1MVXA

Structure of the set domain histone lysine methyltransferase clr4
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
269
structure length
269
Chain Sequence
KLDSYTHLSFYEKRELFRKKLREIEGPEVTLVNEVDDEPCPSLDFQFISQYRLTQGVIPPDPNFQSGCNCSSLGGCDLNNPSRCECLDDLDEPTHFAYDAQGRVRADTGAVIYECNSFCSCSMECPNRVVQRGRTLPLEIFKTKEKGWGVRSLRFAPAGTFITCYLGEVITSAEAAKRDKNYDDDGITYLFDLDMFDDASEYTVDAQNYGDVSRFFNHSCSPNIAIYSAVRNHGFRTIYDLAFFAIKDIQPLEELTFDYAGAKDFSPVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRYPTIC LOCI REGULATOR 4
publication title Structure of the SET domain histone lysine methyltransferase Clr4.
pubmed rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 62
structure length 269
sequence length 269
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2002-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF05033 Pre-SET Pre-SET motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 1mvxA00
3RU0A 3OXFA 5T5GA 5ARFA 5T0KA 2O8JA 3F9ZA 3S7DA 4O30A 1N6CA 3S8PA 3CBOA 4NVQA 3SWCA 3RIBA 3F9YA 4WUYA 3HNAA 3BO5A 4BUPA 5LSZA 5TEGA 5TH7A 5HI7A 3M58A 2W5ZA 3TG4A 4MI5A 2JV0A 3M59A 1O9SA 3OS5A 2RFIA 3F9XA 3K5KA 1ML9A 3S7FA 3DB5A 5F59A 5EX3A 5KJKA 3EP0A 3QWVA 5TTFA 3SW9A 5JHNA 5T0MA 1MVHA 3FPDA 3M53A 4H12A 3RJWA 3KMJA 2F69A 3DALA 4Z4PA 3CBMA 2BQZA 4I51A 5AYFA 3VV0A 5KJLA 3RAYA 3MO2A 1MT6A 2R3AA 3MEKA 4YNDA 5ARGA 1ZKKA 1N3JA 4QEOA 5CPRB 3N71A 5EX0A 3S7BA 2IGQA 5LSXA 3M5AA 5CCMA 5EG2A 4QENA 1PEGA 4FMUA 4JLGA 4J8OA 3MO5A 2W5YA 4YNMA 3IHXA 3MO0A 1XQHA 5F6KC 4AU7A 5CCLA 4NJ5A 4RZ0A 5JIYA 4J7FA 5JINA 2G46A 4YNPA 4QEPA 4JDSA 3OPEA 4C1QA 1N6AA 3KMAA 3OOIA 4YPAA 5JJ0A 3M54A 3PDNA 4E47A 1MUFA 3QWPA 3F9WA 4J83A 3S7JA 4MI0A 4LDGA 4O6FA 3KMTA 3M56A 3M55A 3OXLA 2QPWA 5KJMA 3VUZA 3TG5A 3QWWA 1MVXA 3OXGA 4YPEA 1H3IA 3RQ4A 4J7IA 4YPUA 5F6LA 5HQ8A 3M57A 5KJNA 3CBPA 5F5EA 4IJ8A 4IJDA
chains in the Genus database with same CATH superfamily
