1MXGA

Crystal strucutre of a (ca,zn)-dependent alpha-amylase from the hyperthermophilic archaeon pyrococcus woesei in complex with acarbose
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
435
structure length
435
Chain Sequence
AKYLELEEGGVIMQAFYWDVPGGGIWWDHIRSKIPEWYEAGISAIWLPPPSKGMSGGYSMGYDPYDYFDLGEYYQKGTVETRFGSKEELVRLIQTAHAYGIKVIADVVINHRAGGDLEWNPFVGDYTWTDFSKVASGKYTANYLDFHPNELHCCDEGTFGGFPDICHHKEWDQYWLWKSNESYAAYLRSIGFDGWRFDYVKGYGAWVVRDWLNWWGGWAVGEYWDTNVDALLSWAYESGAKVFDFPLYYKMDEAFDNNNIPALVYALQNGQTVVSRDPFKAVTFVANHDTDIIWNKYPAYAFILTYEGQPVIFYRDFEEWLNKDKLINLIWIHDHLAGGSTTIVYYDNDELIFVRNGDSRRPGLITYINLSPNWVGRWVYVPKFAGACIHEYTGNLGGWVDKRVDSSGWVYLEAPPHDPANGYYGYSVWSYCGVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha amylase
publication title Differential Regulation of a Hyperthermophilic alpha-Amylase with a Novel (Ca,Zn) Two-metal Center by Zinc
pubmed doi rcsb
source organism Pyrococcus woesei
molecule tags Hydrolase
total genus 160
structure length 435
sequence length 435
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mxgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mxgA01
2W62A 1J12A 2XJ7A 2VC9A 1FA2A 2WSKA 1MQPA 2GJPA 2VZOA 1TFVA 3WQVA 1O6IA 1WZAA 2CHNA 3VSTA 4AYSA 1YHTA 3KZSA 1KXTA 1B3WA 4ZXOA 7CGTA 4TX8A 1LG1A 5BYWA 2XSBA 3ARYA 4GI8A 1VFMA 1H5VA 1ODZA 2WCSA 2FHBA 1SMDA 1R86A 3AMGA 3IJ9A 2BXYA 3W28A 3CUHA 2Y4SA 4B3KA 2XGBA 2DEPA 3AZRA 4OOUA 1A47A 4A3YA 1U2YA 4OIFA 3UCQA 3PBGA 4BCEA 1G9HA 4CU8A 3BUDA 4PTVA 3HZ3A 2J8GA 1TZ7A 2WANA 3BLKA 4ZE5A 4M80A 5ABEA 4NSBA 1RPKA 2V3DA 1OGBA 1CIUA 5A6KA 3FY1A 4KH2A 1E4NA 2J7BA 1AQHA 5CJ5A 1V3MA 3PZIA 3GXNA 3NDYA 3LPOA 5C71A 1TE1A 1US3A 2FH8A 2C7FA 3VMNA 2GVYA 4CCCA 1J10A 2GSJA 3POCA 1CECA 1JF5A 4HOXA 3SCUA 2D22A 3THDA 1B3VA 3PTKA 3K8KA 4AZIA 3AIWA 1HP5A 4NI3A 2OWCA 3SCSA 1ISWA 3OIHA 2PWDA 4Z2JA 2D73A 2XSAA 1K9TA 1W32A 4X9YA 4H7VA 4PMYA 5KZ6A 5CXPA 4Z2KA 3VD4A 2YL5A 1VEOA 3W82A 3WNMA 2WMHA 3BUIA 4UFKA 1CXKA 2E8YA 5BXPA 6CGTA 4TTUA 2WZEA 2F1BA 2YJQA 5AY7A 3W24A 1HP4A 3MO4A 2YKKA 5C70A 1HXJA 3GXFA 2EQDA 4DO6A 1JD7A 1UR1A 3CZNA 1QOXA 3AXHA 4BQ4A 1UWRA 1J0KA 4AMCA 4WIWA 2XFYA 1V3IA 3DX2A 2EPLX 1BF2A 2XIIA 2JIEA 3F5LA 1SMAA 1WO2A 1V02A 3WNOA 1ZJBA 4KGLA 4E2OA 3K1DA 1XV8A 1GPFA 3WKZA 1CGTA 1GONA 1CXLA 1FFQA 3AHXA 2ZXDA 4E4PA 3SCQA 4Q7NA 8A3HA 2G3MA 3L4TA 1Q6EA 4XZWA 4ZE4A 4NZFA 3K4AA 2PWGA 4PMQA 3WEOA 3CTTA 3GTNA 4GQQA 2FDMA 5DEZA 4OGZA 2WKLA 3NSXA 4YHEA 3ZJ6A 2ZX6A 4JHZA 4CD6A 3NCOA 3ZJ7A 1JF6A 2IXVA 3WBAA 1XH0A 1X6NA 4W85A 1EDQA 3PTQA 1UD8A 1W9BM 3T09A 4IUGA 2GFTA 3W38A 1E0XA 3CH9A 2IXUA 4HPHA 3BCDA 1E6SM 3WQ4A 1UD5A 2WW5A 1CGVA 1MYRA 1JZ4A 1LWHA 4UOJA 4ML4A 4GO9A 2BHZA 4PMVA 3L2MA 5I0DA 1B90A 3N17A 1PBGA 5AC5A 3CMGA 4PSRA 2WHKA 3VMPA 5CSUA 2EPMX 1EA9C 2G3NA 1FH8A 3ZJ8A 1H0GA 1GOMA 2FGLA 4J3SA 1WE5A 3AMLA 4GZEA 5A6AA 1D2KA 2CKSA 2F2HA 1UR4A 1G0CA 2ZUMA 4GI9A 5ABHA 1UH3A 3NJ3A 3FW6A 1E40A 2EADA 3CZ8A 3AHYA 3MSDA 1CPUA 4NX0A 3W27A 4UOZA 4AZCA 4UZSA 4OBSA 4AW7A 5DFAA 2VX7A 4HZ8A 3VSUA 1TMQA 3LPPA 3WELA 4YPJA 1GQLA 2WPGA 1BFNA 1BLIA 3GDBA 3VIOA 4J3UA 3S6TA 3VD3A 1B1YA 5JIWA 3B9EA 5EFFA 1TQSA 1CWYA 4DUXA 3WD0A 2X0YA 7TAAA 2ZUUA 1E4MM 5HBFA 2D23A 1QX1A 3WENA 3SCVA 2WMKA 3DYMA 3HN3A 3WD2A 2YDQA 4WSJA 3WH6A 1ISVA 2VL4A 3W29A 4AEEA 4JAWA 5KEZA 3TTQA 3POHA 1NP2A 3QOKA 3N18A 4GO8A 3VMOA 1NOUA 3DX4A 4NXSA 1V6XA 1XD1A 5I78A 2UY3A 3J7HA 1R7OA 1E3ZA 2AMGA 4UQEA 4OUEA 2CITA 1XGZA 2ZUVA 2BY1A 1ZBKA 5GNXA 3VDAA 2BVTA 5E1QA 2QMJA 3N12A 1Q6DA 1BPLB 1HT6A 1I75A 2EPNA 3CGTA 3WY3A 1EHAA 4FNPA 1KBKA 3CLWA 2VQUA 3HG4A 4IPLA 1OSEA 1WDSA 4HPGA 2CETA 2WCGA 1TA3A 1OCQA 5ABFA 4CN6A 4QP0A 2E9LA 5CPTA 4IM4A 1CLXA 2FHCA 1C7SA 3W4RA 2OW6A 5FCZA 2Y8VA 3PZGA 4ZFMA 3F5KA 3MANA 3BMWA 2ZIDA 1H2JA 1MXGA 3NSNA 1K9DA 4AD0A 2D1ZA 4PRWA 4GXPA 3EMQA 5A95A 3VU2A 2DQXA 2G3IA 2O9RA 3I3EA 3RM8A 2WVUA 1XYZA 1EXPA 1CGUA 1UQYA 1W3HA 4N0RA 3WQWA 3JUGA 4URIA 3AICA 1LWJA 2F7OA 1LG2A 4XX6A 1V03A 5LA2A 4S3JA 4AD5A 3LPGA 2GJRA 3U7VA 1JNDA 1V3HA 1QI2A 2DT1A 5A8QA 3HU7A 1EGZA 1NOFA 3AXIA 2RGLA 2WMGA 1VF8A 4PSPA 3SCWA 4EE9A 2VR4A 1EIBA 1CDGA 4QAWA 4HA4A 1O7AA 3K8MA 3WDQA 3LRMA 4M24A 3WDJA 5FL1A 2GK1B 3AHZA 1WP6A 1C8XA 1C92A 1GQJA 1HJVA 5D9PA 1KWKA 1XH2A 1ZBCA 1ESWA 3BMVA 1CXIA 2DSUA 3VM7A 2CIPA 1EO5A 1S46A 1PAMA 5HPCA 2E9BA 1KXQA 3K46A 3BAYA 1W9UA 1KB3A 1VRXA 4MJ2A 2WAGA 4P7OA 1G5AA 5HXMA 2A3AA 1GOIA 4AYGA 2BVYA 1CXHA 1GVYA 1EHNA 3A47A 3CBWA 2WHMA 2Y8KA 1UKPA 2YDRA 2BXZA 4EK7A 5CPQA 2DH2A 4BF7A 2JEPA 2VCAA 2VRJA 2GJXB 3WMCA 4AZ5A 4W93A 3UEQA 1UG6A 4GIAA 3MV01 3VIFA 3CHFA 4U5KA 1JNEA 3W53A 1R34A 4AD1A 4JL2A 1EO7A 3U57A 1NP0A 4P7LA 3GH4A 5M17A 4PMXA 4CD8A 3H54A 1YQ2A 2PI6A 4UFMA 2ZX7A 1CBGA 3M7SA 1LL4A 1J01A 4H2CA 3VGFA 4TVCA 4P7RA 2J77A 4BA0A 3WFZA 4B15A 2B31A 1PZ2A 3D5HA 3U5YA 1E70M 1E0VA 3VSVA 1W9DM 4U5IA 3ALFA 2WC3A 3SCRA 2HISA 1TQVA 4NZCA 5I24A 3BGAA 3BVXA 5I6SA 4W7VA 1ZL1A 3AZSA 3BSHA 2A3EA 1E4LA 2WVSA 2XN1A 2RGMA 5JBFA 4JKKA 4A3HA 1MW2A 1QNPA 3GNPA 3H53A 2OYLA 1B3ZA 3GYCA 4M81A 1VIWA 4DWSC 5CLTA 2DSZA 1D3CA 2D0HA 1OIFA 1E56A 1JFXA 4TOQA 4EAMA 1JDAA 3WDRA 4F66A 1JDCA 2EJ1A 3GH7A 1KWGA 1LJYA 3KWXA 2VJXA 4PEEA 