1MXGA

Crystal strucutre of a (ca,zn)-dependent alpha-amylase from the hyperthermophilic archaeon pyrococcus woesei in complex with acarbose
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
435
structure length
435
Chain Sequence
AKYLELEEGGVIMQAFYWDVPGGGIWWDHIRSKIPEWYEAGISAIWLPPPSKGMSGGYSMGYDPYDYFDLGEYYQKGTVETRFGSKEELVRLIQTAHAYGIKVIADVVINHRAGGDLEWNPFVGDYTWTDFSKVASGKYTANYLDFHPNELHCCDEGTFGGFPDICHHKEWDQYWLWKSNESYAAYLRSIGFDGWRFDYVKGYGAWVVRDWLNWWGGWAVGEYWDTNVDALLSWAYESGAKVFDFPLYYKMDEAFDNNNIPALVYALQNGQTVVSRDPFKAVTFVANHDTDIIWNKYPAYAFILTYEGQPVIFYRDFEEWLNKDKLINLIWIHDHLAGGSTTIVYYDNDELIFVRNGDSRRPGLITYINLSPNWVGRWVYVPKFAGACIHEYTGNLGGWVDKRVDSSGWVYLEAPPHDPANGYYGYSVWSYCGVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Differential Regulation of a Hyperthermophilic alpha-Amylase with a Novel (Ca,Zn) Two-metal Center by Zinc
pubmed doi rcsb
source organism Pyrococcus woesei
molecule tags Hydrolase
molecule keywords alpha amylase
total genus 160
structure length 435
sequence length 435
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mxgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mxgA01
2ZIDA 3CHFA 4UOZA 1H1NA 1RP8A 2D2OA 2EXOA 5BRPA 2XWDA 4DO5A 3L4ZA 2CITA 4W7UA 4UQEA 3SUWA 3MS8A 4BA0A 1H2JA 3CGTA 1MW1A 1NOFA 1XCXA 1GOQA 3BCFA 4LXFA 2J62A 1J18A 2XFRA 4E4PA 1R8LA 2CXGA 4W7VA 1KR1A 5I78A 1JAKA 1JZ7A 1XYZA 5DFAA 5A6LA 4P8WA 3QHMA 1BYBA 4OJYA 4BQ2A 3CZGA 3EMQA 4W8LA 5DMYA 3IGUA 1KQZA 4AZCA 1HJQA 2XUCA 3GBEA 3WBAA 3WY2A 1CXHA 1SMAA 1DP0A 2WKGA 2ZUMA 2WSPA 3AIVA 5D9NA 3SCSA 4QAWA 1UKOA 1VF8A 5A8QA 1UD6A 1UD4A 1HXJA 5A3HA 1EDTA 2VO5A 4TXEA 3CZ8A 1TA3B 4LGXA 2XHYA 2PI6A 4PEEA 2PWDA 1E0VA 3PN8A 4JCMA 3ARYA 2WVUA 3QR3A 4AIUA 3ZJ6A 1OINA 2V5CA 1GVIA 1VEOA 5FCZA 2O92A 3VU2A 4GXPA 3CZNA 1D3CA 1C7SA 5EB8A 4B3KA 1IV8A 2WMFA 2E8ZA 1JFXA 5E6ZA 1G01A 4MB1A 1UD3A 2WZIA 2XIIA 4DUVA 1OT1A 3WL0A 2XN1A 3K4AA 2GK1B 3TONA 1HL9A 2EJ1A 2X8RA 3RCNA 2CEQA 1V3JA 1JZ6A 1TQWA 3LPGA 2ZX6A 4FLSA 2WPGA 1G5AA 3PZNA 3VIKA 2CESA 1ZBKA 1UQZA 2DSWA 2VI0A 1ZBVA 1EHAA 3I3BA 4EE9A 1JDDA 4Z2KA 2V3EA 2J74A 4HU0A 3WQ4A 3VGBA 4W5ZA 3DYMA 2O9PA 4X0NA 3MMUA 1XD1A 2OLHA 3FN9A 3L4WA 8CGTA 4DWSB 4D6JA 4AD3A 2XM1A 2FGZA 4WJXA 1C90A 2VCBA 1JZ3A 2JE8A 3FNDA 1B30A 4D1JA 3AIUA 4FK9A 2VQUA 1R46A 4GI8A 4DWSC 3AMGA 2VR4A 2X09A 4D6IA 3EYPA 1WNOA 1CIUA 1JF5A 1W9PA 3LPOA 2PB1A 2DT1A 1VEMA 3AOFA 3LPPA 3U5UA 1SR0A 1CGXA 1WO2A 5CXPA 2W63A 4Z2JA 4PTXA 3LPFA 3UG3A 1CXLA 2YA1A 2WMHA 3T08A 3AYRA 4AD4A 4J7RA 1HJSA 2WMKA 2A3BA 1VFOA 1LL4A 3N04A 1ZB5A 1B0IA 3IJ9A 5E0CA 2DSVA 3F5KA 3VD4A 3VIMA 1E5JA 1UYQA 1B90A 2FGLA 5FL1A 1T0OA 4RE4A 3RJYA 4BF7A 3WDQA 4D1IA 2YJQA 4HMCA 1OSEA 3WMCA 3OB8A 1BG9A 3WF3A 4H04A 2G41A 4JKMA 4U33A 1QBBA 4XUYA 1GZJA 3L4UA 3F4VA 5CG0A 2JIEA 5JIWA 2GJXA 1UD8A 5FKYA 4AYSA 1HJVA 3OGVA 1CNVA 4Z2GA 1ITXA 2VNCA 1E6PA 4JHZA 4D71A 2WHMA 4N42A 3RDKA 1KBBA 3L4XA 3GTNA 2UY5A 5E70A 2WWCA 1O7DC 1MQRA 1NP0A 4OUEA 3ZIZA 4HMDA 3SUSA 2GK1A 1HT6A 2F2HA 4J3WA 4AYGA 2CPUA 1QNPA 1GCYA 1US2A 5AYBA 1IT0A 1UR9A 4GPNA 1I1XA 3BAWA 2ZXAA 3T2QA 3W29A 1E0WA 4AMWA 2OYLA 3MMDA 2XYLA 3B9EA 2WMIB 1RP9A 2WMIA 1GORA 2D73A 3EJSA 1V3MA 3PTMA 1R87A 4U5IA 1UUQA 4W85A 3U7VA 5I23A 3FXYA 1UR0A 4WKHA 3GXFA 1LF1A 2A3AA 1WZMA 1DWGM 4HMEA 1HL8A 1ODZA 4AZ5A 5A6SA 2ZUTA 1UR2A 4PCTA 4C7DA 4HTYA 5A1AA 3DX4A 3AICA 2EPLX 4UR9A 2ZX8A 4D6HA 1Q6CA 3WMSA 1ISXA 3BXWA 3W81A 1FOBA 1F4HA 4PCSA 1CBGA 3DX1A 4FLRA 2Y8KA 2G3MA 4JFUA 2DH3A 2XFYA 2ZX5A 4JZ5A 1BAGA 3VMPA 1R7OA 2QMJA 3VGFA 4MNJA 1UG6A 2F7RA 4A3HA 3WNLA 1ISVA 1G94A 3GXPA 1QVBA 2X2HA 2WC4A 3WH9A 1A47A 2EPMX 2WHJA 5BWFA 4AZ7A 3VX1A 1D2KA 1KGUA 3GYCA 1CXKA 3VM7A 1EDGA 3CZSA 1E1EA 1BG4A 1G1YA 1C8QA 2WBKA 4LPCA 1R47A 5IXEA 4P7LA 4ZE5A 3WH6A 2BY3A 1LJYA 3N17A 1HKKA 3PHAA 1H0IA 3PTKA 4NI3A 1FH9A 2DSKA 1DTUA 4CN6A 1JD9A 1E43A 3CPUA 1CXEA 4CU7A 3WKZA 3CHDA 1FHDA 2PF0A 3OZPA 2C8NA 3DHUA 5HOSA 6A3HA 1QX1A 3W25A 5BCAA 3QHNA 2MANA 3VIIA 5FIPA 1KB3A 1V02A 4ATDA 4CD7A 1FFRA 1HJXA 3WELA 1BF2A 2YDSA 4A4AA 1BYDA 1TQVA 2YLAA 5BYWA 4CGTA 2ZUWA 5LA1A 1J0YA 1NH6A 1ISZA 3GDBA 1HKJA 5FOOA 2XN0A 3SCUA 3GXIA 2XVGA 4TVUA 1UWIA 2YDQA 3APGA 1CLVA 2CBIA 1ISYA 3T2OA 1LLOA 1BVZA 1OM0A 2WXDM 3BUQA 5CGTA 2BY0A 2DDXA 3CHEA 1P6WA 3HG5A 3NCOA 5D4YA 2XSBA 3EMZA 3BLKA 1HJWA 4WKFA 3SIMA 1EOKA 2TAAA 3WENA 2WC7A 5DO8A 3AYSA 4MPKA 4PTMA 3IAQA 4UCFA 1DWAM 5HBFA 3MKKA 3AQUA 4QCFA 1OGBA 5D8WA 2XGBA 3LX9A 2EABA 1NWSA 3VVGA 2VZVA 3AIQA 5A6KA 4KRUA 3N9KA 1D7FA 2EO7A 1W1YA 2E9MA 1E6ZA 2C0HA 1MYRA 1QWNA 1W32A 3UESA 3FW6A 3WD2A 4HOZA 3PZTA 3BVTA 3WL1A 4KMQA 1WCGA 3FY1A 3WEZA 3BUDA 3PBGA 3W28A 2G3JA 3M7SA 3CUJA 3ZOAA 1UH3A 3DDGA 1UH4A 4B15A 1HX0A 4UQBA 1JZ4A 2XPKA 1C7TA 3AS2A 3AHVA 5FL0A 3VIHA 4U2YA 4DO6A 1E6QM 1GJUA 1KTCA 1JFHA 4MAZA 2HISA 5BXTA 5HXMA 2X1IA 1WZKA 5KZ6A 1B3ZA 3WF1A 5A6JA 2WANA 1DHKA 3UG5A 2EPNA 4GZEA 4EK7A 2CERA 3VGHA 3GXTA 2WCAA 3MUZ1 3CUHA 4HU8A 1CYGA 4PYSA 1QHPA 3POCA 4AXNA 3CLWA 2ZXQA 3KWXA 2W92A 3ARTA 5A2CA 4QFUA 3BVXA 2F7OA 1W2PA 3BH4A 4U2ZA 3VO0A 4M1RA 4ZXOA 1E0XA 1UKPA 2QV4A 3A6OA 1UA7A 4GO8A 2WZEA 1DWJM 1M53A 1WE5A 3PZIA 3OLEA 4RE2A 5KEZA 3BUPA 3MU7A 3WSUA 2VX6A 4FNUA 3OG2A 