1MXGA

Crystal strucutre of a (ca,zn)-dependent alpha-amylase from the hyperthermophilic archaeon pyrococcus woesei in complex with acarbose
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
435
structure length
435
Chain Sequence
AKYLELEEGGVIMQAFYWDVPGGGIWWDHIRSKIPEWYEAGISAIWLPPPSKGMSGGYSMGYDPYDYFDLGEYYQKGTVETRFGSKEELVRLIQTAHAYGIKVIADVVINHRAGGDLEWNPFVGDYTWTDFSKVASGKYTANYLDFHPNELHCCDEGTFGGFPDICHHKEWDQYWLWKSNESYAAYLRSIGFDGWRFDYVKGYGAWVVRDWLNWWGGWAVGEYWDTNVDALLSWAYESGAKVFDFPLYYKMDEAFDNNNIPALVYALQNGQTVVSRDPFKAVTFVANHDTDIIWNKYPAYAFILTYEGQPVIFYRDFEEWLNKDKLINLIWIHDHLAGGSTTIVYYDNDELIFVRNGDSRRPGLITYINLSPNWVGRWVYVPKFAGACIHEYTGNLGGWVDKRVDSSGWVYLEAPPHDPANGYYGYSVWSYCGVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Differential Regulation of a Hyperthermophilic alpha-Amylase with a Novel (Ca,Zn) Two-metal Center by Zinc
pubmed doi rcsb
source organism Pyrococcus woesei
molecule tags Hydrolase
molecule keywords alpha amylase
total genus 160
structure length 435
sequence length 435
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2002-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1mxgA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1mxgA01
2V3GA 1US2A 1VAHA 3M7SA 4HOZA 4DUVA 2GVYA 2XM1A 1GW1A 5LYRA 1V0LA 3VGFA 1QOXA 5CPQA 1EQPA 1H4PA 4J3VA 3VM7A 1W9PA 4HMDA 2E4TA 5EFDA 2WVUA 3GXNA 2EEXA 3WUBA 3SUSA 3MU7A 3OLEA 2EADA 4J3XA 1E9LA 3T09A 1ISWA 3VDBA 2JFEX 2DIJA 1CNVA 4ACYA 4E8DA 1S46A 1JNDA 3MMDA 1WO2A 2FE0A 4D6JA 4U5IA 4FNTA 3AS0A 5FCZA 3S2CA 3MV11 1X6LA 3SCRA 3KL3A 3UG3A 1H2JA 4AZCA 3CBWA 4BQ2A 5CGTA 3WEZA 1PIGA 1VB9A 1VJZA 3ZT7A 3CV5A 3QOMA 1R86A 1WZMA 1HP5A 2NW0A 5ABFA 2WC3A 2X2YA 4UQAA 2BVYA 1UR9A 1PAMA 5ABHA 1E4NA 3ZJ6A 1WKYA 1ZBWA 3PTMA 1EO7A 2AAAA 3VGGA 1F4AA 3WH7A 1PS3A 1XV8A 4AZBA 3SURA 1CGXA 3ZMRA 2Y24A 3WQ5A 2YA1A 3GXTA 2QPSA 2VX5A 1CGTA 2X09A 3J7HA 1E73M 4H8UA 1GOIA 2VR4A 3N9KA 3A4XA 2V38A 2C0HA 1CGUA 2VQUA 4DO6A 1WP6A 2WLZA 2E9BA 4DUXA 3BUBA 1UWUA 4W5ZA 3OIHA 4B3KA 2VTFA 1LG2A 3QHMA 4Z2KA 2WCAA 5ABGA 3IANA 3CHFA 3VNZA 3WDQA 2J62A 1ZBCA 2CBIA 4GXPA 1JZ7A 3OLGA 4D1IA 2YL6A 7A3HA 1QX1A 4U31A 3VNYA 4Z2LA 3VGHA 5FL0A 2E3ZA 1KCKA 1IZJA 5A1AA 3BUQA 1Z32X 2BHUA 4CN4A 1GVIA 5I24A 1UWIA 5I23A 5D4YA 4DUWA 2ZXQA 4W7UA 1MWOA 4PMQA 3VX1A 1BQCA 1ECEA 3WD3A 2XVKA 3GNPA 1AQMA 2W5FA 1V3LA 1ZU8A 3CUGA 4LYPA 1R7OA 1MQRA 1UQYA 4BF7A 4AZ5A 2GK1A 1W2VA 1AQ0A 3POHA 1CXKA 3UEQA 4P7LA 1TMQA 2V5DA 1WDRA 1EDTA 5AC4A 1E72M 5BYWA 3VMPA 1O6IA 2F8QA 2CITA 3OZPA 5IFPA 4XB3A 1QHZA 2DSWA 3LXAA 2RGMA 3BCFA 3W4RA 4AYGA 2VZSA 4B15A 1IT0A 2FHFA 4YHGA 3WDPP 1XSJA 2WZIA 1BGGA 3NDZA 3ARXA 3OGSA 5D8WA 4HTYA 1PPIA 4CCEA 1GHRA 3EJPA 1NP2A 1IV8A 3L4WA 2X05A 2W62A 1V02E 4DWSA 1CBGA 1GQLA 3B9EA 1CXLA 1US3A 4PUEA 1QHPA 4CU8A 2YA2A 2FYVA 5FL1A 1O7DC 1JFHA 1NWTA 2ZX5A 1NOUA 1GJUA 1UKTA 1TCMA 2E8ZA 4HU0A 1E3XA 4JIEA 1OINA 3KL5A 3EMQA 1O7AA 4NSBA 3TTOA 2CKRA 4TVUA 3ZJ7A 4CKQA 4TVDA 1GOWA 4U3CA 3FN9A 3T2QA 1E70M 2WXDM 3AZTA 3EBVA 1BG4A 4FF5A 2J74A 1OIMA 4WF7A 2EPNA 2WLYA 1KXVA 1XH2A 1NWRA 2D3NA 4RL3A 2FHBA 3VD5A 1KGWA 3BVTA 2ZWYA 3CLWA 3ZR6A 2BY0A 1KQYA 3MMWA 1W9UA 1TQTA 2WVVA 4HMCA 1BYAA 3WH8A 2VRKA 4WJXA 3BCDA 4OGZA 4D6HA 4PMXA 1KQZA 1AVAA 3CGTA 3AIBA 4EKJA 3DX3A 1EOMA 1VFOA 2J47A 4CN6A 1XRVA 1DWIM 6A3HA 4PMUA 2G3MA 2Y4SA 1BVNP 2WVSA 4PCSA 1ITXA 1TR1A 2WMHA 3WQ6A 5C70A 1UQZA 3L4XA 2W67A 1M04A 4PTWA 3ARUA 4AZHA 3G6LA 4HOWA 1EQCA 2CKSA 1WDPA 1OGSA 3VIFA 1G0CA 5I77A 5AY7A 2VZOA 1D3CA 4JFWA 4OIFA 4FNPA 5HXMA 5HPCA 3H55A 4MPKA 3AZSA 4C7DA 4B16A 3DX0A 2VOTA 2DT0A 3CZNA 3NSMA 3LXCA 5AC5A 1V0KA 4UFHA 3T0BA 2YIHA 3WD0A 4W8BA 2ZICA 3VIPA 1TQSA 4W7WA 4M1RA 4UNIA 4CU7A 2PWGA 3TA9A 2X0YA 