4TVDA 2VX6A 3AISA 1TR1A 4OBRA 1RP8A 3FN9A 4CN4A 1PX8A 4LYPA 1GORA 2D0GA 4GPNA 3EYPA 4WK9A 4AZ7A 1V6VA 2V3GA 1IV8A 3CMJA 1DTUA 3L4XA 2W92A 3ZJKA 4JFTA 2C0HA 2CYGA 5D9MA 4MNKA 3L4UA 3WF2A 3VIGA 3T2OA 2ZICA 3GBDA 3N04A 3D4ZA 5BRPA 2YLAA 1E6ZA 1RD6A 1E43A 4U3AA 2UY4A 2XGIA 3VGEA 1CEOA 4CUCA 3ARZA 4GQRA 4TX6A 4W8LA 3WF3A 1VEMA 3AIEA 4M1RA 2XVKA 1W9XA 2JE8A 1E5JA 5DMYA 2WHJA 1BTCA 3WN6A 1DEDA 5ECUA 2YBTA 3A5VA 4W7WA 4QLLA 2DSVA 3RM9A 2VOTA 1WB0A 2NT0A 1GOWA 3WD4A 2HVMA 3CV5A 3O2LA 1VEPA 2XM1A 1BG9A 2ZXAA 5D9NA 4M56A 4UQBA 2X05A 3WH7A 3VIHA 2EPKX 1C93A 5BXTA 1CZ1A 5I5RA 1JXKA 3EMCA 3BAIA 5F7UA 5DT5A 1BAGA 2C8NA 4HA3A 1HTYA 4DWSA 3LRLA 5A69A 4HMEA 7A3HA 1KTBA 1DWJM 3AHVA 4KMQA 4WSKA 2BHYA 3GXDA 1P6WA 1BYCA 3M07A 3EJQA 1KQZA 2JIWA 3D50A 3SCTA 2VURA 1ZBVA 4D1JA 2EO7A 1F4HA 3WD1A 1PEZA 1JAEA 1UWQA 3WUFA 1G94A 1V6UA 2NW0A 4W84A 3A3HA 3GZAA 1V3JA 1MVYA 1LL7A 3BUPA 1ITXA 3I3BA 1QW9A 3CUGA 2XFRA 2O92A 1PIGA 1TUXA 4JFSA 3LXAA 3ZOAA 3T0DA 3CZEA 1NOWA 1ISYA 4PN2A 5A2BA 2OWXA 1NWRA 3HG3A 3WNKA 4AD4A 4HOZA 4PUEA 4AZGA 3QOMA 4UQDA 4LYRA 1XCWA 1BYBA 2CBUA 1HVQA 2CKRA 3VPLA 4ATDA 1UR0A 1QPKA 3WF0A 1WAWA 2W61A 1ODUA 1BSIA 3CUFA 3MKKA 1EQCA 4PMUA 4AEFA 2J7CA 4W5ZA 1UUQA 4M8UA 1E6NA 1GCYA 3RILA 3VIIA 4W86A 3CHDA 5A1AA 1XC6A 3PN8A 1H41A 4FNUA 1WNOA 2EAEA 3ZM8A 3RCNA 4P8UA 3IANA 5A8MA 1KCKA 2GDVA 1CXFA 2VT0A 3BVVA 4MAZA 4CD5A 2BY2A 1R46A 4UFHA 1GZJA 3ARVA 4S3KA 4MB5A 3VUPA 1W3KA 4CVUA 1E1EA 1U30A 1UASA 2EEXA 2JALA 2ZWYA 3AJ7A 1ZU8A 5A6MA 4AXNA 3PTMA 1UD4A 1RH9A 2ZUSA 1QVBA 2WVVB 4A4AA 4UFLA 4AZCB 5DO8A 4CD4A 4K68A 4LX4A 3WFLA 3ARWA 5I2UA 3D4YA 1VAHA 2EXOA 3NSMA 4JFVA 3VD7A 3MMDA 3KE0A 1N82A 2CBJA 3UESA 2J7EA 3RM4A 3PZNA 2VVNA 1QNRA 3NUKA 2J79A 3AS3A 2DGAA 2WM0A 2D0FA 3DECA 3HMCA 3KL0A 4CCEA 1UQZA 1UWIA 3TTOA 3WH9A 5A6SA 1NWTA 2E4TA 2DT0A 4X0VA 1UD2A 4Z2IA 2VZSA 5DF0A 3OLDA 2AOSA 2XWDA 4OKDA 2VZUA 1VJZA 5LYRA 3DX1A 3LPFA 1UZ1A 4JHOA 2MANA 3BVUA 4MJ4A 1UHVA 3CO4A 1E1FA 2PC8A 4MB3A 4U31A 3I3DA 3PZUA 4NZJA 1X1NA 1U33A 2WVTA 1JAKA 1ZBWA 1H4PA 4QDMA 4UZUA 1CNVA 1MFUA 3VDCA 4JZ5A 2CNCA 2AAAA 3T2QA 2YOCA 2EPOA 2O9TA 1EDTA 3EJRA 4UTFA 5BRQA 1VBUA 1W3LA 5D8ZA 3AYSA 2OSXA 5I79A 3PHAA 4J28A 1R87A 1FHDA 4GKLA 2BVDA 3O6AA 2FYVA 1Z32X 3VIKA 3CC1A 2ZX9A 2ZE0A 1TVNA 3OA5A 1W9PA 1WZKA 2WXDM 4PTWA 1HL8A 3WF1A 1XHGA 3A4XA 2W63A 1GOOA 2WZHA 3WNLA 4FNRA 4DWSD 1KFWA 5BWFA 3OLEA 2BS9A 4OZOA 2XM2A 1Y7VA 1BGGA 4FLQA 4HZ7A 1HKJA 2GUYA 3N11A 3OG2A 3OBAA 1J0IA 4PMNA 1BQCA 2D24A 2EACA 1E72M 1WKYA 4E8DA 1QNQA 3A24A 3OLIA 1VBRA 3RMEA 4H8UA 3W6LA 4QCEA 4L4OA 1V6YA 5A2AA 1ZJAA 3N15A 3VNZA 1CGWA 1GQKA 1PJ9A 5E0CA 4KRUA 4D6CA 3A21A 3ZO9A 1OD0A 1US2A 4ZEPA 3IJ7A 3PZMA 4Q22A 1ISXA 4GI6A 5BXRA 2YL8A 3CUIA 1B9ZA 3W81A 4AZ6A 2PWEA 3VDHA 1Q6GA 1CENA 4PTXA 1PPIA 3MUAA 5A6JA 1JZ5A 2QF8A 1QI5A 2J7DA 3AIVA 3LMYA 1ITCA 3SUTA 4OOZA 1W1VA 2D2OA 4OJYA 4R5EA 3CPUA 3KL5A 2F7QA 1ECEA 3ZMRA 3FAXA 3WH8A 2G4FA 3ARPA 1E15A 1K6AA 2XVPA 3WMBA 2XVNA 2VUYA 2VCCA 4AIUA 3AQUA 3IJ8A 4ZXLA 5I3DA 3PZVA 1CYGA 1FH7A 1UR8A 2PBOA 4HA1A 2XPKA 2F1AA 3AS0A 3WDPP 1H11A 4V2XA 1J11A 1UD6A 1NM9A 1OINA 1FP9A 1HVXA 3LXBA 5HDRA 1HX0A 1OT1A 2OSYA 1UWSA 1ISZA 3PZ9A 4HMCA 2XUCA 3RIKA 4JIEA 1J18A 2YL6A 4MNMA 3VINA 3M6DA 1D7FA 1XSIA 3WEMA 3QHNA 1TG7A 4RE3A 1MW1A 1BHGA 3ARSA 4QLJA 3D3AA 1XD0A 3ZT5A 4J3VA 5FOOA 1C90A 3OGSA 2YA2A 5IDIA 2F18A 2IGTA 4UFJA 1JZ7A 3ZSSA 1EQPA 4MDOA 1HJXA 4B3LA 2WB5A 2CESA 2XVLA 1KGUA 1V0NA 2J4GA 1TQWA 3MMWA 4JKMA 2UWFA 2W4XA 1KGXA 1UD3A 3GXIA 1E5NA 4J3XA 5I23A 3NYDA 3W26A 3WDHA 1EOMA 1NARA 4MB1A 1XCXA 1R75A 3SUVA 3WUBA 4EKJA 3BUQA 2JEQA 1WDQA 1OD8A 5AYBA 3WMSA 4D6GA 4FLOA 3VGGA 3B8SA 2DT3A 2W91A 4BQ2A 3L4YA 4H8VA 1QHPA 2E9MA 5D8WA 4Y7EA 4E8CA 3VKKA 4KRTA 4AISA 4B16A 4BS0A 3AMCA 1W1PA 2ZUTA 1KQYA 5EBAA 2DH3A 4JFWA 1VB9A 2Z1KA 1C8YA 1LF1A 3AROA 3A4WA 2QPSA 3LXCA 3IAPA 3WBEA 3SCPA 5A8PA 5A94A 3UG3A 3ECQA 4W8AA 1DHKA 2VCBA 3WQ6A 3MUIA 5IHRA 1V0KA 3HG2A 4AD2A 3EDEA 3W6MA 2J78A 1LL6A 2WSPA 3GXTA 2DIJA 1JD9A 3BC9A 1W1YA 2JF6A 3VD9A 4W7UA 1AMYA 1QBAA 3BSGA 4UQCA 3QGVA 5E0FA 4JCLA 4WKAA 3IK2A 1KXVA 3L4WA 1IZKA 2WC7A 2WMJA 2GDUA 2DT2A 5JUVA 1HNYA 1GHRA 1HL9A 1QWNA 2QV4A 2PF0A 4XV0A 1OGSA 1UOKA 3OB8A 3GXPA 4W8BA 3SUWA 3L2LA 5BCAA 2J62A 3BCFA 1R33A 2E3ZA 4F9DA 4P8WA 1VJSA 2XFFA 1UR2A 1UWTA 3LRKA 2CPUA 2OWWA 1XSKA 1QWUA 3DHUA 4J7RA 2YL9A 4D6FA 3SURA 3WY2A 1UKOA 2X2IA 3ARQA 1KR1A 4PYSA 4WKHA 3CZJA 3RPMA 1QI3A 4DUWA 1PZ3A 3VIPA 2VTFA 2ZOXA 3FHQA 2D3LA 1WZMA 3BLBA 4UNIA 5EMYA 1HKKA 2GK1A 4PMDA 3UG5A 1NH6A 3WL1A 5M5DA 2YFNA 1VFFA 4JKLA 3ARTA 1E4IA 1FFRA 4CCDA 2BFGA 4D6DA 1HJWA 4PMOA 2XTKA 3IAQA 2J7HA 5CLWA 3EJUA 4BZYA 5E70A 4H04A 3DX3A 1C7TA 1E73M 2YFOA 3PZOA 4CD7A 3MS8A 2A3BA 1JDDA 1B31A 3FHAA 1E9LA 2PBGA 4WJXA 2A3HA 4NRRA 3AOFA 3MUZ1 1CXEA 2WYSA 1MW3A 1FP8A 1CLVA 4UCFA 4PMZA 2YLLA 3DDFA 2XG9A 3T0BA 3AFBA 3ZT7A 4PBGA 3SUUA 1AQ0A 2UY2A 1VENA 4B9ZA 4ATWA 1SYTA 1WCGA 1MW0A 4WKFA 3AI0A 1UA3A 2BHUA 1SZNA 4HU8A 3BH4A 1O7DC 5E9AA 3AXXA 3MV11 3T08A 2VO5A 1B3XA 2F7PA 4PCSA 2OLHA 5CZKA 3DDGA 1A3HA 3OZPA 4AMXA 3M46A 4FLSA 4U2YA 3EJPA 3W0KA 3WD3A 2OYMA 2VMFA 5GNZA 2VR5A 2J8FA 4FMVA 2YBUA 5A8OA 3DX0A 2ZUWA 2XYLA 4ACZA 