3BO5 A;  3MEK A;  4BUP A;  3OXG A;  4AU7 A;  3PDN A;  2F69 A;  3M57 A;  2JV0 A;  4MI0 A;  3MO2 A;  3OS5 A;  3DAL A;  3KMT A;  1XQH A;  3MO5 A;  5JJ0 A;  5HQ8 A;  4JDS A;  3M56 A;  4IJD A;  3FPD A;  4Z4P A;  3S7B A;  2R3A A;  3OOI A;  5AYF A;  4C1Q A;  5KJN A;  1MVH A;  3QWW A;  5T0M A;  3OPE A;  3CBO A;  5F5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...