3RU0A 3OXFA 5T5GA 5ARFA 5T0KA 2O8JA 3F9ZA 3S7DA 4O30A 1N6CA 3S8PA 3CBOA 4NVQA 3SWCA 3RIBA 3F9YA 4WUYA 3HNAA 3BO5A 4BUPA 5LSZA 5TEGA 5TH7A 5HI7A 3M58A 2W5ZA 3TG4A 4MI5A 2JV0A 3M59A 1O9SA 3OS5A 2RFIA 3F9XA 3K5KA 1ML9A 3S7FA 3DB5A 5F59A 5EX3A 5KJKA 3EP0A 3QWVA 5TTFA 3SW9A 5JHNA 5T0MA 1MVHA 3FPDA 3M53A 4H12A 3RJWA 3KMJA 2F69A 3DALA 4Z4PA 3CBMA 2BQZA 4I51A 5AYFA 3VV0A 5KJLA 3RAYA 3MO2A 1MT6A 2R3AA 3MEKA 4YNDA 5ARGA 1ZKKA 1N3JA 4QEOA 5CPRB 3N71A 5EX0A 3S7BA 2IGQA 5LSXA 3M5AA 5CCMA 5EG2A 4QENA 1PEGA 4FMUA 4JLGA 4J8OA 3MO5A 2W5YA 4YNMA 3IHXA 3MO0A 1XQHA 5F6KC 4AU7A 5CCLA 4NJ5A 4RZ0A 5JIYA 4J7FA 5JINA 2G46A 4YNPA 4QEPA 4JDSA 3OPEA 4C1QA 1N6AA 3KMAA 3OOIA 4YPAA 5JJ0A 3M54A 3PDNA 4E47A 1MUFA 3QWPA 3F9WA 4J83A 3S7JA 4MI0A 4LDGA 4O6FA 3KMTA 3M56A 3M55A 3OXLA 2QPWA 5KJMA 3VUZA 3TG5A 3QWWA 1MVXA 3OXGA 4YPEA 1H3IA 3RQ4A 4J7IA 4YPUA 5F6LA 5HQ8A 3M57A 5KJNA 3CBPA 5F5EA 4IJ8A 4IJDA
chains in the Genus database with same CATH topology
3RU0A 3OXFA 5T5GA 5ARFA 5T0KA 2O8JA 3F9ZA 3S7DA 4O30A 1N6CA 3S8PA 3CBOA 4NVQA 3SWCA 3RIBA 3F9YA 4WUYA 3HNAA 3BO5A 4BUPA 5LSZA 5TEGA 5TH7A 5HI7A 3M58A 2W5ZA 3TG4A 4MI5A 2JV0A 3M59A 1O9SA 3OS5A 2RFIA 3F9XA 3K5KA 1ML9A 3S7FA 3DB5A 5F59A 5EX3A 5KJKA 3EP0A 3QWVA 5TTFA 3SW9A 5JHNA 5T0MA 1MVHA 3FPDA 3M53A 4H12A 3RJWA 3KMJA 2F69A 3DALA 4Z4PA 3CBMA 2BQZA 4I51A 5AYFA 3VV0A 5KJLA 3RAYA 3MO2A 1MT6A 2R3AA 3MEKA 4YNDA 5ARGA 1ZKKA 1N3JA 4QEOA 5CPRB 3N71A 5EX0A 3S7BA 2IGQA 5LSXA 3M5AA 5CCMA 5EG2A 4QENA 1PEGA 4FMUA 4JLGA 4J8OA 3MO5A 2W5YA 4YNMA 3IHXA 3MO0A 1XQHA 5F6KC 4AU7A 5CCLA 4NJ5A 4RZ0A 5JIYA 4J7FA 5JINA 2G46A 4YNPA 4QEPA 4JDSA 3OPEA 4C1QA 1N6AA 3KMAA 3OOIA 4YPAA 5JJ0A 3M54A 3PDNA 4E47A 1MUFA 3QWPA 3F9WA 4J83A 3S7JA 4MI0A 4LDGA 4O6FA 3KMTA 3M56A 3M55A 3OXLA 2QPWA 5KJMA 3VUZA 3TG5A 3QWWA 1MVXA 3OXGA 4YPEA 1H3IA 3RQ4A 4J7IA 4YPUA 5F6LA 5HQ8A 3M57A 5KJNA 3CBPA 5F5EA 4IJ8A 4IJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RU0 A;  3OXF A;  5T5G A;  5ARF A;  5T0K A;  2O8J A;  3F9Z A;  3S7D A;  4O30 A;  1N6C A;  3S8P A;  3CBO A;  4NVQ A;  3SWC A;  3RIB A;  3F9Y A;  4WUY A;  3HNA A;  3BO5 A;  4BUP A;  5LSZ A;  5TEG A;  5TH7 A;  