4TUFA 1KBBA 2WHLA 3S2CA 5FIPA 1R8LA 3BLPX 3EDFA 3AMDA 3CHEA 3AZTA 4FNSA 1W2PA 4GZIA 2V3FA 4FLRA 3CZLA 1BGAA 1Q4NX 2PWHA 4JCMA 2PWFA 3QR3A 1OB0A 5M03A 1JI2A 1LQ0A 3ARXA 4UR9A 1JZ3A 3G6MA 2Y2WA 2X09A 1WDPA 3EDJA 3G6LA 4L4PA 3AIBA 1FHLA 1UKSA 1H0IA 4FNTA 2WNWA 2VVSA 3ARUA 2WK2A 3TONA 4AZBA 3WIJA 1R47A 4GINA 5LA1A 3GXMA 5A6BA 5C8BB 3CHCA 4DM2A 2WCAA 1VFOA 4LPCA 1E0WA 1SR0A 5EB8A 4DUVA 4W89A 3KLLA 1GQIA 2Q8XA 2EBNA 4QLKA 1PX3A 3VX1A 3NDZA 2XHYA 5GPRA 2OW7A 4AIEA 2J25A 4D6HA 3AS1A 1R7AA 3CZGA 4ACYA 1UZ4A 4NXKA 3U7BA 3AS2A 4ATLA 2WBGA 3WH5A 2BY0A 3VGBA 2TAAA 2DDXA 1E71M 3APGA 2X1IA 3WUEA 2WMIA 3KL3A 4RE4A 1DP0A 2ZUNA 5CSYA 1MFVA 4LXFA 4NF7A 4EANA 2V5DA 3T0AA 1H1NA 3WEZA 4ZENA 3BVWA 4AC1X 1H3GA 1W9VA 4FK9A 4V28A 2QLYA 4D1IA 2VZTA 2X0HA 1NQ6A 4NRSA 3MUY1 4GZJA 2G41A 4V27A 2UY5A 4F9JA 5ABGA 2Y24A 4AY1A 1QBBA 1HJSA 2ZXBA 1G1YA 2PB1A 4M82A 3KEHA 5M3WA 3DHPA 3VD5A 2VX5A 3U5UA 2WLYA 3VILA 1B30A 3TTSA 1MQQA 1EH9A 1NWUA 2CHOA 4BQ3A 2OYKA 1W91A 1GVIA 3KLKA 2VNCA 1LLOA 5CQ1A 1GUVA 2ESCA 4DM1A 2DPEA 3L4VA 4CKQA 1QNSA 4CU7A 1AVAA 4PCTA 3F4VA 4KGJA 4XUYA 2BV9A 1ZS2A 1HXKA 1TQUA 4UQAA 1JZ2A 1UKQA 3K8LA 2DSWA 4C7DA 4MADA 2WBKA 3RO8A 2J75A 1J0HA 3QHMA 1JYXA 3O9NA 1IZJA 2QHAA 5GNYA 3UR7A 2V5CA 1J0JA 1WDRA 2QMKA 2WZIA 4TXEA 2VRKA 1JYNA 3TP4A 3AYRA 1C91A 1NWSA 4UOQA 3VOCA 1OWQA 1W2VA 3BXWA 1M53A 1HN1A 3UR8A 2G3JA 2ZX8A 3TOPA 4TTGA 4JFUA 2J74A 3T2PA 1V02E 5AC4A 3WQ5A 1M7XA 2YDSA 3DYOA 4QFUA 4WF7A 1SFSA 2ZXQA 5DT7A 1JZ6A 3SUSA 1OBAA 3EBVA 3ZT6A 2FGZA 4U33A 1XH1A 5GQBA 2CXGA 3VIJA 1H49A 3SEPA 2CCRA 3S5YA 1FH9A 5IFPA 4FNQA 1TA3B 2QPUA 1PS3A 2CEQA 5IFTA 5ABFB 3VM5A 4QCFA 3B9AA 3A23A 1WZLA 4MDPA 1V0MA 3VNYA 1UWUA 5E6ZA 3EDDA 1TQTA 2DIEA 4M29A 3HG5A 2E40A 4MTVA 3N1AA 3GM8A 1TVPA 4XZBA 2F7RA 3EMZA 1KCLA 1KXHA 2CERA 3IGUA 2WKGA 6TAAA 3FAWA 4W5UA 3N9KA 2WC4A 4D6IA 3WQ8A 2ZX5A 5A6LA 1HKMA 1OGGA 2WVVA 4R27A 1CTNA 3RJYA 2EABA 1I1WA 3GH5A 1E55A 1GW1A 2A3CA 5A3HA 1KTCA 3VGDA 4CGTA 1EDGA 3BUBA 1HJUA 4AMWA 2G8ZA 2VI0A 1Q6CA 1QHZA 3RDKA 1C8QA 2D3NA 1PIFA 1GJUA 1WPCA 3BAJA 5CGMA 5A6BD 5IXEA 3E1F1 2J7GA 2O9PA 1JFHA 2V38A 3ALGA 1E6QM 4J27A 3PZQA 3BAWA 2VRQA 1JGIA 5BXSA 1CGYA 2YA1A 1B2YA 4AIOA 4D6EA 4Z2HA 2VX4A 4YHGA 1EOKA 4P7QA 1KGWA 4BQ5A 3K4DA 5I77A 5CG0A 3GNOA 4D72A 3II1A 3VVGA 2CBVA 2Z1SA 4MNJA 4LYQA 5LA0A 3MMUA 3WY4A 2O9OA 1V3LA 3OGRA 3WL0A 4HU0A 1Q6FA 4AWEA 3OLGA 4JL1A 4W87A 4WLCA 4KWUA 3VTRA 2X2YA 3CIVA 1UH2A 5CPSA 4J3WA 3D52A 1E6RA 4AD3A 1J0ZA 1W1TA 1HKIA 1F4AA 1DWHM 4UQ9A 1XYFA 4J3TA 3D51A 3B9DA 3TTYA 3S5ZA 5JIPA 3W25A 2F61A 4UFIA 3QHOA 1M04A 4HMDA 3H55A 1K9EA 4MPKA 4CVWA 3VO0A 3TV8A 5A2CA 2IUZA 3BVTA 3CZKA 3OGVA 3THCA 5BROA 4B9YA 5D9OA 3SIMA 3WNNA 3A22A 4HOWA 2XWEA 2CBIA 5E09A 2YA0A 3CUJA 3WUGA 1E6PA 5CGTA 3AHTA 4U3CA 4P8XA 3F5JA 4XB3A 2JFEX 2JF7A 3LX9A 5JBEA 2J7FA 3MU7A 1OT2A 1L8NA 3AIQA 1JYWA 3DYPA 5TD4A 3NIYA 2XVGA 4LQ1A 5AYIA 2XN0A 3BAXA 2F8QA 3VX0A 1JXJA 3EJTA 3AIUA 1BVZA 1UH4A 1V3KA 1GOKA 3A4AA 3SCNA 1OM0A 3FXYA 4PMRA 1UYQA 3SCOA 1B0IA 1GHSA 2W5FA 2Y5EA 3L4ZA 4F79A 2E0PA 4RL3A 2WMFA 3HJEA 4LGXA 1MXDA 2XN2A 2X2JA 1V6WA 1JG9A 1I1XA 1DWAM 8CGTA 2YIHA 2J47A 2DSKA 3ZR5A 3UETA 4W88A 3CZSA 3ZR6A 4PTMA 3ZIZA 2OSWA 4IPNB 3WY1A 3EDKA 2X2HA 1PX4A 4HP5A 4HZ6A 1JYVA 1OIMA 4D6JA 2X8RA 2V3EA 5HPOA 1KR0A 1J9YA 4C7GA 1JL8A 2FHFA 1DWIM 3WDIA 1HJQA 2BNJA 5FKYA 3MSGA 1M03A 1ZB5A 3MI6A 1XSJA 1V08A 1QW8A 5HOSA 9CGTA 1K9FA 4MAVA 1DWGM 2FH6A 1BYAA 5EFDA 1HWWA 2WWDA 1BYDA 5FL0A 3AMKA 5IHSA 4MNLA 3ZQ9A 3WNPA 5HNNA 6A3HA 4DO4A 1B3YA 4Z2LA 3GNRA 1XRVA 3PZTA 3VIMA 3ZSTA 4F8XA 1GOQA 1QNOA 1MQRA 2ALWA 1IT0A 2ZWZA 1BVNP 3DC0A 4X0NA 1C3FA 3VGHA 1X6LA 4CN1A 1DWFM 3FNDA 1QI4A 4D71A 1H09A 4FF5A 3WSUA 4ACZB 3W37A 1M01A 3AIRA 1QHOA 4AZHA 4DO5A 4RE2A 4DWSB 2FE0A 5E6YA 1JIBA 5JBDA 4P8VA 2D20A 3VDBA 2VQTA 4U2ZA 1UR9A 4MB4A 1FOBA 1W3JA 4CU6A 1VFUA 1HIZA 2NSXA 1RP9A 4YN5A 1T0OA 3RJXA 1CGXA 4N42A 4C7FA 3UERA 1QI0A 2WWCA 1L0PA 1BG4A 4IISA 3BAKA 1R85A 1UA7A 2GJXA 2W66A 4Z2GA 4H8HA 2NT1A 4HTYA 1GJWA 1UKTA 3OZOA 5A8NA 3TA9A 5D4YA 2E8ZA 1HF6A 4H41A 1JI1A 5FD0A 3WF4A 2VZVA 3UG4A 1E6XM 3EJSA 2WLZA 4P7NA 3A6OA 4TVUA 1J0YA 1TCMA 2W67A 1V0LA 1MWOA 3GBEA 1G01A 1E3XA 1GNXA 2WMIB 1AQMA 1JZ8A 2XIBA 4PUDA 3ARRA 3N13A 2BY3A
chains in the Genus database with same CATH superfamily
4TTDC 3VFNA 4PGEB 1QLFB 4QQ3A 4FR1A 4B4FA 3M17B 4KCTA 5EBLA 3UX9B 5EUKB 1G7LA 4TX8A 5MERA 3N41F 1S7QA 3TH6A 1NAMB 2WCSA 3P0VL 2P42B 2YBRB 3W7DA 2P53A 4N86A 5FAAA 2N59A 2C15A 3NIGB 3AZRA 3RY6A 1WAUA 2PCFA 3M0HA 3NJGA 3GJEB 3B3IA 5JR1L 4A37A 2BZCA 4I9AA 2NLYA 1EF3A 3IWVA 2A74B 2V5TA 3HR5B 2R2BA 4JQXC 3FT2A 12E8H 4MJ5B 3HFYA 2W0FA 4PUWA 1X9UA 4QIUA 3W87A 4LCCA 4AIBA 4R7JA 2HPMA 1UUMA 1XIEA 1JF1B 4Z2JA 4H25B 3PK7A 2NXZD 2JXMA 5CXPA 1IL1A 2FB2A 3T4YA 1AS6A 3GKWH 3AWOA 2WMHA 3IWUA 4IFKA 2ZNXA 4TTUA 5HNUA 2F5AH 4IMLB 4WO4B 3W24A 1KFKA 2YKKA 3MUGB 1HHJA 1M9HA 3CH1A 4F0HA 4P49A 1MJUL 3MBWA 2IBZY 5FEPA 2OAAA 4ZFCA 2CLKA 1CB7B 1RJZA 2FBJH 5IR1A 1ACXA 4L3CA 1BF2A 5CZRA 5T5NG 1F4XH 4FFZH 1V02A 1HIMH 1CGTA 3NP3A 4RA0C 3NJIA 3P1VA 1YEDA 2JF1A 3DJSA 4NQEB 2XA3A 4PR5A 3CTTA 3WEOA 2YARA 3QPZA 2VM8A 2OU4A 1KBGL 4L8SA 3LZQA 4G8EA 3ULVL 