2J25A 1PX4A 2QPUA 4PMOA 4AW7A 3BAKA 3HU7A 1L0PA 2IXUA 4JFTA 5CPQA 2G3NA 1QHOA 3NDYA 2BVDA 1ESWA 1GPFA 2XVNA 1GQJA 1LG1A 1H41A 3K8MA 3TOPA 2OW6A 4BCEA 2WYSA 3PZGA 1V6VA 5A6BD 3WEMA 3F5LA 1HP5A 2QPSA 1HNYA 1BYAA 4ATLA 1KXHA 4K68A 4CN4A 2D0FA 7TAAA 1MFVA 3ZSSA 4KH2A 4TUFA 2VRQA 1EH9A 1NARA 4E8DA 4KRTA 3IAPA 3KLLA 1E4LA 1B2YA 2Y8VA 3KZSA 1R86A 1JAEA 1JZ2A 5CSUA 5I79A 4ACZA 2ESCA 2J75A 2GJPA 1NWTA 1EXPA 2J8GA 4F9JA 3UERA 1HN1A 1R33A 3PTQA 5AC5A 3CMGA 3OA5A 3WFZA 1E6NA 1Z32X 3VD5A 1V0NA 5A2BA 2ZWZA 3SUVA 4H2CA 1IZKA 2YL6A 2X2JA 1VIWA 3FHAA 5IHSA 4JCLA 2DT0A 1H11A 4QCEA 5C70A 2FHFA 4F9DA 4D72A 3BSGA 3WFLA 3ARQA 4ML4A 1C3FA 4NXSA 5LA0A 4JIEA 3PZ9A 3OZOA 2WVVB 1JGIA 3ZT5A 4AMXA 3EDEA 1UR1A 4MNMA 4CCEA 4BZYA 2BV9A 3L2LA 2WMJA 4P7OA 3VPLA 1QBAA 2VL4A 4YN5A 5I2UA 2ZOXA 3WQVA 1NWRA 2ZX7A 4DWSA 2G3IA 3CZEA 3VMNA 5A6AA 1CGWA 2O9TA 1ECEA 3DC0A 2EPOA 5DEZA 5ABEA 4CUCA 5DT7A 1TCMA 3KE0A 1TVPA 4P7NA 4UOQA 1TUXA 1HVXA 3ZSTA 3WY1A 2JF7A 5I5RA 5D9OA 5FD0A 2W66A 5E1QA 2PBGA 2OYMA 3A23A 3SURA 2D23A 2DT2A 4LQ1A 1NWUA 2BHZA 4ACYA 4PMZA 4HPGA 1UWSA 1RH9A 1GUVA 3RJXA 1K9FA 3BLBA 2OWXA 1LQ0A 2X0HA 2C7FA 4B9YA 3WNNA 3ZO9A 4M56A 3TTSA 4PSRA 2A3HA 1CTNA 3D4YA 1UWUA 3DX0A 3ZT7A 2F18A 1KWKA 1KQYA 4Y7EA 2YFNA 5GNXA 4ZEPA 4MB5A 3W37A 1UZ4A 4ZFMA 3GNRA 3QOKA 2WCGA 3RM4A 2BVTA 4AZGA 2Y5EA 2F7PA 2ZUSA 5ABHA 5CPSA 4UZUA 4W8AA 3AXHA 1KGXA 2J7BA 1Y7VA 3CHCA 3WF4A 1GVYA 3SCVA 2WB5A 1A3HA 2D0GA 4W7WA 3N11A 3T0DA 3K8LA 2CBJA 2FHCA 2VZSA 4UZSA 1BFNA 4CN1A 2WBGA 5EFDA 3WQWA 3ARSA 1TQTA 2FE0A 3WDJA 1WZAA 1GOIA 4DUWA 2UWFA 1EDQA 1W1VA 2JEPA 4NSBA 3RO8A 4M8UA 1BHGA 4OKDA 2WHKA 2F61A 1V0LA 1WZLA 5A8MA 2G4FA 3SCRA 5A6BA 3LXCA 3THCA 3GXDA 4GKLA 4CVWA 1KWGA 2D3LA 4XZWA 1MW3A 5ABFB 2E9LA 2XWEA 5HPOA 5M5DA 2OWWA 5M03A 5HPCA 1H4PA 2ZXBA 1PX3A 2XVPA 4HZ7A 4DO4A 5A8NA 4WK9A 3EBVA 3A21A 5F7UA 2IGTA 1LWJA 1MW0A 1PJ9A 1QOXA 2WW5A 3D51A 1MVYA 3SCTA 3S2CA 1E4NA 2AAAA 3S5ZA 4J3SA 3BAIA 1VBUA 2YLLA 5A69A 1S46A 2ZWYA 3FAXA 1V03A 1EHNA 4PMVA 3ARRA 1TFVA 2XN2A 1TQSA 2J78A 1H49A 2W61A 1UKTA 3CC1A 3MUY1 3HG3A 4QDMA 1HXKA 4YHEA 2WZHA 1HWWA 2WK2A 3DX3A 2GVYA 2XIBA 1VAHA 2CETA 4H41A 1EO5A 2EADA 2WM0A 3VIGA 4PUDA 2QMKA 3K8KA 1RD6A 1JXJA 2O9RA 3E1F1 3IANA 4UFLA 4UTFA 3ARVA 2FH8A 1JYWA 3SUUA 1E3XA 1XYFA 4PMNA 2VRKA 3WIJA 1E72M 2EBNA 1J0JA 1SFSA 2D24A 4F79A 3CZKA 3A5VA 5E0FA 4ACZB 1WP6A 3DYPA 4JHOA 4AEFA 1X1NA 2AMGA 1OT2A 4AD1A 2GFTA 2PWGA 2E0PA 1EO7A 1FFQA 5AC4A 3MO4A 3EDFA 5BXPA 1J9YA 4AC1X 2JALA 1FP9A 5A8PA 2CIPA 1NQ6A 3PZMA 2VT0A 2WKLA 3AZSA 4PTVA 5TD4A 4MNLA 1ITCA 2J7GA 4RE3A 2RGLA 9CGTA 3EDDA 1XSKA 3QOMA 4TX6A 8A3HA 3LMYA 1QI2A 2GUYA 2QF8A 3DX2A 1OBAA 4TOQA 1WAWA 4OOZA 1JDAA 1CGVA 1JI2A 3J7HA 4AD0A 4IPNB 3IK2A 2VX5A 3B8SA 3VOCA 2W67A 2J4GA 3W0KA 1QHZA 2VTFA 4HZ6A 1QW8A 3SCQA 4WSKA 1V3KA 2EPKX 3HN3A 4ZENA 2PWHA 2ALWA 1E55A 1CGYA 3GXNA 2VR5A 3GNPA 5D9PA 5DT5A 4W89A 1UQYA 1V6YA 4H7VA 2DSZA 1C8XA 2G8ZA 6CGTA 5M3WA 3AFBA 5GNZA 3T09A 3H54A 1GQIA 3F5JA 4D6DA 1H0GA 4AIEA 2YFOA 1OCQA 3U7BA 3UG4A 3CBWA 1LWHA 4NXKA 2EQDA 1GW1A 2WCSA 4XB3A 3DDFA 4B9ZA 1OIMA 4PMUA 3TTQA 2A3EA 1E4IA 1UASA 1W3JA 3GBDA 1X6LA 1KGWA 5IFPA 4BQ5A 4W86A 2XJ7A 4JFVA 4CVUA 4FLOA 1EIBA 3W38A 1CXIA 2A3CA 2BFGA 1KXQA 3A4WA 3VDHA 3OLGA 1AVAA 3WNOA 1J10A 2X05A 2WWDA 1TMQA 3D4ZA 7A3HA 1JZ8A 2BY1A 1BGAA 4URIA 1UR4A 4QLKA 3AHYA 4PUEA 1V3HA 4JKKA 4WF7A 3PZUA 3AMLA 1OD8A 1KCKA 1K9EA 5LA2A 1XC6A 4L4PA 1BYCA 1BGGA 4GIAA 3CUIA 1K6AA 3CUFA 3O9NA 4W88A 4X0VA 5I77A 1E56A 1SMDA 4X9YA 3BVWA 3GH7A 4LYPA 4B16A 1TZ7A 2OYKA 2VUYA 3MI6A 1H09A 1E6XM 2V5DA 2Z1KA 4BQ4A 1TG7A 1YHTA 1J0HA 4AMCA 4XZBA 2BNJA 1M03A 1DWFM 2VC9A 3AIWA 4PTWA 1W3LA 1YQ2A 3BAJA 1W3KA 3W4RA 5BXRA 4C7GA 1E9LA 4RL3A 3W53A 2DSUA 3W26A 3UETA 1MXGA 3ARWA 1Q4NX 5D8ZA 3VGDA 2FH6A 2CKSA 2WC3A 3AS1A 3AHXA 4HOXA 3AISA 3WH5A 1BPLB 1QNQA 1M04A 2E40A 1CPUA 2VOTA 4MJ2A 4CU6A 1WKYA 1VENA 2X2YA 4S3KA 4CD8A 4Q22A 2F7QA 4D6GA 2CYGA 3AMCA 4UQ9A 4JL1A 4M82A 2F8QA 2IUZA 2W62A 1K9DA 2E8YA 5CSYA 3I3DA 1GOWA 2DEPA 1QI5A 3O2LA 3I3EA 3WBEA 2PBOA 3FAWA 1BVNP 1V0KA 1FH8A 1GHRA 3VGGA 1B9ZA 5A8OA 1O6IA 1VB9A 3THDA 3KL5A 3GXMA 4EANA 1BQCA 1NOUA 1VFFA 1UOKA 4HP5A 1TR1A 2XM2A 2XSAA 2J47A 3CV5A 4UFKA 3N18A 2VX4A 5ABGA 1AQHA 1V6UA 2VZOA 2GJRA 3CMJA 2D3NA 1QNSA 2J79A 4HA4A 2JFEX 3A4AA 5BXSA 2B31A 3ZJ7A 4UNIA 3W27A 2WAGA 5CPTA 4TTUA 1US3A 3VD3A 1N82A 2VVSA 3AHTA 1QI3A 1PIGA 2YDRA 3W24A 3ZMRA 1C93A 6TAAA 1GOKA 4W87A 4AY1A 3MANA 2CHOA 1J0KA 1R7AA 4M81A 4BQ3A 1G9HA 1NP2A 4W84A 1BSIA 3T0BA 2VURA 4V27A 1HKIA 3IJ8A 4WLCA 1VJZA 2Z1SA 3GM8A 1V02E 3LXAA 5HDRA 4Q7NA 2VZTA 2VCCA 4BS0A 3A22A 1JI1A 4U31A 3WQ5A 3WUGA 2J7HA 4MNKA 1XH0A 2CBVA 1J11A 1WB0A 3AXXA 2VZUA 3VSUA 4R27A 1C92A 2WVVA 2BHYA 1UKQA 3AIBA 3NJ3A 3VINA 1B1YA 1WPCA 4OIFA 4B3LA 3SCOA 5GQBA 3G6LA 4ZXLA 1CGUA 1V08A 3VIFA 3WDPP 3A24A 4PMRA 2FDMA 4AZBA 3NSNA 1W9DM 4HPHA 4UQAA 1OD0A 3BLPX 3VILA 2ZE0A 1WDQA 1W9UA 2RGMA 2E4TA 3H55A 4NZCA 2QHAA 4P8VA 2BXYA 2CKRA 1FA2A 3LRMA 1W9XA 3RM9A 1J0IA 4AZCB 5EBAA 3VNYA 2V3DA 5I6SA 4L4OA 4M29A 2WVTA 4EAMA 3MSDA 2ZUUA 1I75A 1VRXA 2JF6A 4W93A 3ALFA 4EKJA 2YKKA 4U3CA 4IUGA 3VDAA 2DIJA 5AY7A 3M07A 1E5NA 5JBFA 3CUGA 2VCAA 3WMBA 