1QBBA 3VMOA 3AMCA 3ARYA 4Z2HA 3AJ7A 1V3HA 3N04A 4PBGA 1C8YA 3WH5A 4GINA 1MW2A 5C8BB 3GH7A 1WPCA 4D6FA 1FP8A 2DSZA 3L4VA 1TG7A 3RIKA 2GDUA 2WHMA 4PTMA 4W8LA 4TX8A 5CPTA 2WCGA 1X1NA 3N18A 4MADA 1YHTA 1UD4A 1J18A 4FMVA 3EJUA 1H0IA 4PCTA 1RD6A 2GUYA 3VSVA 2Q8XA 5A8QA 5E09A 4Y7EA 6CGTA 3BLPX 5D9NA 2VC9A 4LGXA 2XFYA 2JEQA 4RE2A 2EO7A 1VIWA 3K46A 1MVYA 4JHZA 2EACA 2WAGA 1BPLB 4HZ7A 3GTNA 3ARZA 4PMYA 4OUEA 3DHPA 4M81A 1ZJAA 1C7TA 2WKGA 3RPMA 2XPKA 3PN8A 1QI5A 4DO5A 2VNCA 1QBAA 3II1A 4TVCA 3I3DA 4BCEA 2FGLA 3KLLA 4NRSA 1K9EA 2WBGA 3KZSA 3LPFA 1DWFM 3HG2A 3MI6A 4CCCA 3TOPA 2OW6A 1XYFA 3WL1A 2A3HA 4X9YA 1LWHA 1GQKA 1MFVA 2D24A 4JKKA 2WNWA 3WNLA 1C8XA 2X8RA 1UWQA 4JHOA 2ZXAA 1B3YA 1A3HA 2V5CA 4GI6A 2D1ZA 4AIUA 4P8VA 1GONA 4JFVA 3EDJA 3NSNA 1CYGA 2XWEA 2YDQA 4PN2A 2OSYA 4W8AA 2W61A 2BNJA 2YFNA 4NXSA 2J7FA 3DECA 3GBEA 1UZ4A 2VRJA 5DFAA 1V3JA 3CUHA 5BXSA 1TVPA 1HXJA 1ODUA 1PX8A 1KTCA 3L2LA 3U5UA 1UH4A 1J9YA 3D50A 3EMCA 4W86A 1JYXA 5D9MA 1UD5A 5JIPA 3PZOA 3T2PA 4BZYA 1I1WA 3BAJA 3SUWA 1ESWA 4W84A 3EDFA 3IAPA 4QCEA 1D2KA 2VJXA 4ATDA 3AIUA 4YHEA 1E4IA 5A6BA 1B30A 2PC8A 5M5DA 2F61A 3SCWA 5BRPA 2WPGA 4XX6A 4UR9A 2ESCA 3PTKA 2D0GA 3SCOA 1TA3A 5D9OA 3K4DA 3OG2A 3AHYA 5DT5A 1UKQA 3B9AA 1E6PA 2OYLA 2OYKA 5A8OA 1V6WA 3O2LA 3JUGA 3UESA 1E4MM 3PZMA 3A3HA 5HOSA 4OZOA 3F5LA 2VQTA 3EJRA 1DWJM 2ALWA 3A4WA 3WL0A 3DX1A 3WELA 3WQWA 2XVPA 1QVBA 3ZR5A 1WB0A 3QHOA 3W81A 3BLKA 1B90A 4FLSA 1JXKA 3AISA 4BA0A 5BXRA 4IISA 4ACZA 2D73A 1E71M 4J3UA 1GORA 1VEMA 4FLRA 3K4AA 1JIBA 7CGTA 2FH6A 8CGTA 2ZUVA 1PJ9A 4NZJA 3WNOA 1Q6EA 4P7QA 2ZUTA 3W26A 5FD0A 3HG3A 4F8XA 3QGVA 3WQ8A 1R33A 1ZJBA 2EQDA 3WEOA 2V3EA 2W4XA 4UZUA 1SZNA 4AZ6A 2NSXA 2X2IA 3GXMA 1V6VA 1LWJA 3BXWA 4CCDA 2WYSA 3CC1A 5A6LA 4UQCA 2PBOA 2F7OA 3M07A 3EDEA 1NQ6A 1EH9A 3WQ4A 3EYPA 2X2HA 3N1AA 2DPEA 4A3YA 4EK7A 3D4ZA 2DQXA 3M46A 2AOSA 3VUPA 4OOUA 3KE0A 1FA2A 2DDXA 4LPCA 1ISVA 1KCLA 3HZ3A 2O9OA 1W3KA 1NH6A 2VX7A 1EOKA 1PX3A 3TTSA 3FY1A 3NDYA 3AIWA 4ZE5A 1GOOA 4RE3A 1XYZA 1R46A 1ZBVA 2W66A 2E9LA 1L0PA 1CWYA 2BY2A 5I0DA 3W53A 4TOQA 1JDCA 1J0ZA 2G4FA 2JEPA 4UQBA 2PB1A 2ZIDA 1HF6A 4PSPA 3RO8A 3TP4A 2D0HA 4AW7A 2F18A 3WF4A 3UG5A 1GOQA 4FLQA 2DSKA 1MXGA 2NT1A 2XN2A 2OW7A 2A3AA 4M80A 1D7FA 4EANA 4Z2GA 1E55A 1GQJA 2WC7A 4PMZA 3DYMA 3ZIZA 1KR1A 1AQHA 3DC0A 1TQWA 2YBUA 1FHLA 3ZJ8A 4H2CA 2V3FA 4OBSA 2F1BA 4ZENA 4WSJA 3RDKA 3ARSA 2XWDA 1WAWA 4GO9A 4PTVA 3WDRA 2DT1A 5BXPA 1RH9A 4MTVA 1GOMA 3AYRA 2Y5EA 4MDPA 1UD8A 3RM8A 3ALGA 1NWUA 4LYRA 3N11A 3VD9A 2CXGA 2G3JA 1CXFA 2D3LA 5CLTA 2CEQA 3LRMA 1GZJA 3GDBA 1V6XA 4MB3A 1UR1A 3RM9A 3A47A 1HJVA 2WMKA 4MB4A 2VL4A 4JKMA 1JYWA 2F1AA 4GI9A 1EGZA 5BWFA 2J8FA 4L4PA 4GZEA 2UWFA 3B8SA 4GI8A 5A2BA 1EDQA 2CIPA 1TA3B 4WK9A 4WKFA 3EJQA 2OWXA 1EIBA 1E0XA 3D51A 2QHAA 5IFTA 6TAAA 2VVSA 4UQEA 1NWSA 1HL9A 3ZSSA 3E1F1 4V27A 3VD4A 1QWNA 2E0PA 4AEEA 4KRUA 1MFUA 5DO8A 3A23A 3IJ9A 4W89A 3OGVA 3ARVA 1XGZA 4KMQA 1BVZA 5A8PA 2BXYA 3K1DA 3BSHA 5BROA 1MW1A 2WB5A 3VOCA 1HJXA 2XGIA 1Y7VA 2DH2A 5E70A 2VMFA 4Z2IA 2QPUA 3DYOA 5JBDA 1MW0A 1VEOA 3D4YA 2NT0A 4IM4A 1WDQA 1ZBKA 5A6KA 4JFTA 3VMNA 4TTUA 4OKDA 3WH6A 2VZTA 4U2ZA 2JF6A 3WD4A 1UA7A 1C93A 3CZJA 5I6SA 1CECA 1LF1A 1QNRA 1VFUA 1UG6A 2YKKA 1B9ZA 3PZVA 3WY4A 2WC4A 1HJWA 3AIVA 1H0GA 1W1TA 2RGLA 3AOFA 4UOQA 3MANA 3SUVA 4ML4A 2IXVA 2XM2A 3WMSA 3D5HA 3AMKA 3RM4A 3QHNA 2CERA 1EA9C 2ZUUA 3A21A 5E6ZA 3D52A 3BC9A 1NARA 1HT6A 4YPJA 1JZ6A 1J0HA 2XFFA 2O9RA 1J0IA 3FHQA 5A6BD 5I79A 1UOKA 4P8WA 4AY1A 3MUIA 2UY3A 1QW8A 3WNNA 1E6QM 2XVNA 3VIKA 1OIFA 1GJWA 4QLJA 4BQ4A 2VUYA 1N82A 1ISXA 1H3GA 3T0AA 4X0VA 1DWHM 1HX0A 4RE4A 1E1EA 3HG4A 4D1JA 1DTUA 1H1NA 3MUY1 4JFUA 1GNXA 3SCSA 1B0IA 1NM9A 2UY5A 3SCQA 4F9JA 