4CD6A 5D4HA 3WQDA 3FO2B 1HNGA 1MKFA 2XFGB 2Y5TB 3UP6A 3QUKA 3WJMA 2F15A 2XWCA 3RVTC 2XYCA 2ZYFA 3FGCB 3BHBB 4U6XB 1AOHA 2FGLA 3MV7E 3RGVC 4OBTA 3ZDZE 3WNJA 3QCUL 1S7TA 3VTTA 1PTGA 3KMDA 3ZGIA 4PBWD 3MBDA 5I8KH 4IJRA 2XWJA 5BS0D 1U22A 4EUPG 5JMRA 2DIAA 3C9NB 3WD0A 2WMKA 3IETB 4MDJA 3SBFA 3GTVA 1C5DA 4KPLA 4K7PY 1P4BH 1UYWH 4UV4H 3FQ1A 3TTQA 3POHA 2J71A 1MJ7L 5REQB 3KS5A 3O0FA 3WEXA 3RLUA 3F84A 5A2LH 1ZAHA 3GIPA 4GX9A 4IICA 4NXSA 1GGOA 1CX9A 3N40P 3J7HA 4N9CA 3R25A 1GRWA 2QYGA 3LU2A 1Q0XL 3FB7A 5GS1B 5AL0A 1ZHKA 2QMJA 4GOAA 4PRDA 4MCYB 2CMRH 4IPLA 2IPFA 4ZO8A 2BVQB 1H6UA 3O41B 1V7MH 4FOMA 2O5YL 3S3DB 4ZQCA 5EEUA 1MDTA 4YVNA 3BPLB 3NIDF 2X9YA 1RZKL 1DPMA 4LLMA 3AAZA 4JTCA 3IGFA 5JPMB 2NZLA 2G3IA 3A4EA 2X4OA 1S9WA 1J9QA 2F7OA 3BG9A 1K4GA 3UWQA 2DT1A 4XCFH 4GFTB 2RGLA 2GJNA 1FVCB 1N7ML 4JN1L 3Q9PA 3SCWA 4X4ZA 5B22A 3GSNL 5CCGE 4GJ1A 4M61A 2ISWA 4M24A 4HC1A 3NVQA 2A4ZA 2PCXA 3EWDA 4R9HA 5HI3C 4RPQA 2DQEH 5LNDA 1KWKA 1XH2A 1M6OA 2E6JA 4X6EB 1OW0C 3O16A 1RFDH 3CFEA 1IBZA 2E9BA 3O11B 1A3RH 4F8TA 3BAYA 4D9RE 4MFHA 4I7WA 5A2FA 1F3XA 2DZBA 2VB5A 4BF7A 4A35A 3FFSA 1IIHA 1OTSD 3HRZA 1AKPA 1NDMA 1LOLA 3DOIA 2GG1A 5I3HA 1OGAB 4OFIA 1G7UA 3GFYA 4FQPA 3IPEA 2IPJA 4Y6GA 4PJGB 2PI6A 5JQ9A 2O4EA 4KEUA 2HJPA 1WITA 1J01A 3TC6A 4TVCA 4JDZA 5E24E 5EG6C 1P84J 2HWZH 4LCYB 1OYCA 1D6EB 4IKKA 2K9UA 4LIQH 3QUYB 1KJ2A 4R7VA 4K71B 3QWRD 1O12A 2P10A 3EO9H 3QRBA 4FKEA 1ETZB 4JLRA 2QEJA 3H53A 3M1ZA 4N0FB 2BIIA 2DSZA 4X6BA 1T99A 3DUUA 2VQ1B 4V1DB 1UCWA 3KWXA 3B9NA 3KCPB 5J06A 1HDMA 3S5OA 1V6VA 2V3GA 4M02A 2Z91A 3TF7C 3MLWL 4MYAA 3CZFA 1XFBA 4JNMA 3GD6A 3QPYA 3GZQA 2MOGA 3H3PH 2ZXGA 4KFOA 4BD4A 3T2OA 5DGRA 4H0LC 4UUIA 4U6VH 3SQOH 4CUCA 6PAZA 3ARZA 4W8LA 4M5YH 2WHJA 1P4LA 3VACA 3PGFL 1BXVA 1Q2SA 3IGAB 2BNUA 3E2HB 1VHNA 2B0SH 1V51A 4UQBA 1NINA 2CO6A 5ENWB 3NA8A 3MV9E 2NV1A 3UA3A 1NFDA 4O1DA 5C0NC 3N9SA 2C8NA 4J2QA 1PCWA 3RDTC 4GUOA 2CNYA 7A3HA 2K9FB 4QG9A 4IOSD 1TMLA 4KZEL 4P5TC 2JB5L 1UMLA 1ED3A 2JIWA 1KGYE 4D1JA 1JRCA 1QR7A 3P3TA 2EO7A 2UV8G 1UWQA 5K9QI 1ITXA 5CJOL 2O92A 3VWJC 2EUWA 3B34A 4AYFA 3BQUA 4L9ZA 5A2BA 2OWXA 2NY3B 1K7XA 1XGPB 5FDWA 2AEQL 2MHAA 4RBPK 2WSRA 3R0NA 4UV7L 1E7UA 2P5EB 1ZDQA 3GS4A 3GSXB 4XPBH 3ARDB 1MLBB 3KBFA 5PTDA 4HK0B 2Z1BA 3OO2A 5AWNH 5E99L 4P8UA 1P7HL 2ZDSA 3WQEA 4JBRA 4XPFL 1H0DA 1L5GA 2ZRXA 3CIWA 1D5XA 2HX8A 2DUZA 1HEZB 2P47B 5CSGA 4U1HB 3X17A 1VAHA 1BD2D 5EEVA 3NSMA 1XFPA 1YAIA 2VDGA 1EWEA 3W1NA 3IIZA 3DBPA 4L64A 2BPBA 2VVNA 2J79A 3CQJA 3QI9A 5H2ZA 3QQDB 3MX0B 1SQ2N 2NY1C 1I9IL 2O5ZL 3EH4B 5DF0A 5FJTA 1URIA 3ABGA 4Y2OA 4M7LH 3NN8A 1L0QA 1L2QA 5I0VA 4QRPD 1ETB1 3C2RA 3MP3A 5DWUL 3PZUA 1U33A 1L7IH 1AD9A 3GMMA 3GW0A 1K8IB 4JZ5A 1YYLL 1JRHL 1NFPA 3CFBA 2O9TA 1VACA 5C9UA 2R7EB 2P8MB 5FYLE 4UAOB 2GBVA 5I07A 5D8ZA 4HK5A 3B1UA 1FHDA 3K6IA 2HT3C 2ICCA 2AGJH 5G1MA 5D70L 4XN5A 2WXDM 4F57H 5CLYA 4S38A 1H6EA 1EBGA 3OGCA 3CAWA 3IDJB 4XNAA 5EF2A 2FBOJ 3UF9A 2GUYA 3N11A 4PMNA 1TU2A 3FL7A 1N0LA 4PJ5B 3ZW3A 5D03A 3IMVA 5D37A 3FB6B 1LNUA 5MHBA 3KPSB 1NMAL 1VPQA 4JREB 2ZAHA 4X42A 3X3GH 4QCIA 3ZE2B 1IM3D 2FJGA 2MH4A 1AS8A 1JN6B 4O1CA 4A7SA 4E0RA 4H3DA 3RF9A 3GFXA 2A9AA 1K4CB 2P88A 1I8IB 4YSAA 2OODA 2VCCA 3SCMD 1DJYA 2IMMA 3AC0A 1EEZB 3EX4A 3BFWA 3SYAA 4LBRA 4E2DA 2BZNA 2XPKA 3D85B 3GUTA 1G4TA 5FO8B 2I9LA 5C09B 5D2LF 5H1WA 5DZ9A 3ATDA 1MF2H 4MAUH 1S7UB 3TGXA 3QJTB 1JHLL 2IFFH 2F18A 4Q4RA 3WLBB 3QXAA 1CFQB 1GIGH 4WZ9A 4MDOA 4B3LA 3LRSA 3ZRFC 4N24A 2WWMD 4HXBH 4JPKH 1YPZE 4I77H 4MHHG 5DWPA 1G7JA 4L8DA 4AT6A 3GGWB 4I48B 2EYTB 4HCRH 5GHWH 3CSBA 4XVJH 3B8SA 5DS8B 5IEKB 3K2GA 4Y7EA 3FXIC 1W1A1 1O9VA 3P69A 1ZV5A 2QQNL 1KULA 3GHUA 2CXEA 3B04A 3ESNA 3KYMA 2AXFB 1KLZA 2YC1A 4GKNA 1O94A 3TFCA 4W8AA 3PWGA 2K8QA 1V0KA 2E1WA 4ONGH 4OLUL 4UM9B 4WDUA 1E9OA 4HKXB 2QZ5A 1XB8A 1GVSA 2QKFA 1NCCH 2AFNA 2DQDH 2A4CA 4LDLB 2OMZB 2WHVA 2WMJA 5FOJA 2GGHA 5E1IA 5JHLL 3GS0A 3EYQD 1T5XB 1UOKA 3ATEA 4KK5C 3OZYA 1OQOA 3N3TA 4R7NB 1FWFC 3H2PA 1H60A 4NBYB 2F5BH 1UWTA 4IXHA 3SDDD 4POZC 5EDXA 1QSFB 5CZJA 3C5SA 3ZN6A 4HXAH 3KM2A 3GQFA 1O7VA 3ATFA 3VZZA 2GK1A 1FNSH 4LLUA 1NH6A 3ZE0B 4HAKA 3AT9A 3LCHA 1CD1A 3MYJA 3N50A 1M42A 4JN2B 3UD6A 4C55A 2VFIA 4IRJA 4E3VA 5HWJA 1B31A 1E9YB 3CFKB 2OV0A 2YD5A 5FF6A 3SY6A 4ODWB 2Z6FA 1CLVA 3LOTA 3RWHA 4JHWH 4MNGE 5I06A 4M4RA 4Y8AA 4XH2B 2VFGA 4LH8A 4AQ1C 2PCPB 3NCCB 3VRJA 2OLHA 1IYXA 4J9JA 4EOUA 1A3HA 2X4RB 4U2YA 4PJ7E 1AL7A 3E9TA 4LUTB 4UWQB 2J4WH 1IWAA 4FQLH 3V4PB 1UP0A 2NZ9C 4XD6A 3TF4A 1LMKA 1OB0A 2HRPH 1YNTB 4ZB5A 4WCYL 2I85A 4P2CG 1L7TH 4FP1A 2GOUA 1NGWB 1Q5MA 4F58L 3TCLB 4URKA 2OW7A 2ARJA 3E0WA 5J11C 5K39A 1Q66A 4ACYA 5TE7H 1UZ4A 4Z7QE 1YEFL 2FX9L 2TSAA 2X1PA 4ATLA 1U2HA 2TAAA 4YDLB 3KS0H 4NF7A 3O06A 1W3IA 2IDUA 3WEZA 5HJLA 2VZTA 2XPYA 4W9HC 4TU1A 1G7PA 3VFGH 5TJWK 1FL6A 4DPCX 1FWAC 2WBXA 1YEGL 5XINA 3VD5A 1MWAA 3DURA 1TCRB 1JTTA 2E5EA 1IBGL 4ATTA 2ZP9A 3AXLB 3GC5A 4Y19A 1CZ8L 4NJ9H 4CU7A 4U6HB 4KGJA 1MOEA 4ZFOL 5AAMC 4HIEB 4XVSH 4GH3A 1MDLA 5D7IA 3UXAA 1E7VA 5CZ0A 2QHAA 3TEVA 4AI7A 4LRIA 3SM0A 1AL8A 3GI8H 2AI0L 2YOAA 3ILQC 2X4TA 4O51A 5IBUB 2G3JA 5DHEA 4TTGA 5K1NA 1C08A 3PNWB 3MCLL 1YMYA 1DLFL 4U33A 3C2FA 3EWZA 4M51A 2WBWB 1ZKAA 