1MX2A

Structure of f71n mutant of p18ink4c
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
156
structure length
156
Chain Sequence
WGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGNAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of p18INK4c proteins with increased thermodynamic stability and cell cycle inhibitory activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle inhibitor
molecule keywords Cyclin-dependent kinase 6 inhibitor
total genus 48
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1mx2A00
1SW6A 3ZUVB 3TWWA 4OAUC 5EIBE 2ETBA 1N0RA 2ZGDA 2P2CP 5AARA 2Y0BG 3Q9NC 4HB5A 3UTMA 5EILA 3V30A 2BKKB 4DRXE 3TWQA 4N5QA 5ENQD 2L6BA 3C5RA 3JUEA 2AJAA 5CBNA 3V2OA 5CEDB 1MJ0A 3B7BA 5CECB 4U8YD 2QYJA 4BESA 3TWVA 5ENOD 5KWDA 4HI9A 5KBAA 3F6QA 5HRYA 1S70B 4K5BA 4BERA 1YYHA 4J8YA 4BSZB 3EHQA 5AQBA 2V5QC 1D9SA 2HE0A 4QFVA 2MYOA 3J5PA 4F6RD 3V31A 4CZ2D 4K5AB 5ITZF 3J5QB 3NOCD 4G8KA 3EHRA 4O1OA 2V4HC 2XEEA 4O60A 5KNGA 1WDYA 2QC9A 3JXIA 4F1PA 1IHBA 5ENRD 5JMND 3TWUA 2FO1E 5CERB 5KNHD 1BLXB 2F8XK 4Z68A 1WG0A 5AQAA 3W9GA 4CYMD 1BI7B 3UI2A 2ETAA 1IKND 3KEAA 1K1AA 3NOGD 4O1PA 1K3ZD 4LSZE 5AQ7A 5HKPA 5D66A 2XZDG 4JB8P 4HNAD 4ZFHA 2J8SD 4RLYA 1SVXA 1BD8A 1YMPA 5FIOA 4DX6D 4ZHBA 4TUMA 4GPMA 5AQ9A 4BETA 5EYPF 4DX7D 3ZU7B 1AP7A 5ENTD 3Q9UC 2RFMA 3IXEA 1NFIE 2JABA 3B95A 4GMRA 4DX5D 4QQIA 5CBOA 5CEAA 4J7WA 4DX1A 3UXGA 1MX6A 4YDWA 3V79K 1YCSB 2F37A 4K5CA 4HI8A 5EYLA 2DWZA 1MX4A 1K1BA 3TWTA 1IXVA 5EIDA 2PNNA 2B0OE 3TWSA 1BU9A 1G3NB 2XZTG 1N11A 2DZNA 3DEOA 2RFAA 2XEHA 3AAAC 4LG6A 4U8VD 2NYJA 4C48B 5AN8A 3HRAA 2KBXA 5ENSD 4BEPA 5ENPD 3D9HA 2KXPC 3DEPA 4G8LA 4HRNA 2BKGA 3V2XA 4HQDA 3JXJA 4OAVB 2XENA 4HLLA 1UOHA 1MX2A 4B93B 5FINA 5BXOA 3T8KA 2DZOA 4DUIA 5BXUA 1OT8A 4U95D 1N0QA 3SO8A 5EN5D 1TR4A 1AWCB 1QYMA 3EU9A 3ZKJA 1OY3D 2A5EA 4LNUD 4HRLA 2Y1LE 2F8YA 4U96D 3LJNA 3T9KA 4DX2A 1DCQA 5AAOA 1A5EA 2VGEA 4ATZD 3TWRA 4A63B 3W9FA 4HRMB 2ETCA 5HS0A 3ZNGA 3TWXA 4YDYA 3NBNB 2ZGGA 4UUCA 1MYOA 4NIKA 4HBDA 1BI8B 3AJIA 3HG0D 2DVWA 5JA4D 1DC2A
chains in the Genus database with same CATH superfamily
3FUFA 4OAUC 2ETBA 3Q9NC 5G05J 2VSOE 4U8HA 2R02A 3AS5A 4CDRA 5CCMA 3Q5MA 3T5XA 2QYJA 1NI1A 4PH4B 4TXQA 3ASDA 5KBAA 3CSTA 4XX5A 1QNFA 2OVBA 4XKCA 4UQZA 3V31A 2I6HA 3D9PA 3G2VA 4U04A 4Q96A 4WUYA 5G2NA 2XPYA 4A3TA 3ZRHA 1BI7B 3SF4A 1K3ZD 4LSZE 5KJNA 3EIJA 4HNAD 5AJDA 5ENTD 3I3NA 1N54A 2L6JA 1MX6A 3D9NA 2R03A 5CRVA 3EHMA 1TNOA 4MS6A 3RU0A 3ZIMA 5ANRA 3PNLB 3RK6A 4PS7A 5LCWC 4HLLA 3CVUA 4G11A 3DSTA 3QWWA 3ENEA 1UN9A 2QZAA 1OUVA 2R59A 3SI5A 1DVPA 2IOSA 5KJKA 3APCA 1S0PA 3TWXA 3PUJA 2WXLA 1B89A 3HXBA 4L9PA 4ABNA 5ARFA 4TXPA 5FWQA 3ZFWA 4R7LA 3DPDA 3CVVA 2EIJE 5B1BE 5CECB 4JA9A 1NP7A 1OWOA 1S70B 4BSZB 4I1OB 4E85A 3CKCA 1FPPA 2IEJA 4KMOA 4B8AA 2P9SG 4LCTA 4AOFA 3CVNA 1IHBA 2P9PG 5JMND 1SA5A 3CHMA 1UJJA 1K1AA 2IU1A 4J6IA 4TV3A 5FZRA 4F53A 3VTYA 1OWNA 4HLEA 5BNWA 5G05C 3IXEA 2KCVA 4OYSA 3SFYA 1U3CA 3MKRA 3KD7A 3QAQA 3D9IA 3TWTA 3LYAA 3QK0A 2XPZA 2LSUA 2QYUA 3IBEA 5ENSD 3D9HA 4G8LA 3V2XA 1H2UA 1YA0A 4FLHA 4RG9A 3C98A 3T8KA 2AW6A 2J9QA 2DCPA 1EYHA 4I1AA 1Z6TA 3JQ0A 4A63B 2JEKA 4I17A 3C3OA 2KZTB 3CQGB 4MLPA 3IV0A 3HIZA 1N0RA 2PM7A 5FT9A 3CK9A 2GRMA 3C5RA 1HFAA 5CHEE 5DBKA 1SQMA 4BESA 2MOWA 1Y6IA 4CT0A 4J8YA 3LY9A 2HE0A 3X2QE 2FBNA 5JHBA 4JL0A 3MV2B 1H2TC 4UI9J 4AXHA 3TGOA 2R2LA 1QQEA 3CK7A 4JW1A 4CYMD 1IKND 3KEAA 3C3QA 4B89A 3UMVA 3U3WA 4GYWA 5EX3A 3SD5A 2YNQA 2OVFA 2Y69E 3DXKG 2RFMA 5E75A 2XRZA 4FJZA 3CSFA 5CEAA 1JWFA 2XS8A 4EZLA 4HI8A 3TWSA 1JCQA 3O48A 3LY8A 2LO6A 2P9NG 2IFUA 4BEPA 4EBAG 5AJLA 2C0LA 4DUIA 1N0QA 2FF4A 3DSVA 2R5SA 3HDXA 2Y4TA 4UQXA 1SZ9A 1DCQA 3PEUB 1KZPA 1QZ2A 1WM5A 4A55A 4JHKA 4I6JA 3FY4A 3E34A 1OCOE 4KZCA 3Q7AA 2KZTA 2ZISA 4N3BA 3UINC 3V30A 2PL2A 3SHFA 