1KXTA 1B3XA 5CXPA 1KXQA 3KWXA 1UR4A 1QWUA 1RP8A 4AMXA 2EPOA 4S3JA 3WUGA 3DHUA 3HJEA 4QLLA 3CHCA 2JIEA 4P7RA 3WF3A 2O9PA 1UA3A 2F7QA 1V02A 1QNQA 2E9MA 2XTKA 3W24A 1P6WA 4AMCA 4EE9A 1JYNA 1JL8A 3FAWA 3A22A 5A95A 4BS0A 5CG0A 1H11A 4PYSA 1OB0A 1VFFA 2J7DA 1U33A 4MNLA 4OOZA 3N12A 1PX4A 1HJSA 3I3EA 4PUDA 1XCWA 4JCLA 3ZOAA 1V08A 3KLKA 1MYRA 3OA5A 5D9PA 2ZX6A 5E6YA 2ZUMA 4PRWA 3IAQA 4CD7A 1Q6GA 3BVUA 2PF0A 1FHDA 4H41A 2WSPA 2BS9A 4IPNB 1UHVA 3FXYA 2FDMA 1R47A 1E6RA 3WIJA 2G41A 1G1YA 4KGLA 3W28A 4GIAA 2QF8A 3CUJA 1KGUA 3CMGA 3OB8A 1BHGA 3CZSA 1UWRA 1QI4A 3MSGA 4OJYA 2Z1SA 1W3JA 2JE8A 3PHAA 4BQ5A 1HL8A 4JZ5A 2VZUA 2XN0A 1W32A 4UZSA 2J7GA 3EDKA 1FH8A 1QHOA 3ZSTA 1R85A 2QMKA 3KEHA 4AIEA 2Y8VA 4D6IA 1J11A 1JD7A 3BH4A 2CESA 3W29A 3BAWA 1H41A 2XVGA 2XIIA 1BF2A 2WSKA 1E6XM 3W37A 1LL7A 4AYSA 1I75A 3WF0A 4XZWA 3THDA 9CGTA 4D71A 4H8VA 1JF6A 1OGGA 2C8NA 2BHZA 1OWQA 1J10A 1J0KA 4LXFA 4PMOA 1DHKA 3DX2A 2WZEA 4AWEA 4NZFA 1BYDA 2YJQA 2XGBA 2UY4A 2W92A 5AYBA 2XFRA 5HNNA 2J25A 3VIGA 2CBJA 4UOZA 3MUAA 3NSXA 3RJXA 2IGTA 4QAWA 3BVVA 1UD2A 2EAEA 1V6YA 2CETA 1C3FA 1JYVA 2GJXB 5BXTA 3VX0A 2BHYA 1CDGA 4FNSA 1R7AA 1JZ4A 4KGJA 1HKMA 1ZB5A 2D23A 2BY1A 2YL8A 4AD3A 4WLCA 3T08A 2YDRA 3RJYA 1W9XA 3THCA 3T0DA 2QV4A 4ZEPA 4HA4A 3SCTA 1CLVA 3MSDA 1OGBA 5A8MA 3G6MA 2PWFA 2J4GA 4ZFMA 3TTYA 4M8UA 1QI2A 3VPLA 2DEPA 3PZ9A 1HN1A 1K9DA 4AC1X 1E6SM 3SUTA 5A69A 4WKHA 4P7NA 3VVGA 4NRRA 3LMYA 1UD6A 4R27A 2VVNA 3APGA 1BLIA 1XH1A 3AIEA 1QPKA 1HJQA 2VURA 1V6UA 1UUQA 3HN3A 3BMVA 3MV01 5M03A 1I1XA 1C8QA 1GCYA 3CUFA 1LL6A 1HKJA 1HKKA 5KEZA 3GXFA 2YDSA 3SUUA 2DT3A 3ARQA 2GJRA 2PWHA 1WNOA 4AZ7A 1QI3A 1VRXA 1LL4A 5CQ1A 4AZCB 1H5VA 3AHVA 5BRQA 3ARWA 4J7RA 3F5JA 5IHSA 3GM8A 4XZBA 1CZ1A 4DWSB 2WMFA 1E43A 1VJSA 3DDGA 2C7FA 2YL5A 3SEPA 3AXIA 1HKIA 2VT0A 3WY3A 3SIMA 3A5VA 1HIZA 2G3IA 1LJYA 3VIOA 5AYIA 1CXHA 5GNYA 5IDIA 1V3IA 2B31A 3EMZA 2WCSA 2DGAA 5A2AA 3GH5A 3N13A 4KH2A 1JDAA 3U57A 3FAXA 1E5NA 4W5UA 1JAEA 2XSAA 1QNSA 4FNQA 4UFIA 1ISZA 2ZWZA 3U5YA 4HPGA 4X0NA 2XUCA 3FW6A 2BV9A 2XSBA 1E40A 3WBAA 1FH9A 4UTFA 1WZKA 1ITCA 3WDHA 2J8GA 4GQQA 4HZ6A 1MW3A 5JBFA 4U33A 3K8LA 4AMWA 3QOKA 1UH2A 1JI2A 2F2HA 3BGAA 1E4LA 1RPKA 3NCOA 3AXXA 2EPLX 5ECUA 3WEMA 4MDOA 4QCFA 1QI0A 3EJTA 4WKAA 4AD4A 5DF0A 2FGZA 1XSIA 2GSJA 2WZHA 4CD8A 4E8CA 3OLIA 3L4TA 2D2OA 3GXIA 3NJ3A 1PEZA 1UR8A 3BMWA 1UYQA 4MNKA 5A8NA 3AMDA 1XD1A 4MJ4A 4D6EA 4FNRA 2CHNA 2DT2A 1GUVA 2BXZA 1OT2A 3AHZA 1CGWA 1ISYA 4PMVA 1WZLA 3N15A 3VIJA 1KB3A 4J3TA 4UFMA 3VO0A 1CEOA 5IXEA 4W7VA 5HDRA 3CZKA 4GQRA 3WY2A 2JIWA 3WSUA 2VCCA 3TV8A 2ZXBA 1H49A 4UFKA 4AD0A 4P8UA 3S5ZA 3AHTA 3NUKA 2IUZA 1M01A 4IPLA 5F7UA 3BUDA 2BFGA 5A6MA 4MAZA 2J7HA 4V2XA 1UR0A 4IUGA 2JF7A 3CTTA 3VDCA 3HU7A 4AD1A 3ZJKA 1HXKA 1WDSA 3BAXA 3IGUA 2VRQA 4J3WA 1V0MA 2HVMA 3SCPA 1XC6A 3N17A 1CLXA 1TUXA 4KWUA 1M53A 4WSKA 1TE1A 1SR0A 1CTNA 3L4YA 2XG9A 3PBGA 3EDDA 3GNRA 3AI0A 3RCNA 2XJ7A 2FHCA 1TQUA 5BCAA 3M6DA 3VGEA 3BLBA 4DM1A 3UETA 1A47A 2VO5A 3WNMA 3O6AA 3VDAA 1B3VA 4KRTA 2ZX7A 1XCXA 2BVDA 1L8NA 3TTQA 2OWCA 1BTCA 1JI1A 3IK2A 2WM0A 3UR8A 3VDHA 1V0NA 4MB1A 2JALA 2X0HA 2OLHA 3VD3A 3WENA 1QW9A 5CSYA 2XIBA 1G5AA 4W93A 2O92A 2F7RA 2CYGA 3CHEA 4P8XA 5CPSA 2OWWA 4OBRA 2DIEA 2WHKA 2VI0A 3POCA 3SCNA 4M29A 1KBBA 3WD1A 1KWKA 3VGDA 4LX4A 5E9AA 2J7EA 3CPUA 1SMAA 3T2OA 3VD7A 1HVQA 1JF5A 2VZVA 5A94A 1RP9A 4NXKA 3ZQ9A 1XH0A 2EPMX 1UWTA 2W91A 1W3HA 3F4VA 1B2YA 2W63A 2A3EA 5I78A 2XN1A 4UOJA 5CSUA 3BUIA 4JCMA 1G94A 1CXIA 1OT1A 1E6ZA 2WMGA 1JZ5A 3VILA 1V3KA 1PIFA 4FK9A 5E0CA 1FFQA 4AZGA 1C91A 4PTXA 4D6CA 4JAWA 5JIWA 1TZ7A 2ZUWA 4J28A 2EABA 3W0KA 1DWAM 4XUYA 3QR3A 4HU8A 1KFWA 4U5KA 3MKKA 3PZIA 1FH7A 1G9HA 2CCRA 2J7CA 2DSVA 3OBAA 1W1VA 