4QYOA 5F93C 1FH9A 3B05A 2AMXA 2ZSWA 2QSQA 3OZKA 1T2XA 3S2MA 1W5NA 3FO1A 3QQWA 4B9JA 3FAWA 3EFDL 1TR7A 4WI9A 1CFNA 3SN6N 5CU9A 5DJ8B 4HT1L 3P2TA 1LRNA 4H88L 4N8VA 2C9XA 1R0AH 3Q5TA 2OOGA 1P2CB 4OV5A 4RAUA 1WPCA 3URQA 2ZT9C 4IU3A 3X1FA 4JR9H 3N4FA 1RHHA 1B2YA 1RERA 3MR9B 3ZKMD 1C5CL 3G1FA 5CMAA 4KJWC 4MNJA 1P9MA 5KITA 3BPWA 4PJFE 3GNDA 1W31A 1V3LA 4IX2A 4NQ1A 1B0WA 3E9UA 3AALA 1X39A 2R1WB 4QRFA 5I82A 2V6AA 3P9MB 3L3DB 4PRTA 3PNUA 2F61A 4UI2A 5GGRA 3RHWK 1PBYA 1XPGA 4P9HC 2XTJE 2IUZA 3DMMA 1OFQA 3CZKA 3THCA 1U3HB 5I00A 2O6EA 1XIWD 4L1HA 1WXYA 4HKPA 2ZA3A 1LE9B 1E27B 5CGTA 2FIKB 2VEMA 4G5ZH 2W95A 1P7QD 5ERWA 3GSOA 4UOW0 4D3CH 4LBEB 3AIQA 2GTWB 5AYIA 1NEZB 5CPNA 1AYOA 3NSCA 3BUYA 4KXDA 4EI6B 1Y6NR 1Y8BA 4KKQA 4JFHE 1OM0A 5JQIB 2VDRB 4N20A 3C2OA 1I7UA 4FQ1L 5IOPA 3OGOE 4F79A 4ZUVA 2E0PA 2R9RA 2DFAA 1F3DJ 5EOCH 1EZWA 3E6HB 3TCSA 5SWZB 2J47A 2YIHA 4RX4A 2P5ED 4QWWC 4NQCB 2COQA 3CDYA 3CZSA 3FQTB 3ZR6A 4KOBA 2DD8L 4MWAA 3GO1L 1VFBA 3CEPA 2AABL 1K7FA 1POJA 2VISA 4OJCA 4L4VD 2CLIA 1UM5H 2APTA 1K2DA 1KBIA 3NYZA 5E6ID 3LB6C 4KZDL 5J1SC 3L81A 2EDFA 5FWRA 2E25A 1MRFH 2O30A 4UTAL 4KROC 3NIFB 1WHOA 1H62A 4N9DA 1UXWB 4H1LH 4H0GA 2JKRM 2OMXA 2HT2C 4MNHA 3QSKB 3CD4A 2H32A 4A7UA 3MA7A 1XHHA 4IRSA 2ESVD 3EB4A 4LPTA 3W1PA 2YRZA 4OQTL 4HQQH 3LEVL 4M1CD 1SRDA 5JIHA 3CZUB 1INEL 2AQQA 3ZKSD 4N42A 3N2TA 1B0GA 3JWDL 4J23A 1HQRB 3OXRA 2MKWA 3MAWA 1VPYA 5EEYA 1PS9A 2FX7H 2NWSA 4XZ9A 1GJWA 1QKZL 3CX5J 4A55A 3EJSA 4P7NA 1XCTB 4EIVA 3V1PA 4MZ3A 4S3DA 1CURA 4HWNA 3H9SA 3B7RL 2BY3A 4OCMC 2VC9A 1MQPA 4XPHL 4GB9A 1XH3A 2PN5A 1O6IA 4KQNA 3WBYA 1LORA 4WJKB 4IK6A 4U1NA 1U8IB 1K4HA 1XGYH 4N90D 3CMOL 5D6CB 4LEOB 3T65B 3DJZA 1WXJA 1IXPA 2WV3A 2VDKH 1AS7A 5CJXC 4YXLL 2V7NA 1YA5A 3MFFB 1SVCP 1M68A 3H7BB 3IJYA 1G67A 1UWEL 4D8PA 4BINA 4PTVA 4WJ5A 5K9JL 4E9YA 2EINB 1KF9B 4E5XA 3FT3B 3O3BB 5CN3A 3I9PA 5DD1H 5ANME 1NQBA 4R88A 4L5FH 4X6DA 4NKOA 2VLME 5C09D 5EO0B 1WAAA 5FO2A 4G7FA 3GNML 5DEFB 4UT9L 3FUKA 1ISWA 3TJHC 2LE9A 2PWDA 1IEBA 3KVMA 2HG5B 3EO1B 5FC9A 4XTRD 4Z7VB 5JQ6H 1HQ4A 3MNZA 2VEPA 2Y0FA 2XPGA 4PRIE 4BRVA 2EC8A 4Q8PA 2IV8A 4GUCA 1UWGL 2C18A 1M7DA 2HX7A 2EDKA 4XNQB 1J6OA 1ZAGA 1QOXA 2BODX 4WIWA 5IGXH 3MP4A 4Q4IA 3HGOA 2VLRA 4DJFA 3J07A 1A6PA 4KKLC 2A73B 3I75A 3T04D 4HIPA 1KLFA 3D0CA 1BQKA 3BH8B 3FK3A 4OV4A 1Q6EA 2HJFA 4RNFA 1XGRB 4NZFA 3O8XA 2H3NA 5DHYA 1IKOP 1P7TB 4LCSA 4R0LA 4H26A 3ZQXA 3VYOA 4G6FB 4WW1B 4YHEA 5C0BA 2OL3B 5AW1B 3KOZA 4X7TA 2A6KA 3TFBA 3AB0C 3MRHA 3TIEA 4WOQA 3F00A 1R24A 3T09A 2R69A 4IUGA 3O1NA 2HBXA 5I3KA 1YIXA 4PULA 1MYRA 2OM5A 2E9GA 4QTFA 4XX5A 4DGYL 1GYCA 1PBGA 3HAEG 4HGMA 2CZEA 4K5OA 2WQXA 4MS6A 5CIPB 4JJ5A 4YTUA 4NEHB 1F3JB 3U0PB 5K7JA 1T41A 5MEQA 3AYVA 3V0FA 5G2WA 4FP8L 1NELA 3PBWA 5FYKL 5KSAC 5D5ME 1U9KA 3WLOA 3ZTEA 4DF2A 3L3JA 1GQLA 2VXTL 1B1YA 2GHWB 3B9EA 1TQSA 2DQUL 1BIIA 3UIZA 2VFFA 5T33H 2ZCHL 3EYOB 2N1TE 2G0KA 3QXWA 3T3PF 4QRQB 2REQA 4AEEA 2CBTA 3IDUA 3TC3A 5D6DC 4HB7A 1MAJA 4K0OA 2P5WE 1Z41A 3ILPB 3KHOA 5JO5A 3TWCH 3OMZA 1OLZA 1S78D 5DA0B 4OUEA 4HKJA 3RZCB 2VHLA 1KBKA 1W3TA 2VQUA 1F56A 5TNVA 1CBVL 2AV1A 4BZ2H 4YVUA 4IM4A 4YR6B 2XBZA 5G1YA 2H9AB 4MRCA 2G0WA 3MANA 2FIRT 2F0CA 2OMTA 4ZTOL 4HG4K 3EOEA 1ZCOA 2WXMA 3I3EA 1LCOA 4JQ2A 3ES6A 1IXQA 5JORA 2VR7A 5LA2A 2VITA 2NRDA 4JFEA 4HCDA 4RZ4A 3WK2A 1YVLA 4NAEA 4JZJA 2ZKMX 4HH8A 1MNZA 3K81A 3GTHA 4B3EA 4ERSL 1D5MB 3TM6A 3K8MA 3AT0A 3LLFA 1CE6A 3E2RA 4QHNB 4XNYH 5HSFA 5H8DA 1XIIA 1EO5A 1S46A 1TPVA 4EIBA 4JDEB 4K7PH 3MREA 4Y16C 4HS3A 2VH5L 2A3AA 1GOIA 1CXHA 1OFBA 1PAZA 4JX0A 1UKPA 5DD0L 3LZOA 4IBQA 4KESA 3DI3B 1XLEA 2JEPA 3C8KB 4REQB 5TFSH 5J5EA 3ATYA 2OJZH 4GIAA 3MV01 3VIFA 4AD1A 2CO2A 3RCYA 4EIGB 3X13A 4L5ZA 1YQ2A 5FECB 1F02I 5FFOA 1ZTXE 3VI3B 1V7YA 1BFOB 4LSSL 4DGVH 4NJKA 2CKBA 2HFGL 1FHUA 3CUXA 2FNWA 4P9ML 3ZDXB 4BXVA 1KIRA 3BW9B 4Z1AA 2HKHL 3HZMB 1DZ0A 5EIQA 4NIYE 2MCPL 4OJFL 4K7FB 4L1WA 1A66A 5LG6A 3GYCA 2E77A 3HZYB 5IV2A 3FZUD 1E56A 4TOQA 3INPA 2G4GA 4EDXB 4EAMA 1RZJC 1KD0A 5BS0B 2K4WA 4FZEH 3UGEA 1PX8A 1RALA 4ZSOB 4AZ7A 3QZWA 1IAII 1H8NA 1F8TH 4BI7A 5EZLB 5T91A 7REQA 4JIIX 1JXGA 2VZ3A 3GSWA 2BIMA 5IWLA 2A5UA 4Z7UB 3VOIA 3UO8B 4XBEL 3TH3T 1GG0A 5AOIA 2YLAA 4LLDA 1KCVL 4O58L 4Y4HD 2RQEA 4NN5C 3GYRA 4TX6A 2C9SA 1TDQA 4FF9A 4R96B 3TT1H 1NOAA 4M1GH 3QVAA 5IFHL 3ZWTA 3KPPA 3VA8A 3VRIA 1ZGLB 5DXYA 3WIAA 2OX1A 4CBZA 1BG9A 3AUOA 2NUYA 7PCYA 2AXJA 4KKCD 4CNSA 5KN5B 1MCPH 4PRRA 4WWKD 2XG5B 5F7UA 3ROLB 2D7QA 5HVHB 3REVB 1H3PL 1Z42A 2P49B 4QD2E 1P6WA 1WCQA 3M07A 4L9YA 3QFJD 5D7HA 4NAFA 5T3ZE 2VURA 4LAZA 2LV4A 1XLFA 3DKHA 3QWOA 4XAFA 1QW9A 2A74C 1TUXA 1F97A 2PLKA 3B3BA 1FFNB 4H1ZA 2DQIL 4PIRF 3DVNA 2J8OA 2WBJA 3NQBA 2G5UA 5TE6L 3T77A 3SYOA 4E5XG 1Z7AA 3F7LA 3THML 5HHOE 2JBMA 1JCJA 1QPKA 2WXGA 1FVDB 4RK8A 4BUHA 4IEFA 1IIGA 1KEML 5G2NA 4W86A 3LN3A 1IC1A 5I73B 1A5MC 1RQEA 1A5BA 3NK3A 4PB9L 4FHKA 3EYSL 5A8MA 3IJ6A 1IC4H 1TETH 4WO4C 1WLHA 4CD5A 5EPDA 1EGJH 1AZNA 1W3KA 1UASA 1ZU8A 4BFIB 3W1UA 2K1MA 5I6LA 3PHSA 3SRFA 1FNEB 4P9HH 4A1RA 4F93B 3CNYA 3Q8BA 3BL3A 3AG4B 5DVOA 5F3HB 3EZ8A 1JGDA 4WOZA 3OPUA 2QJMA 6PTDA 1LOSA 1MXSA 2V2HA 3FQ2A 3QPXL 4NRYB 2YHGA 2JH2A 1UZ1A 1CLZH 2EXWC 2EEAA 