3JUEA 3FUIA 3UT4A 4ACLA 3ASGA 2DYRE 2FO7A 3AG3E 4GAAA 3Q15A 1D9SA 3FTYA 4K5AB 2XEVA 2X6HA 1WAO1 4YVQC 3Q78A 1N94A 2IJGX 4ME2A 4AV7A 2F8XK 5D0OD 3UI2A 3CR3A 4FP7A 5HKPA 5D66A 1TJCA 3VTXA 4ZFHA 3PRZA 2RG8A 5EYPF 3AU5A 3DWLG 3Q9UC 3ASNE 1LTXA 4Y6CA 3ZHEB 2ILRA 4DX1A 3PNTB 1TNUA 3IKOB 5BPPA 2IY0C 4GTOA 4Q94A 1FCHA 1K1BA 1IXVA 3GZ2A 4WNEA 2A4ZA 4LG6A 5G04J 4U8VD 5AN8A 3LS8A 4N5CA 2YHCA 3Q73A 5ENPD 1TNYA 5C2YA 5FINA 5J90A 2GRQB 1MZCA 2EIME 4XKBA 1W3BA 4YDEA 3PE4A 2J49A 4KXKB 2ONDA 4ATZD 1N9AA 4MKTA 4J8SA 2ETCA 4GZ6A 3APFA 3VLEA 1SW6A 2Y4UA 3BQOA 4GTVA 3DBSA 3TWQA 1OCCE 2ZU6B 2BUGA 3SNXA 3ZYMA 2AXZA 3EDTB 1Z3YA 5KWDA 1YYHA 1ELWA 1HS6A 1KT1A 4C0EA 2H6FA 5AQBA 3L9TA 2OEWA 4GA0A 4O1OA 1HF8A 2QC9A 3TWUA 3HYMB 3RRUA 3MX3A 4BT8A 2NXPA 3PEVB 2P9KG 3EU5A 4LEUA 5KJMA 5JJ6A 3HXEA 4NACA 3G2UA 3UM0A 4BETA 4TUUA 1DC2A 2WXKA 3CVPA 3K9IA 3CK8A 2GW1A 2B6CA 4GMRA 3B95A 4DPRA 2CHXA 2NC9A 2X6FA 3SZ7A 4Q69A 3UQ3A 5C1DA 2B0OE 1G3NB 4U0UA 2CFZA 2CG2A 2DZNA 4HVBA 4L2LA 4N39A 3I4GA 1MX2A 3L22A 4U95D 3SO8A 1X81A 5EN5D 1HZ4A 1H0AA 2XGOA 4N3CA 3T9KA 3TWRA 1HG2A 3GYZA 4PDXA 3O4ZA 3HG0D 3P2BA 3ZGQA 3FH5A 1ZB1A 2Y0BG 1HX8A 4UQYA 4AY6A 4GYOA 2L9BA 3OXFA 1A17A 4FA6A 1QBQA 4CDMA 1BPOA 2A5UA 3FFLA 5T4YA 3ZXSA 2M63A 4UI9C 4G1TA 4ILGA 4XIFA 3NB2A 3NZUA 4FLBA 2GRNB 3KEZA 2KATA 1Q2ZA 1OWPA 1IQUA 2HM8A 1D8DA 4KT6B 3U64A 5CRUA 3E33A 1N4SA 4DI4A 4QQIA 1FT2A 4HOUA 3V79K 3IEGA 2VTBB 3CVWA 3B7UX 5FJYA 4PS3A 1V55E 3CVQA 3DEOA 2EINE 3L17A 5A23A 3QB2A 3JUIA 3HXCA 2KBXA 1SZAA 5G55A 2KXPC 2VYIA 1TEZA 2WXRA 4L7TA 3VLDA 4J8EA 4M7CA 3L6AA 2J09A 3ZKJA 3FULA 1HH8A 4IULA 3PDNA 5LFAA 4B94A 3GW4A 5HS0A 4L2YA 1TN7A 3Q49B 1FVHA 2KM4A 5BV1A 3TXNA 5FQ7A 2BF0X 2P9UG 4A1GA 4EHMA 4ANXA 4B0ZA 3V2OA 1XGWA 4U8YD 1HXIA 5ENOD 5LX8A 4I2WA 4L23A 5AYWD 3S7BA 4CZ2D 4U63A 3CHQA 3U4TA 3G2TA 4I43A 4JPSA 4EQFA 3BUAA 3PZ4A 3LY7A 4I9CA 5AQAA 1O1SA 2WMNA 3SQVA 3S7FA 1ELKA 4GTSA 3ZYQA 4WNDA 3OTNA 1YMPA 4F1SA 3FTWA 1OCRE 5FQ6A 4HORA 2YQ8A 4G25A 1KZOA 3PZDA 5CBOA 4EPZA 4UWGA 3R7QA 5CCLA 3FUHA 3U66A 3D3MA 2WXQA 3R7RA 4JEUA 3HXFA 4WAFA 3DEPA 3OXGA 4OAVB 4JHRA 4ANUA 5A6CA 3ZW3A 2J4DA 3FUMA 1U3DA 2OV8A 4X8QA 3DSUA 4HRLA 2Y1LE 3EJNA 4HRMB 1N4RA 4KVOA 2PZIA 4PS8A 3FH8A 3D9OA 2LNIA 3ZUVB 1OXJA 4K0RA 4G23A 4GA1A 3GZ1A 4PUCA 5ENQD 2IOLA 4EECA 3FU0A 3UPVA 3TAXA 5ENNA 4BSXA 2WQHA 1H19A 3S7DA 4N2SA 4BERA 3EHQA 4ANWA 3LEWA 1MHQA 4HXIA 3FTUA 4JZYA 4G8KA 3EHRA 3B7RL 4YDOA 2MHKA 2Y3AA 4XEIG 3E4BA 3JQ1A 3QWVA 2GRRB 5EDSA 4GTTA 2FULA 2IQCA 4JB8P 3FP3A 5FIOA 2H6HA 4ZHBA 3EIQC 3ZU7B 1WY6A 4W9RA 3U9WA 4I2ZA 2YHEA 2DWZA 5EIDA 1HG5A 1N11A 3FU5A 3BG1B 4OVUA 2AVPA 4GCNA 1FVFA 4ILIA 3C3RA 3MGBA 2V0PA 3CGHA 3CLJA 3OXLA 3MEKA 3FUDA 3CHPA 4DX2A 2C0MA 2WMOA 3BG0B 3FUJA 2R17C 3CVLA 2LAHA 4KBQA 1S63A 3P1UA 3FEXA 2BKKB 3LXUX 4DRXE 3PH0C 4FJYA 1INZA 1EPUA 5KJLA 4F3VA 3SGHA 1N52A 3D9JA 3NF1A 2V5QC 2MYOA 1NL4A 3EHNA 5ITZF 4N2QA 5FQ4A 2XHEA 3NQPA 2LSVA 1EDUA 3MV3B 2CHWA 3R9AB 4I9EA 3ESKA 2VSNA 4GB9A 4G26A 4DX7D 2IONA 3MJWA 3D9LA 4GPKA 3NAWA 4C9BB 3ASOE 4GU5A 4GTRA 5ANLA 3ZN3A 3CHRA 2VJ8A 4YNDA 3HRAA 2CHZA 4NRHB 2XCCA 1PAQA 3ZEFA 3Q47B 3D9MA 3CQCB 2DZOA 3PS6A 3ZPJA 3I4RB 4LRZA 2J07A 4ILHB 4Y6WA 3DSSA 4LNUD 4HFGA 2VSYA 1A5EA 1GW6A 4U0ZA 1OCZE 3E37A 3ESLA 4J8FA 3ZNGA 2FEZA 4HBDA 4NQ0A 4M3OA 3RO2A 2WQ6A 3TG5A 1UN8A 3TXMA 3B7BA 3ML9A 1UG3A 4CT4A 2J08A 4GZ3A 4RG6A 5ARGA 4BX9A 1XNFA 2UY1A 4CRWA 5FZQA 5JJTA 3J5QB 3NOCD 4YVOA 3OAWA 4J0UA 4LUNU 2WXJA 2FO1E 1WG0A 4FHKA 4NURA 2OCCE 3IHVA 5T8IA 3AG4E 3PREA 2AWIA 1O5MA 3MZLB 1PY1A 2WXNA 3PUKA 4A1SA 2KCLA 1E7UA 4D10C 5BUZA 2WXMA 4V3IA 3SBTB 4WNGA 3DSWA 4J7WA 2ZIRA 5E76A 2V4LA 4AM9A 1K8KG 4JEHA 2H6GA 3QKYA 3E32A 3HVEB 4DK5A 4GYYA 3B13A 1X5BA 1EF1C 3L16A 5BV0A 4HRNA 2XS1A 3RJVA 1HO8A 5KCMA 2F0YA 3LVQE 3L54A 1VDYA 3PE3A 2F8YA 4U96D 