1MXGA

Crystal strucutre of a (ca,zn)-dependent alpha-amylase from the hyperthermophilic archaeon pyrococcus woesei in complex with acarbose
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
435
structure length
435
Chain Sequence
b'AKYLELEEGGVIMQAFYWDVPGGGIWWDHIRSKIPEWYEAGISAIWLPPPSKGMSGGYSMGYDPYDYFDLGEYYQKGTVETRFGSKEELVRLIQTAHAYGIKVIADVVINHRAGGDLEWNPFVGDYTWTDFSKVASGKYTANYLDFHPNELHCCDEGTFGGFPDICHHKEWDQYWLWKSNESYAAYLRSIGFDGWRFDYVKGYGAWVVRDWLNWWGGWAVGEYWDTNVDALLSWAYESGAKVFDFPLYYKMDEAFDNNNIPALVYALQNGQTVVSRDPFKAVTFVANHDTDIIWNKYPAYAFILTYEGQPVIFYRDFEEWLNKDKLINLIWIHDHLAGGSTTIVYYDNDELIFVRNGDSRRPGLITYINLSPNWVGRWVYVPKFAGACIHEYTGNLGGWVDKRVDSSGWVYLEAPPHDPANGYYGYSVWSYCGVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha amylase
molecule tags Hydrolase
source organism Pyrococcus woesei
publication title Differential Regulation of a Hyperthermophilic alpha-Amylase with a Novel (Ca,Zn) Two-metal Center by Zinc
pubmed doi rcsb
total genus 160
structure length 435
sequence length 435
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mxgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mxgA01
4PSRA 3SUTA 2FHFA 1EO5A 2OWXA 1AQHA 3GXIA 3HG4A 3WNOA 1WKYA 4GZJA 3LXAA 3NUKA 3NSNA 1Q6CA 3GXNA 1U2YA 4J3SA 2HISA 1VENA 4KH2A 3F4VA 5A69A 3EDKA 2ZUUA 3MUY1 5A8PA 2PI6A 1LLOA 4EKJA 2PWGA 1GQKA 2VNCA 2PWEA 3TTOA 2ZUNA 1V02E 4BS0A 9CGTA 3AHZA 3ZO9A 5FD0A 1E72M 3CLWA 4LX4A 4AXNA 3KLLA 1DWHM 1A47A 4WSJA 1MQQA 1J01A 3ARVA 1SMAA 1LQ0A 2DEPA 4MAVA 4OZOA 3ARYA 1C93A 1AVAA 2MANA 1IT0A 5FL1A 4P7QA 3CIVA 1QX1A 1UWTA 2E9BA 1GQIA 2DIEA 4DWSD 1C7SA 1QW8A 1KR1A 2XWDA 1HJWA 4PMNA 1JG9A 2GK1A 2F8QA 4E4PA 1VFUA 4JKMA 1J18A 3B9AA 3U57A 3VD3A 3LMYA 4OOZA 1KBKA 4F66A 4UQEA 3VM7A 1VFOA 2XSAA 4V27A 2E8YA 4IISA 1WCGA 1PAMA 1HIZA 4UOQA 1R46A 3WDPP 1XCWA 1B30A 2WVVA 4PYSA 4BQ4A 3JUGA 1UYQA 4CKQA 1TVPA 4D6DA 2XN1A 5ABFA 1QHPA 1GCYA 1B3VA 3A6OA 2VMFA 3F5KA 4HP5A 4MNLA 3W25A 3L2LA 1PX8A 3VOCA 5D8ZA 1VAHA 3N18A 1K9TA 1W32A 3QOKA 1C92A 1KR0A 3QR3A 1QI3A 4C7FA 5KZ6A 1MW0A 2ZX8A 1JZ7A 3T08A 4AD1A 3VMOA 2O9PA 3LRLA 3D4YA 2XHYA 1AQMA 4GI8A 3CUHA 4D1IA 3PZ9A 3WUBA 4LYPA 5DT5A 1BAGA 4ACZA 1FP8A 3VNYA 4PTVA 1QI2A 3ZJ7A 4NZJA 3EBVA 4PTMA 3DC0A 2XVLA 2D22A 1S46A 4OBRA 1KCLA 2X0YA 2F1AA 2UY3A 1M53A 3IAQA 1W1YA 1C90A 1WDSA 3UERA 1M04A 2QLYA 4BZYA 1CECA 5FIPA 3VM5A 3SUVA 4AZ5A 1WAWA 5A6BA 2XM2A 1ZB5A 2A3BA 1PIFA 3HG3A 2X05A 1KFWA 3CUFA 3MMDA 3BH4A 2WB5A 1M01A 3B9DA 5CLTA 5DF0A 1V0NA 2YL6A 1TUXA 3RM9A 2CBIA 4W8LA 3CO4A 1W1TA 1WDPA 1H2JA 4D1JA 4B15A 4X0NA 4XV0A 3VGHA 1JDDA 2PWHA 2WZIA 1JZ5A 3WY4A 3T0AA 3D52A 5CSYA 4IPNB 1EOMA 1PX4A 2NW0A 4QDMA 1ZL1A 1B0IA 4D6GA 3KL3A 2ZE0A 4GINA 4YHGA 2EPKX 1W3KA 4P8UA 1GQLA 1DWAM 1E70M 4CN1A 1JF6A 2XGIA 1US3A 4M81A 2WVVB 4EK7A 1HN1A 3SCVA 3AHVA 4DWSC 1W2VA 5A2AA 1UKSA 4RE2A 1JFHA 4PUEA 3A5VA 1DTUA 2WCSA 5IFTA 4UFKA 2OSXA 3QOMA 4BA0A 4PMQA 3L2MA 3SUSA 2WVSA 1UD4A 4PN2A 2BY1A 1OD0A 1JZ2A 2DSVA 4YN5A 5BXRA 1B90A 3FW6A 1TQSA 3M6DA 2W67A 1HKMA 1PS3A 1H5VA 3WMBA 3CC1A 1FHLA 1NWTA 1W3HA 2WKLA 2J7FA 1JAKA 4JFTA 2ZUTA 1CGTA 2CKRA 3ALGA 4QP0A 3ZM8A 1WDRA 2F7QA 4CD6A 4Q7NA 1JL8A 1VBRA 4TVDA 4WLCA 2EADA 4ZE4A 2EPMX 2GJRA 6CGTA 3W53A 4FMVA 3VINA 3TTYA 3DDFA 2Y4SA 3N13A 3OLIA 3VU2A 3HU7A 4CVUA 1TG7A 3EYPA 1DWFM 3EMCA 4DM2A 3W26A 3LPPA 2V5CA 3BVXA 4YPJA 1XH2A 2ZUWA 2GJXA 3EJTA 3WH8A 3MANA 1G9HA 2VX7A 3AIVA 3WFLA 5D8WA 1CENA 1XHGA 2YOCA 3LX9A 2YBUA 2O92A 4AD4A 3W4RA 3FXYA 3VIGA 3A47A 2DDXA 4AISA 3K4AA 3N04A 3DYPA 3W29A 1TVNA 3VIMA 1Q4NX 1LF1A 4CU8A 3CHCA 5CSUA 1QI0A 1UKOA 1JDCA 3WD3A 3RO8A 5AY7A 3LXCA 1CXLA 2WZEA 3AIBA 3PZNA 3CZEA 1I1WA 3NDZA 4F79A 4JL1A 3VIHA 5HPOA 3GNPA 5LA0A 1G94A 2XPKA 1JXKA 1LWHA 1BSIA 4DWSB 1JAEA 2D24A 3CZNA 1QNRA 2D3LA 5CGTA 1E73M 3FAWA 1US2A 1ZBWA 1HKJA 4NXSA 1ISVA 3BLKA 3QGVA 2W5FA 3ZMRA 2CXGA 3L4TA 2ZWYA 1HTYA 1GHSA 2GJPA 4U2ZA 3BUIA 1Q6FA 4KGJA 2D20A 3VKKA 1E3XA 3BVWA 2J79A 3ZT7A 1CWYA 3MUIA 3NSXA 4S3KA 4F8XA 1JZ6A 1XCXA 1HJQA 1V6UA 3UG5A 1BLIA 4MB5A 4R27A 2CYGA 2JIEA 1A3HA 1GOMA 3WY3A 1FFQA 1UWUA 1W9UA 1TCMA 5A8OA 2VX4A 1BQCA 2WSPA 3WQ8A 4E8CA 3ZT5A 2YFOA 5E70A 1UWSA 4MNJA 4BQ2A 3DX2A 4QLKA 4W85A 3VSTA 4KMQA 1QI5A 1CYGA 2IXVA 4XX6A 1FA2A 1OCQA 1VJZA 3L4XA 1EQCA 3UCQA 2D0HA 1W9DM 4PMRA 1J0ZA 1BTCA 1V03A 3O6AA 3TTQA 1BG9A 2WMIB 2GUYA 1V6VA 3PZMA 2J62A 1J0YA 1K6AA 4TXEA 4HU8A 2RGLA 5A3HA 4LXFA 4W89A 2F7PA 1KQZA 1B3ZA 1WNOA 4KWUA 1CGUA 4UFJA 4F9DA 2WCGA 3VGFA 1BG4A 1EO7A 4ACYA 4JCMA 4JKLA 1OBAA 3KWXA 1VBUA 7CGTA 1FH7A 1OB0A 2VCBA 3AYSA 2CITA 1HNYA 2VVNA 4P8XA 5CZKA 2XIBA 4JZ5A 1ZBKA 4UNIA 3PBGA 1OGBA 4WKAA 2DSWA 1LL7A 2YLAA 3NCOA 1I1XA 2DT2A 4U3AA 3RPMA 1W91A 8CGTA 3O2LA 1DWJM 5CPSA 3DDGA 5DT7A 4NX0A 4D6HA 3UR8A 1UR4A 3WUFA 4MB4A 1O6IA 5CQ1A 1LG1A 1ZBVA 4Q22A 5M17A 4U31A 1FH9A 3G6LA 3OLGA 1JNEA 2CEQA 3CTTA 5JIPA 1NWUA 1H0IA 7A3HA 1VRXA 3PHAA 3OGSA 4W8BA 3WDRA 3DHPA 2XG9A 3A4AA 1WE5A 5EBAA 3VGGA 2X0HA 2YDQA 3CZ8A 3EDDA 5JBFA 4JCLA 2XTKA 5I3DA 4U3CA 3SIMA 1RPKA 2ZOXA 4MADA 2DQXA 2ZXAA 4DO6A 5A8QA 2OYLA 2WLYA 3KL0A 2PBOA 1C8QA 5GQBA 3ARWA 3RCNA 5BWFA 1R7OA 3ARSA 1UKTA 1E9LA 3CUGA 3AS3A 4A3HA 4DM1A 4P8WA 1J10A 4J3VA 1JZ4A 