1MXGA

Crystal strucutre of a (ca,zn)-dependent alpha-amylase from the hyperthermophilic archaeon pyrococcus woesei in complex with acarbose
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
435
structure length
435
Chain Sequence
AKYLELEEGGVIMQAFYWDVPGGGIWWDHIRSKIPEWYEAGISAIWLPPPSKGMSGGYSMGYDPYDYFDLGEYYQKGTVETRFGSKEELVRLIQTAHAYGIKVIADVVINHRAGGDLEWNPFVGDYTWTDFSKVASGKYTANYLDFHPNELHCCDEGTFGGFPDICHHKEWDQYWLWKSNESYAAYLRSIGFDGWRFDYVKGYGAWVVRDWLNWWGGWAVGEYWDTNVDALLSWAYESGAKVFDFPLYYKMDEAFDNNNIPALVYALQNGQTVVSRDPFKAVTFVANHDTDIIWNKYPAYAFILTYEGQPVIFYRDFEEWLNKDKLINLIWIHDHLAGGSTTIVYYDNDELIFVRNGDSRRPGLITYINLSPNWVGRWVYVPKFAGACIHEYTGNLGGWVDKRVDSSGWVYLEAPPHDPANGYYGYSVWSYCGVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha amylase
publication title Differential Regulation of a Hyperthermophilic alpha-Amylase with a Novel (Ca,Zn) Two-metal Center by Zinc
pubmed doi rcsb
source organism Pyrococcus woesei
molecule tags Hydrolase
total genus 160
structure length 435
sequence length 435
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mxgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mxgA01
4TTGA 2PWGA 1MQPA 5E0CA 4P7QA 4D6HA 1BLIA 1TVNA 4WIWA 4CCEA 2QV4A 4AD0A 1OBAA 5FL1A 3VGGA 3LXCA 1HTYA 4J3VA 1CGTA 1W9DM 3WUEA 3PZTA 1LG2A 3A4AA 2Z1SA 3GXNA 1TE1A 2X1IA 1ZL1A 3FXYA 1MXDA 2YOCA 1FFRA 4K68A 2JFEX 5I0DA 2J77A 2XIIA 1JZ3A 1QX1A 4AD4A 1OCQA 3PZUA 3ARSA 3VTRA 3WMCA 4U5KA 5BROA 3SEPA 5E9AA 4H41A 1QHPA 2JF7A 3THCA 2A3HA 1JZ8A 3AISA 1C7SA 2Y2WA 1NOWA 1C3FA 1J0ZA 4F66A 1CXKA 3ARZA 5A3HA 4U3CA 2VMFA 3W37A 4AC1X 5F7UA 1JZ2A 4D6FA 1AQHA 1UWRA 3AIBA 3S5YA 1NWRA 4PMQA 4DO6A 3SCUA 1R86A 1US3A 4AY1A 4KRUA 5JUVA 3SUVA 4Z2GA 1UZ4A 2DSUA 4PMRA 1NWSA 4QLKA 4JFWA 3WFZA 1BG9A 1ESWA 4P8WA 3T0DA 2WCAA 1JZ6A 1CGYA 3DX2A 5A6LA 4H2CA 4ATWA 1AQMA 3UERA 1OSEA 2GDUA 1DTUA 1EHAA 2YDSA 1B30A 1LL4A 4PMNA 4L4PA 3SUSA 1NQ6A 5A8PA 4P8XA 3WY2A 1JF6A 2WAGA 4ATDA 3VNYA 2Q8XA 1H0IA 2WCSA 3W0KA 3CO4A 4HU8A 1NP0A 1W3JA 4XZBA 2EABA 5I3DA 5ECUA 3VIGA 4HA3A 2PB1A 4Q7NA 5E09A 4D6GA 2XVLA 3T09A 1J01A 4W87A 4P7LA 1BYCA 3PTQA 1FHLA 2DSWA 3WUGA 5A6JA 4AWEA 4V27A 2OWWA 3WY1A 3WL0A 2YL5A 1HL8A 4GPNA 2D1ZA 2PBGA 1E1FA 1LJYA 3CH9A 2J8FA 1V6WA 2YLLA 2V3DA 2YL9A 1GOMA 3SCWA 4A4AA 4B3KA 4OIFA 3WDJA 1H0GA 5CJ5A 3KWXA 2BNJA 4LPCA 1W9PA 3CZJA 4IISA 3RCNA 2XPKA 4ZE4A 3QHOA 4JFTA 1TQSA 3CZNA 4M29A 2FE0A 1KBKA 4KWUA 3BSHA 3GXIA 2E4TA 1EDQA 4ZE5A 4GZEA 4MJ4A 3VSTA 4WKHA 4LYPA 1KXVA 3A4WA 4PMDA 2WC4A 4IM4A 3EJSA 4QLJA 2W67A 1QI3A 2F18A 1C7TA 4YHEA 1ZJAA 1HJXA 4TXEA 4DWSD 2D23A 2PC8A 3BLKA 3CHEA 3GXDA 3OGRA 1VFUA 1HKKA 1E4NA 3FAWA 3HJEA 3TTSA 1IT0A 1NH6A 1G01A 5D4YA 3GH4A 1C8YA 3BAWA 5TD4A 3FHQA 2XTKA 4UZUA 3ARWA 1V3MA 2QMJA 4UQ9A 3POHA 3W25A 1BVZA 4FNQA 2D73A 4YHGA 3OLGA 3ZSSA 1E0VA 2ALWA 2WSKA 1ISYA 4AZHA 3VIPA 4FNRA 1CWYA 1QWNA 2OYKA 1HJQA 5JIPA 3ZT6A 1HJWA 5HBFA 1W3KA 2J7FA 3ARRA 4Z2KA 4LYQA 3WUBA 2ZX5A 1E43A 3O6AA 3PZIA 4Y7EA 4H8VA 1JAKA 1J0KA 2V5CA 2XSAA 3LMYA 4TOQA 4C7GA 4J3XA 1C92A 1SMDA 4M56A 2ZUWA 2J25A 1VJSA 2GVYA 1JZ7A 5GNXA 3GM8A 2CBUA 1NARA 1Q6EA 4WKFA 2XGBA 4NZFA 2VT0A 1KGUA 2BY1A 2YKKA 3IJ8A 4B9YA 3CPUA 4CCCA 2XVGA 2ZUUA 2QPUA 5HNNA 3S5ZA 4EE9A 1OM0A 1TQUA 2WBGA 5CGTA 3H54A 1GCYA 5CSUA 2NT0A 2IXUA 5ABGA 4M81A 2F8QA 3WNLA 1OB0A 2WLYA 1H3GA 2XIBA 1MFVA 1EO7A 3OGVA 4ACYA 2VQUA 2X2HA 3RJYA 2WVUA 3NYDA 3MI6A 1Z32X 4PBGA 4MNKA 1UUQA 1D7FA 1DP0A 1KXQA 1H1NA 4EAMA 3A5VA 7A3HA 1VAHA 3TTOA 1UR4A 4J7RA 1E15A 1TQVA 1Q6FA 3WF3A 3HMCA 2W63A 2J8GA 3PTMA 3SCQA 4J3WA 4NZJA 3BAXA 4MADA 4W89A 1UH3A 4DWSA 2ZE0A 5M3WA 1H09A 5LA2A 1XSKA 1H11A 4PUEA 3N15A 1UD3A 2XN0A 3QR3A 3SCNA 4CVUA 5A94A 3W6MA 8A3HA 1QWUA 1B31A 1R34A 4UFHA 2D0GA 2X2IA 2B31A 5BCAA 1WZLA 4L4OA 5A2BA 3RILA 2CKRA 3WENA 5BXSA 2W62A 2J4GA 3PBGA 3VIJA 4NSBA 4PSRA 1QNOA 2WSPA 4HMEA 4XUYA 1GW1A 2WW5A 3H53A 3OZPA 3PZNA 3ZO9A 5A1AA 3CZKA 2BHZA 2OWXA 3AHVA 4UFKA 3VDAA 4UFIA 2YFOA 1EO5A 2VQTA 1KQZA 4GI6A 4LXFA 4P8VA 4OOZA 1G5AA 1CXFA 3OZOA 1KCKA 3AHTA 1W3HA 1ISZA 1W9VA 2TAAA 1JD7A 3MSDA 3BUIA 1IZKA 4E8CA 1EOMA 1RH9A 3BLBA 8CGTA 2XG9A 3O2LA 3F5KA 5M03A 2YIHA 4W8BA 2J47A 3VVGA 1GOKA 4UOQA 1QHOA 3WQ4A 4UQAA 5AC4A 1BSIA 1JNDA 5A6BD 1BYBA 4F9DA 4LQ1A 2BV9A 3GBEA 3MUZ1 5IHSA 4AW7A 4JL2A 1HXJA 4JKKA 1VEOA 3A47A 3ARQA 1E6XM 3IAQA 4D1IA 3AOFA 3BUPA 4V28A 3CC1A 3WUFA 2ZWYA 3GXFA 4J27A 3WNMA 5EB8A 1E6NA 3VD3A 4ZEPA 1HN1A 2NSXA 1U30A 4JL1A 3ZOAA 4FLRA 4LX4A 4DUXA 2VVSA 1W9XA 5A8NA 1KBBA 4EKJA 4NI3A 5I78A 4PMOA 4W93A 2VJXA 2D22A 1FH7A 3BMWA 1HJVA 1SR0A 3WNPA 1EDGA 4GKLA 1CECA 2W5FA 1YHTA 2MANA 3SCRA 1EGZA 3VGEA 1UG6A 5I77A 1T0OA 3EJTA 3ZM8A 2JEPA 4MNLA 1VEPA 4A3YA 3OG2A 2BHYA 1ZB5A 4Z2LA 4RE3A 3MU7A 1KWGA 1KTBA 3KL0A 3MUIA 3A3HA 2GDVA 2DEPA 2DT0A 3KL5A 3D4ZA 1MXGA 4HMDA 5HDRA 1V6XA 3ALGA 1J12A 3OIHA 3VIOA 1CGXA 4XX6A 5DT7A 4HPGA 1RP9A 1GOIA 1ODUA 2DSZA 3BCFA 2VX6A 5GQBA 3VIHA 3N9KA 2YL6A 4UCFA 3LPFA 5CQ1A 4WKAA 1VB9A 4JCLA 1V0NA 3GH7A 1NM9A 1MW3A 2VO5A 4J28A 4Z2IA 3FW6A 4UQBA 4DM1A 2GK1B 1UOKA 1JDAA 1I1WA 2Y8VA 3LX9A 4W8AA 1DWIM 1VFFA 1TCMA 3NSMA 3W4RA 2WMJA 1AQ0A 1BGAA 3WIJA 2VR4A 2ZXQA 4QCFA 3EBVA 1QBBA 4MAZA 5I6SA 2VCAA 2ZWZA 