3WNMA 4W8BA 5DF0A 2GJXB 1CDGA 1DEDA 5LYRA 1C8YA 1B3YA 3EMCA 1OWQA 1W9BM 4JKLA 4LX4A 3WD0A 3WY3A 1VJSA 3A3HA 5I0DA 3ZT6A 4OGZA 3QGVA 4NX0A 3K4DA 2VX7A 4MB4A 3TA9A 3D5HA 3MUIA 5I3DA 1W2VA 2WLYA 3EJQA 3GZAA 1VBRA 1UR8A 1QNRA 2E3ZA 1XSIA 4MAVA 1E15A 4M80A 2VMFA 2DPEA 2DQXA 3ARPA 3DECA 4QLJA 3UR7A 1E70M 2DIEA 3HJEA 2PWFA 1AQMA 4UQDA 4H8VA 3K1DA 2CCRA 3RILA 3T0AA 4J28A 1JXKA 1GQLA 3W82A 3WNPA 5BRQA 1QPKA 3AIEA 3BCDA 3AZRA 1WDSA 1TVNA 3RM8A 1CLXA 3RMEA 2YBTA 3PZOA 4CD4A 4IPLA 5GPRA 3ZJKA 4FMVA 4QLLA 2WHLA 1E40A 1H5VA 3N13A 5JBDA 1UA3A 5ABFA 1FHLA 1DWHM 1LG2A 3VDCA 4FLQA 2GDVA 3ZJ8A 3U5YA 2D1ZA 3S5YA 3AZTA 3AHZA 1OGGA 1NM9A 2XGIA 3VIJA 3ECQA 3N12A 3OBAA 1V6XA 4PMYA 3D50A 4TVCA 1V3LA 4FNSA 1TQUA 2JEQA 4S3JA 1JYVA 2UY4A 2WLZA 1J01A 1ZBCA 2W5FA 5D9MA 1ZU8A 1W1TA 1HVQA 3AIRA 5A2AA 3AS3A 4E2OA 4ATWA 4NZFA 2BVYA 3VNZA 2OSXA 1AQ0A 2YA0A 3WNKA 3IJ7A 2DGAA 1HTYA 4CD6A 1FP8A 3W6MA 4JFWA 4CKQA 2CBUA 4WSJA 1LL6A 1U30A 1PEZA 4J27A 1TE1A 3BVVA 4CCCA 1BTCA 1JYXA 4PSPA 4M24A 2FYVA 4OOUA 3VMOA 1I1WA 4D6CA 4FNTA 3H53A 4AWEA 3NIYA 3WQ8A 1CECA 1E6RA 3MMWA 3WUEA 3VIOA 2YIHA 3EDJA 4H8HA 1C91A 3VIPA 3VSVA 2JIWA 1QW9A 2AOSA 3WUFA 4ZE4A 1JF6A 3TTYA 1UH2A 1VFMA 1CZ1A 3BAXA 4V28A 4TX8A 1CXFA 2OWCA 2XVKA 2ZXDA 3WDHA 1VFUA 4AEEA 2J77A 1ZL1A 5EFFA 4GQQA 2VRJA 4MB3A 1WDPA 2F1AA 3WQ6A 1R85A 1JYNA 3CH9A 3WF2A 1DWIM 1H3GA 1PX8A 2UY2A 1ZJBA 3OIHA 1LL7A 3II1A 3K46A 2WNWA 1JZ5A 3WD4A 4DWSD 4J3XA 3VDBA 3ZR6A 1EGZA 4AISA 3AXIA 2DH2A 5IFTA 1GONA 2EEXA 3OLDA 3BVUA 1XRVA 5A95A 3B9AA 1B3XA 1GNXA 4E8CA 5IDIA 3WH7A 3M46A 1KFWA 1JDCA 4UFIA 4FF5A 5HNNA 1MWOA 2UY3A 3LRLA 4DM2A 1G0CA 1KTBA 2ZUVA 3NDZA 3WN6A 2D22A 1M01A 1CGTA 1MQPA 1E6SM 2D20A 5C71A 4P7QA 4HA1A 1ZS2A 3A4XA 1PS3A 3NSMA 3KL0A 2WVSA 4UOJA 4UFMA 1QNOA 5CGMA 1HKMA 1XH1A 2E9BA 3L4YA 4U5KA 4FNPA 3GH5A 4HZ8A 1SYTA 2ZX9A 4KWUA 4JAWA 4C7FA 3B9DA 5BROA 1EQCA 1ZBWA 4XV0A 3EJUA 2CHNA 3S6TA 1UKSA 1JL8A 4PBGA 4JL2A 4WKAA 3CTTA 3ZM8A 1HF6A 4AD2A 1JIBA 3ARXA 4CD5A 3D3AA 1XD0A 4HOWA 4OBSA 2VVNA 2GSJA 4H8UA 1IZJA 4PMXA 1PPIA 4P7RA 1KBKA 5GNYA 3LRKA 3CIVA 3QHOA 4F8XA 1M7XA 2CNCA 2X0YA 3WH8A 1CENA 2IXVA 2W4XA 4J3UA 3KEHA 1XSJA 3OGRA 4A3YA 1ZJAA 2D0HA 1HP4A 1QI0A 4OZOA 4F66A 4Z2HA 1MW2A 2NW0A 5CQ1A 2EACA 3A47A 5EMYA 2XVLA 3AJ7A 3VTRA 2X2IA 2BHUA 1PIFA 5I24A 3JUGA 2OW7A 3NYDA 4OBRA 2YL9A 3KL3A 3BMWA 5E6YA 3WD1A 4GO9A 4D6EA 3WD3A 1B3VA 1QWUA 5A94A 1J12A 1Q6GA 4PMQA 1E3ZA 4J3VA 3BMVA 1V6WA 2VQTA 2J7DA 3L4VA 4AZ6A 4PRWA 1K9TA 1RPKA 2VJXA 4YHGA 1BLIA 4GINA 4NF7A 4UQCA 2F1BA 5CLWA 2BXZA 1EA9C 4MJ4A 3DHPA 1JD7A 4V2XA 5JBEA 3NSXA 4U3AA 3BGAA 3VX0A 3FHQA 1U2YA 1Q6DA 2WMGA 1JG9A 4MDOA 3MV01 2WSKA 1XHGA 2J7FA 1EOMA 3UEQA 2YA2A 4Z2LA 4WIWA 1UWTA 3UR8A 3HG4A 1SZNA 2YBUA 4DM1A 3OLIA 3GNOA 2OSWA 3WDIA 4TTGA 1F4AA 4GZJA 1TA3A 4UFJA 2NSXA 3TTOA 3SCNA 3EJTA 3T2PA 3O6AA 3W6LA 1QI4A 3UCQA 1AMYA 4IISA 3HMCA 3TP4A 3BC9A 1E71M 2OSYA 1W9VA 1Q6FA 3MSGA 1CEOA 2W91A 1FH7A 4MDPA 4LYRA 1MXDA 5CLTA 2O9OA 1E1FA 2ZUNA 1X6NA 3PZQA 4MADA 2GDUA 2XTKA 3ZQ9A 1XGZA 1GJWA 5E09A 4AIOA 2J7EA 1GQKA 4J3TA 3U57A 5M17A 5AYIA 4NRRA 1GHSA 1PZ2A 4PMDA 2NT0A 3N15A 1XV8A 1XH2A 3ALGA 3AS0A 1R75A 1B3WA 1W1PA 3LXBA 1W3HA 1MQQA 5E9AA 2NT1A 2J8FA 3VM5A 3HG2A 3WDRA 1U33A 3BUIA 3SCPA 2YL5A 3PZVA 2XG9A 3G6MA 5C8BB 3KLKA 3SCWA 2DT3A 3POHA 4P8UA 3VKKA 3CZLA 1MFUA 3D52A 3AROA 5CJ5A 3ARUA 1PBGA 2XFFA 3MV11 5IHRA 4PN2A 4GQRA 4JFSA 4DUXA 1OIFA 2Y2WA 3NUKA 4KGJA 1HIZA 2FHBA 3M6DA 1JNDA 3ARZA 2ZICA 1Q6EA 4TVDA 3L2MA 5JUVA 4KGLA 1PAMA 1ODUA 1V0MA 2BS9A 2J7CA 3VD9A 3BUBA 1GOMA 1OGSA 1L8NA 3GH4A 4YPJA 4NRSA 5A6MA 1E73M 4N0RA 1GOOA 1UWRA 4AD5A 1WDRA 3RPMA 2Y4SA 1O7AA 4HA3A 2V3FA 4UFHA 1JNEA 3SEPA 3VGEA 4IM4A 1ISWA 2YL8A 2PWEA 1UHVA 1HJUA 1OB0A 3AMKA 4XX6A 2V3GA 4AZHA 4GZIA 4CCDA 4R5EA 3MUAA 1UD2A 1NOWA 3WEOA 1R34A 5JIPA 3BSHA 5ECUA 1E4MM 1J0ZA 3TV8A 1UZ1A 4P8XA 3N1AA 2Q8XA 1KXVA 5CZKA 3SUTA 2BY2A 1VEPA 1XCWA 4FNRA 4FNQA 1UWQA 2V38A 3ZR5A 4W5UA 1UD5A 1PZ3A 3L4TA 3VUPA 3EDKA 1CWYA 2HVMA 4LYQA 1B31A 1KXTA 3WUBA 4D6FA 3BAYA 4AZIA 4CU8A 3VD7A 2YOCA 4GI9A 3DYOA 4MTVA 3WF0A 7CGTA 1KR0A 2EAEA 3AMDA 3OGSA 4GI6A 1KCLA 2PC8A 3WY4A 3AI0A 2Y24A 1W91A 4NZJA 3EJRA 3HZ3A 3VSTA 1EQPA 2QLYA 3EJPA 3CZJA 1V3IA 3RIKA 4QP0A 4Z2IA 3CO4A
chains in the Genus database with same CATH superfamily
5DS8B 3U48A 3INOA 4PPTA 1JHKH 4UOZA 1H8OA 1H1NA 1RP8A 2IAMB 3LD5A 3W7MA 3U30B 2ACSA 2WY3B 3UTTB 2PF6A 4UNVA 4PRHD 2XWDA 3SCMD 3L4ZA 3VFVA 4OCNC 4UQEA 1OQFA 4W7UA 3SUWA 4JHAH 2H2PC 4N90E 4G42A 4HEPA 4BA0A 1O5XA 4XBSA 2EUZA 4ODHL 1FORH 4MHHG 4WQ6A 1MH5B 4ZPVA 5IBTL 1QEWA 1I7RA 4BR1A 1CUOA 4IQEA 5GS1C 2A2QT 1XCXA 5F6IB 4PB3A 3BCFA 3W9EA 4DWHA 3FUKA 2OMVA 2H4EA 3LI1A 3VRJA 4N68A 5BUAA 2BB0A 3VNIA 3QCVH 3DKLA 3MV7B 3ZTEA 1J18A 2XFRA 4DVOA 3KWTA 3GYRA 1T0PB 1P6AB 5EWIL 3QULA 5I78A 3AALA 3AU1B 1JAKA 1JZDC 3IFLL 3QORA 4PJXE 5DFAA 1GG1A 4RFNB 3QHMA 1AL7A 1JGMA 1QFUH 4Q8BA 4QSHA 4OJYA 2VH5L 4LL4A 3ULAB 3TQKA 4BQ2A 1UYWH 3BJLA 1W17A 2BO0A 3VPLA 5I09A 2D31B 2QBWA 2V82A 1KCSL 3IGUA 4QLWA 3TA6A 4LDLB 2W9EH 3RUGE 4JGDA 1IAKA 4L1HA 2HT3D 2ERJB 3B7YA 4AZCA 4AQ8A 4PJCA 4O4VA 3GBEA 3GHBH 5KVEH 3GDLA 3WBAA 1RIVH 1I7ZB 2IO5A 4HJ1A 4QF1A 