3T0DA 2OYMA 1LL6A 1L8NA 2FDMA 4D6JA 3EDFA 3TONA 3KZSA 3A23A 3A21A 4R5EA 1OD8A 1VF8A 2WNWA 5E0FA 2IUZA 4PCSA 1GOKA 3SURA 4AD0A 3SCOA 2ZXBA 1CDGA 3H54A 2Y5EA 1W1VA 2BHUA 3WKZA 1YHTA 2VOTA 2WVUA 3D3AA 1RP8A 4AYSA 1IZJA 1UD3A 2WKGA 5A2CA 4HA4A 5HNNA 3NJ3A 2VUYA 2WANA 3VIIA 4TX6A 2C7FA 1UWRA 2XVKA 4H8VA 3FAXA 4UQDA 1Q6DA 3MMWA 4NRRA 1SFSA 2DT1A 2O9RA 4DWSA 1HVQA 2EXOA 3GXPA 3L4VA 3VGBA 4UOZA 1OGSA 1EHNA 3OLEA 1UR1A 3PZUA 5BXPA 2Y2WA 2FHCA 4HPGA 1HT6A 1E6NA 5IXEA 1R47A 3BSGA 4W5ZA 4E8DA 2O9OA 6TAAA 5ABGA 1BYDA 1BPLB 4UQ9A 5JBEA 1E4LA 4M80A 3BLPX 1UZ1A 4D72A 3ARZA 1UASA 1ECEA 2D0FA 1JD9A 1UKQA 4FNUA 2J4GA 1HJXA 2VZSA 3UR7A 1XH1A 2ZIDA 3ZR5A 2WM0A 1JYWA 2F61A 1KXQA 2GJXB 3MUAA 3GM8A 1E0XA 4TUFA 1E3ZA 4ML4A 5E6YA 4ATDA 1FFRA 2OSYA 1VFMA 3OBAA 3KEHA 4FNQA 1TA3A 1PZ3A 3NDYA 2OW7A 2WWDA 3VGEA 3VIFA 2WMFA 4PSPA 4UFLA 2PB1A 3T09A 2QV4A 1GJUA 4AYGA 2HVMA 3DX1A 4XZWA 1X1NA 3BC9A 2UY4A 1E5NA 2DSZA 5EFDA 1W9PA 1ZJAA 3UESA 4Z2IA 3WDIA 2D23A 4C7GA 1GOQA 1GOWA 3GNOA 2WBKA 1JXJA 5C71A 4MDOA 1G0CA 1TQWA 3AROA 5A8NA 2VO5A 2J7GA 1KBBA 4KRTA 2OSWA 2CHOA 1V0KA 3N15A 1H41A 1WDQA 4GXPA 2X2IA 4Z2LA 1QPKA 2X1IA 4M29A 2UY2A 4UFMA 2EEXA 2WHJA 3THDA 1Y7VA 1MFUA 3VPLA 1NOWA 3SCUA 3WMCA 4PCTA 3ZT6A 1GPFA 2Q8XA 1W9XA 4TTGA 1GNXA 3PZIA 1CXEA 1R86A 2EPNA 1TMQA 3WBEA 3WQ5A 2NT0A 1O7AA 3FNDA 5A6KA 4W86A 1E0VA 4MB3A 2BV9A 1HXJA 4H8UA 1QVBA 3CHFA 4AIUA 2A3CA 4JIEA 3WH6A 1E4NA 2EACA 3PZOA 1GHRA 2XUCA 2E0PA 4ZXOA 2XFYA 2DGAA 3H55A 3WN6A 2C8NA 2NT1A 3M46A 4Z2HA 2VTFA 2E8ZA 3THCA 2EQDA 6A3HA 2BNJA 1B3XA 3EJQA 1LWJA 1JF5A 1CXHA 1E56A 1NOUA 1GOIA 2VVSA 1CTNA 5BROA 3FHQA 4FLQA 5HPCA 1UR0A 2XN2A 2VQUA 1PPIA 4HOXA 3AZTA 2W63A 3PZQA 4IUGA 3LPOA 1QNOA 1W3LA 4HA3A 1U33A 3I3DA 1BF2A 3ZQ9A 3AICA 3W82A 4M8UA 4D6FA 3RMEA 4K68A 2WLZA 2W4XA 5E9AA 1CLVA 2V3DA 3CZKA 2EBNA 4M82A 2ZUMA 3BMVA 3DX0A 2YA1A 3VDCA 3OZPA 4ZEPA 1OT1A 1XV8A 3OIHA 4H41A 1NQ6A 1O7DC 4J3UA 1E71M 1UR9A 2RGMA 3U7BA 1QBBA 3K46A 4FNRA 4M24A 5I78A 3VIJA 2XFFA 2EAEA 1TQVA 1OIFA 4PRWA 1PEZA 1R75A 1KWKA 1B2YA 1XD1A 2D2OA 3BLBA 4WK9A 4UCFA 1TZ7A 2FGLA 3RDKA 2O9TA 2D73A 3T2PA 5A2BA 2FH6A 1QBAA 1QWNA 2BY2A 3AMGA 1CGVA 3AS2A 5M3WA 5A8MA 2BY3A 2XVNA 3CUJA 1FHDA 2ZXDA 3DYMA 5JBDA 4NF7A 2CKSA 4DUXA 5A95A 2VX6A 1U30A 4L4PA 3AHYA 2OYKA 2YL5A 4MDPA 2QPUA 2A3AA 1UH4A 5A6MA 1HXKA 3PTKA 4Z2GA 3CH9A 3FY1A 1W9BM 5FKYA 3AIQA 1WZLA 4UOJA 3AIRA 3GXTA 1XGZA 1WZKA 4JFSA 2YJQA 3EMQA 4GI6A 2WMIA 4ATWA 3DECA 3CPUA 1PZ2A 3WL0A 3WUEA 5BRPA 4PMXA 4W84A 3VD5A 1V3JA 2WZHA 3POHA 4BF7A 4W93A 1CPUA 4AC1X 4BQ5A 1H49A 3WEZA 1B9ZA 1UG6A 1H4PA 2Y8VA 1PBGA 3GDBA 3WEMA 2WCAA 2YFNA 2J47A 4YHEA 5CXPA 3DX4A 1R7AA 1H09A 2VI0A 3ALFA 2WPGA 5HOSA 1VEOA 1EA9C 5CGMA 3HG5A 1W3JA 4KRUA 1UA7A 3WH7A 1MQRA 1CBGA 4GIAA 1V08A 2JIWA 1DHKA 5HDRA 4GQQA 1OM0A 2VCCA 3MUZ1 2YL8A 4TOQA 2VZTA 4OOUA 4W7VA 3L4WA 3MKKA 1W1PA 1Z32X 1CIUA 2G41A 3M7SA 4RE4A 1QOXA 2B31A 1SR0A 2ZICA 1H11A 2BXZA 3K8MA 3F5JA 1JYXA 1M7XA 4PUDA 2W66A 3U7VA 3GXMA 2XVGA 4AZCA 4AZ7A 3VUPA 4AD3A 1E40A 3EDEA 4MJ2A 1NP2A 4U5KA 1V6YA 2YIHA 1XYFA 3SUWA 3BVVA 3I3BA 3KLKA 1ITXA 3BVTA 2IXUA 1C8YA 3WQ6A 3I3EA 1ZU8A 3WEOA 2F1BA 3A22A 5GPRA 3AYRA 3SCQA 1VEPA 3CUIA 3WL1A 3AI0A 1HP4A 4LYQA 4S3JA 4A4AA 1G1YA 4WF7A 4ACZB 3SCNA 1JGIA 4NI3A 1ODUA 2W91A 4C7DA 3VSVA 3TP4A 3AFBA 3SCRA 4W7WA 1HL9A 2J8FA 1SZNA 3CGTA 1WZAA 3CZSA 2W92A 4TX8A 3WQ4A 2D3NA 1J12A 4GQRA 1HVXA 3CHDA 2BFGA 3N17A 4GPNA 4RE3A 5IFPA 3B8SA 5D9PA 2ZX5A 4LGXA 1UA3A 3BAIA 1KXHA 1TQUA 3GBDA 2E9LA 2VX5A 1MW3A 4PMVA 3U5UA 2FYVA 1SMDA 1MW2A 1E4IA 5EB8A 4JFWA 1R34A 2XGBA 3SCPA 1QWUA 3SCWA 3CZGA 3W24A 4HOWA 3MMUA 5BXTA 3BAYA 3ARTA 7TAAA 3RILA 1GUVA 4CN4A 4JHOA 4LPCA 3VGDA 3AMKA 3ZSSA 4M56A 1HX0A 3U5YA 1E55A 4B3KA 3VDAA 4TVCA 5FOOA 2X2HA 1QNQA 5C70A 1OWQA 4UZUA 4PMYA 1CZ1A 4OJYA 4XZBA 3QHMA 1TFVA 1JI1A 1TR1A 3EJRA 1UR8A 3WQVA 3BUDA 1JZ8A 1KXTA 1D2KA 1C3FA 2YDRA 2JF7A 1EH9A 1RP9A 5A6AA 2WHKA 3VDBA 4CU6A 5LA2A 1WO2A 1MW1A 4J28A 3WFZA 4MTVA 5CJ5A 1EGZA 2BHZA 3B9EA 3OZOA 2ZUVA 2D1ZA 3BAXA 3AHTA 2QHAA 4GO8A 2J7EA 3VIOA 2CETA 2DT3A 1W2PA 4CD5A 1OIMA 1DWGM 5F7UA 2PWFA 4UFIA 3UETA 1NARA 3GNRA 3N12A 3LXBA 3EDJA 1J0JA 1G01A 4H04A 3A4XA 1H1NA 4PEEA 4AIOA 3TOPA 2TAAA 2XFRA 4MNKA 3OB8A 3W6LA 4CGTA 3BAKA 1G5AA 2Y24A 3UG3A 2WC7A 1UD6A 4FK9A 4D6EA 1KQYA 1UQYA 2AOSA 2XIIA 2XM1A 2FE0A 1JYVA 4ZFMA 3PN8A 4QLLA 3GXFA 1UD8A 4W8AA 4EAMA 3BVUA 1PJ9A 3OG2A 1H3GA 4GZEA 2XYLA 2WWCA 4AWEA 1KCKA 1XD0A 3WDJA 4PMZA 2V5DA 1K9DA 5ABHA 2EPLX 1NWSA 3OGVA 1NWRA 1GZJA 1EXPA 5AC5A 1EOKA 3BAWA 4AZIA 3TTSA 4P7NA 1YQ2A 4D6IA 1BVZA 5A6SA 3IJ7A 2YA0A 3AMLA 3WY2A 1ESWA 3WD1A 2A3HA 4CVWA 3VIKA 1NOFA 2A3EA 2CIPA 3BGAA 4A3YA 2J7BA 3WH5A 2ALWA 1IZKA 2J8GA 3GXDA 4WJXA 2VRJA 3VD7A 3HJEA 1LJYA 2BVDA 1CGXA 3MI6A 4MAZA 1E15A 3VX0A 2ZX6A 3VTRA 1HJUA 4J3XA 1GOOA 5A94A 5I6SA 3L4ZA 4CCEA 3SUUA 3D51A 1AMYA 5KEZA 3AJ7A 2W62A 3E1F1 3F5LA 1V3KA 1EQPA 1V3MA 1GVYA 2WAGA 1VB9A 1LL4A 4PMUA 4H8HA 3T0BA 2V3GA 1MVYA 2JF6A 1J9YA 1QHOA 4UTFA 1V6WA 4EE9A 5LA1A 2XJ7A 1CGWA 5CG0A 1SYTA 3GTNA 1XH0A 3NIYA 3RIKA 3NSMA 3S5YA 3NYDA 3EMZA 4CU7A 1JI2A 3VMNA 3IANA 4WIWA 4AZ6A 4MB1A 3ZJ6A 5IDIA 3S5ZA 2WC3A 3PTQA 3K8LA 1OT2A 3CZJA 3VD4A 