3QARA 5D0QD 1O1TA 5B3SE 1Y8MA 3Q79A 1BI8B 2DVWA 1UOHA 3QDNA 3UTMA 4GA2A 3QNKA 3UKUG 2L6BA 4U0SA 2WB2A 2HYZA 4EZJA 4HI9A 1DNPA 4ANVA 5G04C 3TL5A 1TNZA 2WXFA 3JCKC 2EIKE 4P29A 4RVBA 3VLFA 5FZSA 1TNBA 1Z5SC 3IHYA 4U7EB 2J8SD 1H2VC 4WWPA 2CG3A 1O1RA 1HE8A 4GZ5A 1AP7A 5CMWA 3L13A 3LKUA 1LF8A 1NFIE 2JABA 3ZXPA 2R05A 3CV0A 1D8EA 4RQIA 2C2LA 4JD2G 3R9MA 3UXGA 1TJFA 1YCSB 4XI9A 3ML8A 3ABKE 4LNBA 2QY7A 4BTAA 2RFAA 4UWLA 2NYJA 3BEEA 3PZ2A 4GTMA 4G24A 3MKQA 3ONKA 3RRMB 4AP2A 2XENA 4ACKA 5BXUA 3ZYKA 2XCBA 2E2EA 4HOSA 1U2VG 4C0MA 4IYPA 1LD7A 4AJWA 4UUCA 4NIKA 4TRQA 3I5PA 3FU3A 3AS4A 3CHOA 2GRLA 2CFUA 3MA5A 3BU8A 5AIJA 2J4BA 4DLOA 3N71A 5AENA 3NZSA 2IO3C 2MRIA 4U07A 3J5PA 4F6RD 1MQSA 3S7JA 5FQ8A 4GTQA 3FWVA 2XEEA 1WDYA 4DI3A 3C72A 3UX4A 5CERB 5KNHD 3DXMG 3G2WA 4FHJA 3FHEA 1HU3A 4UI9K 5BW8C 3FDHA 5AQ7A 1NZNA 3ZHEA 4BT9A 1BD8A 5AQ9A 4XI0A 4JXTA 4HS2A 4CEMA 2F37A 1L5JA 4K5CA 4AEZC 4LNGA 3SFXA 3UIPC 3L08A 3JYSA 5JJ7A 4AVXA 4TXRA 2X3MA 3EUVA 4I1MA 4MRUA 2BKGA 2FI7A 4BTBA 4B93B 5LP0A 2XRYA 5JHAA 4G2VA 3RSEG 3CEQA 3AU4A 4B8CB 3WG7E 1JCRA 4OVVA 4FADA 3LCAA 3AG2E 4KVMA 4DLQA 4JC8A 2XGMA 3PZ1A 4K03A 4DJAA 4YDYA 3G2SA 2OOEA 4F1PA 1AWCB 3TWWA 3DRAA 5EIBE 3ULYA 2HR2A 4FULA 3Q4AB 5CEDB 1MJ0A 2AXUA 5H7PA 2QFCA 3DPYA 5DIZA 3AG1E 2JLBA 3F6QA 4JA7A 4IRUA 1JUQA 3KAEA 3HVEA 3LPZA 2V4HC 2P9LG 3B7SA 1BLXB 1H6PA 1NA3A 1ZU2A 1E8YA 2NSZA 2DBAA 3QJZA 1N4QA 2WQ7A 3PZ3A 5LOZA 3ZVVA 4JVSA 1E90A 4UWFA 1OWMA 2GROB 2Q7FA 4HOTA 3SFZA 1BU9A 2PNNA 3AS8A 2X6KA 2VGYA 4XE0A 3FTZA 2H6IA 2WXOA 4FU3A 5EX0A 4BWRA 2L0TB 3UKRG 3FH7A 1KPSB 1JWGA 5BXOA 1OT8A 4GMJA 3EU9A 2WPVA 5AAOA 3PVLA 5CMYA 4FC8A 1DCEA 2ZGGA 1ZBPA 5JA4D 3URZA 4UWHA 2LXLA 2WXIA 4HB5A 2VGXA 2AJAA 5IY5E 3QWPA 5LCWJ 1JPLA 3UM2A 4BFRA 2XQ0A 2PM6A 3UT7A 3RAUA 3D9KA 3CHSA 4QFVA 3MKQB 1E8XA 1KT0A 1TN6A 1KLXA 5KNGA 1RZ4A 1E8ZA 4IN3B 2V5FA 3B7TA 2I1JA 2KC7A 3RIBA 3W9GA 5M72A 3LJ3A 2ETAA 2RKKA 4O1PA 3NOGD 3RKVA 4RLYA 2BEDA 4L1BA 1SVXA 4TUMA 3FTXA 4EBAA 1E7VA 4HOQA 1PC2A 3CKBA 4APFA 5EKQD 4F7AA 4AY5A 1E96B 1N95A 5EYLA 1MX4A 1JCSA 2WXHA 1LD8A 3T5VA 3UUXA 4GCOA 2YINA 3FTVA 2P58C 3JXJA 4GTPA 3RO3A 2LUHA 5A7DB 3ULQA 4H7XA 1TR4A 1QYMA 2WXPA 3DSXA 3L82A 5FTPA 2WVIA 3SY2A 2OEVA 2VGXB 2PQNA 3SBSA 3CIAA 3QC1A 3NBNB 2DYSE 3ULEG 3AJIA 4WWNA 5HQ8A 3E30A 2P2CP 5AARA 3UT8A 5BT1A 2X6IA 3HHMA 1UW4B 2AXVA 1NA0A 5CBNA 1H6KA 4WWOA 3TWVA 1TN8A 1Z3XA 3ASHA 4WNFA 2I1KA 2UY1B 4GZCA 4J8DA 4GMLA 3JXIA 2P9IG 3UIOC 2WXGA 4DX6D 4URKA 3QOUA 3APDA 3FUKA 3CVXA 4I6GA 4DX5D 4GZDA 4E6HA 4CCAA 1UJKA 2XZTG 2XEHA 4O6FA 2EILE 2HO1A 3GZSA 2E0IA 2V8SE 2KCKA 3ABME 4LERA 2PQRA 1S64A 3T8MA 4JHJA 2A5EA 1RW2A 4N3AA 2XPIA 2RD0A 1IHGA 1V54E 1N4PA 4BX8A 1SA4A 1P5QA 4MBGA 2XGSA 2ZGDA 3ISMC 5EILA 2BTDA 3WXXA 5T3RA 3S2AA 4CGWA 3FUEA 3MCXA 2X6JA 4N5QA 4RSYA 1IYGA 3ABLE 1H6OA 3LVRE 3ZYLA 4KYOB 5HRYA 4K5BA 2VQ2A 2VSXE 4H7YA 2I2OA 2L0IA 4O60A 4EZKA 5J08A 3KSQA 2UWJG 3UM1A 4KZ0A 5ENRD 2GRPB 3KSLA 4XZ4A 2I9CA 4Z68A 3ASFA 4UWKA 3TG4A 5HI7A 5B1AE 3TJPA 2XZDG 1FT1A 4CGVA 3Q75A 4GPMA 2LXMA 3FEYA 1IQRA 1OWLA 3RRNB 2IO2C 3Q7FA 4AIFA 4BY6A 2IF4A 3FTSA 4YDWA 1ELRA 2EQXA 3AAAC 4APOA 4C48B 3FU6A 3FUNA 4HQDA 3ONLA 3KS2A 2GGFA 2DIWA 3CVYA 3HXDA 4I6EA 3UM3A 2VTBA 4CDNA 1OY3D 3LDZA 2ZXWE 2LAIA 3LJNA 2X38A 2VGEA 3MYVA 5D2MC 3W9FA 4A3VA 2WM9A 1E8WA 1MYOA 4ATGA 1TYQG
chains in the Genus database with same CATH topology