4A4AA 4R5EA 1GQIA 5ABFB 1Q6FA 2XVLA 1F4HA 1M7XA 5GQBA 4CD6A 5CZKA 3W6MA 3WKZA 3ZO9A 1XSKA 4CD4A 1OBAA 3WDIA 4ACZB 5JUVA 3AHXA 3AMGA 3WFLA 3VSTA 3PZTA 2GJXA 4UCFA 3LPOA 2ZUNA 3GZAA 1W91A 3CZ8A 4JFSA 3WMCA 4EAMA 1TVNA 2J7BA 3GH4A 3ZT6A 3KL0A 1C92A 2WHJA 5I5RA 1CPUA 3HG5A 2GDVA 3AYSA 4E4PA 4S3KA 2IXUA 4U2YA 1W9BM 5E0FA 4GKLA 1XHGA 1MQPA 3BVWA 2GK1B 1PZ3A 2HISA 4JKLA 1OSEA 2VCBA 1KXHA 1U30A 1XD0A 4Q22A 5A3HA 4E2OA 1JZ2A 1HTYA 3VSUA 3WUEA 3SCUA 1FOBA 1SYTA 1EHAA 3A24A 1JAKA 3LPGA 4W88A 1ZS2A 3CHDA 3SCVA 5A6SA 3ARPA 5TD4A 3AS3A 1R75A 3HMCA 3UG4A 1UASA 3UR7A 3K8KA 4WIWA 1JZ3A 1BSIA 2D22A 1JXJA 1CGVA 5FIPA 2PBGA 1LG1A 3VTRA 5CLWA 2YA0A 4N42A 2BVTA 5JBEA 4TTGA 3VINA 1GHSA 5FOOA 5DT7A 5I3DA 2ZUSA 4JL1A 1BAGA 4H8HA 2WMJA 5I2UA 4AISA 3S5YA 3RMEA 2PWDA 2DH3A 3IJ7A 2EXOA 5HBFA 3ALFA 1TFVA 1J01A 4TUFA 4MNMA 1Q6CA 4MAVA 1M03A 3CIVA 3WUFA 4DO4A 1UKPA 4F9DA 3AICA 3BAYA 1JFXA 4Z2JA 3I3BA 1W1YA 1EO5A 3NIYA 2D20A 5ABEA 2GJPA 4PMNA 1W2PA 3PZNA 1B3WA 2VR5A 4NI3A 3AS1A 4GPNA 2WK2A 4FLOA 4CVUA 3CZLA 5DEZA 1WE5A 4AZIA 4QDMA 2ZX9A 4URIA 4L4OA 3WDJA 4B3LA 5LA2A 4ATLA 3MUZ1 2Z1KA 2G3NA 2YOCA 1QNPA 5M17A 1W9DM 1J12A 2A3CA 3O9NA 3ECQA 3WBEA 4C7FA 1ODZA 5DMYA 3MMUA 3K8MA 4H04A 3AZRA 5A6AA 3VIMA 2F7PA 5FKYA 5M3WA 5EB8A 3GXDA 1VFMA 2E8YA 4AEFA 3VU2A 2J75A 2D0FA 1HVXA 4DWSC 3L4UA 1GVYA 1VENA 1IZKA 4FNUA 2V3DA 3LRLA 3BVXA 4HPHA 4F79A 2WWCA 1R87A 3D3AA 4C7GA 2YLAA 1JZ8A 4JL2A 3AMLA 1C7SA 4CUCA 4HMEA 4AXNA 2EJ1A 4CU6A 3TONA 2GFTA 4ZE4A 4DM2A 4J3SA 4TX6A 4GZJA 3WD2A 1W1PA 4UQDA 2CHOA 4DWSD 3F5KA 4U3AA 2WBKA 1E0WA 4NX0A 5GPRA 4N0RA 3ARTA 3AS2A 2CBVA 3BAKA 4HA3A 1HWWA 2XYLA 5A2CA 4ZXOA 4V28A 4PEEA 2WHLA 2OSWA 1EHNA 1JGIA 1JG9A 4AD5A 1LLOA 1QNOA 1VBRA 2QMJA 1GPFA 5E1QA 4J27A 2ZOXA 4P7OA 1J0YA 1K9FA 4M56A 2ZE0A 1NP0A 2AMGA 1UKSA 3U7BA 3NYDA 1DEDA 1UZ1A 3EJSA 2WVTA 3CO4A 5C71A 1UD3A 3WNKA 1G01A 2O9TA 3LPPA 4ATWA 1E5JA 3W82A 3AIRA 3MO4A 5GNXA 1T0OA 2CNCA 3W27A 3AFBA 3L2MA 1HP4A 2VX6A 3B9DA 4HA1A 1BYCA 1WCGA 1OD0A 4TXEA 3PZQA 3ARRA 4AIOA 3WNPA 3DX4A 2PI6A 2EPKX 3H53A 2VCAA 2WKLA 4PMDA 3WQVA 1E3ZA 2Y8KA 2Y2WA 1V3MA 1HNYA 3CMJA 4AD2A 3UERA 1CXEA 4PSRA 3ZT5A 1UKOA 3MS8A 5EFFA 3A6OA 3CH9A 3WF1A 3LXBA 3WN6A 4LYQA 2J77A 4UQ9A 1KBKA 1BYBA 3IJ8A 1U2YA 2VX4A 2YFOA 3VGBA 1EDGA 4HP5A 1Q6DA 4CD5A 1SMDA 4GZIA 3LRKA 5LA1A 4NZCA 4CN1A 1KR0A 1VF8A 5KZ6A 4UFLA 2YLLA 5D8ZA 3VKKA 7TAAA 1SFSA 3GNOA 4PMRA 1VEPA 1NOFA 5CGMA 1MXDA 2YBTA 1E6NA 5CJ5A 3LX9A 1AMYA 4M24A 1FP9A 4LQ1A 2UY2A 3OZOA 3WMBA 4D72A 1KWGA 4M82A 3U7VA 1R34A 1C90A 4CGTA 3PZUA 4B9ZA 1B3ZA 2BY3A 1JDDA 3OGRA 2CBUA 4ZXLA 3CZGA 1PZ2A 1B1YA 3BSGA 3W6LA 2ZXDA 1TQVA 2WVVB 3AIQA 4MB5A 4HZ8A 4UFJA 1DWGM 3DYPA 5EMYA 2FH8A 1VBUA 4H7VA 1PBGA 2OSXA 2G8ZA 4XV0A 5A6JA 2E40A 2WW5A 3W25A 4CVWA 1OM0A 1E1FA 1JNEA 1YQ2A 1BG9A 2ZX8A 4K68A 4BQ3A 2CPUA 3WH9A 1CIUA 3BUPA 3GXPA 5GNZA 4MJ2A 2XHYA 5HPOA 4QFUA 2X2JA 4MNJA 5IHRA 4Q7NA 2J78A 3S6TA 1CGYA 3W38A 1DP0A 1WZAA 4YN5A 2MANA 1V03A 1EXPA 1B31A 8A3HA 1GOKA 2YL9A 3OLDA 2J79A 1K9TA 3WY1A 1E0VA 1R8LA 4W85A 2WMIB 4HOXA 1OD8A 3PTQA 1NOWA 3BAIA 1E15A 4NF7A 1LQ0A 3GBDA 1BFNA 2WWDA 5EBAA 1UWSA 1W9VA 3A4AA 2WMIA 1KGXA 1MQQA 1HJUA 1K6AA 1BGAA 1Q4NX 3PZGA 1W3LA 1FFRA 4F66A 3VIHA 4A3HA 1CENA 3UCQA 3VM5A 3VIIA 3WF2A 2OYMA 1ZL1A 1E56A 4D6GA 1J0JA 2DSUA 4D6DA 2EBNA 3AROA 1OCQA 3AQUA 4B9YA 1KTBA 3AXHA 5LA0A 2WANA 3DDFA 2TAAA 3CZEA 3FNDA 4GO8A 3WFZA 2QLYA 2X1IA 1JD9A 3L4ZA 3FHAA 1UR2A 4QLKA 1X6NA 3CUIA 4QP0A 3RILA 3GYCA 3H54A 1UH3A 2PWEA 4W87A 3ZM8A 1H09A 2A3BA
chains in the Genus database with same CATH superfamily