5ITFB 3RA7H 1SMAA 3NPSC 4AT6B 4GXUN 3DENA 5E94A 4O2FA 2PW1B 4XC3L 1AW5A 1QFWM 1XR9A 3KNBB 4QAWA 1UKOA 1VF8A 3SCSA 4O17A 2PPAA 1THFD 1UD4A 1NOLA 4TNGA 3KBMA 2PODA 1EDTA 2VO5A 1JGVH 3CZ8A 3WEAA 2YGPA 2X4TA 3QI9A 4Y2WA 1MF2L 3WTSA 4PJHE 3FFCE 1A3RH 4OFCA 4W9KC 3TJLA 2Y7QB 4MMYB 4UDTA 1QFWL 2OI9B 1ORQA 4QHLB 4ZXBA 3Q9QA 4BEUA 2DIKA 2G9HA 3KPSB 5I5MA 4OV5A 4ATLA 2AZAA 2B59B 1P0SE 1OK4A 5DFTA 1KD0A 1N2VA 4XZHA 4AE0A 1ZPLA 3EJZC 1VEOA 4HCRH 1A2YB 2AF2A 2DQUL 4HS3A 5DC4B 3VYOA 1RR2A 2VDPH 2XI9A 4O1BA 3OMIB 4FQJH 3CZNA 2YD3A 5E7FA 2MH4A 2YEZB 1S5NA 2YEZA 3P40A 3N5AA 2NSMA 3LS5L 2AKRB 3BKYH 3B56A 4TULL 1JFXA 5E6ZA 3PJUA 4I5XA 1U1JA 1OSYA 4QXIA 5EYWA 2BVUA 3V2AR 2OCCB 2XZCH 4C6MA 4MF4A 2OU4A 1ZANL 4MSWA 3NL3A 1OT1A 4GAYA 1MQ8A 4Y16A 3MVTA 1BD2E 4FA6A 1TPXB 4HZAA 3EKZA 2WUCL 2XN1A 3K4AA 4X7SL 1P48A 3FKKA 3LCIA 4NKOA 4JR9L 2R8SH 2GK1B 3TIMA 2NZ9D 4L8DA 1IBGL 5CD3A 2ALAA 4Q8WA 1A7QL 1WBZB 1H63A 3QJSB 2NXYC 3HZMB 3TNNB 2AEIT 2BSEA 2Y7LA 4K07A 3GDKA 3MZ2A 1OVDA 2X8RA 3PABB 2F53A 3COTA 3QQ4A 4ZMLA 1UATA 4O13A 4AF0B 1MMFA 1TZ9A 2ZE3A 3OVQA 4JYDA 3DPBB 2IPKB 5DRZA 2X10A 4X6CE 5C0AE 1JZ6A 3EJYC 3Q48A 4BF9A 1XBRA 1OFQA 3LPGA 4AYFA 2ZX6A 2D7NA 3JWNE 4XBPB 1PKNA 2OO0A 3OQ3B 5HI3D 1U42A 2WPGA 3O6LL 3ZHLA 3EF4A 3R0UA 2GSGB 2INEA 2YSWA 2GC7C 3HS0A 1E1CA 2VR7A 4J5VA 2VI0A 4DFIA 2WLNA 5ILTL 3RAJL 2DM4A 1CU4L 2DYPB 2E67A 3NCJH 3CL6A 4Z2KA 4OB5L 1ZALA 4I4WA 5DFVD 4KFNA 1IGTA 3APFA 3VNLA 1AODA 4XO4A 1WWBX 3QEQD 1E27B 4M62H 4WFHD 3L4WA 5DXXA 4S3FA 2JI1A 1ME7A 4IIEA 5E4AA 3PBYA 8CGTA 3PNZA 4MLSA 4ETQB 2JKXA 1F00I 5EULV 5HVHC 3W86A 4AD3A 4GP8B 3PUCA 3CSTA 3ZL4H 4WJXA 1R17A 2G3XA 3BIBX 3MRQA 4YL2A 2JE8A 1OTUC 3E6HA 5TJWK 2NOYA 4B5TA 2LW3A 2DL9A 4IRJB 3SDCA 2GUOB 4QRRA 2PDCA 3P14A 5T1LA 4FK9A 3ULVC 2IFGA 3D46A 4RX4D 1UB5B 3IU3B 3MJ7A 4LSQL 2X09A 4EE2A 4ODUB 5A3IC 4Q6JA 1WNOA 4DIXA 2PU1A 1CIUA 1JF5A 1WAUA 4J8RA 4PU2A 2DZTA 5D7KD 2MCPL 1BWVA 4MD5B 1YMMD 3CS2A 2ZCLH 3NAVA 3QRFM 5E08L 3IJSA 3MUUA 4AQ1B 1U8CA 3NTYA 4J35A 1IM3A 5J5EA 1K85A 1YX1A 2PZNA 3AOFA 1ZS8A 2HJLA 2ZOLB 4DEWA 1ZS8B 1CGXA 5CXPA 1ET8A 2W63A 1SLUA 5LXGL 3N85H 1UW9A 4U1MB 3ZUCA 1PD0A 2OJ1A 3CH0A 4NJ9L 3MRHA 2YA1A 3EYVB 2WOQA 5EBMA 4GXVH 4BCZA 2Q02A 2ADGA 3TCTA 1MRDL 2Y7NA 2R2EA 2X2UA 4CW1A 2Z24A 1HJSA 1G7LA 2WMKA 3KVMA 2V2DA 3PFQA 5H8MA 4IOTA 3N04A 4OSUH 3PSVA 2Z0BA 3NPVA 4ZW7A 1PDKA 4G9FB 1ZB5A 1TMHA 1A3LL 4KXBA 4X60A 1PDKB 4HJWA 4HUKB 5FJIA 3F5KA 5LAXB 1TZIB 2J66A 4UU9A 1ZA6A 4Q9CA 4YDLC 1E5JA 3GFXA 3VIMA 4PJ6A 1B90A 1GGUA 1BWKA 1QFPA 2C4FT 2CA4A 3P60A 4MLJA 2DTSA 4N8VB 1NCDH 5E6IB 5IMOB 4FYQA 4CQDA 4A29A 2B1HL 5EC1A 5T1DH 5B8CC 4BF7A 3IS1X 2ZYIA 2VERA 3GSUA 3QARA 3ZIYA 2QKIB 1VERA 3KPNA 4X99B 1OSEA 4QOKA 1FHUA 3QIWA 1GEQA 2WSRA 3ABXA 5TNVA 3BEWA 4PCYA 5KN5B 4U6VH 1QBBA 3W11C 5CFHA 2W0KA 1RZJL 4XUYA 3TW7A 3STPA 3W00A 1E5YA 3PGFH 1ZTMA 4QRTA 2CXEA 4MUPA 2JIEA 5D7IA 3CIQA 3MACL 1JVLA 4P4RA 2EC9U 3QQDA 1T1ZA 2GJXA 4G7EA 3U46B 3KWWA 5FKYA 4CNIB 1EEYA 5CCKL 1HQ4B 5ENWB 3MXWL 3SRDA 3IDIA 5HVHB 3F2DA 4KETA 4QJ1A 2FO4A 2FT7A 1CB7B 1NSNL 3T3MB 1ITXA 2HP4A 1OGPA 5IESL 4LVHB 1XGEA 4OECA 2B77A 2FZ8A 2Y7FA 3L6FA 3CV6A 4P9HC 5IG7A 4QOKD 2CLHA 3O0RL 1FCVA 1OAZL 3PF2A 2OS7A 2YB1A 1G1CA 3ARBB 1QVOB 2C26A 2WWCA 3INPA 5I18L 3AITA 1ML0A 4OTXL 2INZA 4WHYG 4ZD3L 4OUEA 3ZIZA 7REQA 4HMDA 3K72A 3UBHA 3NSDA 4YN3A 3U4EB 1RK0A 3M8OL 4WU7A 2JTDA 3RWEB 4BGLA 1I2OA 2F8VA 3CZUB 3QMRA 4L29B 4P5TD 3HPZA 3ITOA 3LLXA 1T6BX 1GCYA 1US2A 1D6VH 4IG2A 1SJHB 3T0EA 1JWMB 4XTRD 4UINL 4F33B 1SQ7A 1FHGA 1NFDF 2R23B 5T33L 3T4WA 1ENUA 3GSNA 5GGVH 2X89A 2ZXAA 3T2QA 2MOQA 3GC3A 3W29A 2AITA 3GD1C 3GAKA 2OYLA 1G7HB 1MCCA 3WLMA 3VFPB 3VXUE 5CAHA 2PD5A 2WXKA 4ZXBC 4CJ0A 3B9EA 3RWGA 3R5EA 4KERA 4FZEL 4XTRC 5H37H 3RWGB 3MWCA 2Q3AA 1I8IA 3GEWB 2DQFB 3GIVB 1BEUA 5EZPA 1KLFA 3QRGL 1RVFL 5K1NA 3NFNB 1M1BA 1V3MA 1XXDC 3PTMA 1VPXA 4NJKA 1NIDA 3RL1B 3IVTA 2BSCA 5G1TA 4MNQA 3BAEL 4JICA 5TTRA 5T3ZE 4W85A 1JPFA 1A5NC 3FXYA 3HQPA 5IREA 5LAPA 1CVSC 4PGCB 3VYPA 4HDIA 1HL8A 4RH4A 2BGQA 3W39B 3E6FA 1LBLA 3AT8A 1OX4B 1FCQA 1DVFC 1A9EB 4YZWA 3IMBA 2YQBA 4WW2A 4ONOA 2UZPA 5F6HI 4PCTA 1M7JA 4PMJA 4QQ3A 2DBLH 1O7DE 1LK2B 1OGAD 1SSDA 3HJZA 4HTYA 5HY9A 2RFGA 3CQPA 4JPSA 3ZJAA 2EPLX 1T5KA 4Z5RB 3TWAA 3FZUC 3GD6A 3EX4A 2AEWA 1LRNA 4HCRA 1Q6CA 3HPSA 1MWAH 5IKCA 3WMSA 2NR6C 3VXQA 3AUVA 3FXGA 4D9PA 1ASPA 4HB7A 3N06B 4F33A 4KV5E 1UFUA 3JS3A 4IP4A 3T6XA 5E6ID 3HRZC 4V2BA 5TBOA 4HCIA 1SU5A 2FEDD 1J1PL 1ZV9A 2XBZA 1GHFL 3APTA 4M5SA 2F08A 1N0LB 1WBXA 2E6DA 1S9KC 1OAKL 3JYBA 3VXUD 1OF6A 3NR0A 3P0XA 4LRSA 4JFUA 1UB6A 1ZVSA 4ZFQA 2MIZA 2ZX5A 1UIOA 3T77B 1Q13A 4JN2A 1AOHA 3QUYB 4YZFE 4QRPA 4OCMC 2L7EA 4ZUWA 3NRQA 5EBGA 3U3HA 3L8QA 2JB5H 3B9VA 3W1TA 1F13A 1Z5YD 4JB9H 1FNHA 2I32A 2PGRA 1UB5A 5GS2D 5K4XA 1G94A 3GXPA 1QVBA 1O66A 4UT6A 2VEIA 4NP4H 1QKZH 3IBOA 3LHUA 4JTGA 1Q3NA 2BOCB 1A47A 1A4CA 4BE6A 1D8WA 4HGWA 2ZYHA 5MI0B 5J4MA 1I2PA 3RB5A 3CVBA 5DJCB 3R13A 2NMSA 1FWIC 1OAYH 2EDJA 1D2KA 3UJEA 4Y4FD 4I0PB 2R2BA 3GYCA 1CXKA 5MF5A 1ORSA 1OG0A 3N1FC 5J3HC 4ZX3A 4IFKB 1TJIH 2LGNA 2VDML 2I5YH 3QJQB 3EXRA 4N86A 1E1EA 2MCMA 4U1NA 1R3IL 4NENB 4U1NB 3BQ6A 4JREB 1A02N 3QORB 