2EPMX 2XFYA 1QI0A 2J7EA 3QHMA 3BVTA 4F8XA 2VC9A 4JHZA 4DWSB 1KGXA 3B9DA 5CXPA 3TA9A 1VFOA 3AS2A 3IAPA 5JBFA 2A3CA 3N18A 5BXRA 1OINA 2OWCA 3IJ7A 1WO2A 2GJXA 1W2VA 3W26A 2G4FA 3AIQA 3TV8A 1XD0A 3VSVA 1QVBA 3PTKA 5DT5A 1R33A 4TX8A 2X8RA 3VD9A 3GBDA 1F4HA 3ARVA 4H8HA 2CPUA 2CXGA 1C8QA 3WDIA 1QBAA 4BA0A 2OYLA 3AZRA 2NW0A 4PTXA 1JGIA 4JFSA 2VCCA 5D8WA 4MB4A 5FL0A 1SZNA 3CMGA 4BQ2A 3FHAA 3AIVA 3B9AA 1V0LA 2BXYA 1C8XA 3DHUA 1GQJA 4CD8A 4AIOA 2VCBA 1R7OA 6TAAA 1FFQA 4BQ3A 3W6LA 3BSGA 1VRXA 1YQ2A 2O9RA 3D50A 3ZT7A 3HN3A 1K9EA 4BCEA 4LGXA 1WP6A 4JKLA 2UY5A 4IUGA 4YPJA 1PX8A 3DDFA 1XV8A 4GQQA 1JYXA 3UEQA 1R47A 4B15A 2D3NA 3AJ7A 4TX6A 3CHCA 2Y24A 3VGFA 1FP8A 4CUCA 5BRPA 1GHRA 5LYRA 1AMYA 1E40A 4UQDA 4KGJA 2VZVA 3K1DA 4WSJA 2A3BA 4GO8A 1R87A 4E2OA 4CD6A 4HOXA 1S46A 1UZ1A 1UD2A 1KWKA 3AICA 4TVCA 3CV5A 3II1A 5M5DA 3D51A 1HWWA 4FNUA 5AY7A 1WZKA 4AIUA 3WDQA 3BMVA 1JXKA 1HJUA 5A95A 1J0JA 2CBJA 4MB5A 3BAIA 4FLQA 4BF7A 2WHMA 1HL9A 2BY0A 3ARYA 2DIEA 2VVNA 4QCEA 3DX3A 1VF8A 3W28A 3AI0A 4URIA 3QOMA 3RIKA 1OD0A 1U33A 1E9LA 3OLIA 3T2OA 1UD6A 4UOZA 1A3HA 2J7GA 3ARTA 3F4VA 3WL1A 1EQCA 2JE8A 4PUDA 1ECEA 1BF2A 3HG3A 3VD7A 1EXPA 1OWQA 3ZSTA 3AXIA 1KFWA 4AMCA 3BAYA 3SCVA 4GQRA 1TFVA 1MQRA 4HTYA 4D6EA 2JIWA 1ZJBA 3BAKA 1OIMA 4FLSA 4AYGA 2PI6A 4EANA 1JDCA 2VZTA 4TVDA 1EOKA 3WD0A 3GDBA 3T0AA 3HG4A 3VM5A 1QNPA 2E0PA 1B3YA 1V3LA 2WHKA 1WDPA 3S2CA 4CCDA 1TUXA 3PHAA 3AMLA 3DX0A 2GJPA 3ZT5A 4PMZA 5BWFA 4CN1A 1W32A 2PWFA 3BUDA 2W92A 3BUBA 3L4WA 3D5HA 3EYPA 4HA1A 3POCA 3UG4A 3BGAA 3N11A 3PN8A 1WDSA 3QOKA 3VDHA 1J9YA 3ARPA 1FH8A 1G0CA 4PTMA 2BVYA 2OW6A 2D20A 4W86A 1UD4A 2EACA 5AC5A 2J79A 1DWGM 4N42A 1UKPA 1VFMA 2F1BA 2VZUA 1BPLB 1VENA 3G6LA 4CD4A 2O9OA 3EDKA 1WPCA 5I24A 4AISA 2HISA 1TQWA 3BC9A 1JF5A 1CYGA 2WNWA 4JIEA 3AHZA 1G9HA 1XYZA 2YA1A 3EJUA 1PBGA 3FN9A 5IFPA 1TR1A 4AZ6A 2GJXB 3MO4A 3A6OA 3VUPA 1HP4A 5GNYA 4GIAA 1G94A 2JIEA 4OBRA 1XC6A 3EDEA 3EJQA 2X05A 5DEZA 1Q6DA 3VM7A 4KRTA 1K6AA 5D8ZA 1JI2A 1QNQA 1HF6A 3GTNA 3CUFA 5AYBA 1E3XA 2DSVA 1P6WA 2WZHA 2F1AA 4UQEA 3VD5A 1O6IA 4W7VA 1E4IA 5LA0A 4A3HA 3D52A 2XVNA 3O9NA 6A3HA 1CXIA 2J74A 2V5DA 2O92A 1GQIA 3M7SA 2DQXA 2J75A 1KXHA 2WMGA 3U5YA 1XH1A 4XB3A 1X6NA 1VIWA 4FF5A 2FGLA 1GONA 3EJPA 2C8NA 1MW2A 5CPSA 3AMKA 4MJ2A 1ITCA 2CITA 2EJ1A 3ZR6A 1JAEA 2WC3A 4UNIA 1F4AA 5JIWA 3BLPX 3CUHA 2UY2A 3WBEA 1W1TA 4P8UA 1IZJA 5A8OA 1UR9A 2IUZA 1E1EA 1I1XA 2VRKA 3MV01 3T08A 1BGGA 1QNSA 4RE2A 1V3KA 5C70A 4ZXOA 2QHAA 3LPOA 1JXJA 2YJQA 3KE0A 2XJ7A 2YDQA 2WMHA 1ZU8A 1ZBVA 4CD5A 2GK1A 5GNZA 1R7AA 3QHNA 4WK9A 1MW1A 4FK9A 1XCWA 3AYSA 3SURA 3WF2A 2CHNA 2WVVB 4PSPA 2CIPA 3WY4A 1BTCA 5IXEA 4AZBA 4GZJA 4U2YA 4AZIA 5CLWA 4W5UA 3AHXA 3AIRA 3L4UA 3KEHA 4MDPA 3K8LA 3TOPA 4AEEA 2DT1A 2QF8A 2WWDA 3WNOA 5CPTA 3OLEA 2F7PA 2UY4A 3DX1A 1TA3B 4P7NA 1LWHA 5KEZA 4QFUA 3WDPP 2EPOA 3MMWA 3EDFA 1LQ0A 1X6LA 1HNYA 3OLDA 5JBEA 3WD4A 5FKYA 1CPUA 2PWDA 9CGTA 2DGAA 1FOBA 1BVNP 2BHUA 4WJXA 2DH2A 3HZ3A 4AYSA 5I2UA 4PYSA 3UR8A 2XVPA 1TQTA 2WHJA 2X2YA 4H7VA 2PF0A 2DSKA 4OUEA 5C71A 1CLVA 3VIFA 3W27A 1V6UA 2YA0A 2ZX8A 4GO9A 1D3CA 1MW0A 3WF4A 1H41A 3PZOA 4Q22A 1E56A 1XCXA 1LLOA 4P7OA 3WQ6A 4OZOA 1ZBWA 3VD4A 1UKQA 3K8MA 3VDCA 3EMQA 1JZ4A 5BYWA 2EPKX 3E1F1 1M04A 3AFBA 1JDDA 1J11A 3HG2A 2BXZA 2BY2A 1CGVA 3VMPA 2JEQA 1R75A 4DO5A 2ESCA 5E6YA 3WDHA 4DO4A 1XHGA 1M03A 4AZ5A 1QOXA 3BUQA 3WFLA 3IJ9A 2ZIDA 1FH9A 1ISXA 3HG5A 3AZTA 1RP8A 2WMIB 4OOUA 1EIBA 1GVIA 4AMXA 4HOZA 1JL8A 4IPNB 4UTFA 2YBTA 3T2QA 4CKQA 5A6SA 5D9PA 1WNOA 2VUYA 2DPEA 4X9YA 1E55A 2WC7A 1GQLA 2YLAA 1GOQA 3SUWA 1ODZA 1GHSA 3NJ3A 2YDRA 1LL6A 1JYNA 1GJWA 1M53A 5CGMA 1M7XA 1WE5A 3W82A 1V03A 3L4TA 1E0WA 1IV8A 2O9TA 1BG4A 1DWHM 4MNJA 2CESA 3CBWA 1R85A 1GNXA 1W9UA 4V2XA 2VRJA 3D3AA 3WKZA 4GZIA 2CBIA 1UD5A 1UR8A 3RM9A 3OA5A 2XN2A 1B90A 3WQWA 3EJRA 4AZGA 1PZ2A 3ECQA 2X09A 1KXTA 1GUVA 2E9MA 2VNCA 2F7OA 4NXSA 2NT1A 3IANA 4PN2A 1J18A 2VTFA 3KLLA 3WD3A 2VL4A 3BAJA 2EBNA 2D3LA 1OGSA 1RPKA 2D24A 1PAMA 4RE4A 2E8YA 1I75A 3MS8A 1E6QM 3WMBA 4C7FA 3RJXA 2J78A 3VPLA 1W91A 5CG0A 4W7UA 2OSXA 4U3AA 4W88A 2Y5EA 1FHDA 2DIJA 1K9FA 2JALA 1EDTA 5ABHA 1UWSA 4UZSA 5IFTA 1EQPA 3WNKA 2WMFA 2ZUVA 1UA3A 2FGZA 2ZICA 3SCSA 5E70A 2YFNA 3DDGA 3WD1A 4DUVA 3FNDA 4J3SA 3A21A 2WKLA 1B0IA 1LL7A 3NSXA 3JUGA 1E4LA 5KZ6A 3BH4A 1DHKA 4MNMA 3MMUA 2WYSA 1UQYA 1H5VA 3DYMA 1TVPA 2VX5A 1BFNA 5A6BA 2WK2A 1QW9A 3W81A 1V3HA 4HZ6A 4PMYA 1ISVA 2G8ZA 5A69A 1W1VA 1WZAA 3OB8A 1VJZA 3GZAA 1B1YA 3UETA 4GINA 4MAVA 1PX4A 4DM2A 3AMDA 1QHZA 1NOFA 3VMOA 1UR1A 2WM0A 3WF0A 2WPGA 3ARXA 1V6YA 5D9NA 1CXLA 5CSYA 3MKKA 2W61A 3MSGA 3ZJ7A 4NRSA 3THDA 2C0HA 4CVWA 5FD0A 2ZUSA 5M17A 1LG1A 5EFFA 3VX0A 2YA2A 4BZYA 1V3JA 1BAGA 1QI4A 4LYRA 2J62A 3AMCA 3ZJ6A 1CXEA 1DWFM 3CIVA 3WN6A 3WQ8A 1H49A 1JI1A 4JFVA 4D1JA 5GPRA 2ZX9A 1UASA 3AS3A 1E6ZA 1US2A 1FP9A 3GNOA 4OBSA 1UA7A 1GQKA 4ML4A 3VGDA 2GSJA 3SCTA 1CLXA 5D9MA 2FH6A 3N04A 4AMWA 3F5LA 2CYGA 2J7BA 2GJRA 3I3BA 1UD8A 1XYFA 4UR9A 3VIMA 1CIUA 1H4PA 1PS3A 1UH4A 3T0BA 1JFXA 2XFRA 5E1QA 4B9ZA 5ABFB 3U7BA 1PIFA 4CU8A 1E6RA 1WDQA 3CZGA 2EXOA 3DECA 3D4YA 4W85A 2XN1A 4BS0A 4HZ8A 1W9BM 3WF1A 3A22A 3PZMA 1OIFA 3U5UA 2PWEA 3WEMA 2J7DA 1MVYA 3LRLA 