4HPJA 2PR9A 1FWEC 4ENZA 3HFTA 2E6FA 4P06A 2AJ3A 1KEGL 4AGPA 4B0MM 1UM4L 3WX7A 3D0LB 2FO4B 1AJ2A 3T2QA 2OKTA 5TH2B 5FJPA 4ZAKA 1OFPA 4WAFA 2P3ZA 3RWFA 4Y2NA 2AJUL 5AZEH 2X12A 1CD8A 3PPCA 2W63A 4OZFG 1FL5A 2XRAH 4UM8B 1PG7H 1UA6H 5C54A 4UQ2B 3D2UD 2ZZUT 2D24A 3JV0A 4ICXA 4GS7B 4L4OA 5E5UB 3WS6C 2QVHA 5F0MB 4F4RA 4TMCA 1W54A 5M95B 3UGUA 3GLEA 2ZZ6A 2UXTA 5DRXB 3PV7A 2Q8AL 2CLPA 4MAYA 1M6JA 3COTA 2Y62A 2NUWA 9XIAA 2VAAA 1XGEA 4AYMC 3V6FB 2Y63A 4LVDA 4HN8A 3PG9A 3U36B 4LNVA 1N8IA 2X7WA 5GS1C 4N1EA 2MCG1 4AIUA 3AQUA 1FFOA 3UA4A 4XCYB 4JRXE 4WEEA 4G56A 4YBQC 4MPQA 3CSPA 3L5AA 1NM9A 1OINA 1XTMA 5JDJA 2OZ4A 3EIFA 4N5EC 3BPLC 4HMCA 4MNMA 4RIRB 1D7FA 5JPMC 4C6PA 3D3VE 1XLAA 4OU1A 3D3AA 4J3VA 4X5PA 4EI5A 5DFVD 3PIQA 5CLXA 1VCGA 3OSVA 1EQPA 1M3UA 4MMZB 1BFSA 1NDTA 5I1EL 4OGYL 4RDVA 3SUVA 1KFCA 5IMLB 5T3XL 15C8H 5AHEA 4H6QA 1YBQA 4XBGB 5AOLA 1S7WB 3QDMB 3DX7A 1KQYA 5DDHA 1Q9KB 2DZPA 1LUCB 3W1TA 4WUKH 4L8BA 1C8YA 1XQLA 4PS4H 4C6QA 3X1GA 4ZQTA 4GFIA 2GTZB 2EKSA 5DD5H 1FLRH 2WO4A 2J78A 2A5HA 2BX7A 4LSUL 1W1YA 2BWDA 1IGCL 3B03A 4LJ3A 3L9RB 4LS0A 5AW2B 2H5UA 4UANA 4XMXA 3UBXG 1MJ8H 4OLXH 1YDPA 2QV4A 1SFLA 2WOQA 3MRIB 3QIWB 2PF6A 2J62A 2Z8VC 2J12B 1RVFH 2QHRH 3MA8A 3TPUA 2I9UA 1GGTA 4H6RA 1ROWA 3QUYC 4K71C 2LFEA 4WKHA 5CKAA 1PZ3A 1EUNA 4M62H 5I1DA 1S5NA 1G9ML 1MHCB 5IVXA 4IMGA 4G6FD 3UJTH 4ADGA 1MFAH 1DL7L 1FYTA 5HNTA 1A80A 1HJWA 5F1IA 3CXOA 4YGVB 4ZTPH 4KJQD 3IAQA 4ZR8A 2VMEA 4DAFA 1JBJA 1AGFB 2SFPA 3KX6A 4ZTYA 3L3GB 2NXIA 1I1AA 3B2XA 1TJXA 3M88A 5DHVB 1XLIA 3MUZ1 3UYIA 3UZZA 1A4AA 3QUZA 4AENB 1IM3B 3QZWG 2X6AA 4PMZA 1BAWA 4JZOB 1W5MA 4JQIH 5D2TA 3IRZA 1EJFA 1B3IA 4JRWA 3BAEH 4OFVA 4KWSA 2WYTA 1SZNA 1BEYL 5E9AA 3W7PA 2PXYA 2VO5A 2V68A 4QG8A 4AMXA 4AIXA 1UZGA 2JJWA 1LP9E 3E2HC 3CNKA 4U1SB 4YHNA 2W9LA 3AU1A 1QEXA 4Z3TA 3CXDL 3AZTA 3I2CH 2PWHA 2VLJE 1HUVA 3ARXA 4ODVL 3EAKA 3GBNL 5KYYB 2J43A 5C07D 5HDQL 1RZFH 4GINA 4BK4A 3CHCA 1V05A 2EGZA 4GNKB 1S5IL 3C5JA 3FOKA 3RZCD 2F53B 4Z23A 3MUHL 3OP2A 4PA8A 5JOFB 5AW7B 2EO1A 2BXVA 2FT8A 3ZS4A 2ZUYA 2NY3C 3MJ8A 3JTSA 3WSQL 1BF5A 2WMIA 4IGBA 3W1QA 2ZOLB 3CDZA 4AQAA 1HH9B 4ANKA 3ARDC 1B0RA 5FM4A 2MTPA 4HFUH 4F7KA 3TNNA 1F45A 4PODA 1XF0A 2H0EA 1XKJA 1MCQA 3FQXA 2PA6A 3E5PA 2EDDA 1MQQA 2X6BA 4X4XA 2UWEE 5E5MB 2WW8A 5JPNB 3TV3L 5IB3A 3KLKA 4G7VL 1J1OL 3EEZA 1K8DB 5TF1H 5F4XA 1IAKB 1DIDA 4NAMA 4NKMA 1ZT4B 4RLDA 4FRWA 1J05A 3CVHH 4Q2ZB 2OQJA 4XKYA 1QNIA 3SDDB 4D0DB 4NUJA 2X6VA 1ID5I 3F64A 4PREB 4GQGA 1S5HA 4WY0F 3QZ6A 1A7QL 1HOCB 35C8H 1RZ8B 6REQB 4AMKH 3VOCA 4RDBA 3SSGA 3VU1A 3LLXA 2BK8A 3QEZA 4EMZA 1GHFL 4PQXA 3U7AA 4YCPA 3UTZB 1LEKB 1B2WL 5EMKA 3U6RB 5E00B 2Z1PA 1RHCA 3EJYD 1Z9LA 5HYJD 2EDNA 1OV8A 2CCRA 2OXNA 3QMSA 3HPLA 3OVRA 2WINB 1SQMA 3A23A 3WNIA 3M7OA 1B6UA 4UAOC 1E4XI 2FB4L 3EBHA 1VRDA 1MFDL 4BSWA 3B9KA 1ORSA 4LIQE 1B57A 3GU9A 3SJVA 4PJIB 1JNHA 1MFCH 4DK3A 1WD9A 2WKGA 3QIBA 1SFHA 4NZDA 4HD9A 3TROA 3N9RA 3EH3B 2I25N 5A3HA 3T4WA 2CE6A 5EZIH 3L3KB 3RDKA 3RNKA 1IT9L 4BQ9A 3RWCB 2F7IA 4JREC 3DFQA 4JY8A 2J88A 2Q86A 3HB9A 5L0QB 5HD8C 4UMGA 4O2EA 5LA0A 4A67A 5C2UB 5AKRA 2V0TA 3N1FC 5I8OH 3CIVA 1UH2A 1DIEA 1EP2A 3BIBX 1F4AA 1WBXA 2M8XA 1ADWA 5AVYB 3LV3A 2WPBA 2XWZA 4FS0A 1XEDA 2JTDA 3LIZA 1QDSA 1XW8A 5TQ0H 1QSED 2I5GA 1UVQA 3FDKA 4OU3A 2GJLA 5I6XB 3T0EE 1OFOA 4PCPA 4IJCA 3WKYA 4TV6A 4ADSA 4BI6A 2BS71 3CUJA 3E80A 4PRPE 3BEWA 4XB3A 4YDIL 5GRJL 4AUUA 1POKA 3O6KH 5HTSA 2XVGA 2WQUA 4YSEA 5I5MA 3IEAA 1SVDA 4AH2B 4K2SA 3F58L 1IAIH 3SKOA 4AC7C 2UXGA 3KHQA 3APFA 4O02A 1ZGLP 4O57A 4PMRA 3MSPA 2P8BA 4PWEA 4YBLB 4CEUC 3IIOA 1BBDH 3KS6A 1DCLA 3DX8B 3AAMA 3R94A 8CGTA 3A13A 1NAMH 4KKRA 5C0CA 4YHMH 4IG2B 2RJGA 4NT6B 1YO4A 5EZPA 1B88A 4Q58C 3EDKA 3HTWA 5K9OA 4HP5A 2O61A 3DTDA 1KR0A 4F92B 3CWNA 4UYQA 5IBLD 5E9NA 4L1LA 2PTTA 1ZLSL 4RBPH 3UG8A 3GW3A 5FL0A 1AI1H 3QUXD 1OG0A 3NGBB 3L0KA 2VN4A 4GGHA 3W56A 4ZX3A 4UWMA 3ECUA 2IQ9H 2JKJA 2ZWZA 4GWEA 1CT8A 3BP4B 3PWPA 4QXTB 3VFTB 2D9CA 3MLTB 2XY1A 3KH4A 3MBXL 3KPNA 3N6HA 3VDBA 2AEIT 4AL8L 4OUUB 1XUZA 4G9DA 5G5DA 5LHDA 5DANA 1T0OA 4GVGA 3SQRA 1T1WB 3SDOA 5CEZL 3OKLA 5HUPA 4QTHA 3I84A 4NNBA 3BAKA 3FXGA 2DQFA 2F8IA 5B39B 3I10A 4ABUA 3OZOA 3CLFL 4UTBA 1Z44A 4TMBA 5IMOA 5CP7B 1NM4A 1F1AA 2ATPA 4J3ZA 4O0ZA 4ZQKB 5INDA 1FZKB 1ZLVK 4F8LA 1U8KB 4AY0A 3UQNA 2BWIA 1BEXA 1Q90A 3V6BR 1REQA 3E9AA 2XG4B 5JXEA 3DO7B 3ROOA 7CGTA 1LG1A 3LCIA 4GI8A 3TIDA 2F38A 4Z7NF 1E0OB 2I07A 3L6FA 2IGFL 2VE6B 1OP5H 2QV5A 1UB6A 3V9CA 1XIWB 5ESAB 4TUJB 4WGKA 3KPLA 1OK0A 1U91B 3O3AA 4MSWB 3PBGA 1P7QB 3IMUA 3EG9B 4HJ1A 3PUCA 4CU8A 2LLLA 1T0PB 2XV0A 4BEQA 4NSBA 1LVEA 4GQ9L 5D1XE 4PVLA 4KK9D 1TV3A 2H3DA 4ENED 1BDYA 4HA0A 4B9KC 2IOOA 1VERA 2ZP0T 3ZZSA 2E27H 1J10A 4PG2A 4GA8A 5DYOA 1AXTH 3I7QA 1OB1A 2E4FA 4AZIA 4J4PC 3M7WA 2Y1VA 1XF3B 3VXSE 4YDLC 3P9LB 4R2GD 4U3SB 4UILL 1FWGC 3IJHB 2KX9A 4AFYA 4Q9RH 3VD4A 2DS4A 1DJQA 1MSPA 4XVOA 4G71B 4QXUL 4Z7AA 5J6HB 3RG1C 4L4VB 4P46D 5EOQL 1HWHB 1M7OA 1W72A 1KSRA 2MFNA 3GU2A 1S7SA 5E6IB 1U8CA 5GRVL 1WO2A 3OM3B 4KGLA 1JCKA 2BOCB 1AHWB 4YSCA 3QDMD 3Q5OA 3RPTA 4FQIH 4PUKA 4GT0A 2X0VA 3QJSB 4HK7A 2IMNA 4YHLH 3WQOA 2V9QA 1FSKC 2VQ4A 4XZMX 2BLFA 5T1KA 4RE0A 3EYVA 2ESVB 4PJEE 4S1RL 