1MX4A

Structure of p18ink4c (f82q)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
156
structure length
156
Chain Sequence
WGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGQLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of p18INK4c proteins with increased thermodynamic stability and cell cycle inhibitory activity
pubmed doi rcsb
molecule keywords Cyclin-dependent kinase 6 inhibitor
molecule tags Cell cycle inhibitor
source organism Homo sapiens
total genus 46
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1mx4A00
1WDYA 3J5PA 5ENTD 2L6BA 2KBXA 2ZGGA 5CBOA 3T9KA 1D9SA 4ZHBA 1K1BA 3HG0D 1BI7B 4G8LA 4U8VD 1BI8B 1UOHA 2BKKB 1IXVA 3HRAA 3TWWA 4U95D 2XEHA 4HRMB 4O1OA 1MYOA 2XZDG 3Q9NC 5CECB 2RFAA 5KNGA 5KNHD 5BXUA 4O60A 1SW6A 2ETAA 4HNAD 5CERB 2V5QC 3B7BA 1AWCB 3EU9A 1MJ0A 4U8YD 1N0RA 2BKGA 3DEPA 3TWVA 4HRNA 4CYMD 4DX5D 5JMND 4C48B 4TUMA 2ETCA 4BETA 4YDYA 4DX6D 3IXEA 2F37A 5FIOA 4DX2A 1K1AA 3ZNGA 5CEAA 4OAVB 4BESA 4RLYA 4K5BA 4B93B 2HE0A 2Y1LE 5FINA 4UUCA 4NIKA 5D66A 1MX2A 1N11A 4J7WA 1A5EA 4F1PA 2MYOA 4HI9A 2NYJA 3V2XA 5KWDA 1MX6A 1OT8A 1QYMA 1DC2A 1WG0A 4LSZE 3NOGD 5CEDB 2XZTG 3EHQA 2F8XK 5EILA 5KBAA 4J8YA 4N5QA 2DZOA 2JABA 5AARA 1NFIE 3W9FA 5CBNA 3TWQA 4QFVA 5ENRD 4DX7D 5JA4D 1S70B 2KXPC 2PNNA 3B95A 1K3ZD 4G8KA 4YDWA 4OAUC 2DVWA 2Y0BG 4BSZB 1DCQA 5EIBE 4ZFHA 5ENPD 2XENA 3TWXA 3D9HA 3EHRA 3DEOA 5EIDA 5AQ7A 1AP7A 3ZUVB 4F6RD 4U96D 3LJNA 3V2OA 1TR4A 3TWRA 2VGEA 3NBNB 5HKPA 3UXGA 5BXOA 2J8SD 3JXIA 3Q9UC 4HLLA 5EN5D 1MX4A 3TWUA 4ATZD 1BU9A 5HS0A 2AJAA 2RFMA 2ZGDA 5AN8A 3W9GA 3JUEA 2V4HC 2A5EA 3V79K 1OY3D 2P2CP 4JB8P 4K5AB 1N0QA 4LNUD 4O1PA 3TWSA 4A63B 4Z68A 2FO1E 3ZKJA 2QYJA 1IHBA 1G3NB 4HB5A 4CZ2D 4DX1A 4QQIA 3JXJA 5AQAA 2DWZA 4GPMA 3T8KA 3V30A 4DUIA 3UI2A 3NOCD 3UTMA 4HBDA 2ETBA 5EYLA 4K5CA 1IKND 5ITZF 1BLXB 2XEEA 3AAAC 4GMRA 5ENSD 5EYPF 3C5RA 4HQDA 1YCSB 4BEPA 1SVXA 5ENOD 4DRXE 3ZU7B 3F6QA 2DZNA 3J5QB 4BERA 5AQ9A 3TWTA 1YYHA 5AAOA 3SO8A 5ENQD 1YMPA 3V31A 4HRLA 4LG6A 4HI8A 1BD8A 2B0OE 5HRYA 2F8YA 2QC9A 3AJIA 3KEAA 5AQBA
chains in the Genus database with same CATH superfamily
1WDYA 3E4BA 5CRUA 1GW6A 3T9KA 4GZ5A 2WXNA 2WXRA 3ASGA 3PUJA 4DK5A 5KNGA 4CEMA 3ABLE 5DIZA 1HF8A 2V8SE 3Q4AB 1E8YA 3SF4A 2WPVA 4AOFA 4DX2A 4RLYA 3FU5A 1OWMA 3IKOB 4M3OA 4BT8A 4Y6CA 1N11A 2WXPA 4F1PA 3RIBA 4GCNA 2P9UG 3CHSA 3G2UA 4J8DA 1LD7A 2LSUA 2OEVA 1TN8A 5FZRA 3R9MA 3RKVA 2FF4A 3ASOE 4J8EA 5EIBE 3CK8A 4ZFHA 2HYZA 3LJ3A 3EHRA 1SA4A 2LAHA 3GZ1A 4AEZC 1KT1A 1MHQA 2XS8A 2C0MA 5HKPA 4DPRA 3FU3A 5LFAA 3MV3B 3R9AB 2GRMA 2CFZA 1N0QA 3LCAA 1IHBA 3IV0A 3TAXA 1TN7A 4JZYA 2OEWA 4J6IA 1FPPA 3DWLG 3FUIA 3P2BA 4HS2A 5G05J 5ENOD 4BTAA 3PDNA 5ENQD 4ANVA 3V31A 4LG6A 4GA2A 2QC9A 3ZHEB 1H2UA 1X81A 2DBAA 2CFUA 5CBOA 5FTPA 3AG4E 4WWNA 1UOHA 3CK7A 5JJ6A 3HYMB 3DPDA 5D0QD 2GRPB 2ETAA 2A5UA 4K03A 3ESLA 4TUMA 2WXMA 3MCXA 4JHRA 2Y1LE 1SZAA 1TJCA 3AG1E 4UWLA 3TXMA 3W9FA 5BPPA 2KXPC 2OVBA 3T5XA 3C3OA 4EZJA 3FUHA 4LCTA 3DPYA 3D9HA 5EIDA 3B7RL 3NF1A 4UI9J 5B3SE 3NBNB 3CVPA 2PZIA 3FTWA 3FDHA 4KXKB 2FI7A 3FTZA 2LXMA 1TNYA 4JC8A 3CR3A 3ZKJA 3N71A 5LOZA 3T8KA 3QWVA 4BFRA 1D8DA 4GZ6A 4DRXE 1HU3A 2C0LA 3SI5A 4Y6WA 2KCVA 4I9EA 5BNWA 5CCLA 5JHAA 1ELWA 1P5QA 2WXHA 2J49A 4HOSA 1HG5A 4GTQA 4JEHA 2P9NG 4U0UA 2BKKB 3TWWA 1INZA 3E37A 3LKUA 1NA0A 1MYOA 3Q9NC 3IBEA 2YHEA 2QYUA 2GROB 5JJ7A 3TWVA 1UJKA 3TG5A 2I1KA 4XZ4A 1K1AA 3FUKA 2WQ7A 4UUCA 2A4ZA 5CCMA 5A6CA 3FTUA 3FUFA 4I2ZA 2ZU6B 4J8YA 3PZ2A 4DX7D 1MZCA 3PE4A 3UM1A 3TL5A 4HLEA 3PEVB 5J90A 4N5CA 1N4PA 4BWRA 1V54E 3MJWA 3PZDA 5AQ7A 1AP7A 3ZPJA 2RKKA 2XPZA 3Q9UC 2XEVA 3AU5A 1E7UA 3DXKG 3QOUA 4TXQA 5ARFA 4N3BA 2AJAA 2J07A 3L08A 3V79K 2P2CP 2WXJA 2VGXA 4KYOB 3FUJA 2M63A 5CMWA 4WNGA 2J4BA 1BLXB 2WQ6A 3SY2A 4X8QA 4WNDA 5ENNA 5KCMA 3ZIMA 1OXJA 3C72A 