1SW6A 3ZUVB 3TWWA 4OAUC 5EIBE 2ETBA 1N0RA 2ZGDA 2P2CP 5AARA 2Y0BG 3Q9NC 4HB5A 3UTMA 5EILA 3V30A 2BKKB 4DRXE 3TWQA 4N5QA 5ENQD 2L6BA 3C5RA 3JUEA 2AJAA 5CBNA 3V2OA 5CEDB 1MJ0A 3B7BA 5CECB 4U8YD 2QYJA 4BESA 3TWVA 5ENOD 5KWDA 4HI9A 5KBAA 3F6QA 5HRYA 1S70B 4K5BA 4BERA 1YYHA 4J8YA 4BSZB 3EHQA 5AQBA 2V5QC 1D9SA 2HE0A 4QFVA 2MYOA 3J5PA 4F6RD 3V31A 4CZ2D 4K5AB 5ITZF 3J5QB 3NOCD 4G8KA 3EHRA 4O1OA 2V4HC 2XEEA 4O60A 5KNGA 1WDYA 2QC9A 3JXIA 4F1PA 1IHBA 5ENRD 5JMND 3TWUA 2FO1E 5CERB 5KNHD 1BLXB 2F8XK 4Z68A 1WG0A 5AQAA 3W9GA 4CYMD 1BI7B 3UI2A 2ETAA 1IKND 3KEAA 1K1AA 3NOGD 4O1PA 1K3ZD 4LSZE 5AQ7A 5HKPA 5D66A 2XZDG 4JB8P 4HNAD 4ZFHA 2J8SD 4RLYA 1SVXA 1BD8A 1YMPA 5FIOA 4DX6D 4ZHBA 4TUMA 4GPMA 5AQ9A 4BETA 5EYPF 4DX7D 3ZU7B 1AP7A 5ENTD 3Q9UC 2RFMA 3IXEA 1NFIE 2JABA 3B95A 4GMRA 4DX5D 4QQIA 5CBOA 5CEAA 4J7WA 4DX1A 3UXGA 1MX6A 4YDWA 3V79K 1YCSB 2F37A 4K5CA 4HI8A 5EYLA 2DWZA 1MX4A 1K1BA 3TWTA 1IXVA 5EIDA 2PNNA 2B0OE 3TWSA 1BU9A 1G3NB 2XZTG 1N11A 2DZNA 3DEOA 2RFAA 2XEHA 3AAAC 4LG6A 4U8VD 2NYJA 4C48B 5AN8A 3HRAA 2KBXA 5ENSD 4BEPA 5ENPD 3D9HA 2KXPC 3DEPA 4G8LA 4HRNA 2BKGA 3V2XA 4HQDA 3JXJA 4OAVB 2XENA 4HLLA 1UOHA 1MX2A 4B93B 5FINA 5BXOA 3T8KA 2DZOA 4DUIA 5BXUA 1OT8A 4U95D 1N0QA 3SO8A 5EN5D 1TR4A 1AWCB 1QYMA 3EU9A 3ZKJA 1OY3D 2A5EA 4LNUD 4HRLA 2Y1LE 2F8YA 4U96D 3LJNA 3T9KA 4DX2A 1DCQA 5AAOA 1A5EA 2VGEA 4ATZD 3TWRA 4A63B 3W9FA 4HRMB 2ETCA 5HS0A 3ZNGA 3TWXA 4YDYA 3NBNB 2ZGGA 4UUCA 1MYOA 4NIKA 4HBDA 1BI8B 3AJIA 3HG0D 2DVWA 5JA4D 1DC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SW6 A;  3ZUV B;  3TWW A;  4OAU C;  5EIB E;  2ETB A;  1N0R A;  2ZGD A;  2P2C P;  5AAR A;  2Y0B G;  3Q9N C;  4HB5 A;  3UTM A;  5EIL A;  3V30 A;  2BKK B;  4DRX E;  3TWQ A;  4N5Q A;  5ENQ D;  2L6B A;  3C5R A;  3JUE A;  2AJA A;  5CBN A;  3V2O A;  5CED B;  1MJ0 A;  3B7B A;  5CEC B;  4U8Y D;  2QYJ A;  4BES A;  3TWV A;  5ENO D;  5KWD A;  4HI9 A;  5KBA A;  3F6Q A;  5HRY A;  1S70 B;  4K5B A;  4BER A;  1YYH A;  4J8Y A;  4BSZ B;  3EHQ A;  5AQB A;  2V5Q C;  1D9S A;  2HE0 A;  4QFV A;  2MYO A;  3J5P A;  4F6R D;  3V31 A;  4CZ2 D;  4K5A B;  5ITZ F;  3J5Q B;  3NOC D;  4G8K A;  3EHR A;  4O1O A;  2V4H C;  2XEE A;  4O60 A;  5KNG A;  1WDY A;  2QC9 A;  3JXI A;  4F1P A;  1IHB A;  5ENR D;  5JMN D;  3TWU A;  2FO1 E;  5CER B;  5KNH D;  1BLX B;  2F8X K;  4Z68 A;  1WG0 A;  5AQA A;  3W9G A;  4CYM D;  1BI7 B;  3UI2 A;  2ETA A;  1IKN D;  3KEA A;  1K1A A;  3NOG D;  4O1P A;  1K3Z D;  4LSZ E;  5AQ7 A;  5HKP A;  5D66 A;  2XZD G;  4JB8 P;  4HNA D;  4ZFH A;  2J8S D;  4RLY A;  1SVX A;  1BD8 A;  1YMP A;  5FIO A;  4DX6 D;  4ZHB A;  4TUM A;  4GPM A;  5AQ9 A;  4BET A;  5EYP F;  4DX7 D;  3ZU7 B;  1AP7 A;  5ENT D;  3Q9U C;  2RFM A;  3IXE A;  1NFI E;  2JAB A;  3B95 A;  4GMR A;  4DX5 D;  4QQI A;  5CBO A;  5CEA A;  4J7W A;  4DX1 A;  3UXG A;  1MX6 A;  4YDW A;  3V79 K;  1YCS B;  2F37 A;  4K5C A;  4HI8 A;  5EYL A;  2DWZ A;  1MX4 A;  1K1B A;  3TWT A;  1IXV A;  5EID A;  2PNN A;  2B0O E;  3TWS A;  1BU9 A;  1G3N B;  2XZT G;  1N11 A;  2DZN A;  3DEO A;  2RFA A;  2XEH A;  3AAA C;  4LG6 A;  4U8V D;  2NYJ A;  4C48 B;  5AN8 A;  3HRA A;  2KBX A;  5ENS D;  4BEP A;  5ENP D;  3D9H A;  2KXP C;  3DEP A;  4G8L A;  4HRN A;  2BKG A;  3V2X A;  4HQD A;  3JXJ A;  4OAV B;  2XEN A;  4HLL A;  1UOH A;  1MX2 A;  4B93 B;  5FIN A;  5BXO A;  3T8K A;  2DZO A;  4DUI A;  5BXU A;  1OT8 A;  4U95 D;  1N0Q A;  3SO8 A;  5EN5 D;  1TR4 A;  1AWC B;  1QYM A;  3EU9 A;  3ZKJ A;  1OY3 D;  2A5E A;  4LNU D;  4HRL A;  2Y1L E;  2F8Y A;  4U96 D;  3LJN A;  3T9K A;  4DX2 A;  1DCQ A;  5AAO A;  1A5E A;  2VGE A;  4ATZ D;  3TWR A;  4A63 B;  3W9F A;  4HRM B;  2ETC A;  5HS0 A;  3ZNG A;  3TWX A;  4YDY A;  3NBN B;  2ZGG A;  4UUC A;  1MYO A;  4NIK A;  4HBD A;  1BI8 B;  3AJI A;  3HG0 D;  2DVW A;  5JA4 D;  1DC2 A; 
#chains in the Genus database with same CATH topology