5DEGB 1RJQA 2OJEB 5EC2B 3ZR4A 2KHAA 3BH9B 2NCMA 3H7VA 1H7XA 2PETA 1F1DA 2CLRA 2Q6WA 2IANA 2BHZA 2K3TA 3QIWD 2KZBA 4PSRA 1H0GA 2DWEB 3OL2A 3TBSB 2GYSA 4KX7A 4OVUA 4A7VA 5D2WA 4Q6IB 1OP5K 5HK4A 3MOQA 4JANA 3TMLA 1SDYA 1MHPH 5AFAA 2N7BA 4NX0A 1OX4A 5HHVL 3T42A 5FW6A 3HHSA 2DDQH 2YDAA 4JKNA 1U1JA 4DI9A 4KPHL 5KUKA 4KKCC 5I5IA 3WENA 3NTCH 2QQ6A 4S2SA 4WSJA 5FEZA 2R8SL 5MHSD 4M5TA 3N18A 1HH6B 3DC8A 3NXFA 3B4NA 5A7BA 1AZ1A 3B7UX 3N6JA 3V0SA 43CAB 4F7MA 2UY3A 3WUWA 3PNZA 1H1YA 2P8PB 3Q06A 3H2EA 2JQAA 4PWFA 3N12A 2RH0A 3CGTA 3EOBA 4U1IA 4LB8A 4CN6A 5DMIL 4DPAX 3AT8A 1KM0A 5J13B 3WTVA 2UZIL 2K4AA 2YD1A 1FPTL 3QC3A 4JKPH 2QQQA 3B8TA 5FCZA 1U3HC 2WZTA 3JVGA 1K9DA 3LH2L 3EMQA 4ODSH 1EXPA 3O2VH 4F33B 3GMLB 5DK2B 4M3PA 4URIA 5I7GA 3K72A 4ORZC 1EO8L 1PD6A 2GJRA 3HA1A 4UTHA 5A8QA 4H9MA 3VKCA 4HYTB 3LCYA 4QY8A 3BP5B 3MRDA 2F53D 4FAAB 1YEHH 4QEHA 3E2VA 2YD9A 1R3JB 2B4CC 3S98A 2HP4A 3FFCB 4NCDA 4Z1DA 1WFMA 4OIIH 2YN5A 1ZBCA 4C1NB 3OW1A 3S6OA 3C6SA 2BDNH 1R3IH 1VFTA 1E9QB 2YZRA 1GVYA 4OV9A 3CBWA 4QRTA 3WIHL 3E5BA 1IE4A 4F2MA 2EDHA 2G2RA 3E0VA 2XN9E 1D2OA 4K8RL 3W53A 3U57A 1EO7A 4NB7A 3Q44A 2P46B 5BJTB 2VXQH 3AABA 3H54A 3DH7A 1G4PA 1CBGA 4XE0A 3KGUA 1F4WL 3HI6L 5SX5H 2BSRA 1YSOA 3R4RA 1ZD6A 2CCLA 2YPVL 4ENLA 3W5MA 4YL9A 3OMIB 3TO2A 4PJBA 4U5IA 3HC0B 1MCDA 2GSGB 1ZL1A 2NY5C 1IGYA 5E6RB 3MLVL 4LKXB 2VRAA 1VIWA 3P2DA 3S36X 5GSVA 3LQZB 5CLTA 1D3CA 5A5WA 4JO1H 4Q8WA 1LJYA 3FO9A 2P26A 4M1DL 3WN5B 1QNZH 3GPSA 2QGEA 2V63A 3L4XA 4BXSV 5L2KB 3ZJKA 4JYFA 2CYGA 4FXJA 5FM5M 5FUCE 1OL0A 3ZVVA 3S34L 2DYPB 3TJLA 1FIGH 4LGSB 4JPVL 1NGZB 2V9RA 4NN7B 1OSZB 3P4MA 1GYAA 5ISZA 2V4LA 1PLBA 3LSCA 2ZAIA 2NQLA 3BZ4A 3FUEA 4ZD3L 1VEPA 1W0YT 3QDGE 2ZCGA 3VK5A 2XX1A 1OOWA 2JJSC 3GI9L 1HTYA 4DWSA 2FLIA 2JWYA 1UCTA 4EEEA 5EF0A 4YHOL 43C9B 3RU8H 1ZBVA 1YQVL 3RU6A 1ILUA 5CKSA 2XJKA 2XV3A 3QCVL 2QSTA 1E0TA 3CUGA 5C0AA 1PIGA 3LXAA 3ZOAA 1AO7A 3CZEA 1ISYA 2XACC 3OR6A 4AD4A 2XBDA 1TOXA 4KQ3H 1D5IH 1E4XH 2D69A 1XIDA 4HPYH 3WKNA 4RKAA 1ORQB 3RTLA 4OHQA 3F7KA 3JWOL 2BVPA 1PKQE 5SX5K 3OA3A 4KIRA 4O4WA 5DJ0B 3RILA 2I69A 3NQVA 2BP3A 1DBJL 3N55A 2FSEA 4ZQMA 3BVVA 1PSCA 3S4SB 3KPTA 2NW2B 1RA0A 4O2CB 3QEHA 3ISIX 1FRGL 5IJKA 1AACA 2EILB 3A3XA 2VR6A 1QVBA 1IM9D 5HI5D 3NO3A 1X96A 1DN0B 3HBZA 2APXA 1AR1C 4APXA 2ZRZA 5CFHA 1RK1A 3BN3B 3SKJL 1HKLL 2RDUA 2EYSA 5A6SA 4FMKA 4JY4A 4K15A 3V0IA 1FLTX 1UROA 1LEIB 3F5WB 4MVAA 2J13A 1O9ZA 3L7FB 4KJQC 3SY0A 1A3LL 2O5XH 2WYIA 3LCXA 2NV2A 2BSTA 5KS9B 3BZFA 4MJID 4HWEH 4JCWA 4I3SH 3HAEA 1H9DA 1ZBWA 1JR1A 2Z28A 3O6FA 4LV9A 4D7PA 3S96B 3QGKC 4Y4HB 3E2SA 2ZX9A 3WIFB 4NZRH 1I7TA 2ZE0A 4A63A 3M16A 1H8SA 1QFWL 1BGXH 1A1NB 1QOQA 4GH1A 5FEWA 1UJ3A 3ZDYB 2AQNA 1N12A 5EWIL 3OLEA 3BUVA 5BWFA 3H56A 3T8XA 4E8DA 4AV4A 4XPAL 4H8UA 1KYOK 2X4PA 1V6YA 1MNUL 3N15A 2ABAA 2UZ9A 2HH0L 3QNXA 1VYRA 2AL1A 1MZZA 3A64A 3PZMA 4WWKB 4PRBB 4G8FA 4YFLF 2CSPA 1FXQA 2A1YA 4PW4A 4IGSA 4PTXA 1RUML 1QI5A 4TNGA 1ITCA 3ELQA 3VFOB 3QFJB 1E5CA 4XOCA 1DO6A 5D7IF 3OQRA 1OGPA 2Z00A 3E8UL 1PD0A 4RISL 2Z7GA 3OVUB 4P2RA 5CZVH 1U92B 3WUWG 3P84A 1ID2A 2WQRA 1WRFA 2NQZA 3D39A 4PL2A 5LN4A 3KS0J 2ONEA 2XUCA 5BRZE 2A1WL 4O17A 3HUJE 2XQYG 3R0UA 4JX6A 2QTEA 3ZT5A 4WDWA 2NXZC 1CDIA 1JZ7A 2OX5B 3H2CA 4NPYA 2CESA 4LSVH 1NC4A 4HSQA 1TQWA 3MMWA 3VFMA 3EJJX 1O9WA 5FACA 2JEQA 1WDQA 1BG1A 3S1XA 4NQXA 4OM0H 1GKRA 3EAUA 2E9MA 1BXBA 2R6OA 1LK2B 4KRTA 2ADIB 3ORWA 2Z65C 4L5FE 4Y9EA 3W1ZA 3NPSB 1S3HA 2G4EA 2QPSA 2W94A 3WAJA 4AVOA 5A94A 4JO3H 3GMOA 4F3FB 3DPBA 1H7RA 4GI4A 4AD2A 1LO4L 1JD9A 3GC2A 1N5YH 1PNDA 2ROXA 2YMXL 2Y9RT 1CU4H 3R10A 1ECQA 1ONQA 3MJ9A 2C13A 5D2YA 4EVZA 3HI5H 2WWKO 3EJYC 1KV8A 4LGRB 4QF1B 3K5RA 1BTMA 2PF0A 2QCEA 1OGSA 3CIQA 5EO1B 3P74A 3BCFA 1R33A 2BASA 3FA3A 2B7NA 1VJSA 1AR2A 4TQHA 4D6FA 4DJDD 1UKOA 4KFPA 3RG6A 3LTVA 1NBYB 3M0LA 3RWEB 1PYFA 5EOTA 1IZCA 3VIPA 5J5RA 2ZOXA 3FHQA 3L9EA 5M5DA 1SO4A 4UU9A 4JTFA 3QFDB 3Q43A 4HUCA 3NOYA 1MIEL 3D2UB 2XTKA 4DI8A 3PCYA 2PDIA 1Y0LA 2CGZA 5E70A 4JFDA 3DX3A 3L5IA 4GYKA 1JPFB 5FSDC 3SDXB 4NRRA 2WYSA 2J8UB 5C2BH 4HEMA 1GT8A 3I9AA 2MIZA 2R29H 1O7DC 5FYJL 1WUFA 4WHTA 3GWJA 4NC2B 4AZ8B 1I2OA 2J8FA 3SGDI 2CLFA 4Z77A 3FCPA 1KCWA 4YZFF 3EH2A 1JPKA 2ZNWA 3Q13A 1MRAA 3OJMB 1LM8V 3CZLA 4MDIA 3T4AA 1E3FA 3LGGA 4BDVB 4UR9A 3NCYP 5HVHC 2AJVH 2HCZX 3B6SB 4PJCB 4JFXA 2GITA 4JDBA 1T7YA 3GXMA 3IGSA 5IJVB 4JTGA 4NZ1A 2K0RA 3W2JA 2OTPA 1OEZW 3LY0A 4MJ6B 3WXVL 5C0EA 4EZLA 4NXKA 3U7BA 3MBED 4JBSA 4ZOEA 3SPHA 4Y9CA 5EOCJ 3N85L 1YJDC 2VMCA 2HCVA 4LT9A 2W07B 3APGA 3FA4A 3FSVA 3SE8H 3KL3A 1UZ8A 2GSIA 2WXKA 4OUIA 1JWUA 2XZAH 3V4UL 1DVZA 3IEBA 3VFSA 4JGMA 5LQBL 4P3DA 4V27A 1OKEA 1TPEA 1PDKB 3I74A 5TDNA 1GXEA 5I73C 4HJIA 3ITTA 5LCVH 1OTSC 3AUWB 4DP6X 2GFBB 3QUMA 4DELA 3SGUA 4MKNA 1GVIA 4YQXH 3MCKA 3VI4E 3X11A 2DQTH 5CBAA 4CKQA 1M9WA 2VSDA 4PCTA 3FFCD 2BV9A 4R97B 2INEA 4A6YL 4S10A 4FG6D 4MADA 3W0WE 3FVDA 1R5IA 4N8CH 1ACZA 4G9FA 2WJEA 3EX3A 3UR7A 4IBLT 4PMEA 1A6VH 2V5KA 3TP4A 1C91A 1NWSA 3NQGA 3JU2A 4QROA 4AC4A 4LCWE 4HWZA 5SWQB 1SJHB 1VGKA 3F2LA 3V5KA 1E5AA 3PFQA 4RFEB 4ZDHB 5HHQB 1O5KA 1BZ9B 4AKQA 4NQTA 3B2MA 2B4CH 3ANUA 4XP4L 3PREA 1KELH 3TO4D 2VDRH 4N6RA 1RULL 2QPUA 5CCKL 