4ZR8A 2GJNA 4DJEC 5F9DC 5C9KA 1VAHA 1EC7A 3H6OA 4HOZA 2AKRA 1JCYA 1PYWB 3PDGA 4GBUA 4PY7A 1O5KA 1YEJL 2GVYA 2JVUA 2CDGA 4X7EC 2QLVB 5F8QC 5K39B 2GEEA 2I16A 1F90L 4KJWC 2YGPA 1CD1B 4XBKA 5SWUA 3LHUA 5IEHB 3IS4A 4MVAA 5FACA 4FQJL 1FYTE 2VXQL 3MRNA 3U0PB 1C29A 1QOXA 3N2TA 2O5YH 1P4LA 5TDNA 1GY2A 1EQPA 4LIQL 4PJCF 4B9IA 3SDDD 1P4BL 3URAA 4RAHA 3H22A 1ICTA 1B54A 4IFOA 1I2RA 2PDYA 3W2LA 4X6EB 3O6FD 3D12B 3MLUH 3Q3GB 5KUMA 2XH0A 4ZO8A 2DQTH 4ZVJA 4RAVB 1KCBA 3D08A 4DTGL 5FM8A 2QNEA 3OLEA 1FWEC 3JXAA 1TUFA 4PRHB 1FXPA 2EADA 1MCQA 1E9LA 4K8EA 1TKWB 4TU1A 2XFXB 2Z93A 5EBWA 2QT3A 2DIJA 4R53A 4ACYA 3WLSA 2IPKB 3J8F7 1JNDA 3G1AA 1R3JB 1NBZB 1TZHB 2AV7A 1BREA 3MRLA 4ZMPA 4PB4A 5F4SA 4D6JA 3I75A 4IKKA 4ZS7L 5FCZA 2XQBH 2Y06H 3EWWA 2VQ1B 5C09E 1G9NC 5DEJA 1OD9A 2CLVB 2KC0A 4X7CC 1SVCP 1H2JA 4IHCA 3CBWA 1PZ0A 1XUUA 3ZVHB 4DQAA 5I5MA 3F1QA 4BQ2A 2HJFB 4K8RH 2N4IA 5TGBA 2WXKA 3F03K 5EOQH 2RCSL 4LOFA 4BUHA 5AKQA 2PGRA 4WWOA 5F7BA 3AM8C 3B5GA 1L9NA 1WZMA 5FJRA 2OTUA 3DHJA 4XZNX 1UZDA 2H32H 1PD6A 2X0SA 1P5UC 3BE7A 4XMKL 1NMBL 2VIRB 2WC3A 5FSDC 5KN5B 4NNBA 4UQAA 1FE8L 2BVYA 1M7DA 3VWJB 5DT1H 2B7PA 1B0RA 1E4XL 2Y7EA 5EO9B 3TVAA 1MCWM 2W9DL 3MCYA 2PYFB 3OZKA 4XT1C 5DHEA 4QRRA 1KTJA 1EO7A 1ZGLM 2Y6SD 4NAQA 3VGGA 2ZVIA 1PEWA 4Q9BA 3HGOA 3WH7A 1PS3A 3ITXA 1T80A 1VGEH 4KK5D 2EVHA 1MQ8A 3TK7A 4PGBA 1AE6H 2G97A 1BLNA 1CGXA 3LNGA 4JFEA 3ZMRA 4XPGH 1X96A 2DFAA 2GOKA 4EX4A 3MCMA 7PTDA 1BVKB 2QPSA 5GZND 2PDFA 3CCHA 1IXNA 3DH7A 1WZ1L 4LVEA 5DD0L 5KETA 4PPTA 1F2XK 3MLTA 3DUSB 2VR4A 3VXPA 4FF9A 5IT2H 3A4XA 3N9KA 4I13B 3NGJA 1JPEA 3RFZA 1T0NA 4FZIA 3W23A 3S8HA 2WLZA 4G1EA 4OQTL 1BXUA 5JO5B 4DT2A 1EJOH 3GNXA 2XG5A 4EPDC 1XYCA 3NM3A 2RIKA 2O6DA 2FEJA 4BY3A 4JQIA 1YYLH 3ZKND 1N59B 5LG6A 3PPHA 2BS8A 4JX4A 1G6VK 3INUH 4GAFB 5HVHC 3LJ3A 1J1PH 2V5JA 5I66A 4OLXL 5D72H 1OLLA 3TW9A 1DBAL 3SPHA 3PF3A 3QHMA 4UILH 5D1QB 1BQHA 4N5UA 4MA8H 3R0NA 2Q6ZA 1IXQA 3KFTA 4G1NA 5ABGA 1TYJA 3N1FC 4XMZA 3ATAA 4PJ9A 4IOIA 4RMBA 4WI0B 3S8WA 3LMJH 4GO6B 3WDQA 2JBMA 4Q89A 1T40A 2J62A 2HH0H 1ZBCA 2BDNL 3B43A 1BZEA 1KIQA 3QNYB 1WWWX 2BOBA 3DXAD 3MMEA 4Z78A 1JZ7A 1M68A 3GSXA 3CNKA 1AZZC 2VDPL 1G7UA 7A3HA 3QFGA 2Q86B 2OMUB 2PCFB 3MHGA 3A12A 3JZUA 1W6LA 3AAZB 1I7TA 1XF5B 5C3TA 5FF6A 5FL0A 1Q7MA 2GQHA 3ROOA 1NEUA 2CLEA 2CLRA 1LO2L 2Y1VA 4GRMB 4JW3A 4JTDA 5I24A 1Q65A 1M9HA 1Z48A 1DE4A 2J4WL 5B8CC 2A1YA 4FS9A 1QOKA 2XFGB 1I8LC 2HSIA 3IBEA 3OPZL 4HHWA 4LSRL 4OGAC 2NSMA 2OR2A 4HU4A 5D05A 4C6JA 1NCHA 3L3KB 2QDDA 2WOBA 2ZAHA 4ZUSB 2E6FA 1L6PA 4TF4A 1KYDA 2TODA 5JOPE 3NK4A 1JCXA 1Q9WB 3MJ9L 3MHUA 1AZNA 1OWRM 5ICYB 1AR1D 1V3LA 4YEFA 2YXOA 3IIPA 1WCBA 1E8ZA 4NI6A 4X6DF 5DGQA 1R7OA 1Y5VA 3NXFA 2JK5B 4D9PA 3HBPA 5KYYA 1P5VA 5LNUA 5K9QG 4ERSH 1JXDA 1Q63A 1W2VA 2GK1A 2X7LB 1G7JA 1OWWA 1UW9A 1PZDA 3TF4A 3QN3A 1O7VA 5CPNA 4FZ8H 4NKIH 3MROB 2ROYA 1IGYB 4PUJA 5K9KA 2WN3A 3FO1B 3LN4A 1MVUA 5D1ZD 3EOAA 4H25B 4HYTB 1M9SA 3GBML 4G42A 4G6ML 2Q9OA 4LL9A 4U6XA 4WHYG 4LF3B 3TFKD 5FWQA 2CITA 4DK6A 1PLAA 1M7UA 3AY2A 2OVLA 3VWKD 4OE7A 3WEXA 1KBIA 3MRGA 2YPVH 4YXLL 1R3SA 1RSFA 1QLEB 1C08B 1KFAL 2VZSA 1DTNA 4FFYL 1AXTL 3KYNB 3ZE0E 5KSVB 4E9WA 4UV7H 1KLGB 1MCCA 2BVOB 3FSZA 2QKIC 3UTOA 1IT0A 2Y36L 4PLKD 1K7EA 1GS8A 1XSJA 3TV3H 1YNPA 4F15B 4B2DD 3ARXA 4XVSH 2O6EA 3BH9B 3L1OL 5K9QI 3L48A 1S7TB 1RCXB 2MCG1 5LJYH 1PPIA 4KRZA 3FKUS 4IRJB 3O3EB 2KDYA 1IV8A 5DRZB 4P3DA 5HYFA 2LLEA 3PWLB 2W62A 3FFDA 1V02E 3EWUA 5GVJA 1CBGA 3KBEA 2VC2B 5A43C 3ZHDA 4B3VA 3BKML 1XPYA 3ATYA 3BGJA 1D3HA 1B4KA 4ECLA 1XC4A 1CXLA 1OFPA 1GZQA 2CHRA 4I90A 4KPLA 1CK0L 4H20H 5DK0A 3N9RA 5H8MA 1HILB 3ZZLA 4R90L 3QIUD 1Z6KA 2YDAA 3GIZH 2MCMA 2HH0L 3G08A 3UYOD 4AC2A 2FYVA 5DQ9A 4MGGA 1X5HA 1BFSA 3WLKX 4U1MB 5IROD 3MP5A 1GJUA 2O7SA 4PJBA 1T1WB 4X5XA 5LN4A 1I9IH 4HU0A 3VOHA 3SKNA 3Q5OA 3KL5A 4XRCB 3ZE0F 5C55A 1OAUL 