 3FUF A;  4OAU C;  2ETB A;  3Q9N C;  5G05 J;  2VSO E;  4U8H A;  2R02 A;  3AS5 A;  4CDR A;  5CCM A;  3Q5M A;  3T5X A;  2QYJ A;  1NI1 A;  4PH4 B;  4TXQ A;  3ASD A;  5KBA A;  3CST A;  4XX5 A;  1QNF A;  2OVB A;  4XKC A;  4UQZ A;  3V31 A;  2I6H A;  3D9P A;  3G2V A;  4U04 A;  4Q96 A;  4WUY A;  5G2N A;  2XPY A;  4A3T A;  3ZRH A;  1BI7 B;  3SF4 A;  1K3Z D;  4LSZ E;  5KJN A;  3EIJ A;  4HNA D;  5AJD A;  5ENT D;  3I3N A;  1N54 A;  2L6J A;  1MX6 A;  3D9N A;  2R03 A;  5CRV A;  3EHM A;  1TNO A;  4MS6 A;  3RU0 A;  3ZIM A;  5ANR A;  3PNL B;  3RK6 A;  4PS7 A;  5LCW C;  4HLL A;  3CVU A;  4G11 A;  3DST A;  3QWW A;  3ENE A;  1UN9 A;  2QZA A;  1OUV A;  2R59 A;  3SI5 A;  1DVP A;  2IOS A;  5KJK A;  3APC A;  1S0P A;  3TWX A;  3PUJ A;  2WXL A;  1B89 A;  3HXB A;  4L9P A;  4ABN A;  5ARF A;  4TXP A;  5FWQ A;  3ZFW A;  4R7L A;  3DPD A;  3CVV A;  2EIJ E;  5B1B E;  5CEC B;  4JA9 A;  1NP7 A;  1OWO A;  1S70 B;  4BSZ B;  4I1O B;  4E85 A;  3CKC A;  1FPP A;  2IEJ A;  4KMO A;  4B8A A;  2P9S G;  4LCT A;  4AOF A;  3CVN A;  1IHB A;  2P9P G;  5JMN D;  1SA5 A;  3CHM A;  1UJJ A;  1K1A A;  2IU1 A;  4J6I A;  4TV3 A;  5FZR A;  4F53 A;  3VTY A;  1OWN A;  4HLE A;  5BNW A;  5G05 C;  3IXE A;  2KCV A;  4OYS A;  3SFY A;  1U3C A;  3MKR A;  3KD7 A;  3QAQ A;  3D9I A;  3TWT A;  3LYA A;  3QK0 A;  2XPZ A;  2LSU A;  2QYU A;  3IBE A;  5ENS D;  3D9H A;  4G8L A;  3V2X A;  1H2U A;  1YA0 A;  4FLH A;  4RG9 A;  3C98 A;  3T8K A;  2AW6 A;  2J9Q A;  2DCP A;  1EYH A;  4I1A A;  1Z6T A;  3JQ0 A;  4A63 B;  2JEK A;  4I17 A;  3C3O A;  2KZT B;  3CQG B;  4MLP A;  3IV0 A;  3HIZ A;  1N0R A;  2PM7 A;  5FT9 A;  3CK9 A;  2GRM A;  3C5R A;  1HFA A;  5CHE E;  5DBK A;  1SQM A;  4BES A;  2MOW A;  1Y6I A;  4CT0 A;  4J8Y A;  3LY9 A;  2HE0 A;  3X2Q E;  2FBN A;  5JHB A;  4JL0 A;  3MV2 B;  1H2T C;  4UI9 J;  4AXH A;  3TGO A;  2R2L A;  1QQE A;  3CK7 A;  4JW1 A;  4CYM D;  1IKN D;  3KEA A;  3C3Q A;  4B89 A;  3UMV A;  3U3W A;  4GYW A;  5EX3 A;  3SD5 A;  2YNQ A;  2OVF A;  2Y69 E;  3DXK G;  2RFM A;  5E75 A;  2XRZ A;  4FJZ A;  3CSF A;  5CEA A;  1JWF A;  2XS8 A;  4EZL A;  4HI8 A;  3TWS A;  1JCQ A;  3O48 A;  3LY8 A;  2LO6 A;  2P9N G;  2IFU A;  4BEP A;  4EBA G;  5AJL A;  2C0L A;  4DUI A;  1N0Q A;  2FF4 A;  3DSV A;  2R5S A;  3HDX A;  2Y4T A;  4UQX A;  1SZ9 A;  1DCQ A;  3PEU B;  1KZP A;  1QZ2 A;  1WM5 A;  4A55 A;  4JHK A;  4I6J A;  3FY4 A;  3E34 A;  1OCO E;  4KZC A;  3Q7A A;  2KZT A;  2ZIS A;  4N3B A;  3UIN C;  3V30 A;  2PL2 A;  3SHF A;  3JUE A;  3FUI A;  3UT4 A;  4ACL A;  3ASG A;  2DYR E;  2FO7 A;  3AG3 E;  4GAA A;  3Q15 A;  1D9S A;  3FTY A;  4K5A B;  2XEV A;  2X6H A;  1WAO 1;  4YVQ C;  3Q78 A;  1N94 A;  2IJG X;  4ME2 A;  4AV7 A;  2F8X K;  5D0O D;  3UI2 A;  3CR3 A;  4FP7 A;  5HKP A;  5D66 A;  1TJC A;  3VTX A;  4ZFH A;  3PRZ A;  2RG8 A;  5EYP F;  3AU5 A;  3DWL G;  3Q9U C;  3ASN E;  1LTX A;  4Y6C A;  3ZHE B;  2ILR A;  4DX1 A;  3PNT B;  1TNU A;  3IKO B;  5BPP A;  2IY0 C;  4GTO A;  4Q94 A;  1FCH A;  1K1B A;  1IXV A;  3GZ2 A;  4WNE A;  2A4Z A;  4LG6 A;  5G04 J;  4U8V D;  5AN8 A;  3LS8 A;  4N5C A;  2YHC A;  3Q73 A;  5ENP D;  1TNY A;  5C2Y A;  5FIN A;  5J90 A;  2GRQ B;  1MZC A;  2EIM E;  4XKB A;  1W3B A;  4YDE A;  3PE4 A;  2J49 A;  4KXK B;  2OND A;  4ATZ D;  1N9A A;  4MKT A;  4J8S A;  2ETC A;  4GZ6 A;  3APF A;  3VLE A;  1SW6 A;  2Y4U A;  3BQO A;  4GTV A;  3DBS A;  3TWQ A;  1OCC E;  2ZU6 B;  2BUG A;  3SNX A;  3ZYM A;  2AXZ A;  3EDT B;  1Z3Y A;  5KWD A;  1YYH A;  1ELW A;  1HS6 A;  1KT1 A;  4C0E A;  2H6F A;  5AQB A;  3L9T A;  2OEW A;  4GA0 A;  4O1O A;  1HF8 A;  2QC9 A;  3TWU A;  3HYM B;  3RRU A;  3MX3 A;  4BT8 A;  2NXP A;  3PEV B;  2P9K G;  3EU5 A;  4LEU A;  5KJM A;  5JJ6 A;  3HXE A;  4NAC A;  3G2U A;  3UM0 A;  4BET A;  4TUU A;  1DC2 A;  2WXK A;  3CVP A;  3K9I A;  3CK8 A;  2GW1 A;  2B6C A;  4GMR A;  3B95 A;  4DPR A;  2CHX A;  2NC9 A;  2X6F A;  3SZ7 A;  4Q69 A;  3UQ3 A;  5C1D A;  2B0O E;  1G3N B;  4U0U A;  2CFZ A;  2CG2 A;  2DZN A;  4HVB A;  4L2L A;  4N39 A;  3I4G A;  1MX2 A;  3L22 A;  4U95 D;  3SO8 A;  1X81 A;  5EN5 D;  1HZ4 A;  1H0A A;  2XGO A;  4N3C A;  3T9K A;  3TWR A;  1HG2 A;  