1O5MA 4RSYA 5M72A 3GYZA 4GZCA 2DIWA 3EU5A 3HXCA 3CKCA 3CIAA 1BPOA 3HRAA 4HRMB 5CECB 5G55A 2RFAA 1N54A 3S7FA 5BXUA 3D9IA 3VLEA 3PNTB 2YNQA 2I1JA 2Y4TA 4FHJA 4DX5D 4CGVA 3UM0A 4K5BA 4CDNA 4I9CA 5G05C 4U63A 1MX2A 3T8MA 4MS6A 1QNFA 4ILHB 5JHBA 2XGSA 4M7CA 1DC2A 2XS1A 2F8XK 4CGWA 3FTYA 2HO1A 3O4ZA 3TWQA 5ENRD 3RRUA 4G8KA 4OAUC 1Q2ZA 3U64A 3KD7A 2R59A 1LD8A 4L1BA 3CSTA 2BF0X 2WQHA 4J8SA 2J8SD 3TWUA 1KT0A 3BEEA 2Y4UA 3Q7FA 1H2VC 3MYVA 1HE8A 4ME2A 3ZYQA 4O1PA 5T3RA 1IQUA 4CZ2D 1N95A 3TJPA 3ML9A 1O1RA 3PZ1A 3DSXA 1HFAA 3EDTB 4BERA 4EBAA 3HHMA 5AAOA 2RG8A 4HRLA 5HRYA 4UI9C 5AENA 2WB2A 4FULA 5AQBA 3FEXA 2WM9A 3ZGQA 5CMYA 2XRYA 3UM2A 2EIKE 1H0AA 3FH8A 3PS6A 1OCRE 1SW6A 5CERB 3JUIA 1B89A 3SD5A 1NZNA 1MJ0A 5BUZA 4AVXA 1Z6TA 4YDYA 3APCA 5LX8A 4PS8A 2JLBA 1KZOA 2R02A 5EKQD 2VSOE 5FJYA 4YVOA 3LYAA 3PVLA 4JHKA 3LDZA 2Y0BG 1H19A 3HXFA 2XCBA 4F53A 5ENPD 1LF8A 4I6JA 3UIPC 1FVHA 4F7AA 5FZSA 4NACA 3E34A 3PREA 4L2YA 5HS0A 3AU4A 4JL0A 2LUHA 3JUEA 3E33A 3CSFA 3LEWA 4UWHA 4HB5A 3LY9A 2CHXA 3AS5A 4XI9A 3CVVA 3UTMA 2QY7A 3DXMG 3AAAC 3CV0A 3C3RA 1KZPA 2VYIA 3SO8A 2C2LA 4A3VA 2PL2A 4G25A 4E85A 3QNKA 3ZXSA 3S2AA 4EECA 3Q49B 4EHMA 4ZHBA 1K1BA 5CRVA 2KM4A 2XEHA 4GTMA 5A23A 5KNHD 4XKCA 4TV3A 4XX5A 3NZSA 4HRNA 2EIME 4MLPA 4U04A 4AV7A 3FTVA 3ULQA 5B1AE 3CVLA 2WMOA 2VTBA 5H7PA 3MA5A 3V2XA 2LXLA 3FUNA 1TNZA 3TG4A 3CHPA 3ZW3A 5JA4D 3DSVA 4YDWA 3L82A 2I6HA 3SGHA 1FT2A 5HI7A 1E8ZA 3DBSA 4A55A 3D3MA 3CVXA 4JD2G 4LNBA 5C1DA 2OV8A 1TR4A 3HIZA 3UXGA 1H2TC 1HXIA 4NRHB 4ATZD 4H7XA 2WXQA 3KSLA 2V4HC 1N4QA 1RW2A 2J4DA 3ZHEA 4A63B 4K5AB 4F1SA 2FO1E 3SHFA 4FP7A 1Y6IA 1UJJA 4NURA 3NQPA 3Q75A 2VTBB 4UWFA 5KJKA 2WXOA 3DSTA 5AQ9A 3UMVA 4BTBA 3ZVVA 4JA9A 4GAAA 3FU6A 4CDRA 4TXPA 4FLHA 2L6JA 1TNUA 3S7JA 4B94A 2IOSA 2J08A 4I1OB 3ASFA 4JHJA 2XZDG 1H6PA 3SQVA 1Z3YA 4NQ0A 2BKGA 5BV1A 4IYPA 3C98A 4KZ0A 2IY0C 5D66A 3Q5MA 1ELRA 3ABKE 3HVEA 2XGMA 3EJNA 1JCQA 3JQ1A 3CHQA 3Q73A 1WAO1 2VGYA 1N4SA 3JYSA 1U3DA 4TRQA 4OVVA 3EHMA 5AYWD 2AXUA 2CHWA 4E6HA 2R05A 1NA3A 3EIJA 3WG7E 1QBQA 3CKBA 5FQ6A 3UINC 3JXIA 2OCCE 3JCKC 4CT4A 1OCCE 4BX8A 5A7DB 1DVPA 1EYHA 4YDEA 1RZ4A 5T8IA 3SFZA 5AQAA 3GZSA 3RO2A 4DUIA 3UPVA 3NOCD 2ETBA 2P9KG 3CVQA 4WUYA 3APFA 3HVEB 3JQ0A 4U07A 1YYHA 1NL4A 4P29A 5J08A 4U0SA 5G04J 4LEUA 2X38A 1UG3A 5ENTD 1E96B 1D9SA 3I5PA 4B0ZA 4GZ3A 3MEKA 4U8VD 3I3NA 1ZBPA 3UUXA 4ILIA 4BT9A 4HFGA 2V5QC 3EU9A 2CG3A 4UWKA 5FIOA 2LAIA 5D2MC 3AG3E 3Q78A 2HR2A 1SA5A 4C0EA 5KBAA 4EZLA 1NFIE 3PH0C 5KJMA 4FA6A 4V3IA 2BUGA 2L9BA 2H6FA 3I4RB 4ABNA 2PQRA 3KS2A 2AXZA 2IFUA 3QKYA 2I2OA 1SZ9A 3NAWA 4RQIA 4ANXA 1BU9A 5ANRA 4LNUD 3ISMC 2HM8A 1OCOE 4N2SA 3RU0A 2QYJA 3UM3A 3SBSA 4GTPA 4WWPA 3U9WA 3V30A 3FUMA 2KZTA 3LVRE 2IEJA 1JWGA 4FADA 1ELKA 3GW4A 1EF1C 1JCRA 4GMJA 5G2NA 4GU5A 2XPYA 2X3MA 1MQSA 5IY5E 4AP2A 1IXVA 2L0IA 3NZUA 3EHNA 4GTOA 4DLOA 3BU8A 4HNAD 3SBTB 5E76A 3CQGB 5JMND 4I1AA 3AS8A 4HOTA 3UKRG 3QB2A 2OVFA 4YDOA 4B93B 4GPKA 3GZ2A 4NIKA 3MV2B 3FULA 3IHYA 2NYJA 1MX6A 1OT8A 2KZTB 2FO7A 5CEDB 2PQNA 3PRZA 3LY7A 2EIJE 1OWNA 2PNNA 3S7BA 4KZCA 1Z3XA 2R03A 4BSZB 2FBNA 4FJYA 4GCOA 4YVQC 3DEOA 3D9OA 4UQYA 5LCWJ 2IONA 5FWQA 3ABME 3CHRA 4AXHA 3LJNA 5EN5D 3CVNA 2EINE 1QZ2A 2X6HA 2A5EA 3CGHA 1DCEA 1EDUA 3ULYA 3ML8A 5LP0A 2YHCA 4TXRA 5FQ8A 5EYLA 5DBKA 1FVFA 3ZU7B 3J5QB 2DZNA 3KEZA 3TWTA 4AY6A 3AS4A 3BG1B 3FU0A 4H7YA 1HS6A 5KJLA 3KEAA 4A3TA 3LPZA 4J8FA 4APFA 2L0TB 3L13A 1BI8B 3ZN3A 2IJGX 2WXGA 2WXKA 4ACLA 3OAWA 3ONKA 3ASDA 1AWCB 1A17A 4U8YD 4UQZA 3DEPA 2CHZA 2ETCA 2X6IA 1JWFA 4AJWA 4OAVB 3DSUA 2HE0A 5FINA 2YQ8A 3ZYKA 3AG2E 3FEYA 2VSNA 5G04C 2XZTG 4WAFA 4EZKA 2JABA 1K3ZD 5FZQA 4U7EB 1DCQA 2P9IG 2XENA 4I1MA 4I2WA 1ZB1A 2E0IA 4LUNU 3ZRHA 4ANWA 4F6RD 3S7DA 1YA0A 2BTDA 1HH8A 4WNFA 2J09A 2ZGDA 3FHEA 3QDNA 4JB8P 3URZA 2XRZA 3D9NA 3C3QA 4GPMA 4URKA 