5HI7 A;  3M58 A;  2W5Z A;  3TG4 A;  4MI5 A;  2JV0 A;  3M59 A;  1O9S A;  3OS5 A;  2RFI A;  3F9X A;  3K5K A;  1ML9 A;  3S7F A;  3DB5 A;  5F59 A;  5EX3 A;  5KJK A;  3EP0 A;  3QWV A;  5TTF A;  3SW9 A;  5JHN A;  5T0M A;  1MVH A;  3FPD A;  3M53 A;  4H12 A;  3RJW A;  3KMJ A;  2F69 A;  3DAL A;  4Z4P A;  3CBM A;  2BQZ A;  4I51 A;  5AYF A;  3VV0 A;  5KJL A;  3RAY A;  3MO2 A;  1MT6 A;  2R3A A;  3MEK A;  4YND A;  5ARG A;  1ZKK A;  1N3J A;  4QEO A;  5CPR B;  3N71 A;  5EX0 A;  3S7B A;  2IGQ A;  5LSX A;  3M5A A;  5CCM A;  5EG2 A;  4QEN A;  1PEG A;  4FMU A;  4JLG A;  4J8O A;  3MO5 A;  2W5Y A;  4YNM A;  3IHX A;  3MO0 A;  1XQH A;  5F6K C;  4AU7 A;  5CCL A;  4NJ5 A;  4RZ0 A;  5JIY A;  4J7F A;  5JIN A;  2G46 A;  4YNP A;  4QEP A;  4JDS A;  3OPE A;  4C1Q A;  1N6A A;  3KMA A;  3OOI A;  4YPA A;  5JJ0 A;  3M54 A;  3PDN A;  4E47 A;  1MUF A;  3QWP A;  3F9W A;  4J83 A;  3S7J A;  4MI0 A;  4LDG A;  4O6F A;  3KMT A;  3M56 A;  3M55 A;  3OXL A;  2QPW A;  5KJM A;  3VUZ A;  3TG5 A;  3QWW A;  1MVX A;  3OXG A;  4YPE A;  1H3I A;  3RQ4 A;  4J7I A;  4YPU A;  5F6L A;  5HQ8 A;  3M57 A;  5KJN A;  3CBP A;  5F5E A;  4IJ8 A;  4IJD A; 
#chains in the Genus database with same CATH topology
 3RU0 A;  3OXF A;  5T5G A;  5ARF A;  5T0K A;  2O8J A;  3F9Z A;  3S7D A;  4O30 A;  1N6C A;  3S8P A;  3CBO A;  4NVQ A;  3SWC A;  3RIB A;  3F9Y A;  4WUY A;  3HNA A;  3BO5 A;  4BUP A;  5LSZ A;  5TEG A;  5TH7 A;  5HI7 A;  3M58 A;  2W5Z A;  3TG4 A;  4MI5 A;  2JV0 A;  3M59 A;  1O9S A;  3OS5 A;  2RFI A;  3F9X A;  3K5K A;  1ML9 A;  3S7F A;  3DB5 A;  5F59 A;  5EX3 A;  5KJK A;  3EP0 A;  3QWV A;  5TTF A;  3SW9 A;  5JHN A;  5T0M A;  1MVH A;  3FPD A;  3M53 A;  4H12 A;  3RJW A;  3KMJ A;  2F69 A;  3DAL A;  4Z4P A;  3CBM A;  2BQZ A;  4I51 A;  5AYF A;  3VV0 A;  5KJL A;  3RAY A;  3MO2 A;  1MT6 A;  2R3A A;  3MEK A;  4YND A;  5ARG A;  1ZKK A;  1N3J A;  4QEO A;  5CPR B;  3N71 A;  5EX0 A;  3S7B A;  2IGQ A;  5LSX A;  3M5A A;  5CCM A;  5EG2 A;  4QEN A;  1PEG A;  4FMU A;  4JLG A;  4J8O A;  3MO5 A;  