5I79A 2J78A 1MFVA 1JDAA 2ZX7A 1I75A 3LRMA 3A24A 4OIFA 2EPOA 2VR4A 4FLOA 4JKKA 2D0GA 5E09A 3OGRA 1WPCA 4BCEA 3W6MA 4F9JA 2CPUA 4PBGA 2WXDM 4FNPA 1KGWA 3UEQA 1QHZA 1CLXA 3T2QA 1QNPA 2PF0A 4JFVA 4P8VA 3HZ3A 1V02A 1E6ZA 1UQZA 1NP0A 3AMCA 2ZXQA 4Z2JA 2XWEA 3AIWA 1HL8A 3ZOAA 2WMHA 4GKLA 2GFTA 4AEEA 1EHAA 4X9YA 4N42A 3LRKA 2FGZA 1E6QM 3T2OA 2WMGA 1HKIA 1WZMA 1K9EA 2J7DA 4WSKA 1L0PA 2F18A 5M03A 5D4YA 1BYBA 4NRSA 1DWIM 3WD2A 3EJPA 2QPSA 2YL9A 3CMGA 4U5IA 1TQTA 2YBTA 5AYIA 4AIEA 2WBGA 3W81A 1RD6A 1TA3B 4OUEA 3ZJKA 1E0WA 1JYNA 2XSBA 3O9NA 1AQ0A 4HZ7A 5TD4A 4W87A 1UH2A 5E1QA 3W37A 1JIBA 3CMJA 1B31A 2GSJA 5BYWA 2G4FA 5ECUA 3ARUA 5AC4A 1V0MA 3AISA 1E6SM 1ISXA 4HPHA 3II1A 1E1FA 3DX3A 3WELA 1DP0A 1E43A 1DEDA 2YLLA 2IGTA 5CPQA 1BYAA 2C0HA 3AHXA 5GNYA 3ZSTA 3PZGA 4CD8A 2EJ1A 1J0HA 2VZOA 2DSKA 3OLDA 2VRKA 4HOZA 4WKFA 1UD2A 3VMPA 1HF6A 2CBJA 1E6RA 2WC4A 4OGZA 3MV11 2OW6A 2JE8A 1N82A 3SCTA 5JUVA 5HXMA 2OLHA 2DPEA 1UH3A 2PWDA 2J7CA 4AZHA 4P7LA 3K8KA 4V28A 2V3FA 1XRVA 4MPKA 2X09A 2J7HA 2JEPA 2DSUA 4IPLA 4NXKA 3VDHA 3W0KA 1KGXA 4JFUA 5DO8A 1UHVA 3WSUA 4W88A 2VZUA 2WYSA 3KE0A 4UQAA 4HMEA 1CXKA 2G3NA 3WMSA 4IM4A 4HMDA 3HN3A 3VILA 3WF1A 5ABFB 2XN0A 2QF8A 2G8ZA 5I5RA 2CCRA 2VQTA 3TA9A 1V3IA 3K1DA 3L4UA 1GORA 1R87A 2WHMA 4CN6A 2BY0A 3SEPA 5EMYA 1VFFA 3EJUA 4AZBA 2V38A 4QLJA 2OWWA 1V3HA 3WNLA 2WK2A 4LQ1A 5M5DA 3D50A 2V3EA 4AY1A 4J7RA 1CEOA 1OGGA 2J74A 2QMKA 1UZ4A 4HU0A 3BMWA 3WIJA 4J27A 3H53A 2FH8A 4DO5A 1TE1A 3J7HA 1KXVA 1FP9A 4UQCA 5JIWA 4CUCA 1XC6A 4CD7A 3BAJA 3VVGA 4AW7A 5DMYA 1ISZA 4DO4A 3RM8A 4HMCA 1GQJA 3MU7A 3ARRA 2DT0A 1RH9A 2VURA 3MV01 2WVTA 2ZUSA 3QHOA 2UY5A 3MSGA 3AS1A 8A3HA 4B3LA 4E2OA 1GONA 3SCSA 2DIJA 2YA2A 3ARPA 2WMKA 4X0VA 4AD5A 2BVTA 2E40A 3AOFA 3VSUA 2WMJA 2ZX9A 3MSDA 1KGUA 3ZIZA 3G6MA 3PTMA 5I2UA 1ITCA 1UUQA 3AS0A 3POCA 1XSIA 1QNSA 1HP5A 2F7OA 3BXWA 1KTCA 2BXYA 4B9ZA 3WF3A 3AZRA 3D4ZA 2E4TA 3IJ9A 4UFHA 2CERA 3VO0A 2BHYA 1IV8A 4JAWA 3WNPA 2AAAA 1V0LA 3W38A 3DYOA 1XSJA 3PZVA 3W27A 2GDVA 2NSXA 4FNSA 1X6NA 3GH4A 1LG2A 1MXGA 3AXIA 4XB3A 3TV8A 2J77A 3CHEA 3FN9A 1XSKA 4QCFA 3PZTA 1NH6A 3GBEA 3WUGA 3WF4A 1CXIA 1ODZA 4KGLA 4W5UA 3EJSA 4PMOA 4QFUA 1EIBA 3L4YA 4UQBA 4AZCB 1B3YA 3DHUA 3FHAA 2ESCA 4HZ8A 4CD4A 4GO9A 4DUWA 3D5HA 3IAPA 2W61A 4OKDA 1J11A 2CESA 3IK2A 4URIA 1MQPA 1X6LA 1BHGA 4TVUA 1UR2A 1R85A 4ZXLA 3WQWA 2QMJA 5A6LA 1EDGA 3CV5A 3HG2A 4GZIA 3VD9A 4U33A 3WD4A 4OBSA 1B1YA 1D7FA 5D9NA 5A1AA 3HMCA 4U2YA 4HTYA 3ARXA 1VJSA 3ECQA 3BUBA 1JFXA 2X2JA 4PTWA 2VT0A 3AMDA 3BCFA 3WNMA 1HJSA 3CZLA 1E6PA 2VCAA 5LYRA 1T0OA 1ZBCA 3M07A 4JL2A 2WW5A 3N1AA 4JHZA 1K9FA 3BUQA 3VX1A 5BRQA 1HJVA 4J3WA 3BSHA 5A6BD 4FLSA 1BYCA 3BCDA 1VEMA 2XVPA 4LYRA 4D6CA 2EABA 2DH2A 4N0RA 1P6WA 4NZFA 1M03A 1GJWA 1OINA 1ISWA 3W28A 1QI4A 2YKKA 4QAWA 1R33A 4D71A 4NSBA 4EANA 1Q6EA 3RM4A 5BXSA 4J3TA 2J25A 4QCEA 3IJ8A 3K4DA 1OSEA 3AIUA 2ZWZA 2G3JA 3MO4A 5D9MA 4DUVA 1Q6GA 4B9YA 5FCZA 1GW1A 1UD5A 3WF0A 4FF5A 3ZR6A 4P7OA 5DFAA 3WNNA 1H0GA 3WDHA 5GNZA 1CNVA 1ZJBA 3WY1A 1PX3A 4AZGA 2UWFA 1PIGA 2J75A 4PMDA 4BQ3A 4HA1A 4WKHA 5IHSA 3MS8A 4AEFA 3RJXA 3GZAA 1ZS2A 1GVIA 1C91A 3A4WA 5FL0A 4H2CA 3A3HA 1FOBA 2CNCA 2WSKA 1HKKA 2X2YA 3GH7A 2E9MA 4RL3A 1UWQA 2F2HA 1C8XA 5ABEA 1BFNA 1J0IA 5I23A 3GH5A 2BVYA 3AXXA 3N9KA 1V3LA 4P7RA 3WD0A 4ATLA 1E6XM 3UG4A 1ISYA 1R8LA 1V6XA 4ZENA 5A6JA 4Z2KA 3CBWA 1F4HA 3BUPA 5BCAA 2VZVA 1HWWA 3WNKA 5I77A 5IHRA 2WHLA 3ARQA 1KB3A 2X8RA 1EDTA 3AZSA 1CGYA 1QW9A 5CPTA 4AMXA 3LPGA 3WENA 3AXHA 4TTUA 2OWCA 2CBVA 5DEZA 3WH9A 4AMCA 1W9VA 4MNMA 2JEQA 3AQUA 2PBGA 2Z1SA 4L4OA 1WP6A 1MWOA 4PTXA 3WF2A 4CCCA 1JZ3A 1KWGA 2VR5A 1UOKA 4HZ6A 4UZSA 2CBUA 3LPFA 2PC8A 1E5JA 1JD7A 3WBAA 5E0CA 1BVNP 1MYRA 3APGA 1FH8A 1BGAA 1EDQA 1E4MM 5EFFA 3QHNA 3RJYA 2GVYA 2E3ZA 5AYBA 2F7RA 4GI9A 5I24A 2VJXA 4CCDA 5D9OA 1XYZA 1B3WA 1WB0A 2Y8KA 3VNZA 2VL4A 5C8BB 1BGGA 3GYCA 3ZJ8A 2G3MA 4V2XA 1CXFA 5E6ZA 4XUYA 1VIWA 3AIEA 2CHNA 1JNDA 2Z1KA 1UWIA 1MXDA 3OA5A 5HBFA 2GK1B 2GDUA 1D3CA 1E1EA 4FNTA 4W7UA 3S6TA 4NZCA 3WDQA 2VRQA 2VC9A 2JFEX 4M1RA 4Y7EA 4AD2A 3VIPA 2BS9A 4AMWA 2EO7A 1J0KA 5I0DA 5GNXA 1F4AA 2DH3A 3IGUA 4H7VA 2FHBA 4B16A 2G3IA 2YDSA 1KTBA 5CLWA 1C7TA 4ZE5A 3KL5A 3N11A 2JALA 4FLRA 4UR9A 4MJ4A 2AMGA 1UKPA 1NM9A 3S2CA
chains in the Genus database with same CATH superfamily
2VLRD 4PSRA 5HGHB 3SUTA 2Z8RA 1EO5A 3E6HA 4TNWF 4O4VA 3UYCA 2DD8H 2PUQT 4NQXB 1JOIA 3GXIA 3HG4A 3TA3D 3GSRB 1DQMH 2NY0D 3IFLL 3HRZB 4LF3A 1M41A 4ZDHB 1WKYA 2EEBA 2NQCA 3ORJA 3ZDYB 2DEYX 3L5AA 1X38A 1Q6CA 1U2YA 1XL4A 3QPXL 5CPOA 4MS6A 4NUGL 4DGIH 1E3FA 3LK6A 3ISIX 5B39A 2NYZA 1KGIA 4N7QA 4ZQOA 3FOMA 3ELQA 4ROQA 2E4FA 1SXZA 4IQDA 3WLJA 3I75A 3UYIA 1GGBL 2AEPH 1G7MA 1EBAA 3CZUB 3QYSA 2FYYB 2PI6A 2V6AA 1LLOA 1U8PB 3BPLB 1N8ZA 2I9LA 4DNLA 4XNZC 1LP9A 5FGRA 2PWGA 1JHLH 1OM3L 1GQKA 1J8HB 4JG9A 2W59A 3MFGB 3TOYA 3EBHA 2DDQH 3KVPA 4LU0A 3TTOA 3B2VH 3CX5K 4DCQB 1L7IL 1V02E 3G6JE 1E5BA 4JRYA 3DX7B 1I8UA 1QLRA 2IQ9L 2J5LC 4L8DB 3S37H 3ZO9A 5F9WC 4BSWB 5DHYA 1PLCA 1P6AB 2PCPA 5BV7H 1S78C 1XTMA 2WINA 1DWHM 3NWRA 1IGTB 5CKGA 1G1KA 1DVFA 2QQLL 3MNDA 4PLJD 1SOSA 3BGMB 5KUMA 4OZGE 3S8WA 2E25A 4NHVA 2WQDA 2YMXL 1XICA 4F2MB 1LQ0A 3ENLA 