4K5CA 5ITZF 5EYPF 1SVXA 3D9PA 1FT1A 4GYYA 4IN3B 1U3CA 4KMOA 1BD8A 4D10C 2ZGGA 2X6FA 2R5SA 4PS7A 4FJZA 3QWPA 3PEUB 1O1SA 4BX9A 2ILRA 3RJVA 3E32A 2P9LG 3LXUX 5T4YA 2OOEA 4LNGA 1OCZE 1PC2A 4DX6D 3B7TA 4BESA 2ZIRA 2VSXE 4FU3A 3R7RA 4DJAA 2MYOA 3FH7A 4HI9A 3LVQE 2XCCA 5EILA 4ATGA 2Q7FA 3BQOA 4F3VA 3FUDA 4JVSA 3D9KA 3BG0B 3SZ7A 4DI4A 4R7LA 4IULA 3KAEA 4HORA 4L9PA 1H6OA 4AIFA 4L2LA 2H6GA 4K0RA 4XEIG 4PH4B 4CRWA 3OXLA 3RK6A 3V2OA 3TWRA 5BW8C 1MX4A 1HG2A 3ASHA 4N39A 3CQCB 4C9BB 3DRAA 3IHVA 3OXGA 2AVPA 1S0PA 2LNIA 3K9IA 2R2LA 3JXJA 3UKUG 4ILGA 3UI2A 2V4LA 4G24A 4EPZA 4HXIA 4GMRA 5ENSD 4U0ZA 1W3BA 3FUEA 4DLQA 4B8CB 4FC8A 5LCWC 2UY1A 1OWLA 4CCAA 1LTXA 2YINA 1OWPA 2L6BA 2NXPA 3QK0A 1PAQA 3B7SA 2IO2C 2ZISA 3G2TA 4U95D 2XGOA 4O1OA 4ACKA 3VLFA 4O60A 3CHOA 4JA7A 3B7BA 1KPSB 3KSQA 3OTNA 3G2SA 4G2VA 1N0RA 3L22A 3L9TA 1KLXA 2X6JA 4APOA 2WXIA 3HXBA 1JCSA 1Z5SC 2GRQB 3UIOC 1UN8A 4U8HA 4WWOA 1WG0A 2NC9A 3MKQA 1FCHA 4RVBA 5AARA 5FQ7A 4Q96A 4QFVA 1S70B 2WVIA 3Q15A 2P58C 2GRLA 3CK9A 2UY1B 2H6HA 4LRZA 2VQ2A 4JW1A 4N3CA 3QARA 5CHEE 3ZUVB 5HQ8A 4WNEA 4HLLA 1XGWA 3P1UA 2FULA 2RFMA 4A1SA 3QAQA 4GTRA 3SNXA 3QJZA 5EX0A 5ANLA 5JJTA 1HX8A 1WY6A 1E8XA 1IHGA 3PNLB 2P9PG 4PDXA 1V55E 4CDMA 5BV0A 3MKQB 3U4TA 1YMPA 4GYWA 1D8EA 1K8KG 4PS3A 3AJIA 4J0UA 3L54A 1O1TA 3L17A 5EDSA 3G2VA 4G8LA 3D9MA 4KBQA 3Q7AA 2J9QA 1UW4B 3ZYLA 3B13A 3O48A 4PUCA 3VTXA 3LY8A 1Y8MA 5FQ4A 4FHKA 3TXNA 4C48B 4GZDA 3R7QA 2F37A 4GTSA 4C0MA 2X6KA 1JUQA 3I4GA 5CEAA 4N3AA 4YNDA 3RRMB 3ZXPA 2EILE 3CLJA 2XHEA 4N2QA 1N9AA 5KWDA 1IYGA 3EUVA 2DYRE 4DI3A 1E8WA 4JEUA 3ENEA 5CBNA 2XPIA 4OVUA 3FWVA 5EX3A 3MZLB 3TWXA 1OWOA 3QWWA 4O6FA 3RAUA 2QFCA 1H6KA 1NP7A 3PUKA 2WXFA 5AN8A 2JEKA 2DCPA 4RG6A 4Z68A 3MGBA 4DX1A 4QQIA 2R17C 2LO6A 2WXLA 3G2WA 4AM9A 1IKND 4HQDA 1YCSB 3F6QA 2MRIA 1E90A 2H6IA 4GA1A 2KBXA 2PM6A 4JPSA 1BI7B 3MX3A 3ZFWA 4HOUA 4XIFA 3TGOA 3ASNE 4RG9A 1QQEA 2LSVA 4KVOA 3CEQA 1SQMA 2IO3C 2ZXWE 3IXEA 4XE0A 3E30A 1NI1A 1S64A 3B7UX 3UT4A 2V0PA 2VSYA 4FLBA 1HZ4A 1PY1A 3HXEA 3MKRA 1QYMA 2MHKA 4LSZE 3NOGD 4CT0A 4BSXA 3D9LA 3FY4A 4N5QA 2DZOA 1DNPA 4L7TA 5AJLA 2IU1A 4B89A 1EPUA 5AIJA 3UT8A 3APDA 1TEZA 2BEDA 4XI0A 4U96D 2CG2A 4UI9K 3UQ3A 5B1BE 4LERA 3ZEFA 4I43A 3CHMA 4A1GA 3RRNB 3W9GA 2GGFA 3TWSA 2EQXA 2VJ8A 3VTYA 4MRUA 2DWZA 3CVUA 3DSWA 3FTXA 2Y3AA 2XEEA 4BEPA 3U66A 5KJNA 2I9CA 4OYSA 3PZ3A 3Q47B 2MOWA 4ANUA 4EQFA 3PZ4A 2VGXB 3FH5A 2GRNB 1U2VG 4HOQA 4MBGA 1S63A 5C2YA 2E2EA 2IOLA 2P9SG 4XKBA 3ZYMA 3RSEG 2AW6A 3FFLA 3ZNGA 5ARGA 3ONLA 3NB2A 2AXVA 5BT1A 4J7WA 3UX4A 4G11A 2GW1A 4EBAG 1VDYA 3EHQA 2PM7A 4JXTA 4GMLA 3CVYA 2WMNA 3B95A 3L6AA 4GTTA 3ULEG 1HO8A 3RO3A 1TNBA 5FT9A 2GRRB 2V5FA 4AY5A 4Q94A 4G1TA 3D9JA 4GYOA 1XNFA 4I6EA 2B6CA 4Q69A 5BXOA 1ZU2A 4G26A 2DYSE 4KT6B 3QC1A 4I17A 2IQCA 1OY3D 1TNOA 1E7VA 4I6GA 2F0YA 3LS8A 1TN6A 1UN9A 4HBDA 2QZAA 3EIQC 4GB9A 3DSSA 2AWIA 3L16A 4HI8A 2B0OE 2F8YA 2UWJG 3J5PA 1TJFA 3HG0D 3WXXA 1OUVA 3T5VA 1N4RA 1N52A 1N94A 2ONDA 2KATA 2XQ0A 4UQXA 3ESKA 4CYMD 4W9RA 4BETA 1X5BA 4L23A 5E75A 1A5EA 1IQRA 3PE3A 5AJDA 1TYQG 4UWGA 3HXDA 1WM5A 2DVWA 4GA0A 3UT7A 3FP3A 3OXFA 3SFXA 3SFYA 3VLDA 2VGEA 3IEGA 2RD0A 2KCKA 4IRUA 4TUUA 4G23A 3X2QE 2Y69E 4GTVA 4MKTA 1JPLA 3FTSA 2FEZA 4B8AA 1G3NB 4KVMA 3Q79A 2KC7A 3CVWA 2IF4A 4HVBA 3HDXA 3BUAA 4BY6A 3C5RA 3U3WA 1L5JA 2KCLA 2NSZA 5D0OD
chains in the Genus database with same CATH topology