3GYZ A;  4PDX A;  3O4Z A;  3HG0 D;  3P2B A;  3ZGQ A;  3FH5 A;  1ZB1 A;  2Y0B G;  1HX8 A;  4UQY A;  4AY6 A;  4GYO A;  2L9B A;  3OXF A;  1A17 A;  4FA6 A;  1QBQ A;  4CDM A;  1BPO A;  2A5U A;  3FFL A;  5T4Y A;  3ZXS A;  2M63 A;  4UI9 C;  4G1T A;  4ILG A;  4XIF A;  3NB2 A;  3NZU A;  4FLB A;  2GRN B;  3KEZ A;  2KAT A;  1Q2Z A;  1OWP A;  1IQU A;  2HM8 A;  1D8D A;  4KT6 B;  3U64 A;  5CRU A;  3E33 A;  1N4S A;  4DI4 A;  4QQI A;  1FT2 A;  4HOU A;  3V79 K;  3IEG A;  2VTB B;  3CVW A;  3B7U X;  5FJY A;  4PS3 A;  1V55 E;  3CVQ A;  3DEO A;  2EIN E;  3L17 A;  5A23 A;  3QB2 A;  3JUI A;  3HXC A;  2KBX A;  1SZA A;  5G55 A;  2KXP C;  2VYI A;  1TEZ A;  2WXR A;  4L7T A;  3VLD A;  4J8E A;  4M7C A;  3L6A A;  2J09 A;  3ZKJ A;  3FUL A;  1HH8 A;  4IUL A;  3PDN A;  5LFA A;  4B94 A;  3GW4 A;  5HS0 A;  4L2Y A;  1TN7 A;  3Q49 B;  1FVH A;  2KM4 A;  5BV1 A;  3TXN A;  5FQ7 A;  2BF0 X;  2P9U G;  4A1G A;  4EHM A;  4ANX A;  4B0Z A;  3V2O A;  1XGW A;  4U8Y D;  1HXI A;  5ENO D;  5LX8 A;  4I2W A;  4L23 A;  5AYW D;  3S7B A;  4CZ2 D;  4U63 A;  3CHQ A;  3U4T A;  3G2T A;  4I43 A;  4JPS A;  4EQF A;  3BUA A;  3PZ4 A;  3LY7 A;  4I9C A;  5AQA A;  1O1S A;  2WMN A;  3SQV A;  3S7F A;  1ELK A;  4GTS A;  3ZYQ A;  4WND A;  3OTN A;  1YMP A;  4F1S A;  3FTW A;  1OCR E;  5FQ6 A;  4HOR A;  2YQ8 A;  4G25 A;  1KZO A;  3PZD A;  5CBO A;  4EPZ A;  4UWG A;  3R7Q A;  5CCL A;  3FUH A;  3U66 A;  3D3M A;  2WXQ A;  3R7R A;  4JEU A;  3HXF A;  4WAF A;  3DEP A;  3OXG A;  4OAV B;  4JHR A;  4ANU A;  5A6C A;  3ZW3 A;  2J4D A;  3FUM A;  1U3D A;  2OV8 A;  4X8Q A;  3DSU A;  4HRL A;  2Y1L E;  3EJN A;  4HRM B;  1N4R A;  4KVO A;  2PZI A;  4PS8 A;  3FH8 A;  3D9O A;  2LNI A;  3ZUV B;  1OXJ A;  4K0R A;  4G23 A;  4GA1 A;  3GZ1 A;  4PUC A;  5ENQ D;  2IOL A;  4EEC A;  3FU0 A;  3UPV A;  3TAX A;  5ENN A;  4BSX A;  2WQH A;  1H19 A;  3S7D A;  4N2S A;  4BER A;  3EHQ A;  4ANW A;  3LEW A;  1MHQ A;  4HXI A;  3FTU A;  4JZY A;  4G8K A;  3EHR A;  3B7R L;  4YDO A;  2MHK A;  2Y3A A;  4XEI G;  3E4B A;  3JQ1 A;  3QWV A;  2GRR B;  5EDS A;  4GTT A;  2FUL A;  2IQC A;  4JB8 P;  3FP3 A;  5FIO A;  2H6H A;  4ZHB A;  3EIQ C;  3ZU7 B;  1WY6 A;  4W9R A;  3U9W A;  4I2Z A;  2YHE A;  2DWZ A;  5EID A;  1HG5 A;  1N11 A;  3FU5 A;  3BG1 B;  4OVU A;  2AVP A;  4GCN A;  1FVF A;  4ILI A;  3C3R A;  3MGB A;  2V0P A;  3CGH A;  3CLJ A;  3OXL A;  3MEK A;  3FUD A;  3CHP A;  4DX2 A;  2C0M A;  2WMO A;  3BG0 B;  3FUJ A;  2R17 C;  3CVL A;  2LAH A;  4KBQ A;  1S63 A;  3P1U A;  3FEX A;  2BKK B;  3LXU X;  4DRX E;  3PH0 C;  4FJY A;  1INZ A;  1EPU A;  5KJL A;  4F3V A;  3SGH A;  1N52 A;  3D9J A;  3NF1 A;  2V5Q C;  2MYO A;  1NL4 A;  3EHN A;  5ITZ F;  4N2Q A;  5FQ4 A;  2XHE A;  3NQP A;  2LSV A;  1EDU A;  3MV3 B;  2CHW A;  3R9A B;  4I9E A;  3ESK A;  2VSN A;  4GB9 A;  4G26 A;  4DX7 D;  2ION A;  3MJW A;  3D9L A;  4GPK A;  3NAW A;  4C9B B;  3ASO E;  4GU5 A;  4GTR A;  5ANL A;  3ZN3 A;  3CHR A;  2VJ8 A;  4YND A;  3HRA A;  2CHZ A;  4NRH B;  2XCC A;  1PAQ A;  3ZEF A;  3Q47 B;  3D9M A;  3CQC B;  2DZO A;  3PS6 A;  3ZPJ A;  3I4R B;  4LRZ A;  2J07 A;  4ILH B;  4Y6W A;  3DSS A;  4LNU D;  4HFG A;  2VSY A;  1A5E A;  1GW6 A;  4U0Z A;  1OCZ E;  3E37 A;  3ESL A;  4J8F A;  3ZNG A;  2FEZ A;  4HBD A;  4NQ0 A;  4M3O A;  3RO2 A;  2WQ6 A;  3TG5 A;  1UN8 A;  3TXM A;  3B7B A;  3ML9 A;  1UG3 A;  4CT4 A;  2J08 A;  4GZ3 A;  4RG6 A;  5ARG A;  4BX9 A;  1XNF A;  2UY1 A;  4CRW A;  5FZQ A;  5JJT A;  3J5Q B;  3NOC D;  4YVO A;  3OAW A;  4J0U A;  4LUN U;  2WXJ A;  2FO1 E;  1WG0 A;  4FHK A;  4NUR A;  2OCC E;  3IHV A;  5T8I A;  3AG4 E;  3PRE A;  2AWI A;  1O5M A;  3MZL B;  1PY1 A;  2WXN A;  3PUK A;  4A1S A;  2KCL A;  1E7U A;  4D10 C;  5BUZ A;  2WXM A;  4V3I A;  3SBT B;  4WNG A;  3DSW A;  4J7W A;  2ZIR A;  5E76 A;  2V4L