1U4EA 3HI6L 3U36A 1QRND 2KLRA 3C0LA 1T4KA 1TEYA 3ARYA 1C93A 3DIFB 1MHHB 2PODA 1YYCA 2HFFB 4TTDC 1AVAA 1C5CH 1R1CA 3A4EA 3RU8H 4L4VA 3L3KA 4P8QA 2MANA 1FVEA 2Y0FA 3PWNB 5JPNC 3ID7A 3CIVA 5D5ME 4G71B 4QEHA 3UCCA 3S36H 4JQVC 1I7RA 3CHSA 3VE0B 1FJ1A 4NCDA 4CCZA 3ULUL 4HEPG 1JK8A 5C97A 4PMNA 1AXIB 4ZDHA 2FAUA 4KI5E 3CAKA 4W9HC 2PXYA 5I18H 1F6PA 1VFUA 1IFHL 2N4IA 4XTIA 4K3JL 3B9OA 1V10A 3GMMB 4GK8A 3PIQA 2ACUA 1LDSA 2V4LA 1QBLL 4AQAB 3B9AA 2AL2A 2EHHA 3GAKA 1K6QH 4MXWH 3D25A 5G2IA 1ZA3A 3WFCL 3C9NB 2CLHA 3SGEI 2YD3A 5E2TL 4F66A 4XMLH 3VM7A 2TMDA 4MFHA 1B6UA 2X2UA 1EHLL 3TJPA 3Q2CA 1JUKA 1P0EA 3P30L 4HJWA 2E9WA 4NILA 3PWPE 2HPMA 3ARGC 4OQVA 2NY2D 4X7SL 1WCGA 2R6OA 4L29A 2D7NA 4UOQA 1R46A 4QXVA 4LMQE 3VJ6B 2XRAL 5HI5D 3C8HA 4BH7A 4UDUA 5H8MA 2CLZB 3QR0A 4RMQA 1YY8B 3KPSE 3DX7A 3NCJL 4KJPD 4YGVA 4GACA 1YAZA 4BQ4A 2Y5TA 3QEQA 3K72B 4IIEA 4RNIA 4PLKC 2Y6ZA 5J1TC 4CKQA 4JG1H 1N19A 1TVPA 4YQXL 1EBGA 4P05A 2ZWLT 3IYLW 2HJPA 4Y5XA 2XA3A 1D7CA 2KQNA 4XN7A 4NUGH 2I9TB 1J8KA 1I2NA 2R59A 2DQUH 4M7JL 4YYCA 5HINA 4P5TD 3NAAH 4GIYA 3VOCA 3S8HA 4GKOA 5D8ZA 1WXJA 2FZ3A 1DOSA 5B38B 1CZ8H 3DFHA 2ARJQ 3KUMA 4XCEB 5LAPA 1H60A 4LP8A 3OBKA 1QSFD 3SADA 1C92A 1KR0A 2V8MA 1MVUA 5F7LB 4E68A 1MW0A 3QR3A 1D5BA 4I9WE 4UTAL 4Q9CA 3VKJA 1JZ7A 3T08A 3LCIA 3CDGB 4IGBA 4Q8PA 2NXYC 2Y7GA 3BLDA 1TRDA 4N68A 3GSQB 4OF8A 5C3IA 4HS3B 1NLDH 2IQ0A 5EDXA 3LB0A 4Q89A 3B5HA 5KJRL 2D4DA 3MLZL 2BOEX 1JNHB 1KYUA 1DBBL 5BJTB 3I84A 5G4HC 1VP5A 3PU7A 3KPSB 4GI8A 3CUHA 2R2CA 1RPQA 1F3WA 4D1IA 3V6OA 3QZWA 3WUBA 3NCBB 3CV2A 4O51B 2IAMB 1KPVB 3NCFB 2OZ3A 4A6YB 1D8WA 1G4PA 4JVPA 4WI3A 2XDHA 4LUJA 2LTQB 1MCSA 2I07A 1L7TL 3QEHA 4O2FB 2Y62A 1QI2A 4C6QA 2YMXH 4UNVA 1HKLL 4B6ZA 3KVMA 1M2OA 4FF7A 4XBPB 4AJVA 4R88A 4YDMA 4NJKA 3HLAA 4NZJA 4QHLA 1TTUA 3LBOA 4EVZA 4L4TE 1KCLA 5I3GA 2EIZA 2HRHA 4N1EA 1PWLA 2PP0A 3NGBC 5KANG 1X5IA 2UY3A 1P5VB 5D7LD 2AANA 4ODVL 3ZE2E 1C90A 2OA9A 4G8GA 1M04A 1RIHH 1MVFA 4ROPA 5FIPA 4AZ5A 1PSKH 5J6HA 1WAWA 1AS8A 2BRRH 5A6BA 3MJGX 1AZ1A 5IGXH 2WZ5A 4RBPK 2GBAA 2X05A 5JHLH 3ZL4L 4I9AA 4N8PA 3MNMA 3BH4A 4EAEA 1OFBA 2BINA 3GBML 4QNPE 2WB5A 2Z26A 1NCGA 2QVKA 3X11A 4GUQA 5CLTA 4AZ8B 1LRNA 1V0NA 2YL6A 5GSRB 1ALDA 4DAFA 5AC7A 5DZNA 1WTGT 3RM9A 1T2XA 1F58H 1G9MC 2A77H 1E8YA 2ISWA 4ZQTA 1LEGB 4G43A 4GKNB 4Q9BA 1VFTA 1U0QA 5FR3A 4B15A 3M0LA 2C9SA 4DPRA 3QUZB 1Z8AA 4XV0A 3VGHA 3PY9A 3H6JA 1P7QA 3QHZH 2YD0A 4TKWA 1RJYB 4L9LA 5DD6B 5F21B 5A7BA 1GKQA 2K6YA 2D03H 1AMXA 1X1ZA 1YYAA 1SJMA 3H24A 1R3YA 4XBSA 3TYBA 3O45A 3QYCA 4HCRH 4IPNB 4JVWA 2ZVRA 3HGOA 25C8H 4N90D 1RZMA 3QQ3B 1W8GA 4K94C 4OR1A 4XVTL 1A66A 1ZL1A 2E7CA 1B0IA 4GEIA 2ZZ2A 3FT3A 3LH2L 4D6GA 2OZ4H 1XUUA 3OHXB 1TPXC 3BW9A 1SFLA 4P2VA 2EPKX 1W3KA 3P77B 4ABWA 3L21A 2PPAA 1H3TA 4OJEH 1E70M 4LEOB 4Z7QE 3UEZA 5KYYB 2K4WA 1BYNA 2VM9A 3ZX1A 3UXKA 3N29A 2XGIA 4QDPA 2VC6A 5LKYA 4TUUA 5L6YL 4LPUA 3ETTA 4L0ZA 4PJFA 4Y9FA 5FF6B 5D93C 3AVEA 5DHEA 3PJXA 1CFNA 5JW5A 2DZEA 1ZQ5A 4Y5XC 5IJCC 1OTSC 1RPUA 4FX6M 4CBPA 4QRRA 3WYRA 3B4YA 1I8KB 1OB1A 2UZYB 3A5VA 3GJEA 1YMMB 2L3BA 1VKFA 4HJ1A 5IG7B 1H5YA 4UFKA 5D1QB 5E23A 1KLUA 4AJYV 3WU1A 1XLHA 4HF5L 3EA3A 4JTJA 4PMQA 1PAZA 3L2MA 4QOKD 4DGVL 5I71C 4WTZA 2NLYA 3L0NA 4RV8A 2VC5A 4JTTA 3J07A 4I18A 3TYFA 4N5EC 4OM0L 4JK0D 4NENA 1T41A 3NDZE 3DLQR 5TDPA 1JZ2A 1AUSL 1BXBA 3QEUB 2ZP0T 4DAIA 3RLHA 4QX4A 2DQIH 2NR6C 5HWJA 1PS3A 3N6YA 4MVBC 5D7SH 1PZ5A 4NJ9H 5H94B 1NJ9A 1H5VA 1W3NA 1SDDA 3CC1A 3UBXG 1EC9A 3FTGA 2PGRA 2EF9A 1RUAH 4DELA 3FULA 2KMWA 2BSSB 4NZTL 2WKLA 1NEZG 1K8IA 1JAKA 2MWCA 4JFTA 1MWAB 4LCYB 4KQ4H 1TV7A 2A7NA 1SMOA 1ZCCA 5C0CB 1NCUA 1QSVA 5FYLH 1AC6A 4YLQT 4EOWL 4O10A 3OAWA 1JL8A 4R33A 4ETQB 4CD6A 4GY4A 4WLCA 2XZQL 3JYBA 4ZE4A 1JUFA 2J1WA 1QZNA 4FQPA 5HVFB 2AK4E 4H6RA 2EVJA 2GQHA 3IGXA 3RPTA 5D7JA 4OGYL 1JNLL 4Q4OA 4IIZA 3UJFA 5JOEA 4QHLB 4HUCA 3TBCA 2FEDD 4A7QA 4BFKA 3RWGB 1LLZA 1KIQB 3P9LB 3QUHA 4H83A 3SBFA 4MQTB 5I1HL 4IJ3B 4QGCA 4BRJA 3ROLB 4M5ZH 4PRAB 2PYEE 1AG6A 2Y4SA 4JQXA 4LRIC 1FWNA 1LO0L 1WA2X 3N13A 4J5NA 2JI1A 5K1VA 2AMXA 3GLZA 2C9UA 3OKMA 2OQHA 1YY9D 5I3FA 2VW4A 4KI5C 3NXLA 5LHEA 1H5BA 3MBXL 2OI9C 3EMCA 3DKJA 4QLRA 3OG6B 1DVXA 5EUOF 4LCWA 5IKCA 3UU0A 2FYYA 3F84A 1KPRA 1OQXA 3D69B 3C60D 3LZNA 4U1GB 4YPJA 5T1KD 2PTTB 3DOIA 1S7VB 3MV8B 1NDZA 5B1JC 3RN6A 3REWA 1OX4B 4YSRA 1MRFL 2W0FA 4I88A 1OK4A 4ODXB 1G9HA 1YQVL 2H3XC 1KA9F 3WEBA 1ZPLA 5KJ7E 4A2LA 1RBAA 2WWNA 3HUJA 3RGVC 4GS7B 1E4KA 3R4IA 1MRCL 1XH3A 1J5SA 1MFDL 2YCIX 4XXDB 1JJKA 3KJ6L 3LX9A 1JXFA 1I1AB 4J3OD 4RQQA 5J9PA 2V7NB 4ML9A 2C9XA 2HLFD 1P6CA 1OAXL 2FZDA 4BQCA 2OGJA 1Q2SA 1R9XA 3IVUA 5FW8A 5HR6A 4GQ9L 3HEIB 2CRIA 1MHHA 2CO6A 4K5PA 4ODTL 4RIRA 4UZGA 2DM3A 4NLAA 4AD4A 1MLCB 1KC7A 3TURA 4UTBL 4G6FB 2C9AA 4ZUSA 4PWEA 2BCKA 3MV9B 4HHWA 5ITFB 3BLOA 1YPXA 4ANWA 3N25A 3UA4A 2VDKL 3UTTB 2DQEH 2XQYG 2X4OA 3VIMA 3Q8EA 4IEFB 3S34H 4U1SB 1WHOA 4CU8A 4YDKL 3CHCA 4GBDA 5CSUA 4YTQA 1BBJA 3D06A 3T8MA 1TTJA 3E0GA 5ILTL 1R3LB 1G7PB 5DMKB 2ZRVA 3ABOA 3AG2B 4FQ2H 4S3AA 4XNDA 4YCPA 2XIOA 3CZEA 4QTIL 5F93C 7ENLA 3DEQA 5KZMA 1M56B 3WCYA 3HKZA 5ESAA 3EA2A 1ZTXE 4JY4A 1B4JH 1LILA 1SF5A 5A16A 1AKJB 1LWHA 4JM0A 4MCNA 3RTLA 4D9LH 