1WDYA 3J5PA 5ENTD 2L6BA 2KBXA 2ZGGA 5CBOA 3T9KA 1D9SA 4ZHBA 1K1BA 3HG0D 1BI7B 4G8LA 4U8VD 1BI8B 1UOHA 2BKKB 1IXVA 3HRAA 3TWWA 4U95D 2XEHA 4HRMB 4O1OA 1MYOA 2XZDG 3Q9NC 5CECB 2RFAA 5KNGA 5KNHD 5BXUA 4O60A 1SW6A 2ETAA 4HNAD 5CERB 2V5QC 3B7BA 1AWCB 3EU9A 1MJ0A 4U8YD 1N0RA 2BKGA 3DEPA 3TWVA 4HRNA 4CYMD 4DX5D 5JMND 4C48B 4TUMA 2ETCA 4BETA 4YDYA 4DX6D 3IXEA 2F37A 5FIOA 4DX2A 1K1AA 3ZNGA 5CEAA 4OAVB 4BESA 4RLYA 4K5BA 4B93B 2HE0A 2Y1LE 5FINA 4UUCA 4NIKA 5D66A 1MX2A 1N11A 4J7WA 1A5EA 4F1PA 2MYOA 4HI9A 2NYJA 3V2XA 5KWDA 1MX6A 1OT8A 1QYMA 1DC2A 1WG0A 4LSZE 3NOGD 5CEDB 2XZTG 3EHQA 2F8XK 5EILA 5KBAA 4J8YA 4N5QA 2DZOA 2JABA 5AARA 1NFIE 3W9FA 5CBNA 3TWQA 4QFVA 5ENRD 4DX7D 5JA4D 1S70B 2KXPC 2PNNA 3B95A 1K3ZD 4G8KA 4YDWA 4OAUC 2DVWA 2Y0BG 4BSZB 1DCQA 5EIBE 4ZFHA 5ENPD 2XENA 3TWXA 3D9HA 3EHRA 3DEOA 5EIDA 5AQ7A 1AP7A 3ZUVB 4F6RD 4U96D 3LJNA 3V2OA 1TR4A 3TWRA 2VGEA 3NBNB 5HKPA 3UXGA 5BXOA 2J8SD 3JXIA 3Q9UC 4HLLA 5EN5D 1MX4A 3TWUA 4ATZD 1BU9A 5HS0A 2AJAA 2RFMA 2ZGDA 5AN8A 3W9GA 3JUEA 2V4HC 2A5EA 3V79K 1OY3D 2P2CP 4JB8P 4K5AB 1N0QA 4LNUD 4O1PA 3TWSA 4A63B 4Z68A 2FO1E 3ZKJA 2QYJA 1IHBA 1G3NB 4HB5A 4CZ2D 4DX1A 4QQIA 3JXJA 5AQAA 2DWZA 4GPMA 3T8KA 3V30A 4DUIA 3UI2A 3NOCD 3UTMA 4HBDA 2ETBA 5EYLA 4K5CA 1IKND 5ITZF 1BLXB 2XEEA 3AAAC 4GMRA 5ENSD 5EYPF 3C5RA 4HQDA 1YCSB 4BEPA 1SVXA 5ENOD 4DRXE 3ZU7B 3F6QA 2DZNA 3J5QB 4BERA 5AQ9A 3TWTA 1YYHA 5AAOA 3SO8A 5ENQD 1YMPA 3V31A 4HRLA 4LG6A 4HI8A 1BD8A 2B0OE 5HRYA 2F8YA 2QC9A 3AJIA 3KEAA 5AQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WDY A;  3J5P A;  5ENT D;  2L6B A;  2KBX A;  2ZGG A;  5CBO A;  3T9K A;  1D9S A;  4ZHB A;  1K1B A;  3HG0 D;  1BI7 B;  4G8L A;  4U8V D;  1BI8 B;  1UOH A;  2BKK B;  1IXV A;  3HRA A;  3TWW A;  4U95 D;  2XEH A;  4HRM B;  4O1O A;  1MYO A;  2XZD G;  3Q9N C;  5CEC B;  2RFA A;  5KNG A;  5KNH D;  5BXU A;  4O60 A;  1SW6 A;  2ETA A;  4HNA D;  5CER B;  2V5Q C;  3B7B A;  1AWC B;  3EU9 A;  1MJ0 A;  4U8Y D;  1N0R A;  2BKG A;  3DEP A;  3TWV A;  4HRN A;  4CYM D;  4DX5 D;  5JMN D;  4C48 B;  4TUM A;  2ETC A;  4BET A;  4YDY A;  4DX6 D;  3IXE A;  2F37 A;  5FIO A;  4DX2 A;  1K1A A;  3ZNG A;  5CEA A;  4OAV B;  4BES A;  4RLY A;  4K5B A;  4B93 B;  2HE0 A;  2Y1L E;  5FIN A;  4UUC A;  4NIK A;  5D66 A;  1MX2 A;  1N11 A;  4J7W A;  1A5E A;  4F1P A;  2MYO A;  4HI9 A;  2NYJ A;  3V2X A;  5KWD A;  1MX6 A;  1OT8 A;  1QYM A;  1DC2 A;  1WG0 A;  4LSZ E;  3NOG D;  5CED B;  2XZT G;  3EHQ A;  2F8X K;  5EIL A;  5KBA A;  4J8Y A;  4N5Q A;  2DZO A;  2JAB A;  5AAR A;  1NFI E;  3W9F A;  5CBN A;  3TWQ A;  4QFV A;  5ENR D;  4DX7 D;  5JA4 D;  1S70 B;  2KXP C;  2PNN A;  3B95 A;  1K3Z D;  4G8K A;  4YDW A;  4OAU C;  2DVW A;  2Y0B G;  4BSZ B;  1DCQ A;  5EIB E;  4ZFH A;  5ENP D;  2XEN A;  3TWX A;  3D9H A;  3EHR A;  3DEO A;  5EID A;  5AQ7 A;  1AP7 A;  3ZUV B;  4F6R D;  4U96 D;  3LJN A;  3V2O A;  1TR4 A;  3TWR A;  2VGE A;  3NBN B;  5HKP A;  3UXG A;  5BXO A;  2J8S D;  3JXI A;  3Q9U C;  4HLL A;  5EN5 D;  1MX4 A;  3TWU A;  4ATZ D;  1BU9 A;  5HS0 A;  2AJA A;  2RFM A;  2ZGD A;  5AN8 A;  3W9G A;  3JUE A;  2V4H C;  2A5E A;  3V79 K;  1OY3 D;  2P2C P;  4JB8 P;  4K5A B;  1N0Q A;  4LNU D;  4O1P A;  3TWS A;  4A63 B;  4Z68 A;  2FO1 E;  3ZKJ A;  2QYJ A;  1IHB A;  1G3N B;  4HB5 A;  4CZ2 D;  4DX1 A;  4QQI A;  3JXJ A;  5AQA A;  2DWZ A;  4GPM A;  3T8K A;  3V30 A;  4DUI A;  3UI2 A;  3NOC D;  3UTM A;  4HBD A;  2ETB A;  5EYL A;  4K5C A;  1IKN D;  5ITZ F;  1BLX B;  2XEE A;  3AAA C;  4GMR A;  5ENS D;  5EYP F;  3C5R A;  4HQD A;  1YCS B;  4BEP A;  1SVX A;  5ENO D;  4DRX E;  3ZU7 B;  3F6Q A;  2DZN A;  3J5Q B;  4BER A;  5AQ9 A;  3TWT A;  1YYH A;  5AAO A;  3SO8 A;  5ENQ D;  1YMP A;  3V31 A;  4HRL A;  4LG6 A;  4HI8 A;  1BD8 A;  2B0O E;  5HRY A;  2F8Y A;  2QC9 A;  3AJI A;  3KEA A;  5AQB A; 
#chains in the Genus database with same CATH topology