2VXQH 6FABH 4LPCA 2DEWX 1MCWW 2QUTA 3A12A 4ERSL 2PW2A 3PDDA 4KW2A 5E2UL 2ICWA 5EU6A 5IXEA 2FQDA 4A7SA 1N0XH 2PYED 3WXVH 4TSCL 5C0FB 3VW3H 5KJRH 2XTJD 2BNQE 2BY3A 4JZNA 4X2RA 4Y90A 2ZUQC 2GC4C 4HT1H 1GIGL 1HKKA 3U30C 4FOJA 4IGNA 2YZ5A 2XZAH 1XG4A 3N40P 4JTCA 4JG0L 4OLYL 3CAFA 2QVTA 2XA8H 1MRFH 5TE7L 5HGDB 2OZ4A 1B3OA 3KYMA 4F0SA 1KPUA 3VXTB 4XXCA 1CR9H 2EEFA 1Z9PA 4F3FA 4WIQA 4CN6A 4Q8PA 3SY0A 3WIJA 5KG9A 1I3GL 2AJ3A 2HX9A 3WBDA 4MJ5B 3BJSA 3OJ2C 4IRJD 4LVHC 1C12B 3HFYA 1DCLA 4S3GA 2PDLA 3F83A 4PB0L 3S96B 3DHUA 1H62A 1IWBA 4E3VA 2VELA 4E4UA 1WFMA 4FXFA 3I2CL 1F4YL 1VJIA 4K3GA 4JEGB 5BCAA 1MLCA 3QHNA 3ABKB 4XPAL 4AYMC 3VIIA 2XWZA 2W65B 3V6OC 4TOYH 1LDSA 1IAIH 1VYSX 4CD7A 2R29H 4CNPA 2P43B 1HJXA 4IOSA 3B3IB 2J8TA 5E2VH 3ULUD 1BF2A 5J6SA 5SWSB 2H9AB 2VXNA 4YDVA 5I8OL 1XIJA 4HLZG 1FNEB 2RCSH 5E9XA 2C9AA 1N55A 6XIAA 5LA1A 1J0YA 1NH6A 4Y5YC 3WLTA 3M45A 2D9CA 4P05A 5FOOA 1HH9B 1A1NB 2XVGA 4TVUA 1N9PA 4M9PA 1U8LA 4BWTA 2R6OA 2HRLA 3OVRA 1P7QA 4PJAE 4CADA 1GSKA 2WKOA 2WWKT 3T2OA 2ADJB 4PLJD 1BVZA 2BM3A 3BGFC 3O3BB 4YDLB 2O5ZH 4OI7A 1H51A 2R14A 1U92A 2WXDM 5GZNA 4DXVA 2DWSA 4HIJA 3UBXG 1NCBL 2D8KA 1UYWL 5L7XH 4XNXL 5ADOH 1OVZA 4HWEL 3HG5A 4OD1H 4H6EA 1NANI 4YDJA 1HAWA 3WLJA 4C5YA 1ZNNA 4YCPA 4HLJA 3TA3A 5D4YA 5I1DA 5I0WA 2B7PA 4F7PB 3TURA 3BLKA 2IMNA 1EFXB 2NQ9A 3VYLA 3LZQA 4Z42C 2TAAA 4MA3A 4ZTPL 3LCWA 4YGVB 4PS4H 3QDMA 4I77L 5DJAB 1CT8A 2VSCA 2V33A 1OSZA 2I17A 4HFUL 3IAQA 4QHNA 5HBFA 1HHKA 4FKKA 3AQUA 3N9RA 4HK6A 4RAVB 1WH0A 3S37L 5HBBA 1JRBA 1JGVL 5KSAA 1M3UA 1MVUA 2CO7B 3P3RA 1AGDA 2EABA 4HISA 3MODL 4N0FB 5FCUH 1NWSA 1QLRB 4G80A 3RO6A 1KCXA 3VVGA 4XP4H 5FEXA 3RDTC 1TMLA 4KRUA 3HAEB 3IGFA 4GRWB 5C6TH 4DGYL 1W1YA 1J05B 2OLAA 3G77A 3WQGA 3KTXA 5SWSA 2H9AA 4HKZB 1K4DB 1QWNA 3TU9A 5C08E 4B9IA 1AH3A 3N43B 2XPGB 4WWID 4P3CL 1HXMB 1FI8C 1XEUA 3JSSA 4N2KA 3ZDXE 3ABRA 4GK8A 3FY1A 3OGCA 3RURA 5LN8A 3WEZA 1JS4A 3ARBA 2V4LA 3D9AH 4XN7A 5I76A 3M7SA 4EI5B 1A7NL 4AYBA 5HHVH 2AQSA 2OMVB 1UH4A 4JY4A 1XCFA 2C3ZA 1U3NA 2BK8A 3CUZA 4RV3A 5ACMA 1X1ZA 2GJZB 4LOEA 2XPKA 3AS2A 1G84A 4TL5A 1JGDA 2XWCA 4K71C 5AL8A 3EB3A 3QZWG 4AWUA 3PAZA 3H6AA 1H5BB 1E6QM 1MCKA 3E80A 4LCSA 4JO2H 3HV8A 1CDHA 4GVIA 5FF7A 5HXMA 2CC0A 1M1XA 1VPOL 4KMTH 1H3XA 2D4DA 2P4AB 3NCCB 4XXWC 4DF0A 3PP4H 4UT9H 1G7HA 1NGWA 3WF1A 5HHMB 4KTDH 3NDYE 5A6JA 3CFIC 4P46B 3C2FA 2WANA 4QHNB 3UG5A 3TVAA 3ZKMC 4N24A 4PGEB 3QJRB 3T2LA 3U2SB 4G72B 5DQJB 3SHSA 3TN0C 4OZHE 5GS0L 2X1OA 3O6YX 1QBLH 3REWA 3BLEA 5EOCL 3O45A 4I0PC 1S8DB 2VDRL 3WG6A 1EGJA 1FWSA 3MLUL 3PB0A 4YR6A 4M7LT 5IR1B 3SYCA 1RCYA 3D69A 3SZ6A 1HJCA 4QGTA 4EMZA 1IQWL 5AUMA 3SBWC 3NJGA 3P3TA 4I3SH 3BW9B 2R82A 2ZXQA 1IXNA 1OALA 2W92A 2ADFH 3OKNA 4N25A 1AZBA 3ARTA 4N26A 1UVQB 3M17B 3KPPA 4NRXB 4XPBH 5C0ND 3RVWC 4BV1A 1GYLA 3V5CA 1P7QD 4N2YA 5ILTH 1RV6X 1DIKA 2F7OA 1B9BA 4F20A 5KSUB 1W2PA 2YBVA 3ITGA 4ZXOA 5KSUA 5DJCA 3KYKH 2CAKA 2JKJA 3A6OA 1KCWA 1UA7A 3KPMB 1UKPA 3QC6X 2Y7DA 5C0CD 3QDGD 3CAWA 2WNNA 1P84K 3I6LD 4E41E 3AWNA 3TO2B 1P2CB 4MNQE 3RYMA 5IUCA 2B1AL 3OLEA 3LEXB 4AGMA 4RE2A 3DETC 3BUPA 4JFPA 3SE4C 2TSAA 5IF0A 3MU7A 1JN6B 4ONHA 4ZO7A 4XZMX 3FA3A 1RZFH 3WSUA 3FH7A 3KW3A 5K59F 4MAYB 4LEQA 2G30A 5ALBL 3G18A 4HIIA 3VFTB 4XMLL 3ZXAC 2E6PA 3HU7A 4CVXB 3Q43A 4HD9A 3QXAA 3STLA 4RGNE 2QVKA 3H0TA 1QHOA 1EUNA 3QXAB 1FPTH 2BOBB 2OEMA 3G0UA 3H4XA 1ESWA 1EEQA 2XVNA 4CCZA 2D3JA 4MUZA 4FG2A 2WNKA 2BWGA 1TOXA 1V7NH 3G1FA 2Q5BA 1H41A 4A63A 5DVNA 4AK1A 3TOPA 3MOQA 4ALAH 4BCEA 1CFQA 4DGUA 1ZQ5A 1DJXA 2UY7A 2LFGA 3C5SA 3QPQD 1R4XA 3QXUA 2BOFX 2UY7B 3C5SB 4F3FB 3FDGA 3F5LA 1HP5A 4RCXA 3U9UB 4R9XA 3QY8A 5I82A 3U0WH 2XFXA 2L7JA 3B05A 2I9LA 3NESA 1FYTA 3FO1A 4L7ZA 1BYAA 4XZLX 5G2HA 3KVPA 4QHMB 5DSCA 4B9PA 3ANVA 2X4OB 1L0YA 4FJYA 4WK4B 7TAAA 3PNUA 2OR9H 3ZSSA 2FEDC 4YHNB 2VRQA 3DO3A 2PDPA 1YUKB 4PTUB 4E8DA 1R0MA 4M7KL 4RSVA 1B2YA 4JHAL 2NR6A 5IQNA 4Z7QB 5ACZA 4QRUB 1Q0XH 2EXWC 1JRHI 4JTHA 1JAEA 5EC2A 2AMUA 5IF0B 2PA6A 4HF5H 5DHXB 1OFPA 2ESCA 4FR1A 1TVDA 3WFEL 4A2HA 1HZYA 1RQ5A 5I1GL 1US0A 4XMKL 2AJVH 3C2RA 4WHCA 3EB4A 1HC1A 1ICQA 1W1B1 5L8LB 4PRPE 4I0CC 2J8GA 4WJ8A 1RCOB 2ON3A 3GHUA 2HWZL 5ANMB 1RZJC 1OT4A 1ZIAA 4TO8A 1UURA 1R33A 3W11D 2A73B 1E30A 3GS6A 4GT7A 1EDYA 3UNTA 3L3OB 1QTWA 5C6MA 2RB8A 3JZ7A 1HJBC 3OA5A 2V5SA 3JWOL 1TENA 1RAKA 1W5OA 3ZDYF 1O5DT 2R51A 4O11A 3GHEL 3VFNB 1E6NA 1FWFC 1Z32X 3UFIA 3VD5A 3KPOA 1NAKL 3MA9H 4KQ4L 5LUMA 4Z7IA 3FSTA 4M6ML 5ISZE 2DQDH 1K77A 3KW8A 4S10A 1ZLWH 4PR5A 4GUCA 1QKZL 2X9XA 1F3TA 3LQAL 4JCLA 4PFMA 5LZLA 5G55A 1WDWA 1AGFB 5F93C 3WJXA 1H11A 2PLCA 1N6VA 5CKGA 4KPLA 3MRJA 2H3NA 2KKQA 1P7TB 1CCWB 2EF9A 4Q8NA 1CFVL 4ICXA 4F9DA 4KEUA 2ZWKA 2G3FA 5LGZA 4K8GA 1WIPA 3NCMA 5BZXA 3ARQA 1AAJA 4H19A 4KCTA 5DJ8B 3FVMA 5AECA 5LA0A 3MTXA 4Y1AA 1EERB 1FDLH 1Q8MA 3TYGH 2YC1B 4LFHG 3VXQB 3B3IA 4MJHA 4AL8H 4F37K 1UR1A 3DOSB 2ENPA 3NK3A 3TFKD 4HVXA 5AW2B 3B7SA 2NV2A 4PUBL 4CCEA 3OD3A 3QBUA 1CICC 1DSWA 5CGBA 1RCXB 1W8GA 2A83A 3L2LA 4KHTL 4PH8A 3WKMH 3QMSA 4M8RA 2A6JB 2Z91A 2WLIB 2RJGA 2NX5A 1WWAX 2KZKA 4PTTB 2MFNA 5D96B 3U2JA 5GJNA 4PJIB 3GJFA 5C08A 1MEIA 1H9VA 4DWSA 1ZHLB 4NHUB 3W2DH 2HH0L 2VAJA 4PJGF 3CZEA 1SDDA 3VMNA 2HFGL 