2DLFL 3B8YA 2AQVA 3SCQA 1I60A 3AFLA 3PGCA 1L9PA 1X6UA 1U41A 2WYZA 2MCMA 5CCGE 3D85B 3O2VH 4I2XE 4MCZB 5L9DH 4O52A 4X6CB 4AQAA 2I26N 5EIQA 2R1MA 2ZOUA 4XNMB 3MC5A 3W7QA 3SQMA 4ONOA 3DVIA 3FB6B 1JFQL 3MR9B 2XXMB 7FABL 1SPDA 4REQA 4E38A 2OMUB 4ZMYA 1QR4A 3WIIL 3LS5L 1UC5A 4PJ8D 4NXSA 1W0VA 4ZOEA 3KCPA 3CWOX 3GKWH 3FSWA 3BLKA 1TLMA 4R4BA 1W5QA 3PDGA 2IJ0C 2W5FA 1L6PA 3QUKA 3S6DA 2CXGA 4MJIE 3L4TA 2J8TA 4RDYA 3DO3A 1LQAA 3MRGA 3OVUB 3MGOB 1QSED 2LVEA 3QDGA 4MA3B 1TQJA 1HTYA 1CLOH 1N64H 3RR1A 1PKQA 1NCJA 2GJPA 4U2ZA 1YPZB 3BUIA 1OGAA 3DN5A 3OJVC 4QAMB 4ABUA 2D20A 2WLJA 4R7WA 3OTRA 4I9XA 2YKLL 4M19A 3NPSC 3T81A 5T1KA 4S3KA 2CHXA 4JX0A 1GZPA 4PW9A 3ABSA 4XD6A 4F0MA 4I6KA 4AX7A 4OU3A 1Z41A 1KZQA 1CURA 1A3LL 1PCXA 3UG5A 2PTUA 3PABA 3E2VA 3I6LE 1F00I 4J8RA 4GB9A 4AQ1B 2JIEA 1GTEA 3SPGA 1BZEA 4WO4A 2MPAL 1L2UA 4LPTA 3TZVD 4HEPA 3SKJL 1QFHA 1SJDA 2Z2UA 3BK0A 4M8QB 3W2UA 2CKBB 5B3NA 4IIQA 5D7LE 5A8OA 2ENYA 1ADQL 3BG5A 1BQCA 3RKDD 1IM3B 4OCWH 4PJIB 2Z0UA 4UOW0 5LDSA 3WQ8A 4AYEC 4PN6A 3QIWB 5CN3A 2YFOA 2YEZB 1HNGA 5KVGE 3KBEA 1EAQA 4LOUD 1SM9A 3TLLA 2HEJA 3MLYH 1YCSA 4MNJA 5JUEH 5EB9A 1AGCA 3DX2A 3BLIA 4QLKA 4FA3A 1AAJA 2FX8H 3HJZA 1QI5A 2X7WA 4XXWC 4L2YA 4GG6A 3C5QA 2FNBA 4XVUD 3KH3A 3FQTB 5HHPA 3LM7A 4LAKA 5ERWB 1FA2A 4YHKH 4XAGA 4HPJA 2WD0A 1OCQA 3L4XA 2YXVA 3RIFF 3TJEL 3LCFA 3LDVA 1EXGA 2D0HA 2NY3C 4R2GD 4R8WL 2PUZA 1YYLH 5D7IF 4LSSL 2H1PH 4QMEA 4LARL 5CCKH 5FESA 1UB6A 4F2EA 4TQTA 1NBYA 4FQLL 1V03A 4P2OB 1HQ4A 1PL3A 1B4TA 4F24A 2BLFA 5A2IH 1PZAA 2F8VA 2VDKH 3PWLA 4M1DH 4K5NA 4HGKC 1V6VA 2WMIB 1CGSL 3P2DA 1I2PA 1K6AA 2FVKA 1N8IA 5DLLA 5AW7B 2H1PL 4HU8A 4PIBA 1OFOA 2RGLA 5D2VA 2RMNA 4XMXA 2NCEA 4L3FA 1BXAA 4LXFA 4P2RD 5IIEA 5IG7A 4TU1A 4S1QH 4HIHB 4DN3H 3H2OA 3ATEA 1INEL 1NMCB 2PR4H 3NSDA 3NZHL 1XIGA 3VE7A 1C12A 4D9QD 3M0MA 1CGUA 5H37G 4UFJA 2WCGA 3WBYA 1QWGA 4G83A 1EO7A 4LAJH 4J8RB 3CSTA 4POZD 4S3FA 2PC4A 4Z7OF 3AU6A 4R4ND 1LO2H 2IO5A 3Q13A 4J3OC 3RGTA 2AJSH 4IGBC 5I06A 4JM2C 2B59A 4R0LC 1Z69A 1X5HA 3PJSB 5IROC 5K9CA 3TCSA 3T3PF 3S5LB 4Y1AE 4NP4H 7CGTA 1FH7A 4C1NA 4DB7A 3G5XB 2Y1VA 5AHNA 1UWAA 1C5DA 4G2AA 5JQIB 2VVNA 3QDJD 1MI5B 4R84A 3GI8H 3DXAB 5CZKA 3S6CA 5CR1A 4NI8A 5DA0B 4HK7A 3QQ3A 3BD4A 4UT9L 1SLUA 4H2AA 3I75B 4B97A 4DT2A 1HZLA 3RKPA 1T2QL 3O45B 5C6TL 2DSWA 5GRUL 3RUGB 2MRYA 3QZLA 4JFOA 3C2AL 4FFVC 4MNHA 1RZGB 2ROYA 2CDEA 4Y5YA 2OZ8A 3O4LB 5DRWB 3H2CA 4H9UA 3ITLA 3TO2B 2L7QA 3UYPB 2HCVA 1T1ZB 5IHUL 3RJQB 4QJ1A 3NQGA 1F90H 4P2CG 1W91A 3D18B 3WLOA 3O2LA 4N6EA 1URZA 3N4AA 4XNQB 4OIAA 1TJ1A 5DT7A 3W7KA 1GZQB 4NX0A 5BMXA 3AG1B 3A3WA 3B0VC 3IXTA 4HBCH 5I5JA 3KOXA 3BN9D 1T6WA 4Y7OC 5E24E 1MCPL 1LG1A 2KERA 4Q22A 5M17A 3EFDH 3GRBA 3S88H 1H5BB 2R29A 3IRPX 5TJWK 2YUZA 3WL9A 2YZ8A 3RPBA 1RZKH 3SKUD 1WKFA 3G6LA 4FN0A 4G42B 1MELA 3I9GL 1M9SA 3EYFB 1Y07A 3NK3A 5C0QA 3BT2H 5HJ3A 3C5XA 4CGUB 4GRSA 3EO0B 2E7LC 5JDSB 2XG9A 3RCMA 5A2KH 2MQ3A 2PW2A 4HALA 3OKLA 1M7DB 5GJSH 4J2PA 4Q4PA 2ZJSH 5FGCE 4BK9A 1XWYA 2YDQA 4RRPM 3DV4A 3HVDA 3OGCB 4G8GD 4UI2A 4X6DE 1D5XA 1JK9A 4IMKC 4MA1B 1VFLA 2VABA 1TVBA 2YXXA 3ESMA 3CZ8A 4Q6IB 3M43A 3F85A 4JCLA 1KN2H 4KH9A 5I3DA 2A73B 2WTOA 1MREH 4QRQB 4U3CA 4MY9A 4YHLL 2NOYA 3TA4D 3WF0A 5DJAB 1KFCA 1PTGA 5DUBA 2ZOXA 2VEIA 4X0KB 3TYZA 3IRCA 4P61A 5A8QA 2MEJB 1EA0A 1VGAA 3D9AH 4NUMA 3UZQB 1QMLA 3CSPA 4F3HA 2WLYA 4WY7L 5AWNH 1XEDA 2RJGA 1H15A 4JKNA 4NWUH 5IK3B 1TPDA 1ND0A 4Z7UA 1DCLA 4XIMA 3MRLB 3ROOB 3DX5A 3BO9A 5DMGC 3W23A 1LZOA 4AGQA 1P7KB 1QYGL 1ZAGA 2IC2A 2PO6B 3I6KB 3HOGA 1LNUB 2DQJH 3KGTA 4WKXA 3V10A 2AV7A 4B7LA 3GFYA 3ARSA 4DHLA 3FB8B 1YE6A 2G50A 4XAWL 1MNNA 3AS3A 3WMQA 1E9LA 4A3HA 4P8WA 1J10A 1NKRA 3FB5A 3TR2A 3MTXA 1POJA 3CFNA 4ERGA 4M7KL 2IXQB 1LDPL 1L8NA 1YADA 4JHBA 1J48A 5CIPB 5CZVH 1Q0YH 4NQQA 5H35B 3ZGHA 4JPGA 4TLSA 5T91A 2O56A 3QE5A 1W6TA 2GQ3A 5DJ0B 1V7NH 3R5EA 4TMBA 4FI6A 1L9SA 2RDUA 1T66D 5AOLA 3X12A 2RALA 4NP9A 4HHGA 1F58L 2PMQA 2XHNA 1OP3K 1P69B 4JIRA 4XVDA 4ZMOA 1OSPL 2Z6FA 3A21A 5KYXA 4KO7A 1N5AA 3RX8A 2Y6SD 3PWVB 4RAVB 2H45A 2VKXA 5IBLC 5BQ7B 3S8GB 1ZSXA 4LLVB 4D7PA 1XCTB 3QHZL 5ESVB 5E0FA 5IUCA 3C2FA 4J4PA 3T44A 3TH6A 4ZYKA 2ATSA 4GMSL 5KYYA 1K85A 4YHIA 3JZUA 4X7DC 3UWYA 4PCSA 1OK6A 5LNUA 5BQ7A 1GOKA 4E36A 4M62L 4LNYA 4AD0A 4OECA 1O5XA 4ZL1A 1NCHA 3QXVA 1KLFA 1XXDC 4OV9A 1G7HB 3UNDA 4Z1YA 5FJIA 1Z3GH 3F8UB 2WYTA 2ZP8A 5IEHA 3G0UA 2NQ3A 4PGJA 1UEMA 5CJMA 2CQVA 3TZVC 5HDQH 2Y5EA 3LKPB 1HDMA 4WY0F 4NNYA 1DIDA 3P74A 2G60H 5IOKA 5K1NA 2ITFA 3IIXA 2XN9E 5I1LB 5CBEA 1HH9B 1ZS8B 2I27N 1A3LH 1Z66A 4IJTA 4F57H 1TO3A 1SDDB 1M1BA 3TN0C 4JS3A 3LGDA 1HHJB 4XRCB 1TFHA 3IXAA 2WKGA 5A2CA 1R3KA 4BCYA 2CWXA 1JPTL 5ABTA 2OGYA 3FSVA 2GGIA 1IQDB 3EJZD 1GOXA 2J24A 4AUJA 1M7JA 4TX6A 2DQJL 2VDRB 2DW5A 5KOMC 3N91A 1ZEAH 1FGNH 2P8BA 4HZLA 4BINA 3BWWA 1TENA 1UXLA 3ZDWA 2FX7L 4WO0A 5F0JB 2F19H 1A65A 1KV3A 1SFSA 4XR8C 2XKUA 5DUBB 3MSPA 1EX5A 2DT1A 3S5OA 1HVQA 4P9HC 5IB4A 1T8QA 3ZR4A 3HI6H 3AY4A 1LE9B 1AIZA 2ENSA 4BRVA 1XW8A 5KS9F 3N3EA 2WB1A 2RJHA 4JEQA 2H1LM 5GRYA 1PKNA 2HT3D 3EKZA 1OAUH 4I9JA 4L64A 1A5LC 4HGMA 4BUHA 2C7UA 2TPSA 4HOMA 4XPTH 3GSOB 4MNQD 5IXEA 5D7SL 4TLUA 2J4WH 1QRNA 6FABH 3OAYK 3KPOA 3BSGA 1UXSA 