 1WDY A;  3E4B A;  5CRU A;  1GW6 A;  3T9K A;  4GZ5 A;  2WXN A;  2WXR A;  3ASG A;  3PUJ A;  4DK5 A;  5KNG A;  4CEM A;  3ABL E;  5DIZ A;  1HF8 A;  2V8S E;  3Q4A B;  1E8Y A;  3SF4 A;  2WPV A;  4AOF A;  4DX2 A;  4RLY A;  3FU5 A;  1OWM A;  3IKO B;  4M3O A;  4BT8 A;  4Y6C A;  1N11 A;  2WXP A;  4F1P A;  3RIB A;  4GCN A;  2P9U G;  3CHS A;  3G2U A;  4J8D A;  1LD7 A;  2LSU A;  2OEV A;  1TN8 A;  5FZR A;  3R9M A;  3RKV A;  2FF4 A;  3ASO E;  4J8E A;  5EIB E;  3CK8 A;  4ZFH A;  2HYZ A;  3LJ3 A;  3EHR A;  1SA4 A;  2LAH A;  3GZ1 A;  4AEZ C;  1KT1 A;  1MHQ A;  2XS8 A;  2C0M A;  5HKP A;  4DPR A;  3FU3 A;  5LFA A;  3MV3 B;  3R9A B;  2GRM A;  2CFZ A;  1N0Q A;  3LCA A;  1IHB A;  3IV0 A;  3TAX A;  1TN7 A;  4JZY A;  2OEW A;  4J6I A;  1FPP A;  3DWL G;  3FUI A;  3P2B A;  4HS2 A;  5G05 J;  5ENO D;  4BTA A;  3PDN A;  5ENQ D;  4ANV A;  3V31 A;  4LG6 A;  4GA2 A;  2QC9 A;  3ZHE B;  1H2U A;  1X81 A;  2DBA A;  2CFU A;  5CBO A;  5FTP A;  3AG4 E;  4WWN A;  1UOH A;  3CK7 A;  5JJ6 A;  3HYM B;  3DPD A;  5D0Q D;  2GRP B;  2ETA A;  2A5U A;  4K03 A;  3ESL A;  4TUM A;  2WXM A;  3MCX A;  4JHR A;  2Y1L E;  1SZA A;  1TJC A;  3AG1 E;  4UWL A;  3TXM A;  3W9F A;  5BPP A;  2KXP C;  2OVB A;  3T5X A;  3C3O A;  4EZJ A;  3FUH A;  4LCT A;  3DPY A;  3D9H A;  5EID A;  3B7R L;  3NF1 A;  4UI9 J;  5B3S E;  3NBN B;  3CVP A;  2PZI A;  3FTW A;  3FDH A;  4KXK B;  2FI7 A;  3FTZ A;  2LXM A;  1TNY A;  4JC8 A;  3CR3 A;  3ZKJ A;  3N71 A;  5LOZ A;  3T8K A;  3QWV A;  4BFR A;  1D8D A;  4GZ6 A;  4DRX E;  1HU3 A;  2C0L A;  3SI5 A;  4Y6W A;  2KCV A;  4I9E A;  5BNW A;  5CCL A;  5JHA A;  1ELW A;  1P5Q A;  2WXH A;  2J49 A;  4HOS A;  1HG5 A;  4GTQ A;  4JEH A;  2P9N G;  4U0U A;  2BKK B;  3TWW A;  1INZ A;  3E37 A;  3LKU A;  1NA0 A;  1MYO A;  3Q9N C;  3IBE A;  2YHE A;  2QYU A;  2GRO B;  5JJ7 A;  3TWV A;  1UJK A;  3TG5 A;  2I1K A;  4XZ4 A;  1K1A A;  3FUK A;  2WQ7 A;  4UUC A;  2A4Z A;  5CCM A;  5A6C A;  3FTU A;  3FUF A;  4I2Z A;  2ZU6 B;  4J8Y A;  3PZ2 A;  4DX7 D;  1MZC A;  3PE4 A;  3UM1 A;  3TL5 A;  4HLE A;  3PEV B;  5J90 A;  4N5C A;  1N4P A;  4BWR A;  1V54 E;  3MJW A;  3PZD A;  5AQ7 A;  1AP7 A;  3ZPJ A;  2RKK A;  2XPZ A;  3Q9U C;  2XEV A;  3AU5 A;  1E7U A;  3DXK G;  3QOU A;  4TXQ A;  5ARF A;  4N3B A;  2AJA A;  2J07 A;  3L08 A;  3V79 K;  2P2C P;  2WXJ A;  2VGX A;  4KYO B;  3FUJ A;  2M63 A;  5CMW A;  4WNG A;  2J4B A;  1BLX B;  2WQ6 A;  3SY2 A;  4X8Q A;  4WND A;  5ENN A;  5KCM A;  3ZIM A;  1OXJ A;  3C72 A;  1O5M A;  4RSY A;  5M72 A;  3GYZ A;  4GZC A;  2DIW A;  3EU5 A;  3HXC A;  3CKC A;  3CIA A;  1BPO A;  3HRA A;  4HRM B;  5CEC B;  5G55 A;  2RFA A;  1N54 A;  3S7F A;  5BXU A;  3D9I A;  3VLE A;  3PNT B;  2YNQ A;  2I1J A;  2Y4T A;  4FHJ A;  4DX5 D;  4CGV A;  3UM0 A;  4K5B A;  4CDN A;  4I9C A;  5G05 C;  4U63 A;  1MX2 A;  3T8M A;  4MS6 A;  1QNF A;  4ILH B;  5JHB A;  2XGS A;  4M7C A;  1DC2 A;  2XS1 A;  2F8X K;  4CGW A;  3FTY A;  2HO1 A;  3O4Z A;  3TWQ A;  5ENR D;  3RRU A;  4G8K A;  4OAU C;  1Q2Z A;  3U64 A;  3KD7 A;  2R59 A;  1LD8 A;  4L1B A;  3CST A;  2BF0 X;  2WQH A;  4J8S A;  2J8S D;  3TWU A;  1KT0 A;  3BEE A;  2Y4U A;  3Q7F A;  1H2V C;  3MYV A;  1HE8 A;  4ME2 A;  3ZYQ A;  4O1P A;  5T3R A;  1IQU A;  4CZ2 D;  1N95 A;  3TJP A;  3ML9 A;  1O1R A;  3PZ1 A;  3DSX A;  1HFA A;  3EDT B;  4BER A;  4EBA A;  3HHM A;  5AAO A;  2RG8 A;  4HRL A;  5HRY A;  4UI9 C;  5AEN A;  2WB2 A;  4FUL A;  5AQB A;  3FEX A;  2WM9 A;  3ZGQ A;  5CMY A;  2XRY A;  3UM2 A;  2EIK E;  1H0A A;  3FH8 A;  3PS6 A;  1OCR E;  1SW6 A;  5CER B;  3JUI A;  1B89 A;  3SD5 A;  1NZN A;  1MJ0 A;  5BUZ A;  4AVX A;  1Z6T A;  4YDY A;  3APC A;  5LX8 A;  4PS8 A;  2JLB A;  1KZO A;  2R02 A;  5EKQ D;  2VSO E;  5FJY A;  4YVO A;  3LYA A;  3PVL A;  4JHK A;  3LDZ A;  2Y0B G;  1H19 A;  3HXF A;  2XCB A;  4F53 A;  5ENP D;  1LF8 A;  4I6J A;  3UIP C;  1FVH A;  4F7A A;  5FZS A;  4NAC A;  3E34 A;  3PRE A;  4L2Y A;  5HS0 A;  3AU4 A;  4JL0 A;  2LUH A;  3JUE A;  3E33 A;  3CSF A;  3LEW A;  4UWH A;  4HB5 A;  3LY9 A;  2CHX A;  3AS5 A;  4XI9 A;  3CVV A;  3UTM A;  2QY7 A;  3DXM G;  3AAA C;  3CV0 A;  3C3R A;  1KZP A;  2VYI A;  3SO8 