4DIXA 1ZOXA 1FWXA 4NSBA 4TVUA 4N6FA 4KX9A 4R4BA 3TTOA 2NNCA 2PPCA 1NPJA 2FX8L 3MBWB 4CKQA 5IFHL 2H8PB 2JQXA 2QCDB 3NJJA 3IN0A 4ES8A 4KU1A 5BJTB 2AL1A 5FHAL 5KYXA 5K93A 3S2JA 2DLIA 2V2TA 3ENLA 2NY2C 4M7JL 5HI5C 1PG7W 3V4UL 3WO4C 1ONEA 3AZTA 3GSWB 1HW6A 3WE6B 5HD8C 2K4AA 1E6OH 4PCPA 3ETSA 1IR1A 2J74A 2QQLH 1U0QA 4HLEA 4XHJD 2MHAA 2C3WA 4MG4A 1K03A 1WK0A 3FTGA 2V2XB 2JKSA 1CG9A 2OCJA 3FO0H 1Z69A 4HWEL 5GRJH 3RAJL 1A7NL 3MFFB 1O12A 2ZCGA 3GR4A 2QCHA 1GPWA 4D2JA 4KZCA 3N2CA 4AMKH 3WSQL 3ZR6A 4NZ4A 3S96B 3UZYA 3IETB 3W07A 4DP9X 4EOWL 3LHYA 2WVVA 2BERA 4JMNA 4JZOB 1HQRB 4DPCX 4LRIA 3W9DB 3GSOA 2BS71 2ZOKB 1FWRA 4Q8NA 2K6YA 3I84A 2AXWA 2HEJA 2WLLA 1MSPA 3WFCH 4G6MH 3BD5A 4NX5A 3GTVA 4JY5L 3CU2A 4PMXA 2JWYA 4Y7OC 3LHTA 2ADGA 2YD3A 4PJ7B 5DBUA 2BWGA 2GJZB 4Y2LA 4J4PD 4EKJA 3CMOH 3DX3A 5F1IA 3BLDA 3OJVC 3OJGA 1XRFA 2Y6SC 4EZMA 3UDWC 1XGYL 1MJ7L 1UM6H 2HTKC 4Z2LA 2DZTA 3RJOA 2WQUA 2ZC1A 5DD5H 3KRSA 3MBEC 2YD4A 1BX2A 2G3MA 3DX9B 3NJNA 4GW1B 5FJUA 3QJFA 2GC4C 2WVSA 2YUZA 3FDWA 4PY7B 4U3SB 1A3ZA 1TR1A 4MA3A 4NUGL 1I2PA 2WMHA 4N2CA 3I6RA 4F0KA 4PJCE 3ARFB 1UQZA 4K94C 1G6RH 1UXSA 4PTWA 43CAA 4ODUA 4RWYH 4NNAA 2DJUA 5J9PB 4NQCE 5FSEC 3G6LA 2EC9T 4QJ4B 1VHCA 3K13A 5DJCB 5A40E 2ERJC 2QJIA 2C9SA 2GGJA 2E6AA 5KUKA 3W1LA 1QFHA 1FVCA 3KYMB 3MV9D 4NZ8A 2CKSA 1FYTA 4RAUB 1X5XA 2IAMD 3NEOA 4JDEA 3LEXA 3PU7A 1MUWA 4H4IA 3VIFA 5I77A 2WM1A 4NNPL 2ZRVA 2JFCA 3MJ7A 4FQJH 4NJIA 5JXAH 2IFGA 4TNVK 2L0DA 3GLAA 3SFKA 2IS7A 2Y0FA 3G1DA 3V5FA 4MMXB 2HWGA 2EC9U 3CAVA 3WKQA 4EI5D 3MBED 3ZL4H 1QBLH 2Z93B 5EBWB 4JTJA 3M17A 4B16A 2V5YA 5T26A 2FWUA 1FC1A 3UWVA 1YY9C 3X3FH 2DQTL 1DL7L 4PLNC 4G8GA 3LB6C 3VFNA 4MJ5B 2CBQA 5J3HD 5AZUA 3S34H 1EJSC 2VO8A 3UTTD 2DT0A 4CCZA 4NP7A 4M6OH 3K7UA 2A7PA 4E5XA 3ZTNL 1RZGA 3ZIMA 3BJFA 5FDWB 4XCEB 2X6MA 1K4CA 3GFUA 1EJUC 4A2LA 4WI5A 4W7WA 1XWVA 1ZP3A 1N6UA 4FQXB 4G43B 4NQ1A 4GMSL 4U6YA 5IQ9B 1NFIB 1PZSA 1YNKL 3ATDA 1UPMB 4KJQC 1QAPA 3O6FA 3LKSA 4EEEA 1RAKA 5LLIC 4ZI8A 3D7PA 3T0CA 2AC0A 2CLPA 4JHAL 5HR7A 3WJXA 3R2GA 9XIAA 4Y5XA 5EO9A 1IC7L 1E6JL 2IH3A 3N04A 4Z7UF 3SO3C 1XKYA 4NQDD 1S2UA 4PBGA 4QRNA 4TQIA 2OZ4L 5KS9E 3WH5A 1E42A 4LFHD 2PAJA 5CGQA 3FUIA 2PR4L 1S3KL 4F2ME 5A6BA 1R9XA 4OAWB 2DQUH 3HZVB 3DGGB 4YDVA 1AZUA 1R0AH 1T03L 1S4IA 1EAPB 4PVNA 5F88B 2DICA 1MRCH 4NQEB 4WWKC 1E4WH 2XWRA 4TX8A 3L7FA 4XP4H 2WCGA 3N18A 1YEHH 2BINA 1LO5A 2QFPA 3EJUA 3PGDB 5F3HB 3V6FA 2JJTA 1OX4B 1H0IA 3QDHA 1RD6A 1RHFA 5I73C 1ZLDA 2RR3A 4P46B 1FH5L 1NWPA 4FYQA 2Q8XA 3ISRA 1EEQA 4JCWA 3I7SA 2FNWA 1NFDE 5HYSG 3DPBA 3FEQA 1PCXA 1R19A 3PQYA 3H1ZA 1P5UB 4HJTA 2Z31B 3FTWA 4IBLT 2VEFA 3EZ4A 2XFYA 3KOZA 3P5ZA 4LVHB 4GCAA 1A6WH 2JEQA 3H9SE 2IQAA 1EDYA 3DO4A 3QPKA 2EO7A 1VIWA 4JFED 4QCIA 4HKXB 3FK4A 4HS8H 3M1BA 2PD9A 4PJCA 2G96A 4Z3FA 4HZ7A 1OGAB 3O41B 1T6BX 5FGSA 5FEBA 2PXYC 3GTNA 5FYKL 4OUEA 3NQ8A 1QLRB 2DQCL 4DP4X 1I9CB 2PTUA 2V17L 1OEZW 4XBGB 4M81A 2FIKA 5E51A 4TSCL 5KJRH 4GYFA 4YOKA 1C7TA 5AHMA 1UJ3C 4IBQA 2WKGA 2X38A 1BWWA 4HWZB 5I75B 3FB6A 1UFGA 1E27A 1U3YA 3JYBA 4XBSA 3M5VA 1HAUA 5ECVA 4AM0A 4D8PA 3PN8A 3JUZA 4H5SA 4AAJA 3K2GA 3PB0A 5K9JH 4BCEA 2FGLA 4NRSA 2JGYA 4MUZA 2WBGA 3NVTA 2A99A 2JXMB 3U46A 5EDSA 3X1FA 5FEWA 5FO9B 3ETBJ 2VEMA 5K7JA 4PJ6A 2EDEA 5AHEA 1YYCA 3JT0A 1JBJA 4Z08A 3TNBA 5MHBA 1JWMA 4HD5A 3RX3A 1MRFL 1CI1A 4PRDA 4KQNA 1NCNA 3WNLA 1SXNA 5CSGA 1M5WA 3G5EA 5AN7A 1JNLH 1THFD 3VXSE 1II4E 3P1VA 1KF9B 3KDOA 4Z7VF 3PJWA 2BGNE 5I7GA 3QUXC 4OY9A 1CFQA 4NQCB 1H51A 1U91B 1UACL 5FPIA 2QUVA 2X6VA 4JEJA 1S78D 4ZFQA 4M6NL 3OZMA 4N4PA 2IPJA 4C4KO 3BPLB 5I76A 1XIMA 2V8MA 3B3BA 5K59F 1CYGA 2FTPA 1EYWA 1CURA 1XPGA 3AU1B 3T71A 1M71A 4OFKA 1YTDA 3SM0A 3DG7A 5AKTA 2BNJA 2YFNA 2FLIA 