3JWNG 5DLMH 4NWTL 3BLEA 4PJAA 2ZYHA 1J8SA 4X5PA 1Y0LB 1U3HA 3GQYA 4OCSH 3LI0A 3L7FA 5FKAA 4EIBA 2NUWA 4HCRA 4R5VA 4BFGA 4JFDD 1WBJA 4NRXA 1IBYA 4PRDA 1SVZA 3TNMA 5F8RC 1H7NA 4UDTA 1MUJA 3QKEA 4DP8X 5T5NG 2X30A 2D0FA 1JD9A 1UKQA 5DD6A 4Z7QF 3GDCA 3LHPL 2PZNA 4KVNL 1UTDA 4XWGH 4JGDA 1GGCL 1WCBA 2VZSA 2ZIDA 4CADA 1D3HA 2F5BH 1H62A 2R8SH 1KXQA 2E9IA 2P48B 3SO3B 2GJXB 2ED6A 3EGJA 4IFOA 1DCEA 4N6RB 3KPPA 4MYXA 3SUSA 4NQDA 4JO2H 4JFOB 4AX3A 5KYUB 4R97C 5DQ9B 2P1FA 1XF3B 5I2IA 4E9QA 2QGCA 2XBZA 3MYOA 1M4KA 5D7JC 1F3JB 2VW7A 4KKRA 1FFRA 5EZOL 2JB5L 3FTZA 4WRHA 4Q8TA 3OBAA 4MKTA 2GJZA 1GYCA 4MXVE 4RE0A 4QRPA 4RPQA 3SPIA 3U4AA 4WJ8A 4BBWA 4J35A 3W7EA 2NWRA 3QXUA 1TA3A 1YBQB 1T0MB 5TPWL 4AT6B 2HG5A 5E2TH 5L2JB 2V5BA 3NDYA 3C09B 4PSPA 3D30A 3NZGA 1RJZA 1U8NB 4KUZL 4Q14A 4UFLA 2BNRD 4X9BA 2KX9A 3U2ZA 1GJUA 2VLRA 2OL3L 4XCYA 2X4NA 3P0YH 1FGVH 5IW3A 4NO2B 3P0WA 4QR6A 2EIZB 3Q3GB 4JGJA 4OZHF 4YFLI 1E5NA 3FYYA 1IM9D 3FYPA 1KNOA 4FXKC 4Z76B 2UY7A 2H6RA 4OTKA 2WIIB 4F7EA 2V2XB 3BH9A 1ZJAA 4TQEH 4IK7A 4KV5F 2O6PA 3RDTC 3SIZA 4BQBA 2E75C 3WQOA 2JKEA 2Y61A 3I2CH 3IU4H 4JQ2A 3JTTA 4QRAA 4ZX3A 4ODTH 5C71A 2EEAA 1YUHB 4MDOA 4KHTH 4UTIA 4W9ZA 2WBWB 2A6NA 3PNZA 1F3XA 4KVCH 3IUDA 2X70B 2YBVA 1UXWA 5M94B 2XKNB 2J7GA 3HFTA 3PIQB 1REIA 4JUSA 3CWHA 3G24A 4RDBA 3TDFA 1PLAA 2OSWA 2P8PB 2OEMA 2I5YL 2EH7L 4D0BA 5IM7A 1TZGH 2XXFA 4FAAB 3HMJG 1TG8A 1AJ7H 3ANYA 1GGOA 4Z2LA 3A67H 4M29A 1IE5A 2FTWA 2X1IA 3F7JA 3WNIA 2R0WL 2WTPA 3SDAD 3NPUA 4UFMA 3DFNA 4AQ1C 2F58H 2INEA 4N0YH 2EKJA 2WQWA 3WD5H 3V0TA 3V4PL 4F33B 2J1YA 1JUBA 3I6GB 3N41B 3WJZA 4D3CH 2DICA 4O28A 2PYED 1UOWA 4FKEA 3ZBMA 3E8UH 2WZTA 1NOWA 3SCUA 1T20B 1OGTA 4RRPG 1AXSA 2R94A 3FT0A 4AWSA 1TQCB 5E7FA 2P76A 1P9MA 2R0ZH 5JZ7D 2P5ED 2R91A 4MMXB 3I02A 1YPZE 1U1JA 5FEPA 4CQ9A 3O7UA 3VZXA 4C56D 1TYRA 4HZAA 3BAEH 3V9FA 4ZX5A 1EGJH 3L45A 5KITA 2MTPA 3NFNA 5BMWA 1W0WB 2B14A 1XGRA 2BVPB 3CLEH 3GNDA 3P2VA 4UMBA 4LSPH 1T03L 2FPYA 4Z1CA 2IH3A 3C08H 4OGYH 2BOGX 4YWSA 1Q63A 3NACL 4OLZL 1D9EA 3NN8B 4AIUA 1JTPA 2FT6A 1U58A 3MRCB 3PZOA 5FLVA 3OVGA 1P4LA 2VUOA 2XUCA 1ZT4A 2E0PA 2A6JB 4KHTL 4LSQH 5D2LB 1DEEA 4PJ7E 5EZIH 2XFYA 3WN6A 1U5VA 3UAAA 3MYJB 2AJXL 1ZK9A 3M46A 1C8PA 3D34A 1HIMH 4IPIA 2EQDA 2W07A 3THCA 2EG6A 1NFDF 2BNJA 4KX8A 2YPLE 2ZJSL 1JF5A 3ZGIA 4N2YA 5I8KL 1CXHA 3PXJA 1QSFB 4PGEB 1GOIA 3IJIA 4XCNA 3FHQA 5F8QC 4FLQA 1U8HA 5JPNA 1PNCA 5E6IB 3U2SB 3T0WA 4FZEH 1TQCC 3IBEA 4HOXA 3V0IA 2W63A 5HDLA 1QNOA 1A53A 1DQQA 1YUHA 4HA3A 4XMKH 4YUEH 4QHRA 2O1AA 5G1MA 4HK3J 4Y1AA 2FTYA 4EI5B 3HOJA 4LSRH 5D1XA 3W82A 4FXGC 1XC4A 1LO5B 3VABA 3FIGA 4IOIB 4PJGE 4U1KB 5G5DA 3OYZA 5FCUH 4NUJB 2W4XA 1RK0A 2FB4L 1CLVA 3Q1SL 4GVFA 3DUSB 4BK8A 4HSCX 1E67A 5CZSA 5HHVH 3PGDA 2EBNA 3BMVA 3S34L 3P69A 1NL0H 3DX0A 1RUML 2AC0A 2YA1A 1E7UA 3APNA 3P6LA 4P57A 3OZPA 1XV8A 3QJHB 4E41B 2V5KA 1LP9B 4G9FD 4GYPA 4JQIA 3JWNC 4N9OB 5F1NA 5F0PB 3CMFA 4H41A 3L1OH 4KK5C 5D7LB 3DTDA 1JMZA 2XTJE 4J3UA 4ZMQA 1XGYL 4PY8J 1GZ1A 1K1DA 2CW6A 1R5IA 1F3JA 1BF6A 1FL3A 3B0XA 3U7BA 1QBBA 5D6CA 3GR8A 3B2DC 1NIEA 1X5MA 1YN7A 4M24A 5I78A 4MBRA 5C2UB 1DJIA 2AW2A 5E1GA 1THFD 2XFFA 3AAMA 3VIJA 3KXFB 5AVUB 2QLVB 1SPQA 4K9EH 5EBWB 1Y1UA 2DZBA 1WD9A 2DWDB 4LVOC 4PRWA 5JTWA 1XD1A 4ILDA 3BWAA 5T5FL 3LUTA 4UTTA 2ZYRA 3BGFC 1HCVA 1J8HD 4QG8A 2XBTA 4GKSA 1LROA 2FGLA 4Z7WE 3GNMH 1N4XH 2Y72A 2D73A 4ZFOA 4QJ3B 3EZ8A 1ENUA 2FH6A 1QBAA 2BY2A 3D0VA 5DJZB 1WAPA 4B9GA 5FDYA 4N2KA 5BZAA 3Q01A 4J6RL 2RH9A 3TCEA 5KJ4A 4B2DA 5IGXL 5E8OB 3G9AB 4I7UA 4UT7H 4MMZC 5DD5H 3ZTNL 4F8OA 4OQTH 4G5DA 1RVFL 2P43B 5AW2B 2AZAA 4ZMTA 2A73A 4QRQA 5DQPA 5EA9A 4GJTB 3V4BA 2CKSA 1U30A 3MV7A 4BUQA 2EE6A 4ZO8A 2YPKB 3EB3A 1Q38A 2OJZL 2QPUA 3CFJA 1UH4A 2CR6A 3PTKA 4Z2GA 5JHDE 5DVMA 5F7AA 3FY1A 4DKFL 1TV5A 1GPOL 4Y5YC 3TQKA 2YPKA 3DBSA 4TQIA 2ZTKA 1WZLA 1PD1A 4ZZFA 1I8JA 4JFED 5JDSA 5LDUA 2Y7SA 3DFQA 4MLIA 1EFZA 3Q94A 4XNUH 5C0CA 1S7TB 1RBLA 2PSNA 4RFEA 3DVNA 5KVDL 4O2FA 1L6WA 4ENEC 3FCTB 5AZEL 2PDIA 4O4WA 4Y1AB 3EMQA 4ELKA 3GRWH 2P50A 3DG3A 4ATWA 5TGBA 3FEQA 2V17L 1X5XA 1RFDL 4XG1A 1O75A 1NCBH 3BXNA 3WL0A 1SVCP 3T0XA 3FTSA 1T0NA 2CLRA 4GEJA 3WFEL 3ZKND 5HYJB 2BGSA 4W84A 3BH8A 4YYFA 3L95A 2VAJA 5DHVH 1ZLSH 1W31A 3CNYA 3AT8A 1H8OA 3VD5A 1DYZA 4WZ9A 4AVNA 1EV2E 2YSWA 5BOJA 1T21A 3JV4A 4WI4A 4YHLH 1TX0A 3RTQD 5BO1H 2IS7A 4MA7H 3WEZA 2XPGB 1A6TA 1RZGA 4FQ1H 4UQIM 3D6GA 3FO2A 3PWUA 1JPGB 2R2HB 2JQZA 3P0VL 2ODOA 3MNZA 4DNMA 2FZBA 5FJJA 3KPRD 2XH7A 5HYSB 5F9OL 3GDBA 4F5CA 5MHSD 3TE9A 2GC7C 4A7SA 2OFQA 1LM8V 3QZAA 3ETBJ 2KT6A 4IHCA 4J3ZA 4M8VA 3DX4A 1F5WA 3DK0A 3CVHA 5J57B 1JPKA 3G5XA 2VI0A 2OTWB 4LNCA 3BPWA 3IJQA 4NGHL 4OLXL 3U0WL 1VEOA 2EDQA 3HPLA 5EIVA 2BBFA 3K72A 3HW7A 1PTDA 1BJMA 3DJRA 4PWGA 1EA9C 3LS5H 3MJWA 4HIQA 4OW6A 3V5HA 5CGMA 3LEVL 2H9GA 4GH7B 1A3RH 1O60A 4MWAA 2PXYC 3SPVA 1IO4C 3WH7A 3BW9B 2WY3B 1TO4A 3SBQA 1JNNL 4D3CL 1DHKA 1WLHA 2DF3A 4KU1A 1FUYA 2JIWA 4IDJH 4GQQA 2VZ3A 1OM0A 2HV5A 1I9RL 4LJ3A 3SM0A 2YL8A 1UM4H 1CFTA 2HT4C 1DQIA 2WBJD 3ALPA 1E0UA 1T5WA 1KCSL 2CDGB 2WN2A 3L4WA 4ADTA 3MKKA 4GPVA 3K6SB 1MHEA 1T20A 4P2QA 1WBXB 3EXLA 2NZLA 2BIPA 3MBEC 1S39A 2F5AL 3QI9A 3WFBH 3ZMNA 1HHHB 3RL2B 4LESA 2NY6D 