A;  2C2L A;  4A3V A;  2PL2 A;  4G25 A;  4E85 A;  3QNK A;  3ZXS A;  3S2A A;  4EEC A;  3Q49 B;  4EHM A;  4ZHB A;  1K1B A;  5CRV A;  2KM4 A;  2XEH A;  4GTM A;  5A23 A;  5KNH D;  4XKC A;  4TV3 A;  4XX5 A;  3NZS A;  4HRN A;  2EIM E;  4MLP A;  4U04 A;  4AV7 A;  3FTV A;  3ULQ A;  5B1A E;  3CVL A;  2WMO A;  2VTB A;  5H7P A;  3MA5 A;  3V2X A;  2LXL A;  3FUN A;  1TNZ A;  3TG4 A;  3CHP A;  3ZW3 A;  5JA4 D;  3DSV A;  4YDW A;  3L82 A;  2I6H A;  3SGH A;  1FT2 A;  5HI7 A;  1E8Z A;  3DBS A;  4A55 A;  3D3M A;  3CVX A;  4JD2 G;  4LNB A;  5C1D A;  2OV8 A;  1TR4 A;  3HIZ A;  3UXG A;  1H2T C;  1HXI A;  4NRH B;  4ATZ D;  4H7X A;  2WXQ A;  3KSL A;  2V4H C;  1N4Q A;  1RW2 A;  2J4D A;  3ZHE A;  4A63 B;  4K5A B;  4F1S A;  2FO1 E;  3SHF A;  4FP7 A;  1Y6I A;  1UJJ A;  4NUR A;  3NQP A;  3Q75 A;  2VTB B;  4UWF A;  5KJK A;  2WXO A;  3DST A;  5AQ9 A;  3UMV A;  4BTB A;  3ZVV A;  4JA9 A;  4GAA A;  3FU6 A;  4CDR A;  4TXP A;  4FLH A;  2L6J A;  1TNU A;  3S7J A;  4B94 A;  2IOS A;  2J08 A;  4I1O B;  3ASF A;  4JHJ A;  2XZD G;  1H6P A;  3SQV A;  1Z3Y A;  4NQ0 A;  2BKG A;  5BV1 A;  4IYP A;  3C98 A;  4KZ0 A;  2IY0 C;  5D66 A;  3Q5M A;  1ELR A;  3ABK E;  3HVE A;  2XGM A;  3EJN A;  1JCQ A;  3JQ1 A;  3CHQ A;  3Q73 A;  1WAO 1;  2VGY A;  1N4S A;  3JYS A;  1U3D A;  4TRQ A;  4OVV A;  3EHM A;  5AYW D;  2AXU A;  2CHW A;  4E6H A;  2R05 A;  1NA3 A;  3EIJ A;  3WG7 E;  1QBQ A;  3CKB A;  5FQ6 A;  3UIN C;  3JXI A;  2OCC E;  3JCK C;  4CT4 A;  1OCC E;  4BX8 A;  5A7D B;  1DVP A;  1EYH A;  4YDE A;  1RZ4 A;  5T8I A;  3SFZ A;  5AQA A;  3GZS A;  3RO2 A;  4DUI A;  3UPV A;  3NOC D;  2ETB A;  2P9K G;  3CVQ A;  4WUY A;  3APF A;  3HVE B;  3JQ0 A;  4U07 A;  1YYH A;  1NL4 A;  4P29 A;  5J08 A;  4U0S A;  5G04 J;  4LEU A;  2X38 A;  1UG3 A;  5ENT D;  1E96 B;  1D9S A;  3I5P A;  4B0Z A;  4GZ3 A;  3MEK A;  4U8V D;  3I3N A;  1ZBP A;  3UUX A;  4ILI A;  4BT9 A;  4HFG A;  2V5Q C;  3EU9 A;  2CG3 A;  4UWK A;  5FIO A;  2LAI A;  5D2M C;  3AG3 E;  3Q78 A;  2HR2 A;  1SA5 A;  4C0E A;  5KBA A;  4EZL A;  1NFI E;  3PH0 C;  5KJM A;  4FA6 A;  4V3I A;  2BUG A;  2L9B A;  2H6F A;  3I4R B;  4ABN A;  2PQR A;  3KS2 A;  2AXZ A;  2IFU A;  3QKY A;  2I2O A;  1SZ9 A;  3NAW A;  4RQI A;  4ANX A;  1BU9 A;  5ANR A;  4LNU D;  3ISM C;  2HM8 A;  1OCO E;  4N2S A;  3RU0 A;  2QYJ A;  3UM3 A;  3SBS A;  4GTP A;  4WWP A;  3U9W A;  3V30 A;  3FUM A;  2KZT A;  3LVR E;  2IEJ A;  1JWG A;  4FAD A;  1ELK A;  3GW4 A;  1EF1 C;  1JCR A;  4GMJ A;  5G2N A;  4GU5 A;  2XPY A;  2X3M A;  1MQS A;  5IY5 E;  4AP2 A;  1IXV A;  2L0I A;  3NZU A;  3EHN A;  4GTO A;  4DLO A;  3BU8 A;  4HNA D;  3SBT B;  5E76 A;  3CQG B;  5JMN D;  4I1A A;  3AS8 A;  4HOT A;  3UKR G;  3QB2 A;  2OVF A;  4YDO A;  4B93 B;  4GPK A;  3GZ2 A;  4NIK A;  3MV2 B;  3FUL A;  3IHY A;  2NYJ A;  1MX6 A;  1OT8 A;  2KZT B;  2FO7 A;  5CED B;  2PQN A;  3PRZ A;  3LY7 A;  2EIJ E;  1OWN A;  2PNN A;  3S7B A;  4KZC A;  1Z3X A;  2R03 A;  4BSZ B;  2FBN A;  4FJY A;  4GCO A;  4YVQ C;  3DEO A;  3D9O A;  4UQY A;  5LCW J;  2ION A;  5FWQ A;  3ABM E;  3CHR A;  4AXH A;  3LJN A;  5EN5 D;  3CVN A;  2EIN E;  1QZ2 A;  2X6H A;  2A5E A;  3CGH A;  1DCE A;  1EDU A;  3ULY A;  3ML8 A;  5LP0 A;  2YHC A;  4TXR A;  5FQ8 A;  5EYL A;  5DBK A;  1FVF A;  3ZU7 B;  3J5Q B;  2DZN A;  3KEZ A;  3TWT A;  4AY6 A;  3AS4 A;  3BG1 B;  3FU0 A;  4H7Y A;  1HS6 A;  5KJL A;  3KEA A;  4A3T A;  3LPZ A;  4J8F A;  4APF A;  2L0T B;  3L13 A;  1BI8 B;  3ZN3 A;  2IJG X;  2WXG A;  2WXK A;  4ACL A;  3OAW A;  3ONK A;  3ASD A;  1AWC B;  1A17 A;  4U8Y D;  4UQZ A;  3DEP A;  2CHZ A;  2ETC A;  2X6I A;  1JWF A;  4AJW A;  4OAV B;  3DSU A;  2HE0 A;  5FIN A;  2YQ8 A;  3ZYK A;  3AG2 E;  3FEY A;  2VSN A;  5G04 C;  2XZT G;  4WAF A;  4EZK A;  2JAB A;  1K3Z D;  5FZQ A;  4U7E B;  1DCQ A;  