1UURA 1NMBH 4U1GB 4X6DF 3MRCB 1G6VK 2DIEA 3MRBA 4OZFA 1R1CA 1WAAF 2E40A 4OCXH 2OCFD 1MHHB 4QPEA 2NXYD 3M41A 3G6DH 2VDNL 4GFXA 3UY7A 1HCVA 3CYJA 5E95B 3EYUL 4W5UA 1ZT7A 2B1HH 3EYFB 2ZX5A 4KDTC 4ZQPA 2DUXA 5H8PA 3WCYA 2RHGA 2A3CA 5HDBE 3FONB 1EDGA 4B5NA 2ETWA 3U2IA 4F7CB 2D3NA 3GIZL 1PIFA 4GS7C 2FZNA 1IILE 3K0WA 5F7HA 3LYEA 4OIAA 2B1AL 3PZQA 4YYFA 4PY8I 5BXSA 2ADJA 5L2KD 3KZPA 4XXDA 4KCWA 4P5MB 4A8LA 5E1HB 2Z1SA 2DYPD 4QTIL 5C07B 1YUKB 2XKNB 1KLUB 3C08L 4DTGH 3TMQA 2NY5H 4PTUA 3D52A 3LZNA 5AVQB 1E6RA 2VO8A 5SWSB 2DQCH 2VIRA 3G6AA 3C75A 4FHBD 5DJZA 1QO2A 4E9QA 3L12A 1IKFH 3Q6GL 5FFLA 1M04A 1SJEB 4XZLX 1QQDA 3F04A 1ZPTA 1LO0L 2C71A 1NFKA 2YO3A 4HS6A 3PP3K 3A22A 1UR3M 1HHKA 5E09A 3PB2A 1DBKH 1ES0B 3L3HB 4KHXH 2OSLA 2DVXA 3R12A 4Q0XL 2BCKB 4GRWB 3LN9A 5JBEA 3BGMA 3BWAB 2WXHA 5E9DB 5HHME 3REQA 1L8NA 2E7LC 4MYPA 4MMZC 4ONFH 5EU5B 5IB4B 1TSHA 5K93A 3QR1A 5EC1B 3KJ6L 1EV2E 3DTUB 2G97A 3VOHA 1CBJA 1UH4A 4HG4J 3R7MA 1OGTB 3JZEA 2G37A 1GPOH 1J1XL 4PJHB 4NWUL 2EE3A 1MXDA 1JG9A 2TRSA 2FTYA 2GYIA 2Z31A 1F6AB 5CINL 2DSKA 3DFSA 3UXFA 4F9PC 2VOMA 4IQDA 5JOPD 3W2KA 2X70B 3NVTA 1PX4A 5GSRB 1L9OA 1P5UB 4AM0B 1RLBA 3S1VA 5EF3A 4XXWC 3UBXA 2Z0IA 5FKYA 3ZJAA 3M0IA 3COOA 1XSJA 5I18L 4XPGL 2AK4A 1DWGM 1S8DA 3MMEB 1J5SA 2WWDA 3C0LA 1HHHB 5HYJB 4Z2LA 3GNRA 5JDSA 4F8XA 5C9ZA 1RBAA 4PJXE 1LK3L 5D05A 1MQKL 2G95A 3VD1A 1C3FA 1FWJC 4OAWA 3V8OA 4XTIA 4XO9A 2A9DA 1I7RA 5I3GA 3BLEA 3AIRA 1TVLA 2MNUA 2B77A 1ME7A 1JVKA 5FKAA 4L37A 2HFFA 5CILL 3T07A 5I19L 3E8VA 5KAQG 1VFUA 3HE6A 1XIHA 3LZFH 1Z3NA 1IBHA 3PP4H 2HV5A 4HVXA 1H7NA 2ICWB 3DG6A 4P2OA 4S3BA 1J8HA 1BG4A 1KT2B 4NRXB 2MOVA 3U7WL 2WQWA 1OEPA 4ZNEE 2GUOA 2WZ6A 1XAKA 2XDFA 3ENLA 1RUQH 1AZUA 3UTQA 3SCMC 3UYRL 2D2JA 4RDQG 5AZ1A 2H3XC 3VSTA 3B9OA 1ZSDA 1KXTA 3ALXA 1A7OH 4JHBA 1QSEB 3RVVD 2FHBA 2QBWA 2NXGA 3NCYS 3EB3A 3DGCR 3W28A 1RURL 2ABBA 5F4SA 5KVEL 2DEPA 3B2VH 1DQDH 4NL1A 1FZJA 2FNBA 2EKCA 3VD2A 3BUDA 4IRZA 1S9YA 2QW5A 2P76A 2WWMC 1OY3B 5KINA 4C1LA 4GW1A 5IFAL 3QV7A 3NDYA 1A1OA 1DQMH 4K3DH 5E56A 4YC2B 2ZYIA 5D72H 2L7EA 4LHUD 2MSPA 5CEXA 3V4VL 2YGOA 2Z7YA 3SCSA 1WBZB 4TUOB 3BRGC 4H7VA 4B7LA 5IROD 1BZ7A 3BFQG 3IFNL 1MCLA 3BANA 3PV6B 4KXAA 1HP4A 4P2QA 2FX8H 1RMFL 1II4E 5JPNC 3QJFA 4BQ4A 3RPIA 1J0KA 1UB5B 1X8FA 2C3GA 4OQVA 3ZTNH 3ZPDA 3EYQC 4GXUM 3QUXB 4PJDA 1EGMA 1XV8A 4Z18A 5B1JA 4JM2F 4TF4A 1CXLA 2DTSA 3AHXA 1TV4A 4RSYA 1I82A 1K1DA 3SDDC 4JFPB 1EAOA 1WQVT 2X4SB 3S5SA 3V5DB 4U1JB 4UTLA 4FALA 2IAMA 4C8XA 4KTGA 4Z0BH 3FYYA 5GZOA 3V0EA 3MGTA 2AKRA 4ZFQA 3V0VB 1JHTB 3KWTA 4E9RA 2I5YL 4FHJA 1WA2X 2WWKT 4Q89A 4WHYH 4YHZH 3CMGA 2Q76B 2EPMX 4I18A 1GOMA 4P99A 3KJ4B 4GZEA 2EH7H 1YXDA 4DERA 4EF3A 2QDWA 5CO1A 5C92A 3NJ3A 3JQOB 2HE5A 1WOAA 1N2RA 5B7ZA 5FO7B 1YMHA 3AHYA 1AZRA 2A83B 4GYFA 5T5FA 4OF7A 1F18A 3PM6A 3CQFA 1TSRA 2HAZA 4E2BA 4PW3A 2DRUA 1BLIA 4DW2L 4WUUD 1SPDA 5AVUB 1GMEA 2CALA 1X5MA 2Y1AA 4IU2A 5T5NF 3NJMA 3MC0A 2OMUA 4H0HB 1AXSA 4MXWL 3VMOA 5L0QC 5IB2B 3UACA 3RUGE 3O2WH 2FWSA 4OT1H 1Q0YL 1NC2A 2ZOKB 3EZ4A 2PDLA 1XXXA 1KN4H 4KO9A 1BPLB 3OHXB 3V0JA 1D8CA 3IDXH 3W1XA 5D9SA 1XDLA 4ROQA 1V7NH 2D2GA 2Z2UA 1XJBA 4PB0H 3VC5A 2PLCA 3F5KA 2QGYA 3BMWA 5I6XC 1K02A 3DA0A 4GXPA 4YS4A 4BWTA 2DQXA 4R2GB 4OCYH 4E9SA 2I60L 1W3HA 1I8UA 4W81A 3S3JA 1XWYA 3CHVA 4ZBJA 2DYRB 4L4TE 2J57A 3BPNB 1QI2A 4FQXD 1TUFA 4B2DA 4XAWL 1ADQA 2WMGA 2V2WA 5FGBC 3WLQA 3TN3A 4P46B 3SGKA 2P44B 3G9AB 5AECA 4LSRH 4FABH 2YXFA 5HI5C 2VWSA 4C54A 1ESWA 2EJAA 4YBLC 1EAPB 3QZAA 5C0QA 1U8LB 1KXQA 4DHGA 3HC4L 2ZCKH 2HZHA 4OZIE 3G3LA 4NAQA 1KDJA 3G77A 3VFWA 3MZ2A 1BD0A 4EK7A 1W5OA 2GJXB 3SGDH 2PMZA 1CYXA 3NCBB 1QK2A 4U5KA 4LSQH 2R4SL 1U3ZA 2PCEA 1D5ZB 3RYSA 1OAYH 2IQAA 3MCOA 3TJXA 3AUJA 5CUSH 1NCTA 3LQAC 3PQYA 2V69A 1FDJA 3NGBC 1YJDH 1EJOH 3S35H 1SR9A 4Q97A 4OGXL 1ZT1A 3NQ2A 4N7QA 4JFZL 1KFJA 9XIMA 2WVSA 5GRUL 1KENL 3KPRA 5B38A 4A3HA 4TSAL 4JG5A 1ML1A 4N28A 4XX1E 3ITVA 2FEEI 2ZOWA 3OJDA 4CC0A 2MJWA 5IJBC 1KWGA 3BW4A 1I9CB 5JHDA 3R0MA 3QH2A 4GPNA 1EXUB 1DTUA 5TQ2H 1UCBL 3DKJA 4GSDH 4OZGE 5BVJA 3IIXA 2WP3O 2VGBA 1S39A 4V2BA 1NCDH 2CM6A 3ZKMC 1YEKH 4W9KC 1D9KD 3VXNA 2QXWA 1M1XA 2VL5A 4GKTA 2AJXL 4JDTH 1KGJA 5DMYA 4O2FB 4W7WA 5LGJB 4RR4A 1KCRH 3WD4A 4Y4KD 3ZZ1A 5I16A 4OLEA 4XNXH 5DZAA 25C8L 2DLFL 1DBBL 4YNYB 4HQVA 4QRPE 3UNTA 3C5ZD 5KOVC 1AJZA 4XBPA 1N5AB 5BMFL 4RMUA 1NKOA 3X3FH 1XIWC 3LRLA 5HGBB 1NEUA 3QZBA 4QG6A 1KTBA 2DJUA 2V5YA 4JIQA 3A6BL 3A9IA 2VC2B 3PRZA 3EBGA 1F4HA 4QXGL 3S37H 1G94A 4KNQA 5CF3A 1V3JA 4YZWA 1LL7A 2L3BA 3I3BA 5AENA 3BSZL 5SWSD 2A6DA 1A4KB 3OC5A 1CDJA 4Z0XB 1BXCA 4RAVA 5IVXF 4HF5L 2BNQB 4HV8B 3QOMA 1YMMD 1OHLA 1NUFA 1G6RL 1DOSA 1AZBA 1BREA 2D4FA 4WKZA 2YPLE 2LTQB 1BZQK 1SOXA 5E9DD 4PFEA 2GDVA 2VT0A 3BVNA 4UFHA 1WS7A 2EVGA 4ZI8A 5DVMA 2D03L 1GZPA 5E6IC 2DMGA 1NLDL 3ECVA 3MQTA 4AEHH 1AHWC 1QG3A 1EYEA 3OYZA 5D4JA 1T3FB 4I4WB 3ALPA 3RM4A 4DJDC 1HSBB 4TPRL 2DGAA 2OQYA 1K6QH 2WGNB 3KL0A 3P4OA 4X7SH 2Y1ZA 2XQBH 3I6GB 3MV7A 1DBML 1USQA 5LYRA 2VMDA 4JHOA 1FL3A 1DLHA 4U31A 4M1CC 4B9GA 3I3DA 5DY2A 3KGTA 1XBRA 5LUMA 2WJ5A 3VB8A 1VBUA 3E1ZA 3NCJH 4P2YA 2AQ1A 2VDML 3T55A 2FYVA 4Q6IC 1TVNA 1L3NA 3GK8H 1S3KL 2I14A 1YECL 2WZHA 4IH3A 3L48A 4OZOA