2W5Y A;  4YNM A;  3IHX A;  3MO0 A;  1XQH A;  5F6K C;  4AU7 A;  5CCL A;  4NJ5 A;  4RZ0 A;  5JIY A;  4J7F A;  5JIN A;  2G46 A;  4YNP A;  4QEP A;  4JDS A;  3OPE A;  4C1Q A;  1N6A A;  3KMA A;  3OOI A;  4YPA A;  5JJ0 A;  3M54 A;  3PDN A;  4E47 A;  1MUF A;  3QWP A;  3F9W A;  4J83 A;  3S7J A;  4MI0 A;  4LDG A;  4O6F A;  3KMT A;  3M56 A;  3M55 A;  3OXL A;  2QPW A;  5KJM A;  3VUZ A;  3TG5 A;  3QWW A;  1MVX A;  3OXG A;  4YPE A;  1H3I A;  3RQ4 A;  4J7I A;  4YPU A;  5F6L A;  5HQ8 A;  3M57 A;  5KJN A;  3CBP A;  5F5E A;  4IJ8 A;  4IJD A; 
#chains in the Genus database with same CATH homology
 3RU0 A;  3OXF A;  5T5G A;  5ARF A;  5T0K A;  2O8J A;  3F9Z A;  3S7D A;  4O30 A;  1N6C A;  3S8P A;  3CBO A;  4NVQ A;  3SWC A;  3RIB A;  3F9Y A;  4WUY A;  3HNA A;  3BO5 A;  4BUP A;  5LSZ A;  5TEG A;  5TH7 A;  5HI7 A;  3M58 A;  2W5Z A;  3TG4 A;  4MI5 A;  2JV0 A;  3M59 A;  1O9S A;  3OS5 A;  2RFI A;  3F9X A;  3K5K A;  1ML9 A;  3S7F A;  3DB5 A;  5F59 A;  5EX3 A;  5KJK A;  3EP0 A;  3QWV A;  5TTF A;  3SW9 A;  5JHN A;  5T0M A;  1MVH A;  3FPD A;  3M53 A;  4H12 A;  3RJW A;  3KMJ A;  2F69 A;  3DAL A;  4Z4P A;  3CBM A;  2BQZ A;  4I51 A;  5AYF A;  3VV0 A;  5KJL A;  3RAY A;  3MO2 A;  1MT6 A;  2R3A A;  3MEK A;  4YND A;  5ARG A;  1ZKK A;  1N3J A;  4QEO A;  5CPR B;  3N71 A;  5EX0 A;  3S7B A;  2IGQ A;  5LSX A;  3M5A A;  5CCM A;  5EG2 A;  4QEN A;  1PEG A;  4FMU A;  4JLG A;  4J8O A;  3MO5 A;  2W5Y A;  4YNM A;  3IHX A;  3MO0 A;  1XQH A;  5F6K C;  4AU7 A;  5CCL A;  4NJ5 A;  4RZ0 A;  5JIY A;  4J7F A;  5JIN A;  2G46 A;  4YNP A;  4QEP A;  4JDS A;  3OPE A;  4C1Q A;  1N6A A;  3KMA A;  3OOI A;  4YPA A;  5JJ0 A;  3M54 A;  3PDN A;  4E47 A;  1MUF A;  3QWP A;  3F9W A;  4J83 A;  3S7J A;  4MI0 A;  4LDG A;  4O6F A;  3KMT A;  3M56 A;  3M55 A;  3OXL A;  2QPW A;  5KJM A;  3VUZ A;  3TG5 A;  3QWW A;  1MVX A;  3OXG A;  4YPE A;  1H3I A;  3RQ4 A;  4J7I A;  4YPU A;  5F6L A;  5HQ8 A;  3M57 A;  5KJN A;  3CBP A;  5F5E A;  4IJ8 A;  4IJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...