3GNPA 4HA4A 2A3AA 3SUUA 1RD6A 3WSUA 5HPOA 1LF1A 2F2HA 3MANA 2PBOA 2HVMA 3U57A 2WVVA 3NUKA 4AD2A 3WDRA 1HX0A 3AS0A 1NP2A 1B9ZA 5IDIA 2G3JA 1B3ZA 2IGTA 2DT3A 3NDYA 4BQ4A 2XM1A 1CNVA 2W91A 5DO8A 1CEOA 4UFJA 2WVSA 3TP4A 2VX7A 1WZMA 5I79A 3WH9A 4PRWA 3KLKA 1GZJA 3N13A 1UWIA 3U7VA 2XSBA 1TA3A 1HIZA 5A2CA 1V3IA 3PZGA 1UWUA 2VOTA 3DHPA 3CZLA 3WNNA 3WQ5A 2E9BA 4PCTA 3LPGA 5A6AA 5FIPA 1O7DC 5LA1A 2BVDA 3VMNA 3AHYA 4D71A 1R46A 1HKIA 1BHGA 1E70M 1JIBA 1CTNA 2V3GA 3SUTA 3CUIA 4PMUA 3VIKA 3CUJA 2C7FA 1JG9A 3OGSA 1UQZA 1JD9A 5E0FA 2XFFA 4B16A 5BXTA 3L2LA 3VSUA 2WANA 1CXHA 2RGLA 4HZ7A 4DUWA 2IXVA 3M07A 3AYRA 4W8LA 3EMCA 1Q4NX 3PZVA 1JYVA 2FH8A 2OSYA 4D6JA 4JAWA 2J7CA 4CD7A 1QW8A 3HU7A 3OBAA 4UFMA 1SMAA 1CENA 3GXPA 3BVVA 2X0HA 4JZ5A 4FNTA 2CBVA 1L8NA 3M6DA 5A8QA 3AIEA 1KR1A 3RM4A 1JYWA 3CLWA 2QMKA 3RO8A 5EFDA 3WH5A 2EQDA 3I3EA 4OGZA 4R5EA 3N1AA 4WF7A 1V0KA 5DFAA 4CU7A 5HOSA 1UR0A 1V0MA 2WMIA 4C7DA 3GYCA 1OGBA 1MFUA 1UYQA 2F7QA 2D0HA 2EADA 5ABEA 2ZX7A 5IHRA 3CUGA 1DWJM 1VBRA 2DH3A 3K4DA 4ZFMA 4AD3A 1OT1A 3G6MA 1VEMA 3WD2A 1PJ9A 3BVXA 3A24A 1E6PA 1CDGA 3TONA 3UCQA 2E40A 3KZSA 4M80A 4M82A 3RPMA 3ZJKA 5JBDA 4R27A 1HVQA 6CGTA 2FDMA 1O7AA 2F61A 1MWOA 3TTQA 4M24A 4NXKA 4F9JA 1W2PA 1GJUA 5DMYA 4PTWA 1UWTA 4NZCA 5D9OA 3CHFA 3H55A 1MQQA 1JZ5A 3ZQ9A 3UR7A 4U5IA 1PEZA 2OYMA 1QPKA 2WB5A 4HMCA 4JFUA 3L4VA 4AIEA 4MDOA 3CZEA 4D6CA 4AXNA 2EO7A 1UKSA 4PCSA 2VZOA 2UY3A 4AZ7A 1FA2A 2AAAA 3GXTA 3VGBA 3K46A 1SFSA 4GI9A 2PWHA 2G41A 3ZIZA 1Y7VA 4W84A 4S3JA 5HPCA 2QLYA 2WZIA 1EA9C 5BRQA 1PX3A 4ATLA 1X1NA 1QNRA 3SCPA 2GUYA 1KCLA 2ZXDA 1ZS2A 3FAXA 1HXKA 3B9EA 4ZXLA 4W5ZA 4QLLA 1J0YA 3ZR5A 4PMXA 2Z1KA 4NX0A 1W1YA 3EDJA 5CZKA 3AXXA 4M8UA 3WEOA 3MV11 3N17A 4JCMA 2G3NA 4CU6A 1E5NA 2AMGA 3S6TA 1U2YA 2BS9A 4AZCA 1K9TA 2E3ZA 5EMYA 5I23A 1J0HA 2DDXA 1NOUA 4NRRA 2J7HA 3PZQA 4M1RA 3L4ZA 3FY1A 1QI5A 1D2KA 1E4MM 2CHOA 1TMQA 1UHVA 1AVAA 1E72M 2CETA 4HOWA 4F79A 1HP5A 2XUCA 2ZUNA 2AOSA 4N0RA 5CPQA 4YN5A 2X2JA 1DEDA 3RDKA 1B3VA 5A6MA 1B3WA 3UESA 3WELA 1E73M 2FHBA 3MMDA 4FNPA 3WH7A 4B3LA 3W53A 2VZSA 2WHLA 4W7WA 4CGTA 1A47A 2EEXA 1KTCA 3VGHA 4E8DA 3VU2A 2WCGA 4S3KA 5FOOA 3A4XA 3BVUA 4HP5A 3WQVA 3VILA 1UKTA 2XVKA 3CMJA 3VDBA 4FMVA 3GXMA 2BFGA 4PEEA 2F7RA 3AXHA 1L0PA 3AMGA 2WXDM 4MTVA 3K8KA 2XM2A 4ACZA 1UWQA 3BCDA 1PZ3A 7CGTA 4XV0A 3M46A 1E6SM 1C91A 1GPFA 4WSKA 4D72A 4Z2JA 4UFLA 1EH9A 4FLOA 1ISWA 4PTVA 3VOCA 1V08A 2CERA 3GNRA 2CCRA 2G3IA 3BXWA 4XZWA 4MPKA 3L4YA 1ZBCA 1NWTA 4MB3A 3GH5A 4KMQA 3EMZA 2FHCA 2EPNA 2WMKA 3J7HA 2XYLA 4RL3A 1KGWA 3UG5A 3DC0A 3F5JA 1GOOA 5ABFA 2QPSA 2VR5A 1HKJA 1CGWA 2RGMA 7TAAA 3VKKA 4PMVA 1MYRA 1VBUA 3CZ8A 2WBKA 1XSJA 1BYDA 2CNCA 4GI8A 2OW7A 3TTYA 4DWSC 3N12A 1UKOA 2OSWA 3LPPA 3SIMA 4AD1A 2ZOXA 2Y4SA 1G1YA 2FYVA 1XH2A 3WBAA 3CGTA 2WWCA 4OJYA 1QI2A 1E71M 3I3DA 3UG3A 2VURA 3NIYA 4U31A 1HT6A 3WH8A 2XGIA 4ZENA 2VI0A 1KR0A 4UQCA 3K4AA 1ITXA 1BQCA 3T2PA 5A8MA 2V3EA 2VRQA 4FNSA 3AS1A 2XHYA 4QP0A 5FCZA 4X0VA 3VX1A 1H2JA 3RM8A 3KL3A 1XD1A 1BYAA 4OKDA 3LRMA 1GOWA 2W66A 2Y8KA 4AEFA 4J3TA 4D6DA 4JKMA 1CGUA 1EHNA 3DYOA 4QAWA 2WLZA 4U2ZA 1Q6CA 3RMEA 1OT2A 1OD8A 4NF7A 5EBAA 1GVYA 1V6VA 1JFHA 2CKSA 3AQUA 2G3MA 4E4PA 5HXMA 3A23A 3LRKA 1XSIA 2D2OA 3W38A 3NCOA 2WVTA 1W1PA 2GFTA 4EK7A 1XH0A 4IPLA 1UH2A 2YBUA 1C93A 2V38A 3WEZA 5A6KA 4H8UA 1CZ1A 4HPHA 5I5RA 1PIGA 4JHOA 3AIUA 3DYPA 4UOJA 3W29A 1E5JA 3CHDA 3PZ9A 1E3ZA 1ZBKA 2BY3A 1M01A 4HU0A 4AZCB 4AD5A 1WKYA 1Q6GA 2D0FA 1OGGA 1WDRA 2WKGA 5DF0A 5A2AA 4TUFA 5AYIA 1HKMA 3W24A 3AIWA 1LWJA 2DT2A 4X0NA 3CTTA 2EPLX 1KB3A 5C8BB 1WCGA 1TG7A 3SCOA 2YL8A 2X0YA 2A3EA 1CBGA 4J3UA 3ZJ8A 1TZ7A 1HVXA 4KGLA 3L2MA 3AZSA 5E6ZA 3ARUA 2VX4A 1KQYA 4KH2A 4U33A 2XWDA 1R8LA 1B3XA 1PPIA 3B8SA 4BQ5A 1DWAM 3VINA 4D6IA 4Z2HA 2WZEA 1K9DA 3CZSA 1UR2A 3QGVA 2OLHA 4MB1A 1XRVA 4CN6A 3WH6A 3MUAA 4QDMA 2ZXAA 2UWFA 2XWEA 3WMSA 2V3FA 3EDDA 3LXBA 2E9LA 1WAWA 1XGZA 4P7RA 3ALFA 1V02E 3VO0A 2ZUMA 2JF6A 4ACZB 4WLCA 4H04A 3L4XA 1HJSA 1E0XA 3MUY1 2ZX6A 5CLTA 4TTUA 2FHFA 3VNZA 1V02A 1B2YA 1C90A 3WY3A 1J0IA 3DX4A 2ZXBA 4TVUA 3IGUA 1JNEA 1SYTA 1WB0A 3NDZA 1N82A 2BVTA 1NWUA 2E8ZA 2W4XA 3IK2A 4GXPA 3APGA 2O9PA 3NSNA 2ZUTA 1J10A 5BXPA 3ZMRA 3BVWA 1W3LA 2CEQA 2EAEA 4CN4A 1GORA 3VIIA 3AROA 3LXAA
chains in the Genus database with same CATH superfamily
2Z31D 1UZDA 4JR9L 4ZS7H 2HJKB 4UV7L 4GB9A 3ULUF 5AVHA 2EEBA 1TSHA 1TVNA 4LRTA 3MVSA 1ACZA 4HK3J 3KLHD 1OY3B 4PBFA 4RMBA 3GXNA 1TE1A 3PIQA 5JMRA 4R97C 3G6JA 2J1XA 1FFRA 2XACC 2VDQH 1BRLA 2NV2A 4ZDHA 1EV2E 1JZ3A 3WN5A 2ORBL 4QHMA 4GBDA 4ZMTA 4YX2H 4AZ8A 1C5DB 1YY9D 1FNAA 3TAKA 5F7UA 3VFRA 4I1RA 4BZ2H 1CDUA 4OV6F 3P0VH 4HYVA 2WWKT 1YDOA 4UNTA 5B7MA 2XC8A 1SW0A 3S36L 3HC2A 1NWSA 4JFWA 3QI9D 4NQED 4H2CA 3LSOA 2YDSA 1LL4A 1GGIL 3S37L 2RDTA 5CZXD 5GRZA 1XF0A 4H00A 4Z1YA 3HI5L 1BXAA 3QR0A 4IGNA 1UC5A 2QVIA 2PXYA 1L6FA 2A74C 1EANA 1XGRA 2EHHA 1K8DB 1EFQA 1LP9F 4HQQH 3JS3A 3EXLA 3EH1A 4NQCA 5DMNA 5J6GB 3P60A 1ZT1B 4L3EB 5CEZE 1LJYA 4F5CE 3L08A 4JKWA 3NIDF 1NCHA 4XO8A 1OF2B 2LE9A 4A4AA 4EI6B 2E7FA 5DXWA 1SJHB 4KW2A 4LPCA 3CZJA 2CFFA 3GXIA 3ZE1B 2YPLB 4LPYA 4YBQC 2K8MA 4LPUA 1X5ZA 4G11A 4CVXA 4IM4A 1HOCB 4R3SA 1H6UA 1M2VB 3KP1A 