1JVOA 1MHCB 2O6CA 2C4FU 4TOYL 1WUNT 2Z4QA 4LSTL 3Q5TA 4HAGA 4NKOA 1VCFA 1SJEB 3JUZA 1SR0A 4DPPA 1UWYA 4LHQB 1DBAH 1YEEH 2CDFA 3WTVA 1X4XA 2BXZA 2BSTA 2XY2A 2ADGB 5LUMA 1PFCA 3VXMA 1X7FA 2O55A 3F5JA 5JQ9A 3HS9A 4Z7UB 3GNNA 4M1BA 4PL1A 4D8LA 4H1LH 2VDOL 3M17B 1R4XA 3BQ5A 4YE4H 1DL7L 1Y6NR 4PR5A 4BWLC 1E40A 2CG9X 3BP5B 3IN0A 3EDEA 3L1GA 3OAZH 4JFZH 4MJ2A 3FQTA 3GC3A 3H2WA 5AW0B 2G2NA 5HHPB 4AQZA 4B9FA 1BD0A 1F05A 3L3KB 2YIHA 1V6YA 2CLKA 2H32B 4YVVA 3T7VA 4C90A 3QZPA 5TFSL 3UBGA 2BZ7A 2GHWB 2AXHA 4NUWA 4BQ6A 3BZ5A 1JPTH 3BJFA 3EFDL 3S88L 1ZV5A 1QNIA 2IXUA 4PRBA 3LLXA 4LDOB 1WAEA 5F7BA 5D03A 3TYAA 4JHWL 3FYIB 1FPTH 4YAQB 2B3IA 4A2EA 4EWND 4JFFE 4WFFD 3F2CA 1FN4A 1VEPA 2PCFB 3LCLA 4GS7C 2JKNA 4MQ7A 3MKCA 4LCRA 6ALDA 5AW1B 5BUPA 1SO4A 3CFDB 3SO3C 5TQ2H 2A9MH 1L7IH 4M7TA 3O1NA 5IOPB 4ACZB 3RURA 1TMHA 1JGIA 1OLLA 1FH5H 1GZPB 3MREA 4MDJB 4MMYB 4NI3A 4X8JA 3CSGA 4FXTA 5BUGA 1QDSA 1J8HA 5AVWB 1XBXA 3L68A 4X60A 2BVOB 5F3HA 2WP3T 2OSLB 4LKCA 3ABGA 2W8CA 4R4FL 5ESQB 3OC5A 2ASHA 1T5AA 3CGTA 4YHPA 1WZAA 2FJHA 4GFTB 1YECH 4X4MA 3O06A 3D18A 1N55A 2PDHA 1KTLB 1ME8A 1GTFA 3V0UA 4LY4A 1J12A 2DWDA 4OI9A 2ZCHH 2CU0A 5EU5B 1D5BB 1S9WA 3TJIA 1IAIM 15C8L 3MLPA 3B9KA 2R69L 2BFGA 4HPYL 3P8IA 2DL2A 2A0NA 1NDWA 4AHPA 4FFYH 5ITBL 1Q6LA 3C5ZB 1VA9A 4QHMA 3SD5A 1HEJC 1WAUA 1YNPA 4GPNA 3TK7A 1OK0A 4KQ3H 3USBA 2FB3A 3PBWA 5E4IA 4FQCL 3JRKA 4X63A 1JXDA 1KV5A 4L9XA 3QFDA 4HJ0D 2DWTA 4MVAA 4JFPB 4PGDA 4PMVA 5JW4R 1RIVL 5HHMD 5F1SA 4D0CA 1N9PA 1KMGA 1P4BH 4PJDA 1G5GA 3LNEA 1Z3RA 4YHNA 1F02I 4GUPB 4NX5A 2K0RA 3GVVA 3QS3A 1OD7A 5CEZH 5HGDA 2GEEA 2XGBA 3SCPA 4IRSD 4Y9AA 4FALA 1EAJA 4F40A 4DF2A 1ACXA 2YZRA 4DH2A 4HOWA 6PCYA 3Q3GA 3GHUA 4YSAA 5FKPB 1P4IL 3P0XA 4L1SA 2BK8A 2L7EA 5BXTA 1W1ZA 3ARTA 4ESKA 5I8CB 4QE5A 4JHOA 1GUVA 3TEXA 3FO1A 3UXFA 3AB0B 4GRMA 4JB9H 3QA3A 5FW6A 3WLTA 4JTUA 2HYMA 5ICYA 1XTLA 3BP7A 1T7YA 4TVCA 2BW5A 5K9KA 3UWUA 5FOOA 1QNQA 3LN4B 3O0KA 2HCZX 4KEZA 1FNAA 5EO1B 1CZ1A 2P8MA 3EH2A 3MRQB 4GG8A 4OJYA 5LQBL 4O1EA 3NP4A 4KFMA 1GMEA 1TR1A 2AS5M 3G5VA 4PUBH 3KTCA 4ZTXA 3TSBA 4KI5F 3WQVA 4H20H 4ZXBC 2ATKA 1JZ8A 5GJSL 4GO6B 2BNUB 1H3VA 4XMPL 4B95C 5HVHC 3RLSA 1KXTA 1FBAA 1ZJHA 4CDGC 3NVDA 1OTUD 5JHDB 4FTVB 1TMCB 3QN3A 3P11H 3TN0A 3SDCB 4EPBC 4RGNC 5C8JA 5HDWA 1RVKA 5LNWA 2BP8B 3HE6B 3EKCA 1UJPA 2QELA 4F2FA 4F2MA 2XVBA 3JT2A 2FLRT 3I7RA 1OARH 4U5KA 2WHKA 4PGCA 3JV0A 3C87A 3OB0H 1NBZA 1FL6A 3CHRA 4OGQC 3DXIA 4LOCA 2R4SH 3ZVHB 4YNYA 5AUMB 4G9DA 3BQVA 5DWUH 3WFZA 1N12A 4Z6AT 5CJ5A 5KSBA 1KSRA 3TVMD 2BHZA 3OX8B 5K9JH 2YD5A 4M93C 1FFOB 2YR3A 2ZUVA 3P4NA 3L7RA 4WFHE 4FZIA 1VIZA 4P4KD 4MOZA 2QHAA 4MMXA 2F0CA 2J7EA 1DO6A 3E7JA 3ZRSA 4F48A 1NUFA 1QFUL 1RL1A 4X5QA 1W2PA 3L4CA 4HLEA 3ETBF 3C6LD 1NGZB 3Q48A 1DWGM 1ZFJA 2B1HL 3CQIA 4GUIA 4Z1PA 4XCCH 5CBAA 3GNRA 5HVWA 4MWFA 4XB8A 1UCWA 3PANA 1JGEA 3D2UA 2MHAB 4YE0A 3LXBA 3NA8A 1J0JA 2Y63A 3MBWA 1U8OA 2AJVH 3RNKA 1H1NA 3TOPA 2PR4L 2TAAA 3NZHH 3QDJB 4ODWB 1XR8B 2EDJA 3P62A 3OJDB 3QUMH 2HJFB 3FCBA 4CGTA 3BAKA 3QUMA 4IU2B 4GZ7A 2F8OA 2Y24A 3S0CA 2KDGA 1VR6A 3OAUL 1TKWB 2CDFB 5DJDA 1QBLH 1WS8A 1A02N 2CRYA 4FK9A 5AW9B 3WLBA 3BXNB 5FYJU 5MP6L 3QIUC 1BTMA 1A0EA 5F7NC 4Y7MA 4PRNB 5F3BA 1XM3A 3BUYB 3CQ0A 3VKDA 4HV8B 2W5PA 1OQFA 4OLWL 2V5SA 4P2QB 1T5XA 1NGWA 3QJSB 4LOEA 4K1WA 4EAMA 3H12A 1E4WL 1M3JA 1PJ9A 1IBGL 4RFEB 1H3GA 4H26B 4HIJB 5IQ9B 3AU1B 4YHYB 1S2CA 1N18A 4OI8A 4ZUVA 2IQTA 4AWEA 3QVAA 1DLFH 2W1NA 4K71C 5DQDH 3BYTA 4C5ZA 1ROCA 1MNZA 2NWSA 4K15A 2V5JA 2GK0B 4Z0BL 4S38A 1XQKA 3WTUA 3QC5X 4HK3N 1NFIB 4XN4A 5HY9A 4W4QA 2X4NB 4MFEA 2QJDA 4PWJA 2EPLX 4G7QB 2NXYB 4O12A 5E0KA 2OZTA 3QULB 4QRPD 1NWSA 4NKDB 3RWJB 3NSFA 1V51A 3OGVA 2GIXA 4NJ9L 2HXUA 2IADB 1ZANH 3LKRB 3QPQD 2HK0A 4X5XB 2BVQB 4G5ZL 4B53A 3IAGC 1EXPA 1WCQA 1DHPA 1EOKA 3BAWA 2Y89A 1Q1JL 4IBSA 3KWWB 2Q3OA 1SOKA 5HYSA 3IFNL 3HZVA 3PUUA 4GW4B 3QUXD 4ZOBA 1USQA 3R06A 2B4CH 1BVZA 3MZ2A 1T89C 3EWYA 1XFPA 2BZDA 4HSOA 3EOSA 4KXZH 2UZXA 4JR9L 3QJFA 3SQOL 3W57A 3BPNC 4BZ1L 1UUOA 5TE6L 4IJCA 1WGOA 3L3GB 4DZ5A 2COQA 4X5LA 2A3HA 2AQ2A 3WD1A 3GIZH 3REWB 1OX4A 1XYAA 3IRSA 4GLEA 4EQ3A 2MJWA 5DHVB 3VIKA 3CIQA 1KELL 4AEIH 3BGAA 4A3YA 5I6PA 1YPIA 2NMSA 2Y6TE 4Y5YB 2J7BA 1L6FA 4HQQH 5HDBE 1MQKL 1IZKA 4WI0A 3NFSL 2K9FB 3QQ1A 5I1AB 4L9LC 3LEXA 3GXDA 1HJCA 1TWIA 1CDUA 2FFCA 1E2VA 4G6CA 2VQ1B 1U8KA 4J1UB 2Y0SA 5E8NA 2BVDA 3DFTA 3ISRA 1P5BA 4QISA 4Z9KB 1EZSA 2ADJB 4MNQA 4D8PA 2YYTA 3U3HA 5BOEA 4HKXA 1WAAF 4DVRH 3JWNE 1IIHA 1A4BA 3L3OA 2GOUA 5DQJA 4E4UA 1MIEH 2ITEA 2VABB 4D8OA 6FABL 3PFMA 1UYWL 4B16A 3QR1A 4I4WA 2J2ZA 5I6SA 3S4SA 1SUXA 3H4WA 1LLWA 4YDJA 3SUUA 2EDMA 2RCSL 3EO0A 4FXSA 3KCJA 3D51A 1VCAA 5JIMA 4XUGA 3H0TA 3DKLA 3SE6A 4XP1L 3WN5B 1RHFA 2VC2B 5KEZA 2I24N 4TSBL 1U5HA 2JI3A 3N5AA 1TEFA 4G7VH 4FS9A 3AJ7A 2V9RA 3K91A 4JZJC 3QFJB 2WXPA 1YY9C 2COVD 5J5EA 1TLKA 4RSYA 4HZMA 5AVNA 4JTRA 5D7IE 4WTZG 1VB9A 5EC2B 4B5ZA 1GY1A 3U2SA 4MPQA 1N6UA 4KVNH 2EG8A 4KTDL 4NO0A 3T0BA 3RX4A 3HS8A 5EZIL 2INZA 4AAJA 3VH8B 3QDMB 1HQ4B 5EH1A 2BB0A 5H2BB 1I3RA 3BIAX 4C6BA 5TE7L 3WLRA 1NTDA 3DGBA 4PRIA 2DJSA 5LB1A 4MSSA 3UZYA 3B2VL 2K6ZA 2YXFA 1G9ML 4GY7A 4GRLC 3TCLB 4M6NH 5I6KA 3DX6B 5IBUB 