2GSMB 2JNZA 2Q20A 4M7ZB 3PC0A 4GBXC 5ENLA 5KYNA 3EKGA 4PRTA 1KBJA 4NO5B 3L54A 4CUCA 3KLHD 1KB5A 3ZKQD 2APWA 3CC5B 1YUHA 4Y5VB 4HKBB 4OGYH 3W0WE 3M7FB 1Z7AA 2HK1A 1U9KA 1QMLA 3F6IA 3ZDZB 2V5JA 1HVXA 3ZSTA 5ESAA 4L5FH 5D7JA 3R06B 3WY1A 5I5RA 1C9SA 3IRPX 2JCCB 3FQXA 3Q9PA 4JGMA 4P06A 4UNTA 2FIQA 5FD0A 4OT7A 4HBCL 5C0BD 5C7HA 4HWBL 5F9JB 3CWGA 4N2OA 4M5TA 1HE8A 4HJ0C 4YHKH 1TYGA 3N40F 1FN4A 1KLGA 3WLQA 3P61A 3A23A 5F3FA 5DMIL 2Y36H 3H9HA 4QTHB 1AZVA 1ONEA 4RWYL 1LHZA 4FLHA 1IBDA 1G7PB 1PDZA 1KLUB 4EQ3A 4BE5A 4S3DA 1HHIA 3DURA 4EPDC 3QFGA 1LQ0A 3ZVHB 1KM2A 5CP7A 1LORA 3CX2A 5AFAA 3LKPA 4ZUVA 2XV0A 3NTCL 3SBFA 2XLLA 2O26U 4ENZA 1U8LB 3I74A 4X6DB 4HYTB 5JW4N 3OAZH 3FN0L 1U8OB 3LHYA 1TEGA 1XLFA 3BUYB 3OA3A 2MRYA 2FD6L 4MFEA 3UXKA 3RG6A 4UTLA 1BVKB 2YUZA 2OYPA 1QG3A 5ADOL 2A3HA 4DKDC 1CTNA 1PMYA 1KJVA 1HU8A 5DFWH 4OV4A 2DVTA 5AW1B 4KFZC 3QVAA 5E03A 3DX0A 2GVLA 4L1BA 5I9QC 4TTDD 3O3UN 1AHWB 5F7DA 1O1HA 4X5XB 4Y8AA 3RF9A 3L3JA 4LALA 4PP1D 2YJLA 4I77H 2YFNA 4M3KB 2KERA 4U0QB 2HUHA 2YLKA 1WBJA 3NG5A 3BWUC 3LUTA 1CLZH 4R53A 4ZFMA 1WYIA 2CLVB 5C07E 1XXFC 3GNRA 1F9CA 3QOKA 1J2WA 1BIHA 2BERA 5KVFL 2YZ8A 1Y18A 4KO6A 3RGVB 3G04B 1HCVA 2YRLA 2J1YA 3SDCC 3T4YA 1MPAH 3VFRB 4EN3D 2EVJA 1QP1A 3MRKA 3MV8E 4S1QL 3T65A 2CIKA 4IU3B 4ZX4A 3BT2H 5HP5A 4I5BB 4X6CA 2Q8AH 3O9WA 1EXBA 3W01A 3NCXA 1IEVA 2J7BA 3FK3A 1JCTA 3CHCA 5DCDA 1BGXH 1DLFL 1R5YA 4KKBC 5D04C 4WO4C 1A3HA 4LL1A 5T1KA 1QR7A 4W7WA 3L5HA 3T05A 1RLBA 2FHCA 2CBJA 2C3WA 4RMBA 1UZ6F 4JVWA 3JYCA 1A7NH 4NKDB 4QJ3B 4H9VA 2VLJD 3KHOA 4D0CA 1RUMH 1A4KB 2AXWA 3GDCA 3GLDA 1WAAE 4EN3A 1EP1A 2OZ0A 2Y7GA 5IW6A 1I7UA 4PJ5D 3WQWA 2FE0A 4YSCA 1ACZA 5I8CA 5FESA 3GC4A 3Q8CA 4N3UA 3FH8A 3T6QC 2OR8A 4Z1CA 5E6UB 4D8LA 1UM5L 2WOYA 4MWAB 4NSBA 4J3OD 3ZKNC 5B1KA 4RUBA 4DN4L 4M8UA 4IHCA 1BHGA 1VHPA 2VC2L 3MJ9L 1D5IL 2CWNA 3ZTJH 2OXHA 2DLIA 5G4MA 3GZOA 1V0LA 3CCHB 2HQAA 2G4FA 4EPSA 4F7KA 2PO6B 4NCC2 4PGEA 4K5NA 4XODA 3UBXI 4JRYD 4MSWB 4E0RA 2VUKA 3HB9A 4Q4RA 4Q8QA 3RJQB 4XZ9A 1KACB 2QIIA 1ZK9A 1KYFA 3CQFA 1A66A 2BX5A 4KK5D 3R18A 3IDYB 3JV4B 5BMXA 2IH8A 5H35A 5HPOA 1TTQA 3IRCA 3L5AA 3F4NA 1KRCC 6XIMA 3HC3L 3CDZA 5DK0B 3L3KB 3ZRFC 1AC6A 3TJEL 5I1JL 4LDEB 1NCJA 4RZBA 3TMQA 2ICWI 1AHWC 1H4PA 1PX3A 2YAPA 5F8RC 4XK2A 2Z27A 2CBOA 2P9RA 3UXLA 3MACH 5IP4A 1QU4A 3Q94A 1GS7A 4HZ7A 5D2TA 1CF1A 5E8PB 3TJIA 3EJYD 1HXMA 2VUOA 4TUUA 3EBVA 3HFFA 5F7UA 1A6ZA 1N18A 1E6JL 1RMFL 3UO8B 1MW0A 2FD6H 5D6DC 5DC0A 3S42A 4BFEA 1QOXA 2ZWLT 1NIEA 2OA9A 2YEQA 3BGMB 3NCFB 1GYVA 4J3OF 3SBPA 3R7RA 1W5MA 4W9ZA 4DVRL 1NFGA 3TVMB 5ID1B 4QG9A 1FGNH 5CGQA 4P9ML 5ISZA 1REQA 1KY7A 3L68A 2X0WA 2XV6B 1PG7H 4YXHH 3EOTH 2CU0A 3KUMA 4ZAKD 4K7VA 1PYWB 3D34A 1T3FB 1PTZA 1VBUA 1FH5L 1PXGA 3OR6B 5A69A 2OTPA 4HJGB 2Z8WC 3FAXA 3R11A 3ZWTA 1YN6B 3C6SB 1CO1A 2OXHB 1G9ML 1ZHNB 3PP3H 3ARRA 5ANMA 4LCUB 2BVPA 1HSBB 2YYTA 3V6FB 5JHDB 1FL5A 2JIXD 2J78A 2PDUA 3HG3A 4H25B 5EA0H 1JUEA 3C2EA 1OL0A 1R0AL 3GB7A 4YHEA 1HWWA 3QXDA 3LCFA 3F2LA 5I1EL 1XRSA 3F01A 4Y8FA 3EYUH 4IDJL 4PLKD 3DX3A 2GVYA 1T7WA 3ULVF 4XD3A 1P1ZA 2GFBA 1GVSA 1F07A 2VIRA 4PUDA 2F15A 4Y4KB 5F9WB 4CSPA 3P3YA 2QMKA 3D4CA 4KROD 3VG0L 1I60A 1DQLH 2AXFA 4MA1B 4EIBA 3GHSA 4RXFA 5TDPB 3TT3L 3QNZA 2VX6A 4UFLA 4YL4A 1R3WA 5L6YH 1U41A 2PO6C 1IE7C 1FQ0A 3VNKA 4UTFA 2Z7ZA 4KAQH 2FH8A 5J6HA 2X89D 5C0JA 3NCEB 3ZVIA 2DMCA 2YGNA 1XYFA 1Y5WA 2VITB 4NILA 4S1RL 1B0GB 1H3WM 1E72M 4LVDA 3R4RA 4JQVA 3CZKA 3S1VA 4MFHA 2YWYA 3NIGE 5I1GH 5M95B 3VC5A 4D8AA 3DRTB 4ICWA 5FYKE 5L0QB 5FJPA 4DZBA 1TTAA 4JHOA 2YMXH 4N6EA 4NQXB 1GMIA 2AABL 4AD1A 1BWLA 1YYMH 3FB5A 3OBKA 2YD6A 5EMMA 1EO7A 3WN5B 1BFVH 1HSAB 2TSYA 1I8LC 1SO5A 3OKYA 1KKRA 1V6TA 1MWAB 4J8RB 3MCKA 3DERA 1ZTXL 3EDFA 4NFBA 4AKPA 1LVEA 1U92B 5GZOA 1J9YA 4J23A 4ECNA 1PLBA 3G08A 3MLVH 5A8PA 3WUZA 1NQ6A 3SB3A 5BV7L 1VR6A 2EJAA 4QRRB 1QRQA 5CPLA 3K81A 5TD4A 1SJEA 3EO0A 5CU5A 4ZFZB 4U1JA 1DFXA 4OGXL 1YMMB 3IFOB 5EEVA 1PNCA 2XNAB 3O3AB 3ELQA 2OL3H 3DVIA 5CN1A 4HIHA 3QOMA 4UTTC 5AHEA 2W59A 4IKIA 1MNNA 4JO5A 2XRAL 3S2NA 4D2JA 2GDQA 1QI2A 4KIEA 4NFDA 2QF8A 4C7DA 4DVRH 3I6KB 4B5SA 4YTTA 4PJ9D 4PIRF 1GRWA 4BK4A 1EYWA 2CHRA 4LEEA 4AY0A 2OEKA 3BX7C 3ML9A 4PQXA 5DD3L 3W7DA 1CGVA 1JI2A 3R0NA 4DNHA 2ZUXA 3N42F 4AZ8A 4N4QA 3F2CA 4X4XB 1IEQA 1YRKA 3GSNL 1CDJA 4FQCL 1FLRL 3OPZL 2VDMH 4DZ8A 4BK5C 2H26B 1Y6NR 3SPVA 3QZBA 1NLBH 2V69A 2FTAA 2ZKXA 1FZMB 5JYLA 3OKOA 4X9FA 1QHZA 4JTEA 2P53A 4HEPG 1IKOP 2VTFA 1HYRC 4PP1C 4LRNH 4XCYB 1VCGA 3UBPC 4ERGA 4ONFL 1EO8H 1LROA 4LU5H 4GY1A 4AD0A 3NA8A 1WVZA 4HQVA 2R24A 2X7WA 1K8CA 1BD2D 3VJ6B 4ZENA 2JV6A 4PVBA 1O5KA 3EXLA 5FX3A 2HN7B 4GUHA 2IFFH 2C1GA 2Z1PA 1HHJA 3IPFA 1CGYA 3N44F 5D2NB 4I7ZC 5IMMA 2VDQL 1E55A 2YGVA 4FPSA 4S39A 3STFA 4A8NA 1TJ2A 5FYJU 3GNPA 3H4FA 4A3UA 2ZZ1A 4PY7A 1UQYA 1V6YA 1MIEL 4IU2A 4P46A 4WY7H 4A7TA 4MXWH 3WK3A 4LY8A 3FIGA 1UZGA 3EFOA 3KBNA 1L9SA 4G8FA 3FUIA 4XXCC 2DAVA 3AFBA 5GNZA 2B9BA 1GQIA 2C9RA 3IEAA 1AZRA 1NGYA 1WAAF 1YN7A 4L4VE 1QFOA 4OD1L 4TS6A 5T5FL 2D7MA 4PLOB 2OKTA 3ABSA 3DC8A 3MQTA 1M05B 3UG4A 4KY1L 5DJXB 3IF1A 3CBWA 1BM3H 4AAJA 3V9EA 2N0KA 4RAHA 3SECA 1IC0A 3LYEA 4YE4H 4AH2B 3PWPA 3TBVA 1GW1A 2MKWA 1YPXA 1SJHA 4K2UH 2WCSA 