2P9I G;  2XEN A;  4I1M A;  4I2W A;  1ZB1 A;  2E0I A;  4LUN U;  3ZRH A;  4ANW A;  4F6R D;  3S7D A;  1YA0 A;  2BTD A;  1HH8 A;  4WNF A;  2J09 A;  2ZGD A;  3FHE A;  3QDN A;  4JB8 P;  3URZ A;  2XRZ A;  3D9N A;  3C3Q A;  4GPM A;  4URK A;  4K5C A;  5ITZ F;  5EYP F;  1SVX A;  3D9P A;  1FT1 A;  4GYY A;  4IN3 B;  1U3C A;  4KMO A;  1BD8 A;  4D10 C;  2ZGG A;  2X6F A;  2R5S A;  4PS7 A;  4FJZ A;  3QWP A;  3PEU B;  1O1S A;  4BX9 A;  2ILR A;  3RJV A;  3E32 A;  2P9L G;  3LXU X;  5T4Y A;  2OOE A;  4LNG A;  1OCZ E;  1PC2 A;  4DX6 D;  3B7T A;  4BES A;  2ZIR A;  2VSX E;  4FU3 A;  3R7R A;  4DJA A;  2MYO A;  3FH7 A;  4HI9 A;  3LVQ E;  2XCC A;  5EIL A;  4ATG A;  2Q7F A;  3BQO A;  4F3V A;  3FUD A;  4JVS A;  3D9K A;  3BG0 B;  3SZ7 A;  4DI4 A;  4R7L A;  4IUL A;  3KAE A;  4HOR A;  4L9P A;  1H6O A;  4AIF A;  4L2L A;  2H6G A;  4K0R A;  4XEI G;  4PH4 B;  4CRW A;  3OXL A;  3RK6 A;  3V2O A;  3TWR A;  5BW8 C;  1MX4 A;  1HG2 A;  3ASH A;  4N39 A;  3CQC B;  4C9B B;  3DRA A;  3IHV A;  3OXG A;  2AVP A;  1S0P A;  2LNI A;  3K9I A;  2R2L A;  3JXJ A;  3UKU G;  4ILG A;  3UI2 A;  2V4L A;  4G24 A;  4EPZ A;  4HXI A;  4GMR A;  5ENS D;  4U0Z A;  1W3B A;  3FUE A;  4DLQ A;  4B8C B;  4FC8 A;  5LCW C;  2UY1 A;  1OWL A;  4CCA A;  1LTX A;  2YIN A;  1OWP A;  2L6B A;  2NXP A;  3QK0 A;  1PAQ A;  3B7S A;  2IO2 C;  2ZIS A;  3G2T A;  4U95 D;  2XGO A;  4O1O A;  4ACK A;  3VLF A;  4O60 A;  3CHO A;  4JA7 A;  3B7B A;  1KPS B;  3KSQ A;  3OTN A;  3G2S A;  4G2V A;  1N0R A;  3L22 A;  3L9T A;  1KLX A;  2X6J A;  4APO A;  2WXI A;  3HXB A;  1JCS A;  1Z5S C;  2GRQ B;  3UIO C;  1UN8 A;  4U8H A;  4WWO A;  1WG0 A;  2NC9 A;  3MKQ A;  1FCH A;  4RVB A;  5AAR A;  5FQ7 A;  4Q96 A;  4QFV A;  1S70 B;  2WVI A;  3Q15 A;  2P58 C;  2GRL A;  3CK9 A;  2UY1 B;  2H6H A;  4LRZ A;  2VQ2 A;  4JW1 A;  4N3C A;  3QAR A;  5CHE E;  3ZUV B;  5HQ8 A;  4WNE A;  4HLL A;  1XGW A;  3P1U A;  2FUL A;  2RFM A;  4A1S A;  3QAQ A;  4GTR A;  3SNX A;  3QJZ A;  5EX0 A;  5ANL A;  5JJT A;  1HX8 A;  1WY6 A;  1E8X A;  1IHG A;  3PNL B;  2P9P G;  4PDX A;  1V55 E;  4CDM A;  5BV0 A;  3MKQ B;  3U4T A;  1YMP A;  4GYW A;  1D8E A;  1K8K G;  4PS3 A;  3AJI A;  4J0U A;  3L54 A;  1O1T A;  3L17 A;  5EDS A;  3G2V A;  4G8L A;  3D9M A;  4KBQ A;  3Q7A A;  2J9Q A;  1UW4 B;  3ZYL A;  3B13 A;  3O48 A;  4PUC A;  3VTX A;  3LY8 A;  1Y8M A;  5FQ4 A;  4FHK A;  3TXN A;  4C48 B;  4GZD A;  3R7Q A;  2F37 A;  4GTS A;  4C0M A;  2X6K A;  1JUQ A;  3I4G A;  5CEA A;  4N3A A;  4YND A;  3RRM B;  3ZXP A;  2EIL E;  3CLJ A;  2XHE A;  4N2Q A;  1N9A A;  5KWD A;  1IYG A;  3EUV A;  2DYR E;  4DI3 A;  1E8W A;  4JEU A;  3ENE A;  5CBN A;  2XPI A;  4OVU A;  3FWV A;  5EX3 A;  3MZL B;  3TWX A;  1OWO A;  3QWW A;  4O6F A;  3RAU A;  2QFC A;  1H6K A;  1NP7 A;  3PUK A;  2WXF A;  5AN8 A;  2JEK A;  2DCP A;  4RG6 A;  4Z68 A;  3MGB A;  4DX1 A;  4QQI A;  2R17 C;  2LO6 A;  2WXL A;  3G2W A;  4AM9 A;  1IKN D;  4HQD A;  1YCS B;  3F6Q A;  2MRI A;  1E90 A;  2H6I A;  4GA1 A;  2KBX A;  2PM6 A;  4JPS A;  1BI7 B;  3MX3 A;  3ZFW A;  4HOU A;  4XIF A;  3TGO A;  3ASN E;  4RG9 A;  1QQE A;  2LSV A;  4KVO A;  3CEQ A;  1SQM A;  2IO3 C;  2ZXW E;  3IXE A;  4XE0 A;  3E30 A;  1NI1 A;  1S64 A;  3B7U X;  3UT4 A;  2V0P A;  2VSY A;  4FLB A;  1HZ4 A;  1PY1 A;  3HXE A;  3MKR A;  1QYM A;  2MHK A;  4LSZ E;  3NOG D;  4CT0 A;  4BSX A;  3D9L A;  3FY4 A;  4N5Q A;  2DZO A;  1DNP A;  4L7T A;  5AJL A;  2IU1 A;  4B89 A;  1EPU A;  5AIJ A;  3UT8 A;  3APD A;  1TEZ A;  2BED A;  4XI0 A;  4U96 D;  2CG2 A;  4UI9 K;  3UQ3 A;  5B1B E;  4LER A;  3ZEF A;  4I43 A;  3CHM A;  4A1G A;  3RRN B;  3W9G A;  2GGF A;  3TWS A;  2EQX A;  2VJ8 A;  3VTY A;  4MRU A;  2DWZ A;  3CVU A;  3DSW A;  3FTX A;  2Y3A A;  2XEE A;  4BEP A;  3U66 A;  5KJN A;  2I9C A;  4OYS A;  3PZ3 A;  3Q47 B;  