A;  4AM9 A;  1K8K G;  4JEH A;  2H6G A;  3QKY A;  3E32 A;  3HVE B;  4DK5 A;  4GYY A;  3B13 A;  1X5B A;  1EF1 C;  3L16 A;  5BV0 A;  4HRN A;  2XS1 A;  3RJV A;  1HO8 A;  5KCM A;  2F0Y A;  3LVQ E;  3L54 A;  1VDY A;  3PE3 A;  2F8Y A;  4U96 D;  3QAR A;  5D0Q D;  1O1T A;  5B3S E;  1Y8M A;  3Q79 A;  1BI8 B;  2DVW A;  1UOH A;  3QDN A;  3UTM A;  4GA2 A;  3QNK A;  3UKU G;  2L6B A;  4U0S A;  2WB2 A;  2HYZ A;  4EZJ A;  4HI9 A;  1DNP A;  4ANV A;  5G04 C;  3TL5 A;  1TNZ A;  2WXF A;  3JCK C;  2EIK E;  4P29 A;  4RVB A;  3VLF A;  5FZS A;  1TNB A;  1Z5S C;  3IHY A;  4U7E B;  2J8S D;  1H2V C;  4WWP A;  2CG3 A;  1O1R A;  1HE8 A;  4GZ5 A;  1AP7 A;  5CMW A;  3L13 A;  3LKU A;  1LF8 A;  1NFI E;  2JAB A;  3ZXP A;  2R05 A;  3CV0 A;  1D8E A;  4RQI A;  2C2L A;  4JD2 G;  3R9M A;  3UXG A;  1TJF A;  1YCS B;  4XI9 A;  3ML8 A;  3ABK E;  4LNB A;  2QY7 A;  4BTA A;  2RFA A;  4UWL A;  2NYJ A;  3BEE A;  3PZ2 A;  4GTM A;  4G24 A;  3MKQ A;  3ONK A;  3RRM B;  4AP2 A;  2XEN A;  4ACK A;  5BXU A;  3ZYK A;  2XCB A;  2E2E A;  4HOS A;  1U2V G;  4C0M A;  4IYP A;  1LD7 A;  4AJW A;  4UUC A;  4NIK A;  4TRQ A;  3I5P A;  3FU3 A;  3AS4 A;  3CHO A;  2GRL A;  2CFU A;  3MA5 A;  3BU8 A;  5AIJ A;  2J4B A;  4DLO A;  3N71 A;  5AEN A;  3NZS A;  2IO3 C;  2MRI A;  4U07 A;  3J5P A;  4F6R D;  1MQS A;  3S7J A;  5FQ8 A;  4GTQ A;  3FWV A;  2XEE A;  1WDY A;  4DI3 A;  3C72 A;  3UX4 A;  5CER B;  5KNH D;  3DXM G;  3G2W A;  4FHJ A;  3FHE A;  1HU3 A;  4UI9 K;  5BW8 C;  3FDH A;  5AQ7 A;  1NZN A;  3ZHE A;  4BT9 A;  1BD8 A;  5AQ9 A;  4XI0 A;  4JXT A;  4HS2 A;  4CEM A;  2F37 A;  1L5J A;  4K5C A;  4AEZ C;  4LNG A;  3SFX A;  3UIP C;  3L08 A;  3JYS A;  5JJ7 A;  4AVX A;  4TXR A;  2X3M A;  3EUV A;  4I1M A;  4MRU A;  2BKG A;  2FI7 A;  4BTB A;  4B93 B;  5LP0 A;  2XRY A;  5JHA A;  4G2V A;  3RSE G;  3CEQ A;  3AU4 A;  4B8C B;  3WG7 E;  1JCR A;  4OVV A;  4FAD A;  3LCA A;  3AG2 E;  4KVM A;  4DLQ A;  4JC8 A;  2XGM A;  3PZ1 A;  4K03 A;  4DJA A;  4YDY A;  3G2S A;  2OOE A;  4F1P A;  1AWC B;  3TWW A;  3DRA A;  5EIB E;  3ULY A;  2HR2 A;  4FUL A;  3Q4A B;  5CED B;  1MJ0 A;  2AXU A;  5H7P A;  2QFC A;  3DPY A;  5DIZ A;  3AG1 E;  2JLB A;  3F6Q A;  4JA7 A;  4IRU A;  1JUQ A;  3KAE A;  3HVE A;  3LPZ A;  2V4H C;  2P9L G;  3B7S A;  1BLX B;  1H6P A;  1NA3 A;  1ZU2 A;  1E8Y A;  2NSZ A;  2DBA A;  3QJZ A;  1N4Q A;  2WQ7 A;  3PZ3 A;  5LOZ A;  3ZVV A;  4JVS A;  1E90 A;  4UWF A;  1OWM A;  2GRO B;  2Q7F A;  4HOT A;  3SFZ A;  1BU9 A;  2PNN A;  3AS8 A;  2X6K A;  2VGY A;  4XE0 A;  3FTZ A;  2H6I A;  2WXO A;  4FU3 A;  5EX0 A;  4BWR A;  2L0T B;  3UKR G;  3FH7 A;  1KPS B;  1JWG A;  5BXO A;  1OT8 A;  4GMJ A;  3EU9 A;  2WPV A;  5AAO A;  3PVL A;  5CMY A;  4FC8 A;  1DCE A;  2ZGG A;  1ZBP A;  5JA4 D;  3URZ A;  4UWH A;  2LXL A;  2WXI A;  4HB5 A;  2VGX A;  2AJA A;  5IY5 E;  3QWP A;  5LCW J;  1JPL A;  3UM2 A;  4BFR A;  2XQ0 A;  2PM6 A;  3UT7 A;  3RAU A;  3D9K A;  3CHS A;  4QFV A;  3MKQ B;  1E8X A;  1KT0 A;  1TN6 A;  1KLX A;  5KNG A;  1RZ4 A;  1E8Z A;  4IN3 B;  2V5F A;  3B7T A;  2I1J A;  2KC7 A;  3RIB A;  3W9G A;  5M72 A;  3LJ3 A;  2ETA A;  2RKK A;  4O1P A;  3NOG D;  3RKV A;  4RLY A;  2BED A;  4L1B A;  1SVX A;  4TUM A;  3FTX A;  4EBA A;  1E7V A;  4HOQ A;  1PC2 A;  3CKB A;  4APF A;  5EKQ D;  4F7A A;  4AY5 A;  1E96 B;  1N95 A;  5EYL A;  1MX4 A;  1JCS A;  2WXH A;  1LD8 A;  3T5V A;  3UUX A;  4GCO A;  2YIN A;  3FTV A;  2P58 C;  3JXJ A;  4GTP A;  3RO3 A;  2LUH A;  5A7D B;  3ULQ A;  4H7X A;  1TR4 A;  1QYM A;  2WXP A;  3DSX A;  3L82 A;  5FTP A;  2WVI A;  3SY2 A;  2OEV A;  2VGX B;  2PQN A;  3SBS A;  3CIA A;  3QC1 A;  3NBN B;  2DYS E;  3ULE G;  3AJI A;  4WWN A;  5HQ8 A;  3E30 A;  2P2C P;  5AAR A;  3UT8 A;  5BT1 A;  2X6I A;  3HHM A;  1UW4 B;  2AXV A;  1NA0 A;  5CBN A;  1H6K A;  