4Y16B 2VD8A 4RZ6A 3GHBH 4H26A 3CVHH 4MQTB 3ATEA 4WW2C 1UQSA 2IOIA 1BFVH 4HC1H 3NFUA 4JY9A 3C75A 1KCVH 4TNEA 4QDPA 2J7FA 2YAFA 5E5UB 4PR4A 1KN2L 2EDFA 1C16B 3HZYA 2NYKA 4AT6A 5EOCL 1V3JA 3CUHA 5BXSA 1LP9F 1KCSL 3HPLA 4NERA 1NDMA 5DZAA 1HXJA 4OZGA 4R7VA 4NZ3A 3WQGA 2AKZA 2J1XA 4A55A 4CC4C 3U5UA 1ETZA 4LVBA 4GP5B 2F74B 3CDGA 4JE4B 5DJXB 5MHSE 1NAKH 4XC3L 3K0YA 1WG3A 3DK2A 2GITB 1J9YA 4PFHA 2EH8H 3RBSA 4WQOA 1XIBA 3M4HA 1B57A 4Z7VA 4WKFA 3BKJL 5DCEA 5HYEA 2O93L 3SUWA 4I4WB 3TN3A 3ZLGA 2OCCB 3BT2H 4W84A 3SJ3A 4BJLA 5EU4B 3SGDI 2CHWA 1FVPA 4JO8A 1TQCB 3D0VA 4XMVA 3U2JA 1D2KA 5F0PB 1YJDC 1A53A 1NPNA 1DIOA 1KTLA 4YHEA 2VD9A 3V36A 1U1JA 3NMEA 1QBMH 1QLFA 4JREC 3OXRA 3L95A 2E6QA 1N3NA 3A4DA 3M1OA 4Z76B 5ISZB 5IJKA 1ORQA 3DETD 4AJ0A 4K3EL 2EVFA 4JGJA 1TPH1 2EDRA 5M5DA 3TNMA 1LYQA 5J0BA 3MLTB 1A6ZA 2V5MA 2EEFA 4UZGA 1FX6A 5C7HA 3RQ3A 4NT6B 1GZHC 3W2DL 2OELA 3BDYL 3NZ8A 2H2SC 1XI3A 1TJRA 3SN1A 1XYAA 4BK9A 4AFYA 4H8QA 3GZKA 5CJXC 1XWYA 3EJZC 1YTKA 4OM1L 5D1XC 5EZJB 4YHZH 4BGDA 2OYKA 5IOPA 3KCPA 1QUNB 4HKBA 1V6WA 4YPGB 1E4MM 2G0WA 2AQ1A 5E9DB 1AO7E 3UESA 5HOSA 2ZFAA 2IPKA 2HAZA 2PA6A 5J3HC 1ZTMA 4G6FD 3VXSD 1DWJM 5B7YA 3A4WA 3DX1A 5IROA 4D2NA 1OFBA 4H8PA 4WW1A 3V79C 3MFFA 2XVPA 4K7PH 3PDOB 1H3PL 1J8HB 2YN3A 3PSWA 4I18C 4OZ4B 3X3GH 1QVBA 4UTWC 1WB0A 3QHOA 3GIPA 3S6DA 3BLKA 3BQVA 2PF8A 1TQCC 2ZRYA 2J73A 4UTAA 5D4JA 4CGUB 2BSCA 2ZOKA 1JVLA 3U0TB 4Z8FH 4BUGA 3LCGA 1NGPL 4KRPD 5AAMA 5LIYX 3RK8A 3FT1A 4BFKA 3W28A 1QVOB 3RP1A 4FLRA 1IAOA 5IUCA 1JIBA 1WITA 1S7VA 3MLZL 1DBJL 1T66D 4X2RA 1ZPTA 2ZUVA 5J1AB 4NZJA 4TSBL 4KKAD 3WKNA 2PDNA 4X6FA 1SXAA 5F7LB 3REWB 1J48A 4PWFA 1OFEA 3VCCA 1Q5MA 1T41A 3WQ8A 2PN5A 4OB5H 1N70A 1YPZA 3E5BA 4YHKL 4MKMA 1D5ZA 3NCXA 2PWUA 3C6CA 2CZ5A 2NSXA 4NFBA 1JCNA 2X2IA 3L5JA 4L4VA 3RKPA 1A5OC 1TTPA 1V6VA 2TRSA 2KKQA 4KOCA 4OIBA 3U9PH 1TMHA 3OAZK 4HEPA 4CCDA 1QFPA 5E6IC 5DHMC 3DV4A 4NNXB 2QPFA 1J87A 2B7QA 3CC1A 3DSNB 4F8NA 5A6LA 2PYEA 3D2TA 4Y5YA 3LHVA 3T4CA 3CN1A 3DFHA 2AFNA 7ODCA 3N1AA 3RY6A 3RRQA 4PJ7E 2Z1WA 2W5PA 2DQXA 3M46A 5D8JH 2R69A 3NRQA 2AOSA 4XNQB 4QTIH 1EWDA 4KKQA 4BWWA 3T6WA 4OOUA 5B3JE 2FRGP 3S7GA 4AK1A 5KSVA 3QRHA 1HHHA 1DJYA 2WJ5A 4IM8A 4MJ5A 3QH3A 5E6SB 2ZYSA 1ID5I 3RGVA 5L6YL 3V1PA 1KCLA 4KCUA 3TBSB 4BFJA 3AYVA 1NELA 3R25A 2YEZA 4QT5A 3QG6A 4N2OA 3FA3A 1ZP4A 3QZPA 4D3CH 2R2CA 4XCNB 4WFGE 4N0FA 3D33A 4QR6A 25C8H 1U1HA 5T3ZE 1XYZA 2IAMA 4XPHL 1R46A 3FFDB 3QHTC 4AKPA 4XUGA 5CJQL 1J5HA 2V7NB 3LH9A 5DD6A 3TT1L 2R0ZH 5BZDA 1QT1A 2HVNA 5ALCH 2XX0A 3OZYA 5LWYL 2BY2A 3APYA 3S88L 2Z7KA 5XIAA 5I0DA 3URNA 4EI5A 1X5MA 3BWSA 4OTXH 5SV4A 5D2LE 1KN4L 3QPQD 1V7MH 3WFBL 1T99A 1TYGA 2A74B 4WXYA 4KH9A 3LERA 3A67H 4Z7IA 1MAMH 1L9PA 1SXSA 3LIZL 4DVOA 5ICYA 1NAMB 4YGVB 4GJ1A 3G5YB 4KJPD 3RO8A 5D02A 3HZVA 4U6VL 2YC1A 2NY1C 2F18A 4FDWA 2CM5A 2R7EA 2PLTA 4UT7L 2XSKA 4D0BA 3WF4A 4F2BA 4G7YL 2BOLA 1OPGL 2G5BA 2YD8A 3DIDA 4FLQA 1MXGA 1VZHA 3HNVL 2WZPA 4IU2B 2OW7A 2QSVA 3BN9C 2XN9E 1CGSL 1Z5LB 4D9QE 4MWAD 3UR2A 4ADUA 3G5ZB 5D7IE 3B37A 3MNDA 1QSEE 2A3AA 1E4JA 5K9KB 1D7FA 4M80A 2JI3A 3EF7A 4MZ3A 4NQSB 5I6XB 2WXQA 3SN4A 4Z2GA 3WIFA 1IGIH 2C1OB 3CSYA 4LU5H 5K2ZA 1HQ4A 1RLBA 3RWEB 4KTEH 5IMKB 4PMZA 4WD0A 1CICB 4NCDA 2ATSA 4Z7UE 2YGQA 4IDJH 4WO4C 3UC0L 4I48A 3CBJB 5JUEL 1JPGA 1FNEA 3OM3B 4JPVL 1RUSA 3MDUA 1N4XH 1C8PA 1BBDL 4H2CA 4LVNB 1J9SA 4GXVH 4YHLH 5EC1A 4TTDD 3UIZA 4BFBD 4IGBD 1WIPA 2E76C 2EE3A 4JKNA 4WSJA 3A13A 3ARSA 3KBWA 1XLFA 2Z0IA 4S2BA 3FRPG 2GSGA 3MLXL 4RZ4A 1LQBC 1OVZA 3VWJA 4NB7A 4S1DD 4MDPA 3B1UA 4PD4K 1UD8A 4K5PA 1T0PB 4IOFC 1QR7A 2QJGA 4GA8A 3IWVA 3HVDA 4Y9NA 4K71C 5INDB 1RZJH 2VLMD 3QJAA 3N11A 3CAQA 3VD9A 2CXGA 3FB6B 3MX0B 2AJVH 4LH8A 4RJEA 1EFXB 