2MOW A;  4ANU A;  4EQF A;  3PZ4 A;  2VGX B;  3FH5 A;  2GRN B;  1U2V G;  4HOQ A;  4MBG A;  1S63 A;  5C2Y A;  2E2E A;  2IOL A;  2P9S G;  4XKB A;  3ZYM A;  3RSE G;  2AW6 A;  3FFL A;  3ZNG A;  5ARG A;  3ONL A;  3NB2 A;  2AXV A;  5BT1 A;  4J7W A;  3UX4 A;  4G11 A;  2GW1 A;  4EBA G;  1VDY A;  3EHQ A;  2PM7 A;  4JXT A;  4GML A;  3CVY A;  2WMN A;  3B95 A;  3L6A A;  4GTT A;  3ULE G;  1HO8 A;  3RO3 A;  1TNB A;  5FT9 A;  2GRR B;  2V5F A;  4AY5 A;  4Q94 A;  4G1T A;  3D9J A;  4GYO A;  1XNF A;  4I6E A;  2B6C A;  4Q69 A;  5BXO A;  1ZU2 A;  4G26 A;  2DYS E;  4KT6 B;  3QC1 A;  4I17 A;  2IQC A;  1OY3 D;  1TNO A;  1E7V A;  4I6G A;  2F0Y A;  3LS8 A;  1TN6 A;  1UN9 A;  4HBD A;  2QZA A;  3EIQ C;  4GB9 A;  3DSS A;  2AWI A;  3L16 A;  4HI8 A;  2B0O E;  2F8Y A;  2UWJ G;  3J5P A;  1TJF A;  3HG0 D;  3WXX A;  1OUV A;  3T5V A;  1N4R A;  1N52 A;  1N94 A;  2OND A;  2KAT A;  2XQ0 A;  4UQX A;  3ESK A;  4CYM D;  4W9R A;  4BET A;  1X5B A;  4L23 A;  5E75 A;  1A5E A;  1IQR A;  3PE3 A;  5AJD A;  1TYQ G;  4UWG A;  3HXD A;  1WM5 A;  2DVW A;  4GA0 A;  3UT7 A;  3FP3 A;  3OXF A;  3SFX A;  3SFY A;  3VLD A;  2VGE A;  3IEG A;  2RD0 A;  2KCK A;  4IRU A;  4TUU A;  4G23 A;  3X2Q E;  2Y69 E;  4GTV A;  4MKT A;  1JPL A;  3FTS A;  2FEZ A;  4B8A A;  1G3N B;  4KVM A;  3Q79 A;  2KC7 A;  3CVW A;  2IF4 A;  4HVB A;  3HDX A;  3BUA A;  4BY6 A;  3C5R A;  3U3W A;  1L5J A;  2KCL A;  2NSZ A;  5D0O D; 
#chains in the Genus database with same CATH homology
 1WDY A;  3J5P A;  5ENT D;  2L6B A;  2KBX A;  2ZGG A;  5CBO A;  3T9K A;  1D9S A;  4ZHB A;  1K1B A;  3HG0 D;  1BI7 B;  4G8L A;  4U8V D;  1BI8 B;  1UOH A;  2BKK B;  1IXV A;  3HRA A;  3TWW A;  4U95 D;  2XEH A;  4HRM B;  4O1O A;  1MYO A;  2XZD G;  3Q9N C;  5CEC B;  2RFA A;  5KNG A;  5KNH D;  5BXU A;  4O60 A;  1SW6 A;  2ETA A;  4HNA D;  5CER B;  2V5Q C;  3B7B A;  1AWC B;  3EU9 A;  1MJ0 A;  4U8Y D;  1N0R A;  2BKG A;  3DEP A;  3TWV A;  4HRN A;  4CYM D;  4DX5 D;  5JMN D;  4C48 B;  4TUM A;  2ETC A;  4BET A;  4YDY A;  4DX6 D;  3IXE A;  2F37 A;  5FIO A;  4DX2 A;  1K1A A;  3ZNG A;  5CEA A;  4OAV B;  4BES A;  4RLY A;  4K5B A;  4B93 B;  2HE0 A;  2Y1L E;  5FIN A;  4UUC A;  4NIK A;  5D66 A;  1MX2 A;  1N11 A;  4J7W A;  1A5E A;  4F1P A;  2MYO A;  4HI9 A;  2NYJ A;  3V2X A;  5KWD A;  1MX6 A;  1OT8 A;  1QYM A;  1DC2 A;  1WG0 A;  4LSZ E;  3NOG D;  5CED B;  2XZT G;  3EHQ A;  2F8X K;  5EIL A;  5KBA A;  4J8Y A;  4N5Q A;  2DZO A;  2JAB A;  5AAR A;  1NFI E;  3W9F A;  5CBN A;  3TWQ A;  4QFV A;  5ENR D;  4DX7 D;  5JA4 D;  1S70 B;  2KXP C;  2PNN A;  3B95 A;  1K3Z D;  4G8K A;  4YDW A;  4OAU C;  2DVW A;  2Y0B G;  4BSZ B;  1DCQ A;  5EIB E;  4ZFH A;  5ENP D;  2XEN A;  3TWX A;  3D9H A;  3EHR A;  3DEO A;  5EID A;  5AQ7 A;  1AP7 A;  3ZUV B;  4F6R D;  4U96 D;  3LJN A;  3V2O A;  1TR4 A;  3TWR A;  2VGE A;  3NBN B;  5HKP A;  3UXG A;  5BXO A;  2J8S D;  3JXI A;  3Q9U C;  4HLL A;  5EN5 D;  1MX4 A;  3TWU A;  4ATZ D;  1BU9 A;  5HS0 A;  2AJA A;  2RFM A;  2ZGD A;  5AN8 A;  3W9G A;  3JUE A;  2V4H C;  2A5E A;  3V79 K;  1OY3 D;  2P2C P;  4JB8 P;  4K5A B;  1N0Q A;  4LNU D;  4O1P A;  3TWS A;  4A63 B;  4Z68 A;  2FO1 E;  3ZKJ A;  2QYJ A;  1IHB A;  1G3N B;  4HB5 A;  4CZ2 D;  4DX1 A;  4QQI A;  3JXJ A;  5AQA A;  2DWZ A;  4GPM A;  3T8K A;  3V30 A;  4DUI A;  3UI2 A;  3NOC D;  3UTM A;  4HBD A;  2ETB A;  5EYL A;  4K5C A;  1IKN D;  5ITZ F;  1BLX B;  2XEE A;  3AAA C;  4GMR A;  5ENS D;  5EYP F;  3C5R A;  4HQD A;  1YCS B;  4BEP A;  1SVX A;  5ENO D;  4DRX E;  3ZU7 B;  3F6Q A;  2DZN A;  3J5Q B;  4BER A;  5AQ9 A;  3TWT A;  1YYH A;  5AAO A;  3SO8 A;  5ENQ D;  1YMP A;  3V31 A;  4HRL A;  4LG6 A;  4HI8 A;  1BD8 A;  2B0O E;  5HRY A;  2F8Y A;  2QC9 A;  3AJI A;  3KEA A;  5AQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...