4YHEA 2YEQA 2OX4A 1GHFH 5I1LA 1NJJA 4U6XB 3QCVL 4PGDB 2D73A 3F65A 3MA8A 2YCJA 2NDFA 4NP4H 3GSVA 4Q4EA 1J05B 5DMGC 4MJ6B 1O1HA 3DRQA 4Y7EA 5ABDE 1ZV9A 3U6WA 5KUMA 1HC1A 3PWLB 4M3KB 3LVEA 1S5IH 5EEVA 2ZUWA 3S36X 2CLOA 5FFGA 5FGCB 3V9CA 3QZWA 1FVEA 1Q8AA 2D4DA 1BWWA 2W9LA 4JMXA 3NQ2A 4IQJA 3NABH 3S37X 2QPUA 2ZTBA 3BURA 2AK4A 4DKAA 1FWFC 2NY5C 2Y25A 4Y5VC 3E2HC 3LY6A 3SE3A 2DQEH 4L65A 1IGMH 2VQUA 3TT1H 3WSQL 5KVFL 1JPMA 4GY0A 3KYKH 2OZ4L 3S1XA 1H8NA 4HHAA 1ZVSB 3UPRB 3IDYB 4UOW0 2H4EA 5G1MA 4IBLT 4Q6KA 2QDEA 2IVFC 5C6PB 1W0YT 1WICA 1MCWW 4I8YA 5FF6A 1PEWA 3DTUB 3T3ME 5EBGA 1MI5B 5DZJA 5DJDB 1BAFH 4S11A 1A7NH 1IIKA 2IWGA 5FV1L 1BMGA 1JF1B 5CN1A 1QWUA 1R34A 5I26A 4DKEL 4IMAA 2HB0A 4X8CA 5BCAA 3A4DA 3JU2A 3L54A 5C9JA 4PJGF 4PSRA 4JFQB 4Q8UA 1JJKA 4M3PA 3IFOB 5EBWA 1GZGA 3D0VB 3H53A 4P4RA 1PHWA 1EO5A 1HYSC 1E27A 1WWCA 2OTPA 3RF9A 1W3HA 1ISZA 3T3PB 1Q8JA 4LLWA 1FL6A 1UZHA 2PDGA 5EO1A 5XINA 4WR3A 3S6DA 3BO8B 3EKGA 3CFUA 2G2RA 3TN0B 1BSIA 3D12B 5AOZA 4O02L 1A5NC 3N9SA 4ZSOB 4XMWA 5GHWH 1VEOA 3HFFA 3WD5H 4WEMB 3PAVA 5BV7H 1Q1PA 4AX3A 1TZ9A 4DY1A 2LAAA 4O53A 4YHYB 3P3YA 1P7BA 5I1KH 1UB5A 4OSUL 2PURA 3IETA 4JNYA 3SQLA 1EDGA 2R2CA 3JZUA 2VR9A 2IAMC 3S4TA 3EJTA 3XINA 3E38A 4MNLA 4P5KA 1A4BA 2DLFH 5EV7A 2W38A 3UR2A 5E2JA 3GFZA 2KQMA 3K5XA 2GBAA 2J6EA 4RFOL 1GR7A 4HUNB 2V5BA 1S7WB 1P0BA 3LNMA 1UCBL 1MZHA 2DEXX 2NUPA 4HWZB 4UCFA 3UBXA 1TREA 2OI9B 3F7JA 1O7VA 1YEKL 2VJ0A 1U3YA 2CKNA 3WIIL 2XTJC 5E8OB 3X1EA 3WIJA 3W11D 4QCFA 1FAKT 1F02I 2DYPA 1OE1A 3U2CA 4NN5C 5C0GB 1OCNA 1HWGB 2GSIA 3PPFA 4WI2A 1F8TH 2AQ1A 2VERA 4P2RA 4U0RB 5JBFA 3N18A 2OWCA 3ZDZF 1QDSA 4YE4H 3KPQA 3P4OA 2G4FA 3MC0A 1T4WA 2M8XA 1XH3A 3WUWA 3E2QA 4WHTB 2DTSA 4NJGA 5L2JA 4OI9A 2D9CA 3QV8A 4WHYG 4IYKA 2DW6A 3D39A 5CCHE 2YBRA 4JFSA 1N0LB 3S35X 1A5SA 3P14A 4OZIF 3CMGA 2QEZA 5DMLA 3BFWA 5B4MD 4AKQA 5GS3A 3BI9X 3U36B 2O9RA 4F8OA 2A6KA 2Z92A 3RTQA 1Q9KB 4XP1L 5HYJB 3NL3A 2N59A 3OGOE 3HBGA 1EXUB 4AQEA 3TE9A 3G08A 4QKXB 2R4RH 2A9DA 5D9SB 4M7LL 1BM3H 1EAJA 4ODVL 1TZIA 1RK1B 2HKHL 2NY1B 3WFEH 4AGOA 3W00A 3WKQA 4AJWA 2MMXA 4LKCA 4ZSUA 2C3ZA 4JUTA 1JWUB 4I4WB 2F0CA 4D8OA 4JHWH 1X7TA 5DJXA 3FCSB 3P4NB 3OLIA 4ODHH 5D5ME 3MRGB 2XINA 3HG3A 4WO4A 4K7PL 3AXIA 1FYTE 3BWUC 3QISA 5AVXB 3BP4B 1RIUL 3EH4B 1V5JA 2VGGA 3ENEA 4XNQA 2N0MA 4UDTA 1QUMA 4RDQF 2WHKA 4LESA 3S2CA 2QADC 3L3KB 4PW4A 2HMCA 2X42A 5EORL 3OZYA 4P23B 3S5OA 4KH9A 4ONHB 3ZMNA 4JY6B 3TWYA 3D9AH 5CAYB 3UTPE 3I9GH 1UD4A 4LPTA 1G7UA 3GMMB 4HGWB 1UKPA 4OI7A 43CAB 2CBMA 4J9JA 3QFJE 3GFXA 2HKFH 1EX1A 4JIEA 4G6ML 2ACUA 1TR1A 3GMQA 3IIVA 3PXLA 1J7VR 1CDJA 4Z7IA 1OF6A 3CN1A 5D38A 1R5IB 1D5IH 4JZNB 4DOHE 1EEUA 4KRTA 2AJVL 4NQEE 1HXYB 2VJ8A 3PWIA 2ZNWA 4HZ1A 3LAFA 3JWDL 1YPZE 3K0WA 1P6WA 5CLZA 1RIVL 1G4TA 4PCFA 4GSDL 2CNZA 1E4IA 3DDMA 3MYJA 4UM9A 4ZPTA 4YHLL 2XVNA 1KRCC 4LF3A 1A6ZA 2O92A 2XA8L 3TIMA 2WXNA 4RE0A 4XAGA 5MENA 1A3LH 2NNFA 3EOBB 3L7RA 2DQHH 3VFTB 4C6LA 5DEFB 3RLHA 4K7PX 1UR9A 4L1LA 1OK4A 4BBWA 1H3WM 1Q9WA 3BLFA 4LEOA 2VC6A 2DMBA 3QB7C 4MJHA 2DQJH 3KE0A 4W9CC 1ZU8A 4YWIA 5IVZA 4FHAA 4ODTH 4LBEA 5FDYA 5C0JA 2OLAA 3AIRA 3C0LA 1E4WL 3CAFA 2BGNE 3K6DA 2FLMA 2C91A 1MH5B 3MODH 1CE1L 2DUZA 5KEZA 4KY1H 2JTDA 5GZND 2YD1A 5AHLA 5CIPA 3M0VA 1BF6A 1CPUA 4FG0A 2BHUA 4GK8A 4Z6AT 3HURA 3B56A 1FVPA 2OXHA 1KTLA 2C9UA 2V7HB 1L8PA 5EU4B 4UZGA 4JB9H 1BEUA 3MMTA 1CL7I 3VRIA 2DZTA 1JDDA 3ID7A 2QZRA 1XQ4A 1R75A 4HAKA 2LVCA 4IMCA 3WFLA 4IRSA 2KL6A 3DOSA 2J6EH 3VXOB 3MLVL 4GQZA 4AMXA 4K0OA 3G8RA 1DLHA 4CKQA 1MRAA 3MRFB 4R2GD 1GQLA 1IGTB 3RX8A 1ONQA 1HYRC 4GFIA 2C15A 3HPSA 1JYNA 4LU5L 4NZTH 4YTUA 4N8CH 1O7SA 1V03A 5HK4A 3VKDA 2LFGA 4IDLA 1IV8A 2JKIS 1Z0MA 3LS9A 1U91A 3ZMEA 4CMHC 5EU3A 3WKZA 3PHOA 1M1XA 3OA5A 3HJ0A 2JF1A 5FB8A 6FABH 2XWJA 2E9MA 4ERIA 1F0LA 3EJJX 3OQ3B 3W9DB 4JDTH 4G7VH 1IC5H 3INUL 1SHXA 1Q6LA 1OTUD 3TC6A 3L3OA 2XKNA 5JPNB 3F2CA 4RE4A 4AEIL 2NQJA 1ROWA 3L65A 3R7QA 1MRCL 4NN7B 1VLXA 4U3AA 2J8TA 4PMFA 1U58A 1N6QH 1UWSA 5JIDA 5BZWB 1PKQB 4OECA 3HIJA 2R1XA 5EB9A 5I06A 1LL7A 4Z23A 2V0AA 4OQTA 1NDMA 2YD8A 3ZDYF 5KZ6A 3N9RA 3MU3A 4JS3A 5FECA 3H4WA 2BDNH 3TCTA 3MMUA 4REQA 3T6WA 4GBXC 1FWCC 1R38A 1RQEA 2MOVA 1VACA 5E9DA 1ADDA 3KLAB 2BDQA 1F3DH 1OE3A 3OHXA 2NR6A 4GY1A 3SDCB 4J6RH 5BOOA 3GY1A 3MNMA 1QHZA 1UR1A 3RLUA 4DGIL 2VITA 3KYOA 2CLLA 3ARXA 1V6YA 5FO2A 4JDEA 4L0PB 4DP1X 4CVWA 2X3BA 3QIWD 2VLKA 3ZHKA 2NUTB 4G71B 5M2FX 3V6FB 4KXDA 2PDWA 2C3VA 1S2WA 4G7EB 2Z7GA 1CYWA 3UZXA 1UXSB 4D1JA 1IAOB 4HDIA 1PAZA 4NUQA 1QLRB 2IQAA 1K85A 5KBKA 1XO8A 3HKZA 4U1IB 2CDFA 2AXFA 3KPRE 1BJ1J 3APDA 4XPHH 4FCAA 4ZUTB 1GYVA 4AMWA 3GI9L 1K7FA 1H4PA 3STEA 4K94C 4TR9A 5FYKL 1CLZH 4GAJL 5DZLA 2KDGA 3SJ3A 4NM8L 4UTTA 4IQEA 2QGBA 3IVKA 4XHQA 4ZMZA 3B43A 3WSUA 4W4NA 5HPOA 2CK0L 3ZTCC 5A6IA 4HGXA 2F6KA 4WV1A 4MWAA 3E0IA 1K3IA 4UFJA 4FDWA 5F2FA 1WZMA 5ETUB 3WH9A 4R90H 4BEUA 2JJWA 3U0WH 2O6PA 4OGXL 3KD4A 3VC5A 1JGEA 2IQ9H 4YS4A 3LS5H 1KB5B 3CYJA 4V2CB 2OCZA 3QEQB 1J1OL 1J87A 3D30A 4XCYA 3GB6A 1QO3A 5HD8D 2J4WL 5FKPB 3VSUA 5JOFB 3N85H 5KVEE 4F7KA 3PJSA 1ACXA 3IV3A 2IXVA 4N0CD 3N41F 2AK1H 1DYSA 2J7CA 1C9WA 2BG5A 2JI2A 4K5OA 5FUOL 3QRHA 1KR1A 5EU7C 1IU1A 5HGDA 4R5EA 3EOUA 