4M61B 1OX4A 4RZCB 2ADIA 3DDFA 5T3XL 5DA4A 1S3KH 4YHYB 2WKJA 1SY6H 1FL3B 1OIMA 3MNZB 3PJNA 4V1YA 5DUML 1QTYT 3OGCB 3FU0A 4JUSA 3T9PA 3HHSB 2CQVA 4RNFA 1W3JA 3S2AA 1JRCA 2XQYG 2XBTA 4L1TA 3WJJC 1S2VA 4RZKA 1MFCL 1UWEH 1YXCA 4D0BB 5C2GA 4YDJB 1AW1A 3AUOA 1AK5A 3O45B 1IIHA 1HEJC 3VTMA 4C6QA 3TN4A 4LKXA 3W38A 2J6XA 2BFGA 5D71L 1PWMA 5IJDC 4JRYE 5J6GA 4GX8A 3WTTA 2XRAH 3A4WA 1KFBA 3T1FA 3OLGA 5C8JA 3B2XA 3V16A 1A5KC 1RY7B 4WOZA 4DBEA 4JTFA 3PTDA 3PJLA 3T0TA 4TTDC 4AVIA 1JZ8A 3Q2LA 1BGAA 1A6AA 4N9GB 3L67A 4CQ8A 1OZQA 3RJDA 2O4QA 3ZMEA 4WGVB 4YSQA 2AK1H 5ICXA 4BINA 2XSXA 1OD8A 1KCKA 3PZUA 1U83A 2O7SA 4E38A 1OQOA 1F6YA 3DESA 1F3JB 4AEHL 1A4JA 5I77A 1K6AA 4J4PD 2ZZ2A 3GSQB 1RJLA 1I2QA 5AOKA 1NMBL 4OCSH 1RZKC 4JG9A 4X9YA 2PTDA 4JTIA 5A7EA 1YE4A 2VGBA 2P80D 5CKSA 2KL6A 3HRZA 1RJZB 3HZYA 1GS8A 1V54B 1T4KA 1X4ZA 3ME3A 5DJ2B 4LUSA 3C87A 1M3IA 3RLHA 2BPBA 3GG8A 1EXUA 1AD0B 5C9JA 3LIZL 1B6UA 2P42B 1FV1B 3QUXA 4FFZH 1AOZA 4JRYA 4ZW5A 2VGFA 1ZHKA 5K39B 1QWGA 2FJFA 3D3VA 2F5BL 1TG7A 4AT6A 3LEYH 1W8EA 3DPDA 2ZADA 5EZJA 4LW7A 3GBNH 5H94B 1FE8H 3F7KA 5I73B 2BNJA 3FFSA 3QM3A 5GGQH 1JXDA 1OEZW 4YLCA 3KPNB 4X99A 4AJWA 1IF2A 2PR4H 1BA9A 1YQ2A 4LPUA 1W3LA 1DBJH 2WYTA 4P99A 3RPKA 4C7GA 3U82B 4PA8A 3TYZA 5F44A 3RFRA 4ZG1A 4H1ZA 1NJ9A 3VFNA 4AEOA 4FFYL 5HJ3B 2YW3A 4H1LA 4FHKA 5K4ZA 2HCZX 1E2VA 2JCCF 2B0SL 3OPUA 3P0VH 1B0RB 4DN3L 2P48B 3UETA 1N5AA 1CD1A 5KTLA 5CZVH 2BMKB 5D8ZA 3GBLA 1F18A 3HB3B 4XNZB 2DYPD 4H8NA 3TC6A 3W7RA 4RWYH 3HN5A 4CNOA 5JMUA 1IBYA 2H3KA 2Z00A 2CKNA 3CU7A 1RMFH 1IIIA 3MRHB 3IRSA 4H01A 4IJBA 1EFQA 4LCCC 2HNHA 1S7TA 2NY6D 2QDVA 3GB6A 3INUH 4QRPE 5D72L 3UTSB 3KHDA 4NY2A 2GK0B 4P9MH 5F1IB 2EP6A 2J3SA 4BCXA 4CU6A 2X2YA 5IVNA 1WKYA 1AANA 1R5IA 4L4TA 5I6NA 4CD8A 3FCUB 4UBPC 2F7QA 2Z26A 3KBJA 4HXBH 4P9HL 2CYGA 4FZEH 5HWNA 2PGWA 4L9LB 3VXRB 3ZPDA 3FYYA 1J1XH 1JRHL 1HAUA 1A7RL 1VYRA 2CLFA 5C5YA 2J56A 5HJLA 4WTZA 1K9DA 4P4KC 1TWIA 3OJGA 5DJ6B 3LHWA 3EF7A 2EDHA 1H3VA 5EZLB 2K6YA 2CUAA 4P59L 3ZDXB 4H20L 1DBTA 1GOWA 3VZXA 1IQDB 5CF3A 4IRSA 4N5UA 5BMFL 3R0MA 5I1EH 5AKQA 4XMLH 3I3EA 4UQ3B 3U9IA 1ELSA 5GJSL 3FAWA 3MLXL 3G08B 1KYOJ 4KRNA 2VXTH 4LNVA 1LE9B 1V0KA 3C4UA 1FH8A 1GHRA 5FF6A 1DBAH 3EWDA 4KNTA 1YECL 3OMZA 1TDQA 3MPCA 5F0LB 3UAAA 5A8OA 1Q9OA 4XI5D 4AYEC 1VESA 3RKPA 2DKMA 5FGSA 2Z93A 3WXWL 3WK2A 2XU2A 4EOWH 3TNNA 1KFGA 3G1XA 3OXSA 4FFZA 3EYOB 1BQCA 1IWPA 1Z0MA 1LNUB 2Q09A 4K3HA 1TCRA 5I26A 3B6SA 5H4YA 3U7YL 2DJ4A 4AIZB 1OFEA 2R1KA 3VQ1C 4G6JL 4GMSH 1F4XH 2PW2B 1IT8A 1QOPA 3V5KB 2L8AA 4HAFA 4LLQB 4XBGA 2XM2A 1KBGL 2XG5A 2WLIA 2Q6WA 2J47A 3RA7L 4YSUA 3HI1B 1UC5A 4IGBD 5CCKH 3HPLA 3QXWA 5CLXA 4AXWA 4N22A 4P5UA 4ENLA 2BRRL 2VYRE 2FVNA 2BFVH 1P4BH 2OX5B 3U7AA 7TIMA 5ISZD 1V6UA 3VE9A 2DUZA 2NW2A 1O5RA 3F6LA 3QH3B 2J79A 4HA4A 3K71B 4GKZA 3V0JA 1SYSA 3MBWB 2B31A 1P4LA 2FGWL 1F0LA 1ZVYA 4L48A 4YWSA 2DD8H 1K2DB 4PJCF 2NUTA 3HRPA 4YGVA 4ASTA 2VN3A 3AT9A 5HJXA 1DUZA 1PY9A 3EYQD 1P1VA 2WAGA 3IARA 3HC0B 1QUNA 1S7RB 3I4EA 5A6BA 43C9A 4DK5A 1PIGA 3TT1H 3V4UH 3QV8A 3W24A 1RSYA 4KROC 1RIUH 4ZTEA 2WBJB 2YMTA 4P2YA 6TAAA 1GOKA 1OX6A 3TEXA 1OIOA 1MCOL 2EUXA 4AGQA 5BRZE 4OJAA 5T1MA 4YHPA 1XIWB 3ABZA 2JI3A 3QZPA 3T0EE 3KRSA 2CHOA 4HGKC 3H22A 3W7PA 4XPGH 1G4PA 4LANA 1WKFA 3MZGB 4QYOB 5FHBL 2PDWA 1AGEA 1R9ZA 2NYYD 2ZXCA 3KPSE 4NNPH 5TE6H 4PULA 5A7BA 4NZRH 2WUCH 4WY0F 3QZEA 4IIBA 3S5SA 2ZQ0A 3Q2CA 2J8UB 1E67A 1GW6A 1VJZA 3VWJC 4HHGA 3C5ZD 3MV9B 2Z1SA 3M6YA 1TWDA 5FIEA 4GCAA 4S3BA 3QIBC 3SB0A 1BMGA 2YEVB 5CP3A 4LHQB 4Z23A 1A1OB 4HIXL 4Y9EA 5B1JC 4PUUA 3RRXA 3RLGA 1RJLB 2KYIA 4GXFA 4MMXC 5I00A 3GINA 4ELKB 1QRKA 5EOQH 3L3GB 1XGUA 4HJEA 3OQ8A 3MRMA 1DEEB 2OLSA 4KNQA 1AXTH 3Q1EA 4P59H 1WG3A 3ZE0E 4KZDH 4ROPA 3MNZA 3WUGA 4CQ9A 2P5NA 2GEEA 2J7HA 3FFDB 4KJQC 1XH0A 4N8VG 3EGDB 5IBTH 3AXXA 3FO9B 1I7UB 4Y4KC 5F9WC 4B95C 3APMA 1QSED 4LEOB 3VSUA 2QGBA 4DK6A 3SQLA 4E9YA 5H2BA 4MZ8A 3FT9A 1UCTA 2BHYA 3I2CH 5GS0C 1UKQA 3U0PA 3MLRL 1A53A 3NZPA 4UV7L 1QR4A 3TF7C 2CDFB 1RUQL 1YHPA 3H2WA 4JRWA 4XHQA 2IIJA 1AXIB 4LFYA 4M1CD 3SCOA 5GQBA 4ZODA 3RI5K 4XB8A 4FZ8L 4IU2B 1CGUA 3M5YA 3VIFA 3L9YA 3WDPP 1NEYA 5IMKB 1THAA 5AENA 3DZ1A 2OR2A 2PDIA 2WTRA 2ZTBA 3IKCB 3RZCC 3NSNA 3Q58A 1GCFA 3V1PA 5F7MC 1JERA 2MHAB 2VABA 3BLPX 3VB8A 4KZEH 1U8HA 3BZ5A 3IRZA 1XIIA 1O1ZA 1G6VK 1NCOA 1ORSB 4G7YH 4L1LA 4XVTL 5LDSA 1W9UA 3R8GA 1E8YA 1UZ8B 3F64A 2WKOF 4JFPB 4XI5C 3PWPB 5DWUL 4A7GA 2EIDA 3H55A 2QGEA 4KHXH 4NJJA 3VAVA 1GZHA 1UGKA 4AHPA 4BKLA 4XAKE 3SOBL 4DIAA 2CKRA 5IG7B 1W9XA 3UWZA 2WXMA 3P2BA 4UM9D 3RM9A 4MD0A 4FP8H 4LMQI 1K02A 4QRQA 1FRGL 4XGZA 4GG6F 2ZCKH 2H8PB 1NC4A 3OKOB 2AGTA 4ODTH 3BWZA 2EDEA 3H2OA 4JFEB 1RIUL 3B0UX 4ZAKC 4AZCB 2BP5M 4H6QA 2HROA 5EBAA 1VFAA 3I02B 1F6AA 3QFJE 3VNYA 3KP1A 1J1OL 4P4RB 4OF5A 2HBXA 5HHMD 2V5YA 3RX7A 2WVTA 4WGKA 1LO3L 4A04A 1D2PA 1UJPA 4G1EB 2P44B 3G5VB 4KJPD 4AYDC 2OELA 3ML8A 3B2VL 2ZUUA 1FP5A 3EA3A 3H8AA 1YAIA 5BV7H 3STLB 1JE6A 4JO1H 4BI5A 5DZOA 5TAOA 5FC9A 4A6GA 4IIFA 2P8MA 3VDAA 2E7DA 4IUGA 1RUML 3M07A 4NQDB 4OT1H 5DD5L 1PTAA 4JY5L 2BSSB 5T91A 1CR9L 1NAMH 1S9VB 4NNXA 4LV4A 2V6AA 2WO4A 1XGYL 2VN4A 1GZPB 5BS0E 3N14A 3V4BA 3WNMA 3HZKA 1KRAC 3QKZA 2V9QA 