4WWO A;  3TWV A;  1TN8 A;  1Z3X A;  3ASH A;  4WNF A;  2I1K A;  2UY1 B;  4GZC A;  4J8D A;  4GML A;  3JXI A;  2P9I G;  3UIO C;  2WXG A;  4DX6 D;  4URK A;  3QOU A;  3APD A;  3FUK A;  3CVX A;  4I6G A;  4DX5 D;  4GZD A;  4E6H A;  4CCA A;  1UJK A;  2XZT G;  2XEH A;  4O6F A;  2EIL E;  2HO1 A;  3GZS A;  2E0I A;  2V8S E;  2KCK A;  3ABM E;  4LER A;  2PQR A;  1S64 A;  3T8M A;  4JHJ A;  2A5E A;  1RW2 A;  4N3A A;  2XPI A;  2RD0 A;  1IHG A;  1V54 E;  1N4P A;  4BX8 A;  1SA4 A;  1P5Q A;  4MBG A;  2XGS A;  2ZGD A;  3ISM C;  5EIL A;  2BTD A;  3WXX A;  5T3R A;  3S2A A;  4CGW A;  3FUE A;  3MCX A;  2X6J A;  4N5Q A;  4RSY A;  1IYG A;  3ABL E;  1H6O A;  3LVR E;  3ZYL A;  4KYO B;  5HRY A;  4K5B A;  2VQ2 A;  2VSX E;  4H7Y A;  2I2O A;  2L0I A;  4O60 A;  4EZK A;  5J08 A;  3KSQ A;  2UWJ G;  3UM1 A;  4KZ0 A;  5ENR D;  2GRP B;  3KSL A;  4XZ4 A;  2I9C A;  4Z68 A;  3ASF A;  4UWK A;  3TG4 A;  5HI7 A;  5B1A E;  3TJP A;  2XZD G;  1FT1 A;  4CGV A;  3Q75 A;  4GPM A;  2LXM A;  3FEY A;  1IQR A;  1OWL A;  3RRN B;  2IO2 C;  3Q7F A;  4AIF A;  4BY6 A;  2IF4 A;  3FTS A;  4YDW A;  1ELR A;  2EQX A;  3AAA C;  4APO A;  4C48 B;  3FU6 A;  3FUN A;  4HQD A;  3ONL A;  3KS2 A;  2GGF A;  2DIW A;  3CVY A;  3HXD A;  4I6E A;  3UM3 A;  2VTB A;  4CDN A;  1OY3 D;  3LDZ A;  2ZXW E;  2LAI A;  3LJN A;  2X38 A;  2VGE A;  3MYV A;  5D2M C;  3W9F A;  4A3V A;  2WM9 A;  1E8W A;  1MYO A;  4ATG A;  1TYQ G; 
#chains in the Genus database with same CATH homology
 1SW6 A;  3ZUV B;  3TWW A;  4OAU C;  5EIB E;  2ETB A;  1N0R A;  2ZGD A;  2P2C P;  5AAR A;  2Y0B G;  3Q9N C;  4HB5 A;  3UTM A;  5EIL A;  3V30 A;  2BKK B;  4DRX E;  3TWQ A;  4N5Q A;  5ENQ D;  2L6B A;  3C5R A;  3JUE A;  2AJA A;  5CBN A;  3V2O A;  5CED B;  1MJ0 A;  3B7B A;  5CEC B;  4U8Y D;  2QYJ A;  4BES A;  3TWV A;  5ENO D;  5KWD A;  4HI9 A;  5KBA A;  3F6Q A;  5HRY A;  1S70 B;  4K5B A;  4BER A;  1YYH A;  4J8Y A;  4BSZ B;  3EHQ A;  5AQB A;  2V5Q C;  1D9S A;  2HE0 A;  4QFV A;  2MYO A;  3J5P A;  4F6R D;  3V31 A;  4CZ2 D;  4K5A B;  5ITZ F;  3J5Q B;  3NOC D;  4G8K A;  3EHR A;  4O1O A;  2V4H C;  2XEE A;  4O60 A;  5KNG A;  1WDY A;  2QC9 A;  3JXI A;  4F1P A;  1IHB A;  5ENR D;  5JMN D;  3TWU A;  2FO1 E;  5CER B;  5KNH D;  1BLX B;  2F8X K;  4Z68 A;  1WG0 A;  5AQA A;  3W9G A;  4CYM D;  1BI7 B;  3UI2 A;  2ETA A;  1IKN D;  3KEA A;  1K1A A;  3NOG D;  4O1P A;  1K3Z D;  4LSZ E;  5AQ7 A;  5HKP A;  5D66 A;  2XZD G;  4JB8 P;  4HNA D;  4ZFH A;  2J8S D;  4RLY A;  1SVX A;  1BD8 A;  1YMP A;  5FIO A;  4DX6 D;  4ZHB A;  4TUM A;  4GPM A;  5AQ9 A;  4BET A;  5EYP F;  4DX7 D;  3ZU7 B;  1AP7 A;  5ENT D;  3Q9U C;  2RFM A;  3IXE A;  1NFI E;  2JAB A;  3B95 A;  4GMR A;  4DX5 D;  4QQI A;  5CBO A;  5CEA A;  4J7W A;  4DX1 A;  3UXG A;  1MX6 A;  4YDW A;  3V79 K;  1YCS B;  2F37 A;  4K5C A;  4HI8 A;  5EYL A;  2DWZ A;  1MX4 A;  1K1B A;  3TWT A;  1IXV A;  5EID A;  2PNN A;  2B0O E;  3TWS A;  1BU9 A;  1G3N B;  2XZT G;  1N11 A;  2DZN A;  3DEO A;  2RFA A;  2XEH A;  3AAA C;  4LG6 A;  4U8V D;  2NYJ A;  4C48 B;  5AN8 A;  3HRA A;  2KBX A;  5ENS D;  4BEP A;  5ENP D;  3D9H A;  2KXP C;  3DEP A;  4G8L A;  4HRN A;  2BKG A;  3V2X A;  4HQD A;  3JXJ A;  4OAV B;  2XEN A;  4HLL A;  1UOH A;  1MX2 A;  4B93 B;  5FIN A;  5BXO A;  3T8K A;  2DZO A;  4DUI A;  5BXU A;  1OT8 A;  4U95 D;  1N0Q A;  3SO8 A;  5EN5 D;  1TR4 A;  1AWC B;  1QYM A;  3EU9 A;  3ZKJ A;  1OY3 D;  2A5E A;  4LNU D;  4HRL A;  2Y1L E;  2F8Y A;  4U96 D;  3LJN A;  3T9K A;  4DX2 A;  1DCQ A;  5AAO A;  1A5E A;  2VGE A;  4ATZ D;  3TWR A;  4A63 B;  3W9F A;  4HRM B;  2ETC A;  5HS0 A;  3ZNG A;  3TWX A;  4YDY A;  3NBN B;  2ZGG A;  4UUC A;  1MYO A;  4NIK A;  4HBD A;  1BI8 B;  3AJI A;  3HG0 D;  2DVW A;  5JA4 D;  1DC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...