3SW6A 2PF8A 2EADA 3F01A 3UWWA 4L8SC 4TIMA 4A22A 4FS0A 1ADQL 4MCYA 1KFGA 3UZJA 1H6FA 1A25A 4HLZG 1MWOA 2B77A 2D3JA 5ILTL 3AAZA 4JG0L 4M24A 2YD6A 4GIEA 2BCKA 3OAYH 5ESQB 2DLTA 4TPRL 4C6BA 3S96B 4KWVA 1IQDA 3LQAH 4WRLA 5CIPH 5JW3L 1KN4L 3LIZH 3HE7A 2ZSWB 4G1MA 3JWNC 2FIRT 3H6OA 3STPA 4AZ7A 3K46A 4WFFD 3I68A 1DQDH 2BP8B 2Y07H 2H47C 1TPXC 4FXGA 5DFVC 4ANXA 2H1LM 2HMIC 4HKPA 4JPKL 4ZXLA 4J39A 4D8AA 4PMXA 1T1YB 2OL3L 2G3NA 3DROB 4YXLL 5ES4B 3G5VB 4R7VA 2PPCA 5I18H 3GRIA 1JR1A 4KDWA 3NZUA 1AZRA 3TBYB 2NUYA 1EC9A 4LFHG 4N0RA 2LV4A 2X2JA 1YEHH 3UESA 1X7SA 4W6WB 2ZKHH 1TJMA 1YNTA 4PY8J 4TQIA 4Z3IA 4HP5A 1V77A 2XWTB 3LZFL 2BP0A 1QYGL 3L9EA 3GYRA 2FZ3A 3CV1A 3F64A 1AGFA 5DEJA 1HHJB 3QP3A 2INEA 4H6RA 4DQOH 1TDQA 3W2DL 5DI8A 1XIMA 1V08A 4XZWA 3PJXA 4DESA 4NIKB 3L4YA 4N9OB 3UO1H 3MROB 4N9GA 3SPVB 5K9CA 4ZOEA 1O5QA 4B53A 1UW9A 3B0XA 3ALPA 4LMQI 4GD0A 4MAYC 3H9HA 3LOWA 1O6TA 4L3ED 3HA0A 3NCWA 2X1SA 3T6QC 4R9OA 1C16A 3BWWA 4WWPA 5TPWL 4YZFE 4IMFA 3IDMA 3HHSB 2V9TA 4IRJD 2LLLA 1XLHA 1E71M 3UG3A 2AJZA 2YPLD 3T4YB 2VABB 2XPYA 4OT7A 4XAYA 4EOUA 2F5BL 3GAKA 3LHYA 3JV4A 2YBVA 1OW0C 2ICEC 5C2BH 3OAUL 1KCRH 4JANA 5C0EA 2KPWA 2V2XB 1AS8A 1QSEB 1OG0A 2NQLA 4ENED 1SPDA 3ZVVA 2GFBA 1CZ1A 5AW9B 5DVMA 2FIKB 5HHPB 4UOJA 1ZQ5A 4A37A 3VXRE 1E5JA 3CHDA 4JYEA 2FQFA 3SYQA 1WFJA 4KX7A 1QZ1A 5IQ7L 4G7SB 5EZJA 2WQUA 1LOQA 1DCEA 1CG9B 4PRIA 1OALA 4ELMA 1HSAA 4IBQA 2CM6A 1UC6A 1R0MA 4NZUL 1MNUL 5FW7A 4Z8FL 2DB8A 1IGCL 4HWNA 2DQIL 2Y22A 4BGLA 5C2UB 4FPSA 1TZ8A 5LN4A 1YEJL 2UWFA 4GRSA 4IX2A 3BANA 3NPZB 3HNVH 5FYLE 5DN1A 4WO0A 4FX6M 2DI8A 2WZPD 1MI5D 5G2HA 3IPBA 4JW3A 3QS2A 1J9TA 2IBZY 3IGUA 5D7JD 1ZT4B 5IROD 4P5SA 4PRHA 4XVDA 5SX5H 4ODBD 5G2NA 1W3LA 3VI3F 3GUTA 5HGAB 4GS7B 4HWEH 4B96A 1REQA 1RZJH 2ADGB 2Z1BA 3L2IA 1XTMA 2ZSVA 1OBAA 5FL1A 2DI9A 3OTTA 4ZUSA 5KSBA 2CQVA 4HJWA 3CFTA 2X6MA 3HI1B 4FKKA 1ZVYA 3MNWA 5FV2A 4DGVH 4Q4PA 4JQAA 2Q6WA 3ULVF 5JHLL 1T5XB 4XNXL 2CUAA 1AQHA 1PSKL 4WUUB 1HQRB 1N6VA 1SY6A 3ME0A 3SGEH 1KGCD 4OUUA 3SUVA 4PMRA 3MRJB 2QUMA 3URBA 3T0DA 1W80A 3BZEA 2I1OA 2NSQA 1FNGA 4PMNA 1IEAB 3B2VH 1Z6JT 5J8OA 4AGLA 1R3LA 2WAGA 1NP0A 1I2NA 1EJOH 3BZFA 4Q7NA 4IXHA 5AW6B 1OTSC 3UYOD 3X11B 4KKQA 4LVAA 4ZQCA 3DBSA 2GUUA 2HFFA 3B40A 2DV6A 3OEXA 1J6OA 2BNUA 4GVGA 3H7RA 4P46C 1UWEL 1GS8A 4K9EC 3VFWB 3C08L 5ADPL 4Q8MA 4W9LC 3AITA 1WS8A 3MQIA 2KLSA 2X3CA 1SXAA 1OG6A 5D2XA 4DPBX 4X3ZA 2IC2A 3BEVB 3FT9A 1A1OA 1TU2A 2FE0A 4OKVB 4JVWA 4KWUA 3D33A 1EDQA 2X6VA 4LBUA 3EFFA 3O63A 4JQVC 3MLUL 2R15A 2PTVA 4UQ2A 2GI7A 5L8LB 2OXNA 4I85A 3SKMA 4X5XB 4KKAD 3M17A 4AC4A 4CNPA 5D2NC 3TCLA 1HE7A 4OZGE 1CZ8L 3PBUA 2Z1PA 2IDSA 3BAWA 4E0RA 4NAJA 1T04B 4G8AC 3PG2A 3QZMA 1JRHL 4XB8A 3BVNB 1BZ7A 1ND0A 3QLLA 1J8RA 4XNDA 3L21A 1WA3A 3F04A 1PSCA 3L9CA 5LGHL 1PZDA 4PRNB 3JVFC 4JM2F 2FEDD 2ATKA 4ONOA 4I3GA 1SMDA 2P24A 1A14L 1YEEL 4MXQD 1CGSL 5FJRA 4JO3L 3PJUA 5HYJD 3DJRA 2FO8A 4WKFA 1D6EA 3QZLA 3SDDC 3CPUA 3W1TA 3LEYL 3S5ZA 4J3OG 3ZZLA 3TT3H 2WBGA 1BJ8A 2EC9U 4RR4A 3MX0A 2F8QA 5KYYA 1GC1C 4UINL 3QV9A 2GVLA 3NYDA 4G6KH 1DP0A 2NY1D 3V5HA 5I71C 1UR4A 4M03A 3FQUB 3EXTA 5F7KC 1RUQL 2AJSH 3VNJA 1AAJA 1I3RB 3O3DA 3P7YA 4X6BB 1P4IL 4ADJA 1R19A 4TUOA 1XR8A 4O02B 2DUXA 2XN0A 3QR3A 2FSDA 3RCYA 4B2DA 1OWWA 3QNZB 1W8GA 1JPKA 1T22B 3OV6A 2FGBA 2PYEE 1J8HD 1V7AA 4NWTL 3KM2A 2H8PA 1YNQA 2OWXA 1TV8A 1H50A 1M6UA 5ACZB 5C5YA 5CJQH 5H8MA 1KM1A 3QHZL 4KI1A 5T1MB 3ZXAC 1RH9A 3FO9A 3QDMB 5FDWB 4W8BA 4PJDB 1ADSA 1DVXA 3WJYA 2GT9B 4Z7AA 4JTQA 2WBJB 2F54A 3L7FA 1URLA 2DBLH 3L5WA 3U0TA 5IVXF 2FZBA 2HT4D 3IU3A 3US0A 4IMEA 5AOMA 4MQXD 4O1BA 1NGZA 1PG7L 1CVSC 1WT5A 3VNMA 3QJFA 5I1HH 2QDHA 3MA9L 2VJXA 2R1KA 3HNSH 3ZVHA 4IMDA 2MCMA 1MZYA 4YFEA 2O56A 1EGJA 3RWDB 2IWKA 4Y4KC 3FN0H 5T3ZL 1OFQA 2W88A 3MUIA 3A3HA 1ZANL 2PDJA 4NCC1 2W79A 1JDFA 4KETA 4DWHA 1NGQL 4G5AA 5IR1A 3VIOA 2DQDH 1AG0A 4HPGA 2KZHA 2OOGA 1QEWA 2VX6A 3WQGA 5T1DL 1AXSA 1XZ0B 1Q1JH 3WMLA 3FSVA 1G9EA 3N9KA 1TCRB 3WLWC 1RUAL 5F7NC 5FGSA 4L3EE 1XIWB 1MW3A 3QUML 2AI0H 3NVDA 1E9PA 5H8PA 1WHPA 1X5LA 1GA2A 3M88A 3ZL1A 1S7TB 2VDPH 3WOVA 1SFHA 3Q9QA 4TV6A 3W4RA 3EHBD 4R4FL 4MAZA 1F3JA 3ZE1E 3U7WL 4G5DA 1F6KA 3F12B 5EN3A 3LTPA 2IOMA 1Q0YL 1RUMH 3IJ7A 4O2FA 4YIQA 4M48H 3TV8A 4Z1PA 2UV8G 2X8RA 2CDEB 1FNSH 3RAOA 3OKNB 1CU4L 4OAWA 1SY6H 4MFDA 4M1GH 3S5SA 5AVQB 1SYVB 2BVPB 4ZFOA 2VMDA 1LUCB 4X6CE 2CUIA 4JFZH 2XWZA 3V4VB 5I17A 1PG7X 4A2EA 1Z3RA 1JYXA 3FS9A 4B15A 5FGCE 4RLIA 5DS8B 2D3NA 4C6MA 3CC5A 3SN1A 4OD3L 3KBFA 4APQB 4HOXA 1E65A 1K5WA 3ESUF 3TJLA 5TQ0L 3S9ZA 3VA6A 3HUJE 4DN4L 4W9IC 3EFOB 1A3RL 3BZJA 3HNTH 5JXEC 3VD2A 4GMSH 5IMLA 2DMHA 4J3ZA 3SPGA 2WHMA 5I74C 4OGAC 1WBJA 3QOMA 4XNUH 3T2OA 4DSYA 5L9DL 1IKNA 5MEQB 5HNRA 3WYZA 2NDGA 3S8GB 1MI5E 1EXPA 3CSGA 1OWQA 3ZSTA 3NQFA 1D9KC 3SCVA 5BO1L 1N10A 2EKSA 3UVIA 2H1XA 3REWA 1OIMA 2JMRA 3DRTA 4R96B 2OSLB 5AYTA 2AV7B 1QSZA 3T0AA 3HG4A 2E0PA 4UWMA 3STZB 4XRCA 1IM3A 1B0GA 2ZYHA 2WOBA 4KQ4H 1XMEB 4S2SA 4UILH 3RGTA 4PUUA 2AKMA 3S8HA 1J9YA 1GZQB 4DYKA 1CTOA 2COVD 4QO1B 5I1CH 5GZOC 1N5YL 3HFMH 1FGVL 3RZCA 5L2KB 5I24A 4FP1A 1XQKA 1GKOA 4UIMB 4ZMOA 3GTHA 4LUIA 1I8LC 2KPNA 2FFCA 1NGPH 1ECYA 3IDXH 3SQBA 1J2WA 1G6RL 4AITA 