4L05A 3AG3B 3FO2A 5EO0A 1IT7A 5B7EA 5LYRA 1C5CL 2CR0A 5DY3A 4HV8A 5IBLD 1B3YA 2AL1A 3N29A 4JKLA 4KDVA 2QADB 1WFUA 3EWZA 4YO0A 2HG0A 4AVJA 3E0VA 3E6FB 2KBGA 3TL5A 4DPBX 4ANXA 2J8OA 3RLVA 2AGKA 3HGSA 1QRNE 3OKMB 1E27A 2VL5A 2VR3A 3GMPB 3EWYA 3EHBB 1MNZA 1D5ZA 1MCNA 5I3DA 4HS6A 4BUQA 3O9WC 3MUIA 4P04A 2IQ9H 2WLYA 5C0GA 3WUWG 3G5ZB 3NFPB 3TJEH 4LIQE 3IJYB 5IHLB 3NFNA 4MAVA 2OI9C 2RALA 1VZIA 1Q9LB 4EBQH 2GJNA 4X7FC 2V67A 4RCAA 4C56B 3DTDA 3ARPA 2DPEA 4LUJA 4QLJA 4PRNA 3OR6A 3SO3C 1E70M 2ICEC 2VB5A 4XP1H 3HJEA 3T1FB 5C8JB 4WI2A 3LRSA 1H7RA 3MJ7B 2ROXA 3VWKB 1IC5H 1S39A 3K1DA 3QNZB 4YFEA 1IYXA 1UACH 2OZ4L 2YRPA 4E8GA 1NCNA 4U3SA 4N9EA 4EF3A 5DMMA 1GQLA 3W82A 5EO1B 2KHAA 3VI4A 3MREB 4G8GA 2PLKA 4Z95H 2GFBB 4POZD 4PJHA 4ZT1A 2RKXA 1WIOA 4PUBH 3GU1A 1K8IA 4NRYB 3HQNA 1JPEA 3TU6A 3PQYA 3MMEB 1IKNC 3GPEA 4HBQA 2IPTL 2YBTA 1PKQA 2YXFA 3PZOA 1J7VR 5E23A 4ELMB 5J1TC 4A2MA 2O72A 2OCJA 1E40A 2YGYA 3IU4L 1JNNL 1H5VA 3NPUA 2V9TA 2H6PB 2Q7NA 2X4RB 4EF9A 5JBDA 1UR3M 5ABFA 3UT0A 1G6RH 1FO0H 3OMAB 1TYRA 3P30L 5E2UH 3T0WA 4N0CD 1LJMA 4DP2X 3CB8A 1CG9A 3DFOA 3LMZA 1W0WB 4QKXB 1H1YA 3ZJ8A 2NCEA 4F91B 1A3XA 1SPDA 2P1YA 5AALA 1Z5HA 3S5YA 1NDYA 3QZAA 1UUNA 4LT9A 3WX7A 3WD5H 1OGGA 1NM9A 3VIJA 3N41F 4RNHA 3IFNL 3OBAA 1MRFL 2IADA 3KDPB 1QNZH 3O6ML 4PI0A 3ROOA 1P9MC 4X8GA 3OF6A 5D7JC 1B4RA 1YTEA 4U0RC 5FYKH 1TQUA 3GB7B 4RA0C 5C3TA 4OFVA 4APQC 1UZDA 2JEQA 2H90A 3EZ8A 4YGAB 2GG1A 4XC3H 3DLQR 5I17B 1W72B 3V0UA 2DP3A 4LSPH 4C56D 4IGBA 1ZBCA 1A6VH 5FJOA 2W5FA 5D9MA 1UEYA 1OWRM 1ZU8A 1H61A 2AV7B 1J1PH 1SVZA 1KCUH 4OM0L 2NYZA 1S7QA 4HIEA 5DUBB 4BBWA 1LEIB 4AFYA 1VFSA 1BYPA 1XICA 1YKWA 4HHPA 4N2NA 4NZFA 3DSNB 3EHBD 4FEZA 1AXSA 1JNHA 3UZEA 1PDYA 3OF6D 1S4IA 1PKMA 3VNZA 2DW7A 2P24B 3UZZA 3Q65A 5HGAB 1IMHC 4HCRL 1MIMH 2YA0A 3DXAA 1KUMA 4G7VH 3WNKA 4JFDA 3W7IA 2PMZA 3J27A 5CBEA 4BWWA 2QW5A 5LNRA 4AWSA 3W6MA 3BZGA 2N01B 4CKQA 1AG6A 4GJIA 4GY0A 4OJDH 1DO5A 5JPNC 3UVAA 1AYRA 1MCHA 3CNKA 1E65A 5FKAB 3MBDA 1QO3B 2G9KA 2HXUA 4Z7UE 3GRIA 5LIUX 5K9DA 3OR7B 5E1AA 3WLPA 2A2IA 1PIIA 4PSPA 5I71B 1AHWA 1QBMH 4M24A 2R7EA 3CXHK 3B06A 3DV6B 5IB1A 1KZQA 4JFFE 3LEYL 2GQ8A 3DN5A 5DZLA 5LSMA 4P3WA 4X7SH 1XG3A 4CMHB 3QUYD 1ZAJA 2EH7H 5M2FX 3AY4A 3PL6C 3NN8A 4YQXH 3CHPA 4FXKC 4BQCA 1XKYA 2R2HB 1VFTA 4YDKH 4OLUH 1OP5K 1MCOH 2C34A 5DT1H 1DIDA 3EOUA 2UWEA 2WGNB 3JWDC 5JHLL 4FA3A 1MI5B 5HHQA 5IUSA 2Q6ZA 4DJFD 5DHDA 3EFFB 3SN4A 3JTBA 4MCNA 5I1LB 5E5CA 3WV0A 2QF7A 1JF6A 5HDOA 3VFCA 3W23A 1UH2A 4LAQL 3S5LB 2OWCA 4JZOA 3CFEB 4GRLB 2XWBA 5JA8B 1GG0A 3CV1A 1MUCA 3GKAA 2XWBB 4GFTB 2J77A 3MGOB 5CBEB 1V10A 3JWDH 3BW3A 5CLYA 2E5BA 1BJ8A 4PTUA 3FTGA 4FEIA 1Z1WA 1QJWA 4KXZI 4Q32A 4MB3A 1S7UA 4JFFA 4CSZA 4LAOA 3P8JA 3EH2A 1KJVB 3MCLL 3TZVA 2F1AA 5D7SL 4KU1A 5EZOL 1Q6RA 4L9ZA 4XN2A 3CL8A 4I9XA 5K59E 2B8OT 3UD6A 5K3VA 2O55A 2L4OA 5J04A 2E9IA 4F57H 1N6QL 3AXLA 2VXVH 3JT2A 4G7SB 1PSKL 4PWKA 3EX3A 2OXGB 3ZQWA 2IH1B 5FA3B 1LL7A 1MDRA 3AUWB 4NNAA 4F7MB 1JZ5A 4IL0A 1U8NB 3FUDA 4IKKA 4MCYA 4DWSD 2Y1YA 2Y7EA 5J57B 5G1YA 4GMTL 1DQTA 2R9HD 5HDBB 1GONA 1V7AA 2EEXA 3QEQB 2OMUA 4LCIL 2XUWA 3P4OA 4O4YL 2YCJA 1MELA 1MY5A 3BVUA 1QATA 4HWEH 2DQEL 5D2LA 1EV2E 5J13B 1BWMA 2RFXB 3UX9B 1B3XA 2PP3A 3OYXA 5A16B 3CIWA 5F4WA 3EKLA 4E8CA 1BZ8A 1OPGL 3B2UD 3UACA 4C6JA 3GR4A 1CFTA 2VMJA 3QDJD 3CN2A 4MCZA 5IZ7A 5DEFA 1VA9A 1P6CA 3ZVVA 1Q6LA 1U8KA 3M46A 4PP2A 1JDCA 1NCBH 3KZPA 1OB1A 2C16A 1SFDA 1S3HA 1WRFA 4JQIA 4QTFA 2CKBH 4LUSB 4FF5A 3H9YA 4M1GH 5HNNA 4DFHA 4O02L 5SWSE 2FNWA 2DMHA 1C8VA 2NWRA 2EKCA 4FFTA 4WY7L 5GSRA 3CHXA 4PJ8B 2ZTJA 4NQCB 3BICA 1G0CA 2VEPA 1DBBH 3WN6A 3NMEA 3DURB 2E5CA 1PGRB 3GSQA 2AXFB 3IACA 3G5WA 4OFYD 1A80A 4YWIA 4AQAA 4P49A 1DEEA 5AVYB 5CZXD 4L0YA 1NFIB 3SY1A 5LIKX 1NFIA 3DO4A 4HA1A 3VWJD 1P0EA 1PS3A 3ULSA 4NFCA 4NPJA 4OZFH 4BFIA 3IMUA 2A77H 4IMLA 5I1AA 3NSMA 7PCYA 1ZLDA 4O1FA 4UFMA 3BSZA 4NZ8A 5DJZB 5CN3A 1BXUA 2X4UA 3PE9A 5D1QC 1GVQA 4REQA 4HX1A 1HKMA 3QIWD 2E9BA 3FYPA 2K8QA 5BO1H 1WZ1L 1IBHA 1NCTA 5GISL 4HZ8A 3L3DB 2J1WA 4ZMVA 2ZX9A 3O8XA 4MS8D 1GKPA 5GGUB 2VLJE 3BO8A 4TRPH 2PAJA 1CLCA 2MTAA 4GACA 4RSYA 1C5DB 2Y7MA 1JL8A 2VSDA 4UB0H 2PDMA 4AGNA 4X8CA 4HN4A 1WDAA 4YFLF 3AYTA 5I6XB 5D2LF 5F7WC 1KZYA 4A7GF 4D9QD 4JX4A 4WKAA 2ZPKH 1S78C 3CTTA 1R2RA 4RJEA 2ZTKA 3MGTA 4OIIH 4M51A 43CAA 4NHVA 5KUMA 2JFCA 3NOYA 4GQ9H 2G50A 2G5UA 4J1UB 5B1JA 4OBSA 3SGDH 4B92A 1C5CH 1CFNB 3ZU8A 1ZHBA 5CBAB 4FA7B 3DJSA 3U6RA 3HPXA 4XAGA 3BDYL 5AFDA 4NNYB 4WI5A 4P5KB 3QIBA 4Z3JA 2PP9A 4LPVA 1N10A 3O3EB 3PCYA 4JBSA 3QUMA 5B3JE 5DHEA 1YEFL 5LIXX 1QFWH 3GWJA 1IJNA 4B60A 4BFRA 1ZENA 3CVHB 3X3GL 3E2QA 2CNCA 1ZKAA 3LVTA 4CW1B 1KIQB 1OC6A 1NMBH 4OCSL 5I6PA 4IP5A 1LQBC 4FQIL 3KEHA 4PB0H 4FFYH 3FTZA 4JZJB 3T2NH 4WXZA 5IQLA 2X4UB 4REQB 4V1DE 2J8HA 2R91A 1SF3A 2EDBA 5C0DB 2R0LH 1PEWA 2NNFA 4UTBH 4F7CA 3O6CA 3SN0A 5CCGE 4A3YA 5C9UA 1PQZB 4IDLA 4Z2HA 5KSAC 1MW2A 3KAAA 1J4EA 1JK8B 4M8QB 2CJUL 4OJCA 2V2TB 3A47A 3OJDB 1S7XA 1BAFL 4MS6A 5EMYA 5D33A 5CC7A 3MA9L 3AWFA 4KQ4H 5KG9B 4N2AA 1YEDA 2J4WH 1CBVH 3UWYA 3VTRA 2Y0FA 2IVFC 2Q76A 4NQQA 4C6DA 3D6GA 5B22A 3SE3C 1VYPX 1WFOA 4PRAB 4WNQA 4GI4A 3ZLFA 2KZHA 3UCCA 1JUKA 4GD0A 2YPVL 4NAMA 5ESVA