2OP4L 1MMFA 3NIYA 4NSKB 1Q72H 3S5YA 1CLZH 3VFRA 1QLFB 3CAWA 4XZ4A 3VMNA 3QXAB 4WK0B 4L65A 4JLRA 3T1WA 3O8XB 2N1TE 3D12B 5IJDC 1XDLA 4WIWA 1PVHA 3STLA 4MB1A 4J4PD 1ED3B 5D2TA 5AVTB 4LUTB 1OTUC 2LLGA 3ECWA 3S5ZA 3QJHA 3PJWA 3ZDZF 5I6MA 5I71B 3QQNA 3PPFA 3K8LA 5AHLA 3RI5F 1R19A 4JO4L 2XFWA 2YCEA 2X4SB 4NVTA 4E3VA 4JTIA 4S1SL 3QFGA 3W39B 5K9DA 15C8H 4LK4A 4PS4L 3ZZSA 3PQYE 5F72S 1R3RA 3VXOA 3OP2A 2ZX7A 2BNRB 1AMKA 3H2FA 4C91A 3W1XA 2VERA 3CFCL 3MRMA 1RUPL 4OIFA 3QFWA 3MDJA 3SKOB 4FLOA 3MBED 3OZ9L 5TF1L 3USZA 3WD5L 2D0GA 2FJSA 1UB3A 3OGRA 3PY2A 5FACA 1DVTA 1W72A 3LQAL 4BCEA 3A4DA 4NN7B 1YEJH 4PHXA 3ZL4H 5J12C 1WV2A 3FKKA 3PHOA 3W6MA 4HUUA 3VFVB 2AJZB 3P81A 4X9SA 3PB2A 2XWTA 3VFPA 2ESVB 4DK3A 2NZIA 2XIJA 3IDNB 2IFFL 5FYKL 2WXDM 2MNWA 1DJSA 2DZXA 3UEQA 1KGCD 3TQ0A 2C9PA 3B7UX 4DJEA 4F37F 4B9CA 3T2QA 4NFBA 1NAML 2PKDA 1KUMA 2Q3RA 2QT6A 1GEHA 5L9DL 3OAUH 1UB6B 4XH2B 5DR5H 1AR2A 5DDHB 1E6ZA 3MJ6A 4MASA 3KP0A 2NQZA 1RUAL 3MRJB 3BQUD 4UNTA 4CW1A 4FULA 4J3OH 1YSOA 4JFFA 4M5YL 3NGJA 4FX5A 1HL8A 2UWEF 2NY2C 2G2PA 1GG0A 2WMHA 3HZMA 4AEEA 3VXRD 4A6YL 3LRKA 4N8CL 1VZHA 2FGZA 4LDLB 4DKAA 4J9JA 4YU1A 2DQCH 3TC7A 2Q5BA 3AG4B 4WSKA 1L0PA 3D3VB 2WZ0A 4L3EB 3S4TA 4QRUB 3T05A 3UT0A 4KT2A 3LQMA 2RCSH 3U7YH 4WVRA 1MNSA 3I50H 4AF0A 2CO7B 1J8HE 1XLLA 3WJMB 4S1DC 2ZRZA 2FQGA 4ICWA 3D07A 2GSGA 2ZP9A 3HE7A 4KJYA 4LPVA 2JGYA 4HS8H 1KZYA 2BASA 3BPOB 5EF2A 1XUZA 2J88A 2IH9A 3HPXA 2QPSA 1FDZA 4E0CA 4X4ME 5KSVB 3R8RA 4KCVA 3H9HB 2IMNA 1AD9A 5ADOH 5L8LB 1F3DJ 1IBHA 2WBGA 4BWTA 3BT2L 5K39A 3W81A 1EJTC 4Q6YA 3W11C 5DYOB 3KDOA 3D47A 3BUYA 5I07A 3DBXA 5T1KB 4QKTA 2B15A 2XU9A 4M00A 5EBUA 4XP4H 2XSBA 1PY0A 5EMJA 2GW5A 1JNHA 1KFAL 5C0JA 1MRQA 3TBVB 4RQQB 3BKJL 3VXUD 4MX7A 2YZ1A 1UXMA 3CUPB 4W87A 1EAPA 5AB1A 1ZEAL 3LSBA 2PLJA 2J1ZA 4WQ6A 2NNRA 2R1WB 4E5XG 2H26B 3W37A 1HXYB 5IQ7L 5I1EL 1SJHA 3RPKA 1B31A 3MQIA 2JQMA 3OWRA 1A14L 5KYUA 2GPZA 3LB6D 1UBSA 1VRDA 3UTSD 2VR2A 2HRPH 5DGRA 4PUMA 2G3ZA 3ARUA 1A5SA 4G7FA 3QDJA 1UC6A 2PDMA 4EOUA 4NRZB 4PJXE 2W3ZA 5XIAA 1ZLVK 1T6VN 3WK0A 3IKCB 4JDVB 5LXXA 2IKIA 3II1A 2HK1A 2KQMA 2B9AA 3DXAA 1Q1JH 1DP0A 4X5XA 3KJ4B 5E8EA 3P9MA 4HMNA 2FX9L 1OOWA 4A29A 2IGTA 2J4WL 1LUCB 2YUXA 1BYAA 4UR8A 4JX6A 5SV3A 4X9IA 4GSDH 5LBVA 4PMJA 1F4XH 3RFZC 5JR1H 3VDGA 2AJ3B 3HZYB 2OT1A 5DHDA 1QEWB 5CGYC 1EFXB 1AQFA 3V52L 2VRKA 2YO3A 2YPLD 1UD2A 4WKFA 3DRTB 3HG1A 6XIMA 2HNEA 2ROXA 2VM3A 1QFWL 4U7KA 3ZVIA 1C12B 1UIPA 5IQ9A 4J6IA 4KY1H 2VKWA 2W95A 3Q8BA 4TUJA 5D1ZC 1AW5A 1LO5A 4H1ZA 4L9ZA 5E5UB 4QGYA 4I5BB 2ZOLA 5ADOL 1ASPA 3BJTA 3NIFE 4PWKA 5IT2L 2E6YA 2WC4A 4BI5A 4TLKA 3HB3C 2OW6A 2J6EL 3NXFA 5JUVA 1F8MA 2GJ6A 5MEPB 5LIUX 1OVZA 1GYUA 3PREA 2AL2B 4JS7A 2V7NA 2PWDA 1KXTB 2WO2B 4M9OA 4XCNB 3ECBB 4O14A 4FOMA 4KDTA 3TX4A 2C6QA 5E9NA 2WWMC 3QZ6A 1FNGB 5DD5L 5DRZA 3PHQA 1JXGA 1QAPA 3OEXA 3BO8A 1PZ0A 3LNMA 1FCVA 2DSUA 3TF7C 3VDHA 2VL5B 3TJEH 1FJ1B 4BHUI 3W0KA 3WXVH 2J71A 3ZTDC 4L3ED 1XGUB 4BZ1A 1FXQA 4WHDA 1HQTA 5DO8A 3T0ED 1N2VA 1UHVA 2BVWA 3ITTA 3JTBA 1E9PA 3O05A 2NX5B 5EU4A 4Z5RA 1B2WH 3MRIB 1Q3NA 2XWBB 4Q6JA 1RQ5A 2WO4A 4X4YA 2WYSA 2IBZY 1FWWA 4IXHA 4W88A 3OKNA 5C0FB 2G3NA 3L12A 3IDMA 2KHAA 3KLHC 5JUEL 2WXOA 3UAJC 3WO4B 1BMZA 4WEVX 3WMSA 3FA5A 4IM4A 4ZFZB 5DHXB 3TZVA 5KBDA 3T40A 1BLNA 5T3XD 5DXWA 3VYNA 5ABFB 3T0EE 3GJEB 5KG9A 1T6MA 1SZEA 1NZRA 4L3EE 3V7AE 3S1XA 3WSQL 2YAOA 2VQTA 2CCRA 4O2CB 3NEEA 1V3IA 1II4E 1INEH 3K1DA 4K3DL 2OJPA 2HE5A 3SKJH 2J9XA 3SPVB 4WWOA 4KBXA 1M1SA 3QRGH 1OCRB 4YZFE 2WHMA 1TWWA 4C54A 2JELL 5EMYA 1AE6L 3FDGA 5C0RL 2SFPA 2Z2AA 4YAQA 3F5WA 3ZK0A 3PP4H 3GB6A 2R29L 2PRLA 1OGTB 4G1EA 1F74A 1GOGA 2EE3A 3FT9A 2ZKYA 3WNLA 2WK2A 4PVMA 4JKPL 4OGXL 1A4AA 5E2VH 3O8XA 1A7QL 4F3FB 3N55A 3D50A 4G80A 4AY1A 2IPUK 3MLRL 3P3BA 43CAB 1G7QA 1CEOA 2DWEB 2FVNA 3WKML 1ZXQA 3TJHC 2O26U 2QMKA 5IROD 3MOQA 3V0VA 2BIOA 2XFGB 4YHYC 3FSTA 3OSVA 4U1MB 3O2WL 4GAYB 1AI1L 2VHLA 3MFFA 1YEFL 1M7PA 1W17A 3QCTH 2FPTA 2CBTA 1GS7A 3GO1H 4FCHA 4HPOH 4KK9C 4NENB 3JWOC 4ZTPH 3ISWA 3B0PA 4W9GC 2VKZG 5IESH 4HPYH 5DRNB 1XFBA 1IFHH 1PCSA 4CUCA 1MNUL 1QP1A 2JXMB 1BQHA 1HH9A 1NUNB 3MKGA 2OQYA 4MMXC 1Z6JT 3CAQA 2FGWH 3BIKA 3ESPA 3FTWA 4KHXL 4NQTA 5MEOB 4R96B 2ZDSA 3L1FA 5AVSB 4F80A 4LNRB 5CO1A 3TL5A 3ANVA 1EGJA 2A6IA 1B3OA 2WNQA 3QHOA 1GHFH 5E4EB 5E8PA 1F4WH 3A9BA 4OT1L 1L6SA 3G5WA 3E49A 2R51A 2UY5A 5T3ZH 2X7LB 3AS1A 1VPOL 1XCTA 3HLAB 1A7OL 1A7BA 1D2PA 1RK1A 3FQRB 3HAEB 2Y1YA 3NZ8B 3F7VB 4E9LA 4EQ2A 1GONA 3LBMA 3SCSA 8TIMA 1TYEB 1I9IL 1F2QA 2AJXH 1CF1A 1WUEA 4H9VA 3P4MB 4K7FA 3HGRA 3M44A 2WNZA 5REQB 5LSMA 2E40A 2XUWA 3EYSL 4K8RH 3ATAA 4IGNA 2VUNA 1HCFX 4Z77B 2Y1ZA 4W4OC 1F73A 1O12A 2XN9B 1T3FB 4HSNA 4EJ1C 4C6IA 1TV4A 1MFDH 3EWXA 5FGBA 1TV8A 5DC2A 1E4HA 12E8H 2WMJA 2ZX9A 1Z48A 2HKAA 2KZBA 3K5RA 3C60A 1RERA 1SN2A 3G6MA 4ES4A 4LCWD 2OTUB 1IR2A 5AVQB 5C2CA 4LLQB 4HK0A 1ZLVH 1R3KB 1QUPA 3V5OA 1XSIA 1QNSA 2PDFA 4PY8I 3PL6B 5LHFA 4L1XA 3JT0A 2Z25A 4CSPA 2JJTC 2F7OA 4XCEA 2PPEA 2FX8L 3LKPA 2FO8A 3PV7A 3APCA 1FI8C 4N2NA 3LGGA 2ZF8A 4F8PA 1AJ7L 1Q0YL 1WITA 2FT7A 5LXGH 4L4TD 4LW7A 3CHVA 3EA1A 1IMHC 4JR9H 4NAQA 2Y25A 5D7JD 1FQ9C 5I75C 2AK1H 3VO0A 2DZPA 2E7DA 2HWGA 2W79A 4WGHA 2R1NA