1KGCE 2ITDA 1JQVA 1Q6DA 4LIQE 3UYPB 3N9GH 1L7TL 4V1YA 4GVIA 3VOIA 5KYUB 4IHOB 3ECBB 4GE8A 3T1FA 5MEOA 3AXMA 4E2BA 1A7RH 4CCZA 4BYHA 4H9VA 4W7VA 2E7DA 3IRZA 5F7EH 3NPSB 3AB0B 2G3ZA 5DTFA 5GS0D 1TZZA 4FEZA 3C5JA 1BQLL 2YGPA 3M7SA 2P42B 1P5UA 3ARFC 1VIWA 2AGTA 3K6OA 4PWFA 2JJTC 1A6PA 4OCSH 2B7NA 1JHLL 4NKDB 1W1TA 4FJZA 1IZJA 3UO8B 4XHJD 4FRWA 1AUSL 2XZAH 1DVFA 1I2RA 3B3IA 3KRBA 4GUPA 5C54A 3CEUA 4A7UA 3MGOA 5C70A 2N01B 2HCVA 3MCLL 1JXJA 5B80A 4KFPA 4IKJA 5I15H 2I14A 1R7AA 3TYDA 2K7PA 5IQ9B 4GJIA 2CIPA 2ED9A 3PL6C 1E2ZA 5J06A 4JRXB 2PCFB 1IAIL 2C13A 2CRYA 4DGUA 4I7UA 2WYHA 1J8KA 3STLA 4QFUA 1K8CA 1X6LA 5IKCA 1FOBA 2WHJA 3WXVL 4CJ1A 3W7DA 1NMCC 4AVJA 3NJVA 2X9ZA 3WQ6A 3C2YA 3GZPA 3LSBA 1ZSHA 4LEXH 3MVTA 1FWEC 4IDJH 4O1FA 1H5BB 1M04A 3NL6A 1L4IA 2JEQA 4YC2B 5HYJE 1NAML 5KSUA 1RU9H 2NY6B 4NJ9L 4DO4A 3TCEA 3U79A 1T5WA 3DG6A 4WNJA 3II2A 2VL5A 5JORA 4LYKA 2I5IA 3DIFB 2ARJB 3B9KA 3GKWH 1A5FL 2Y5QA 3V5KA 5LBSL 1X8FA 4X9YA 3IDGB 3UGEA 2ZOUA 5DHXB 2DZVA 3ZKNC 5B3JF 1XGUA 2IOOA 4MD4A 2J5LB 1M7XA 3JV6B 4PW9A 4AK2A 1MRQA 4FNLL 5IEHB 1ESOA 3GS6A 1KCBA 2X16A 4FG2A 3QFDB 4S3BA 1A5UA 4ZX5A 1AHKA 2VNCA 4IZGA 2GIMA 1CF8L 2VTFA 4RX4D 4ZX6A 1Z5LB 3MRMA 1XR2A 2Q8LA 4DP7X 1RPKA 2J8UF 1J8HE 4TMBA 4JFYA 3L5IA 2P7TB 5CFHA 4W7UA 4L48A 1G84A 1RZKH 2BS8A 3OP2A 4KZDH 2FATH 1NCAH 2PW1B 1R3JB 3D18B 2FBJH 2QGEA 2WKLA 3IFNH 1YPXA 4RW3A 3V0TA 1WAPA 3G8EA 1LEKB 2NTFB 3S5LG 3BPOB 4G9DA 4X4ME 2EEAA 5EUOA 3LS4L 1W8SA 1F6AB 4FG4A 2WK2A 1P84J 2QJIA 4LUYA 4Q4RA 1I1FB 2WWOA 1DVYA 4MAVA 1FNHA 3BP7A 2VFIA 5BOFA 4YL9A 2QAFA 3F7QA 2EZ0C 2A5HA 3GEWB 2BOBB 2C0HA 1FBIH 1UBPC 1K8XA 3CU2A 1LG1A 5C09B 1GGOA 2YA2A 2C6QA 3UMNA 4QWWC 3IWVA 4LYRA 1U92A 4AIZA 5CSRA 2ZXWB 5ERWB 3RIFK 2GSHA 4KJWD 2NQ9A 3FQXB 3AS3A 3I84A 1WFMA 4J40A 2EUZA 1S2AA 2TYSA 4HPXA 4N6RA 3PDDA 2HFGL 5SWZA 3NQEA 3RLVA 1VZHA 3L1OH 2H0FA 3D7PA 4MYXA 5F88B 3IKCA 4TO8A 1NGXB 1REIA 4JRYA 2FJFA 1OFPA 3GO1L 3TCXA 3VW3L 3D08A 4XNBA 3Q6FB 5I2IA 1GJIA 3V95A 2DORA 3I6KB 5CHNB 3PZMA 4M61A 1OIFA 3L13A 3WEAA 1SM3H 3GNPA 2IADB 4MD5A 5HHXH 4D7PA 3L3HB 2F2HA 1Q72L 5HGBB 3RDTB 3RFZA 5DO8A 3QT2A 2J44A 3P6LA 5CEYA 4I77L 1ZPTA 3NZ8A 4XCFH 5E2TH 3G5YA 2K1MA 1O60A 1H6EA 3AJXA 2AQSA 1QPPA 5G5IA 4MPQA 1ICTA 1AKPA 2HWZL 4G6JL 4OFVA 1UQZA 2WO4A 1MJUL 4WEUD 2RGLA 1AOZA 1HHKB 1UUOA 2ISFA 1OM3H 1FWHC 3ZE2F 1JGVL 3UVAA 4NPKA 1V7NH 2UX6A 2CZ5A 2EC9T 5EFDA 4BQCA 1V0KA 2OMZA 1H15A 3OA3A 2Q3XA 3MFFB 3UYCA 5HNUA 1KCZA 4KTGA 3TLLA 1R4XA 3MRDA 1C5BL 3TONA 3HFTA 4JYFA 5CLXA 4M82A 1R24A 3CLFL 3EWUA 1W6LA 1WUFA 4JEQA 4POZD 2X1PA 3TMLA 1FHNA 3QJTB 3EGDA 3HC3L 4FFVC 4PTWA 5J13B 4NZCA 2W60B 4K3EL 1XPGA 1PEZA 5E03A 4Q9QL 2QVKA 1OYCA 5F9OH 1UKSA 1RMFH 5DLLA 2V5SA 3LLFA 1JS4A 5AYZA 4HUVA 4O13A 1M7PA 3WLBA 3KPNB 1ULVA 4C1NB 3OODA 4M62L 3I9IA 1K4HA 4I5BB 4O17A 1PKQE 4W5ZA 4HIXL 4Y4FC 1NY1A 3WEOA 2POTA 4AVOA 5IV2B 1QR7A 1J0HA 2WMPA 2XQBL 2D2HA 1P9MA 4GXVH 3DIVA 4B5SA 4HF5H 3VCNA 1D2KA 1AVAA 5DHYA 1EAPB 4M3JA 2X4SA 1HP5A 1EEXA 3P0YH 1W1ZA 1W8EA 2UWEB 3GIVB 1WX0A 4YHZH 1ZE3C 3MRKB 3MI2A 4W7WA 4Z17A 4MBOA 3S4SG 1OM9A 4WUUD 4LCRA 1M57B 4B7LA 1XLEA 5I6MA 3O41B 1K3ZA 1FRGH 2ZUQC 4R7XA 4X50A 3K2MC 1BKHA 4GUJA 1IKFL 4XMKL 1TZGL 1ZVNA 1IGFL 2X6CA 2ENJA 4XV0A 3NCJL 4D0BA 3IBOA 1G9NH 4AH2A 4FLOA 4PTVA 5FF2A 4KMLB 2VDNL 1ONXA 3DU0A 4MB3A 2EIKB 2XG4B 5J5RA 2J2ZA 3GB7B 4GGBA 3ARGD 1NAL1 5LVEA 4MYAA 3Q5OA 1QBMH 2DMGA 4MJ5A 3DVNA 5AOLA 4QDGA 1ES0B 3HAEG 1E50A 5AB1A 1BYDA 3R6IA 5LGKA 2OW7A 5DRIA 3CVIL 1IBZA 3ARDC 4LARH 1IGWA 4XE0A 3S35L 2EVJA 4G43A 2VLMD 2WWCA 1QUPA 1AMKA 1VRDA 4OB5L 3DAQA 2FL5B 5HHQB 5LO7A 2N7AA 4TV3A 4KFNA 3KLSA 4Z18A 4MZ3A 5CBAB 3U3HA 3H3BC 1E5UI 3W9EA 1NJ9B 4L4TA 4HT1H 2BIQA 3BIKA 3WTSA 5FF4A 2FTYA 1LO3H 3BEWA 2H6PA 2ISWA 3DVGA 1V6VA 3D69A 2CKSA 3VXQB 2Z91A 1I3VA 3W38A 1JGUL 1XH0A 1NUFA 2WB1A 4NI6A 5IBTH 5T33L 1VYSX 3HBPA 3TW7A 4WQOA 3AIUA 3PGFL 5J6HA 2REQB 1F4YH 3V0EA 3G6JF 2VEGA 3QCUH 2YX0A 3KX6A 4N2NA 4I0PC 3V4PA 2LT9A 5FPIA 1YEIH 1MNZA 1RD5A 2PTTA 1NPJA 4ZO8A 1KFKA 3LBMA 5DCDA 1EERB 3D3VB 1VKXB 5E6ZA 3S46A 4YOKA 3W1NA 1TQXA 2R0ZL 3BQVA 3QDHA 3OKOA 2E46A 2YCLB 4IBUA 3T65A 3MZTA 5D1ZB 4Y5XC 3EAUA 1MLBB 1S2UA 4JFXA 1IEIA 4XP4H 1QOPA 1KTKE 1D2PA 3P30L 3NDZE 3WY3A 5CJXC 3QUXC 2ZXBA 1BA9A 4POCA 3CFJA 4ORZC 1N82A 4XI5D 5FCUH 3W07A 3NSNA 1J10A 4PS8A 4HJGB 3KPRA 2BVOB 3H9SB 2D03H 4BM7A 3NGBC 3BTNA 2DMKA 4YHPB 5XIAA 1B0RB 3CLEL 2EYTA 4KC3B 3L3JA 1NANH 3HGOA 1HTYA 4MM1A 3KBEA 5BOZG 2A4ZA 2Z1SA 4YHIA 4A7TA 4MZRA 3TFCA 3FB8B 3E02A 1SVBA 1UCWA 3N44F 1OCQA 3VTRA 3QWNA 1NCCL 3WMCA 3E0LA 4PWJA 1KCXA 6REQA 4LRSA 3O9WC 1S9KC 1KY6A 3RPBA 2IPTH 2GPZA 4DJDC 3QEGH 3ISIX 2WBJD 2R7EB 1GYNA 1IL1A 1KT2B 4YGVA 1O9VA 5BVPL 1KLUA 4GXFA 1I60A 3NO3A 2JFCA 12E8H 1YEWA 5FM5M 3C5ZA 3GZ3A 4IGBD 4ODSH 4XAWL 1H7WA 1W3TA 4A35A 1N3NB 2E7LA 4HUCA 1CBVL 5F96H 5C0QA 2Q8XA 1S2EA 3TOYA 2PTZA 1IBDA 5GVJA 3QJQB 1TIMA 4C59B 5GGQL 3NN8B 4PLOB 3KAAA 4ZMPA 1PQZA 4NOBA 4QRBA 3OVGA 3OC5A 5FO7A 3EUDA 4UYQA 1QEXA 1POJA 3WLNA 2WNKA 2PBGA 1MLCA 4OGYL 4ICXA 3REVA 8FABB 4L5FL 5EGRA 1XIWD 4J8RA 2Y0SA 4XNAA 4JFTA 3AT9A 4QT5A 4ZTOH 4KK6C 5GS1A 3HZKA 4XPTL 4WFHD 2HE8A 2BP1A 4QLJA 3QPQD 3DGCR 4RNRA 3W1MA 3SE6A 3OGRA 1VFUA 7REQA 1IT9L 1WIUA 1WCBB 1E6JH 4FI4A 4XX1E 2QGCA 3MGTB 4GFSA 2YS4A 4X9FA 3D46A 1E0VA 4HUMB 5E1HB 2ALWA 3FIGA 4QJ1A 2EIJB 1QWNA 3B04A 1W2KT 3ULUC 3W1PA 3VA2C 3X3FH 2VXSH 3LRSB 1K7XA 2OT1A 3PWUA 3ITXA 1ZLSH 3F7YA 3HOJA 1XCQA 1QUNB 2O72A 2O5YH 3PS7A 1W0VB 4NHCH 4B9YA 3GBLA 1RJRA 2GJ6D 5DQ9A 1WBZB 4M81A 2OGYA 2BVEA 2HLFC 2R14A 3T2NH 4NN6C 4APQD 4UMSA 4PTTB 3V9FA 2P0OA 3L3GB 1XCTB 2F2KA 1C9DA 1ZSDA 1CK0L 4CADB 2CZEA 4PRTA 1H1NA 5CSGA 1U8KB 3EWXA 3LCWA 2HJPA 3B5TA 2J8GA 3PFRA 2JKWA 3OF6A 4MX7A 2HVJB 1Z69A 3QGAC 3VXPA 2ZE0A 3VTAA 2P80A 4LAZA 5E00A 2ICWJ 2A7NA 1T83C 1UD3A 4LVEA 4WZ9A 1KPVB 3SOTA 4DJFA 5JIKA 2WQXA 1KCSL 1H60A 5IEKB 2JH2A 3NACH 1F90H 1WZLA 3MRCA 3K1KC 2YPVA 3VXGA 4DNMA 1QNOA 5DC2A 2PLMA 5B8CB 1K2DA 3EJZC 3IBEA 4KNQA 1A7OL 3O4LB 1PJWA 4O2CB 4BRVA 3OZPA 3PZNA 1ASOA 4UFIA 1GTFA 1ZLWH 4MIMA 3TX9A 4JO2H 1G7PB 4NYUA 1TLMA 4KVPA 4Y2WA 1WD9A 3V52H 4XZNX 1HINL 2G3FA 1QTWA 2J47A 1XB8A 1QLFB 4R83A 3JTSA 1JPST 3RX9A 4G6AD 5L2KD 3V4PH 5F3HA 3BW9A 3GBEA 2DWDA 3VFGH 4LSRL 3ARBC 3TV3L 3WTXA 3HZVA 3ARQA 1SGKA 3IAQA 4ZA0A 4LLVB 3WNMA 2GUBA 4WUUE 2ZVRA 2BRRL 2OCFD 1P7QA 4G1NA 1KCVL 2DJSA 4ENLA 1DOSA 5IM7B 3BMWA 3CXDL 3RY6A 1B4JH 3T1WA 4MSWA 1HO1A 2VR8A 3PBMA 1UG6A 4YCOA 5ICUA 4PJBA 4E3TA 2YEZB 3M1BB 1G7LB 5I6LA 4NU7A 3IUHA 3ALGA 3LNGA 3MUHL 4PJCB 2ED6A 1HL5A 4TUKL 4QYOA 4FFZL 5E99H 2MOGA 4M7ZC 5IMMB 3FW6A 3WJJA 1NBZB 3GGWB 4XVOA 1UOKA 2LU5A 1PDKB 1TJHL 1AZZC 3SO5A 5BW7C 3VI4A 3U2JA 1K77A 1ZLPA 3UAFA 2VLME 5DRWB 1SSDA 3APFA 2GTWB 3A9IA 4CQBA 4BWLC 3QHMA 3R4IA 1TT6A 4QXUH 3PWVB 5BZDA 3IAPA 1L9NA 1WO2A 1V5XA 4JRXD 5CMAB 3EKCA 1NWPA 2OK0H 5I6PA 1XF2A 3CS2A 3O81A 3RNKA 1LLZA 4PV8B 2BXYA 5HWJA 6TAAA 3GNNA 2APWA 3PAJA 3IMTA 3S7GA 1EJRC 1OTTC 3EX2A 5TE7H 4BCEA 4M8QA 4PGEA 8TIMA 1XV8A 3DHJA 5E1AA 2HK0A 3OC8A 5BRPA 2NY6D 2E7CA 2ZBTA 4UU9A 3SZ8A 4FTVB 2P5NA 2A3BA 4B5UA 3ILPB 3VJ6B 5FJUA 3TVMC 1WCQA 2NY4B 3H23A 4TVCA 2WKOA 2WYZA 5AY7A 3LU2A 4L37B 5E2VL 2D7TH 3N34A 3U4AA 3O8XB 5I1AB 3NH7H 4XX1G 1G7HA 3OKDB 1P6BA 1WDWA 3S6OA 4JGNA 2Q76B 5IW1B 1LYQA 1UXLA 2I7OA 1RBLA 1IGYA 3BAIA 3HG1A 4I18A 1U33A 3GLDA 2CALA 5L4MA 5EOQL 4GAAA 3HPJA 1A3ZA 3IARA 3W3OA 3S3GA 2WN2A 3DOPA 1KJMA 4ZW6A 1DVSA 1DR9A 5D2VA 4UTLA 1G6RB 2B0MA 2EIBA 1D5BA 2FMOA 3W23A 1XLAA 4PMZA 1L3WA 2AF2A 5AZEH 2OB3A 5HMEA 3FUMA 4NKOB 2W0FB 4W9EC 3OD3A 4YHMH 1GVEA 4QRTA 5AUMB 2HNEA 3BPCA 3QHFH 4H5SB 3RWFB 4N26A 4N0YL 1VFMA 2VAAB 1KBPA 1XUUA 3A4JA 4KJYA 3AO0A 4A67A 3MWAA 2QUVA 2ETWA 3CPGA 3WMPA 2GAZB 4HUXA 3FN9A 4B92A 1A49A 1E4KC 5IB1A 3OAYK 1HJCA 4YBLC 1A64A 3WLOA 4U1MA 4PJFE 3TPUA 3ZLFA 3EJQA 3DNKA 3VFPA 5KJRH 5FESA 5D8ZA 3DJTA 4I0KA 3EGSA 3WK0A 5T1KA 2H6RA 5FYKD 1AD0A 1IWPA 4WHBA 3KPPB 2E7BA 1ZCCA 4YDKH 4XK2A 3M5YA 4FXLA 2QFRA 3CFCL 5JPMB 1FDYA 2C5DC 1B2WL 2WWKO 2FPTA 2OXGA 3WE6B 1KXHA 2O4MA 2DW5A 4OV4A 2DKSA 9PCYA 3EGJA 4D9LH 2Y61A 2FJGA 4P8UA 2YPVH 2QPEB 5GSRB 3G3DA 4LVHB 4AL8L 1E1EA 3MXVL 3MHFA 3T08A 5LN8A 5DJ2B 4ZUUB 5TGBA 1AGEB 4H20H 1IEBA 3FO1A 5BPPA 1G0DA 3V1HA 4PJ7A 3D05A 1HOEA 2I07B 4FZIA 1NAMB 2AAMA 4XBKA 3D8MA 3DHMA 4GZJA 3WFBL 2WOYA 5DYOA 2XX0A 4MDIB 3GC4A 3KH4A 4OLZL 2ZYIA 1AIFB 3MP5A 1DCLA 4A6GA 2C1OA 5HTSA 1KJVA 3LLXA 3MZGB 3RDTD 3X17A 3M0XA 4JDVA 4A2MA 2ICES 3IGKA 2XFXA 4R9HA 1A4MA 1IKOP 5BNKA 3QJHA 2V9RA 1MFMA 4N8VB 4WWKC 5CEXA 4J3OH 1AJ7H 2HT3C 3LTSA 2XZCH 1W3NA 3PZOA 4NAQA 5DMIH 1K7EA 1UACH 1PW3A 5IB3B 2X4RB 4M8RA 1U1HA 3EMQA 3IJHB 2PDNA 4KK5C 1Y18A 4KIRA 5BS0A 1MY5A 2QJDA 3LH9A 1BXXA 3QE5A 3ILQD 2CJUH 4Y9CA 3SY0B 5EO0A 1E7UA 2GJ6E 5BRZB 1QXLA 2ZIDA 4ONGL 4Z7VE 5CJOH 3QORB 2PYFB 4IKIA 1NFIB 2L3BA 3LKNB 4TYUA 4IPNB 4NT6B 2JCCA 2JELH 2PUZA 1JV2B 3T0EC 1JUFA 4ZTYA 3FK4A 5ADOL 3LV5A 4POUB 5L4FA 1MOEA 3E8VA 3S3PA 1KC5H 1GHSA 7PTDA 3QR1A 3MCYA 1MCQA 4OQTH 3T4AC 2ISDA 4INFA 5I7GA 4NILA 1DQQB 3W57A 1VBHA 1KXTA 2YAHA 3UD6A 4GG6A 4K1GA 2X4QA 3P2BA 1WA0X 3FOKA 1TX0A 4MNHA 4JTFA 1A22B 4FMKA 3KPMB 2ZF8A 1OOAA 5IESH 3SIKA 2HG5B 5D4HA 3THML 1PNDA 5ID0A 1YVLA 2J43A 1HGWA 1BQHB 3TZVC 1FIGL 2J5WA 3HFYA 4PRDB 5DY2A 3HI6L 1EQPA 4PGBA 1YLVA 2HWGA 4UMGA 1U8OA 2H41A 3QG7L 5IVNA 3BH4A 1A9EB 3SKNA 5L2KE 1F42A 1ALDA 4OCWH 3F00A 2X41A 3B7TA 1BFNA 4MCNA 4NJIA 1SXZA 2B4CH 3QZBA 3WJWA 5A69A 2EO9A 3GLCA 2H3NB 3UETA 4M1DH 4Y16A 3VZXA 1NCWH 5C1MB 3TYFA 4IKKA 4QI3A 5D9NA 4S38A 3GMNB 4WAFA 2PRHA 1AQ8A 2D3VA 2EKGA 5KYXA 5AC7A 3CVCA 1ACYH 4NNPH 5F1NA 1Z48A 4MS6A 4YU1A 3CIVA 2AERT 3NA9L 1MREL 4Y2NA 3DGGA 1N9PA 3FB6B 5LZLA 4XQ6A 4IIQC 1N8ZA 1UASA 1K1DA 1PKNA 5IGXL 4NJHA 2GSJA 1KPUB 1MIEH 4OCRH 4PJXA 3G9VA 3WI9A 2GJRA 4PJIB 4GUHA 5CC5A 3BE1H 4HZLB 1A53A 4NAFA 3J2PA 3U7BA 1DQUA 3DECA 4IG2B 1VIZA 4LUSB 2HDJA 2WUCL 1FHVA 4HA4A 3FO0L 4LSUH 4AQOA 1CL7L 1VGAA 3FHEA 4AVFA 3EJCA 5E08L 4US6A 4YL4A 4LOEA 5KVDE 3NUKA 4KRLB 1SXCA 2IGTA 5HBBA 3TN0D 1RI8A 3V0GA 1HHIA 1YNLL 3S5LA 2YJLA 1TA3A 4HJJL 5BUPA 1OYAA 2R29L 2QCEA 4FXKA 3VXTB 3RUGE 1YSOA 4WEBL 3U46A 3HO8A 3J8F7 3D2TA 1NFGA 3OYZA 1S9XB 5LUMA 4PMUA 1QFWH 4EN3C 2BP5M 2JJUA 4CDHA 1DQJA 3UJJH 4KY2A 4JN7A 1CXHA 1CQKA 2H26A 1TENA 4GAFB 2V0TA 3SODB 3KCJA 4X0KA 5DD5H 3FVMA 5KSAB 1E51A 2B20A 4OR1A 3OZ9H 3GS7A 4CC4C 1CENA 4MJZA 5FUZH 2J20A 3AIEA 1SRDA 3GE7A 1JYWA 5AQ0A 4WOQA 2V33A 3P93A 2JXMA 2OTUB 3IGSA 3FT4A 4XUGA 3ROOA 3N1AA 5FHBH 5LDSA 5HPMB 3GSXA 4HPNA 4JDZB 3TBVA 4D3CH 1EJTC 2DM2A 5ABEA 5K69A 4HIHB 1OT1A 3DA0A 3H26A 3BVXA 1ZA6A 4LCIH 3NQ8A 1YNTF 3UCQA 1OGPA 5EBUA 1A66A 3AQYA 4BFGA 4YWGL 3FB5A 4E6MA 3TF7C 1MHEB 4M93B 3SE9L 3TPKA 5CF3A 1HHHA 2BIMA 3HZYB 1I8IB 3UTSB 2BZ7A 2MNWA 3GRWL 1BKSA 35C8L 4Y2OA 2YGYA 1HUVA 5JDJA 5DCCA 5DRXA 5D1ZD 4HIIB 5GRXG 4HX1B 1C5CH 2YRBA 4BV1A 2VZOA 4PHXA 1TR7A 5F2GA 4L9LC 3E96A 3QBTB 2EE9A 1VJIA 1OGAA 1YMHA 4MLSA 4PY7A 3H9SD 3FAXA 1TETH 2F19L 2CRMA 1J5CA 4RGMB 3N17A 3VFUB 4A2HA 1ODAA 1MCOL 3H2CA 2NY0C 4LQFH 3RFAA 1AQDA 2GJJA 2VDRL 2R9HD 1WXJA 3FQNA 4XD3A 2HN7A 1M71A 2AV1B 5DT1L 2Q8ZA 5JYLA 2KX9A 4XAFA 2EDLA 2PTXA 1AHMA 5BOPA 4WI7A 3PPCA 1B3WA 5ITBH 3GIPA 4XN7A 4LLMB 3OWRA 4S3AA 4JFPA 1T80A 4GVFA 2A9NH 5H4ZA 4XGZB 1HKVA 3S2NA 2V2CA 3CDZA 1L3NA 1JGDB 1XR9A 1JHTA 1RUKL 1FZKB 3GU1A 1NL0L 1S39A 2ADYA 2VKXA 4YYCA 5K1NA 5C8JB 4WFFE 1XRSA 4G1EB 2NNAB 3P9MB 2ICCA 4MMXC 5J56B 1NDGA 4A6YA 1XDLA 4Z2JA 4UFLA 3EOOA 5H94B 4FX8A 4MCZA 3T04D 3GH5A 5IOKA 4P23D 3VUSA 2WMKA 4XMPL 1F6LL 1PD1A 1T8QA 5HDBB 1A8JH 4GJ1A 2BZDA 1M5WA 1YYML 2Z35B 3V5DB 2ENPA 3Q3GA 1DIKA 4YS1A 3ZPDA 3KGRA 3WBAA 4DXVA 4TOYH 2XUWA 4ADUA 3SGGA 2V17H 4K1WA 4GRLB 2Z26A 5I1GH 4Y2DB 3T2PA 2VRQA 2CGZA 3VX1A 4GT7A 1BYAA 4Q8QA 1ZRUA 2W95A 3EBGA 3H2QA 3NURA 2FFIA 1LK2A 4D6DA 5FXCH 4IOFC 4HVBA 3KCPB 1Q6CA 3RMEA 1MHHA 5AVVB 1CI1A 1TPH1 4FQQA 3F5WB 4Z1BA 3QSKB 1XSIA 3GSUB 4AIBA 2E27H 4QRRA 1C93A 3S4SA 3T9WA 4H8UA 4JZJB 3BRDA 4GG8A 5KSBF 2ZNXA 2BY3A 2I5YH 2D0FA 2YAMA 4JQXC 5D2TA 2YSTA 1DN0B 5ANMB 5E5MB 3DG7A 1R3RA 5D03A 2HJLA 2YD3A 1YE6A 2EC8A 1J79A 3ZXWA 5IFAH 1QNZL 3CXHJ 2JB6A 3OVQA 4HLEA 2YPLE 1D7KA 4BQ5A 4LVOC 2GGJA 3FMGH 2ED8A 3ROLA 3HAEA 2KZBA 4QDMA 1OL0A 2ZXAA 5ECVA 1S5NA 2E9LA 1DBMH 1XB3A 4MCMA 3MUGA 1B2YA 4X7TB 1EEYA 3KW8A 5J9PA 5D02A 4UV4L 1RUPL 1W0WB 2AL2B 2FD6H 2DQTL 4MZIA 4B5TA 3SY6A 3H12A 3F58L 3LXAA 2FZNA 4PJEA 2XV6B 1CJYA 3OJDB 2DQFA 4W6YB 4XBGA 1W16A 3C86A 3A67H 1EX5A 1C12A 3V4UH 3B6SB 4RZ5A 2M83A 1IQWH 4MDRA 4PBXA 1MUMA 1X5YA 4UANA 1L9WA 3D34A 2G4EA 3O6FC 2QVHA 4YSSA 4F8QA 2UWEE 1IXPA 4UC5A 4AYMC 3DFPA 2VDLH 2UZYB 3QK0A 2UYLA 1JZ6A 2Y7SA 2ICWB 1AQMA 4W4QA 2A7RA 5GGTA 2RFXA 4F7TA 4LB4A 5FUCE 1NQ6A 4AF0A 4KX8A 3RKDC 1W3JA 3UYRH 5AAWC 3MOBH 5JHDB 4ZO9A 2X1OA 5HYQB 4MA3B 5C0DA 1P0SE 5F4WA 3HR5B 3WL0A 3P73B 3T3PE 4WDIA 1XGPB 1FHGA 2XIMA 4F5CA 2CUMA 1OQOA 4WGWB 2IPFA 1I3UA 2FSEB 3T44A 2HS6A 2IDQA 5D7EA 4PJAB 4DHGA 1I7TB 4OIIL 1XI3A 1A5KC 4S0SD 5GRJH 3IMBA 2J9YA 4ZSOE 3KBPA 4JCWA 2AEPH 5EL1A 2A4CA 5FK9B 4K8GA 1L6ZA 3SCMA 1TZHA 4Z42C 3TXZA 1I2OA 2QFPA 3SDCD 1M65A 2C1HA 5CC3A 1QJWA 1HKKA 1E4NA 3NOEA 4LAQH 3FHQA 3FQRA 2B4GA 3DX6A 3OSKA 1BIIA 4H0IA 1LOLA 4FNQA 3JWOH 4F33B 3EYQC 1Q8MA 4FHJA 3OLGA 7PAZA 3ZSSA 4C6OA 5CZ0A 1SYSA 1UROA 3EAKA 2I7GA 3A4FA 2A2QT 3SRHA 3NFPA 3U1SL 3JTTB 1L9OA 4KRPB 1R3VA 4K7YA 4WENB 3BKCH 4JTAA 3FGCA 4H9MA 1XVSA 1RPQA 1OB1A 1MCCA 3QUZC 4A6YH 2I9LB 1MEXL 4EP8C 5DK2A 3H54A 3ULVC 3QS3A 1AW1A 3G0UA 4F1ZA 1H3GA 4GRWF 1Y5VA 4ACYA 1RSCA 4KXCA 2M2DA 1KXQE 2A83A 2NY4D 1TLKA 4WGVB 2V7NB 1T03H 1UUQA 1XBVA 4GNVA 4IEFB 2DZUA 4M1CC 3O8XD 4F7EB 3NJKA 4ZW5A 1UZ6E 2VWEC 1OP4A 4J3WA 3ZYOA 2BVQA 1LQSR 1YG9A 3ULAB 6XIMA 4P2AA 4DW2L 3CV6A 2J1WA 4GRWH 3KJ6H 3QIBC 5IHHA 1NWOA 4DX3A 3ONBA 1IFRA 3GHTA 1O5DT 4HUUA 1V7YA 1R9FA 4L4OA 1IXQA 1KYAA 3NCYP 1A5MC 3HS0B 1MDLA 4BK5A 4HIEB 3QEQD 4WW2B 4D0DB 5HI5D 3VE7A 5TTRA 1EGJH 1DXFA 3MYPA 4ODXB 1DSFL 4IMLA 2P44B 4GRMA 1ZNNA 1E2VA 4TLTA 4K8RD 4E8CA 1EOMA 4M7JL 1KKOA 3BSMA 2QCDB 3NRQA 5IJCC 1LO0L 3KBNA 3ZZQA 4FOMA 3WJLC 2YGVA 2ZYFA 3VQLA 3MBEB 5AG8A 1H3XA 4FABH 5JLZA 1QVOB 4JTLA 1MFBH 2ZOLA 3QPXL 4P49A 4Z95H 1FLTX 4QXGH 1NBYA 3D0LB 1PG7W 1G6CA 2KUTA 3SN4A 1H0DA 3HIZA 1WWBX 1R6WA 1U36A 4P2YA 4QXTA 2HQAA 4YEEA 1UXWB 3O11B 5D4IA 1MQKL 4NQDB 1INQA 1G0XA 3HAEH 1YHTA 3RDJA 3SCRA 4L0YA 3QNYA 3EG9A 2DM4A 2I9EA 2A77L 1XPYA 4YMPA 1JNJA 4OFIA 3FH5A 1OSZA 4ZX3A 3KL0A 1DUZA 1I45A 1URZA 1RSYA 1V6XA 1MAMH 2XISA 1MFAL 5EF2A 2NY7L 3ZS4A 2Q20A 1VFHA 2P5WB 3IJ6A 3MRRA 3GNML 2YL6A 2J24A 3DUUB 2V82A 1X7IA 1V0NA 2O0TA 1CFTA 4HSNA 5HQMA 3VFMB 1JDAA 2QCNA 1Z6KA 3CH1A 3KWUA 3IF1B 4BH8A 3M44A 2GSEA 1P6AB 1CICA 1QBBA 2HRPH 2J88L 1I9CB 1LBLA 2J7EA 3K4ZA 1I53A 15C8H 3TA9A 1S2VA 4H4IA 1LO4H 4FI8A 3VFNB 3V16A 3B7SA 1HIML 3PTKA 3B1UA 4ZBCA 2D7NA 3LK6A 3VD9A 4MQ7B 3SPCA 2QELA 4CJ0A 2YC1B 2NYZA 3GSQA 4ABVA 2OYLA 2NW0A 4RRPG 1U41A 4BQ2A 5DJ8A 2X28A 1JCLA 3NJGA 4CD8A 5C07B 1M7DB 5IMKA 4OI8A 4PJ8B 5GGTH 5DDHB 1K6WA 3EYSL 4DP8X 3CZFB 5JIIA 1NPUA 4PEKA 1R47A 1Z9SB 4CVZA 5IP4A 3CHCA 3H2EA 2ANUA 3G5XA 3W7JA 5CU9A 3TO4B 3HMXL 1AMYA 4ELDA 3LEVH 3O0FA 1CE6A 1E2WA 5BRZD 1T1WA 3PP7A 2ILLA 1FI8C 4LH8A 3QORD 2OTWB 4WHYH 1Z9PA 4KZCA 2AJUH 3HV9A 3W84A 1AH4A 4F7PA 1LRNA 2PW2A 1V55B 5A95A 2VXQL 5CEZH 3O0KA 5DUPH 2QULA 1EB3A 4G82A 5E9NA 1WISA 3UNTA 2DIEA 3NXLA 3W28A 2WJ7A 3QSRA 4NSKB 1EVTC 2F6XA 4L0ZA 1EQCA 4PUDA 5D5MA 5EN2B 2PTUA 1XIEA 1A6VH 5REQB 4GQRA 1TFVA 5FSEC 1EUAA 2QXWA 1FYTA 2XZZA 3BZGA 5HI3C 1DPMA 4KZ0A 1B3YA 1M42A 1WDPA 1VFAB 2V8MA 1I8KB 1W32A 3CBJB 5GSVA