1XTLA 1NA8A 4BWTA 4CL7A 5CLTA 1PWMA 1FZJA 3VFTA 2MPVA 3O6LL 3VXPB 1NTHA 1XM3A 2CEQA 4PB3A 5G1YA 1T4WA 1ZHLA 3EYOB 1U8HB 3OX8B 2YCLB 1UT9A 3H9HA 4MB4A 5MERB 4G1EB 3PP3H 4IGBC 1OK6A 2YD7A 43C9B 5CUSH 1YXYA 4JKMA 1N0XH 2J72A 7REQA 4LNCA 1EGZA 4U1MA 1I8MB 4MAYA 1WH0A 4XCCH 3VI4A 3WCYA 4MA3B 4NNYA 4ZFZB 3GVRA 4QS6A 1YQVH 2IAND 1TA3B 4L9ZA 5A2IH 4WK9A 4G6JH 1OM3L 2DEWX 2FEEI 4WNJA 5KYWB 4H19A 3FTSA 1J6PA 3CVBA 5GGTL 3QLDA 4NJJA 2CRYA 3HRZB 1EIBA 1IIIA 4JGMA 5DFVC 1O7SA 2OXNA 1UB5A 5E56A 2AGKA 3A5FA 1KSRA 2QHAA 1T5WB 4MSWA 1FO0L 1X7IA 4LVGA 1SLWA 1T6VN 3QO0B 1G7VA 3ZLFA 4V27A 4DZBB 3VD4A 1YRKA 2NY4D 1NC4D 1A5BA 4AEEA 4WIWA 4WNSA 4OW6A 2DW6A 4RMVA 1MFUA 5SX4H 3TWCL 4B5NA 2PDGA 3EJYD 4MBOA 3ARVA 5A6IA 1CUOA 1FFNB 3B9OA 3O0FA 3MI3A 3OG3A 4N2KA 1BVZA 3EWDA 1MREH 4QOKD 4P59H 4WHTA 3Q13A 1DE5A 1QQDB 2BXYA 1U95A 3LNIA 3Q8AA 5RUBA 1MW1A 4RISL 3WTTA 2V30A 4QJ1A 1XLEA 5EEYA 4Y9GA 4EIVA 4IZGA 4O53A 3CX5J 2CRMA 4MQXC 4G7YH 1UUOA 3U30B 1LO0H 3GY1A 2IANB 3OKDB 4FQ1H 1AD0B 1Y7VA 4YK4B 1U22A 3HI6L 1S9XB 2DH2A 4LNRB 1JF1B 4N3UA 3SD5A 2CR6A 4JEQA 3TJLA 2QPUA 1U3HA 2AKMA 4U4MA 5JBDA 1H7RA 5BO1L 4Z0BL 3HBQA 1ZS8B 1MCSA 3D4YA 3ITOA 1Z42A 3NPUA 3OMAB 1RU9L 4ZA0A 5GRZA 1T22A 1NCCH 2YARA 4JFTA 3W9EB 3RMJA 2J55A 4L9LB 3VXMA 4OKDA 4TTUA 3Q1SH 1OCNA 4Z7VB 1LNUB 4K5NA 4LB3A 4AB4A 2E6PA 1NOLA 1DXIA 1CICD 1MMFA 5EF0A 4U2ZA 5C7XH 1AXTH 2NNRA 4AHOA 3EO1B 3UZZA 2R1KA 5L2KE 3CZJA 1NAKL 4XC3H 1LO3H 2Z3FA 3MXWH 4Z5RB 4OCRH 1TTJA 1W31A 3O6DA 3EO9L 3M0YA 2YB1A 1LF1A 1QNRA 5CAHA 1BCIA 1VFUA 4S3FA 3SJVE 2IKJA 1ORQB 5C54A 1B9ZA 2C1PA 1T7VA 5I6OA 4C83B 3UPRB 4YBQD 2UY7A 1GT8A 1VC4A 1GKEA 2H47C 1UMYA 4LRIC 4G8EB 2B0SL 4HBQA 5DJ2A 4CC1A 1YXCA 2WC4A 3THMH 3S5LG 4J5NA 3DRTA 4Y88A 1UJ3B 5C8JA 1AGCA 1Z5HA 1W1TA 3RY4A 3AOFA 4ZTYA 1NFGA 5GS3A 4U7KA 4UUJA 2J6WA 4AYBA 5IEKB 4ML4A 4BJHA 5E0QA 1T20A 3O6LH 4O4YL 5AOUA 1OAZL 3CFDA 4UNUA 1DXFA 1D2OA 3LSOA 2Z2BA 3U8GA 2NY2B 4JQIL 2DQWA 1IGCL 1SGKA 1GXEA 1N10A 4XMUA 3W2DH 1ZCOA 1RXLA 5EDXA 1DYSA 3GTIA 5G4EA 3D52A 4NL1A 2YD1A 2BZDA 3IJLA 2WB7A 3ZKXB 1HT6A 2ISFA 5LXXA 4P4KB 2OA9A 1NF0A 1J0HA 1TIWA 1VPYA 1YMME 1OF8A 3P60A 6PTDA 3QDJA 4HK3N 5T1LD 3GI9H 2EINB 3I6TA 3V0SA 3ETBF 5A6BD 2UBPC 3C08L 4XXDB 4P8WA 4HAGA 4GACA 3COOA 4IEFB 3MUIA 3BQUB 3GBMH 4FQXC 4F7TB 2UY3A 1R3IL 3JVGA 5L7XL 2OGYA 5EMUA 5JPNC 4TM9A 1QPNA 5EEWA 4NHCH 3CV1A 1J1XH 1BJ1J 4K3DH 4KUZL 3ZYJA 5JQHC 4YL2A 3REQB 1FZOA 3NCJH 1PKLA 3M0IA 5CAYB 3UTZA 2AANA 3C6SA 4FQQB 3WS3B 1ISXA 4EXAA 2EXTA 1KFAH 2NY6D 5EIIA 1F42A 2BH0A 2X4QA 4XWGL 3NQ6A 3P81A 5D2YA 1EAQA 1E1EA 2DV0A 2D7QA 3W7GA 4JRYD 3RTQC 3H3BC 5HVGB 3OJ2C 1OC5A 4OHQA 1RKRA 5DTFA 2DVXA 4Y1AB 3SCSA 7TIMA 5F3BA 1A7RL 3IJYA 1W72L 1HFBA 4DBUA 4P4KD 4F9JA 1B3XA 5F9JA 1AW1A 1XIGA 4YDIH 1JGUH 1HKLL 4IJ3B 3V6OC 3KWXA 3GSWA 1DIDA 1QWUA 4O9HL 4PP1D 4YXHH 1R9FA 3UVAA 4Q8QA 5C3IA 3WUGA 3DHUA 3P0VH 4ZO6A 2CALA 4M8RA 4P7RA 2MHAB 2WNNA 3SGKA 2F7QA 4NDMB 3N06B 3QKEA 3L7FB 1FBIL 4ZX5A 5LNDA 1EEUA 1G6CA 1HI6A 1YEKH 2E9MA 4B7LA 3BSMA 1XIIA 1P9MC 1XGRA 5I1HH 1OB1A 1TIMA 1PBYA 4A2RA 3O2WH 5JW4R 6XIMA 1SXBA 1BQ5A 1JYNA 4LALA 3URBA 1JL8A 4W9FC 1UOVA 4LVAA 1LLAA 1LROA 1BQSA 5E1HB 5DY2A 1S7RA 4LSUL 1MCRA 1K1DA 1A8ZA 2VH5L 3JV6B 3Q01A 1EGMA 4PJEA 1IR2A 1H11A 3TPUB 1BV8A 5GGSY 3W9DA 3X13B 1OYAA 3IGHX 2F19L 1VFFA 2J7DA 2QIIA 2H2PD 3F7KA 5C0IA 1U33A 3KDPB 3E49A 4OZHF 2BP8B 3N3MA 2QSCH 4QCIB 1CT5A 3T2NH 5CC5A 2VIRA 1KIPA 4XNMA 3NDYE 3C09C 4HIBA 5I1LB 4AV0A 3C60B 1HJSA 3VW3L 1V7ML 2TRHA 1XG3A 3D2UA 1OSPH 1NGXB 3LVTA 4M1DL 3MYPA 2OP4H 3VFGL 2W0FA 2HRWA 4NC1C 2PYED 4OZGB 1MYRA 4L9YA 1CBJA 2P5WE 3UGUA 1E4KC 5AB2A 1Y0LB 3LNHA 2YLHA 4W9DC 4Z3GA 3CN0A 5FFLA 3ZKMD 2YZRA 4GD0A 3YPIA 2NXYD 2NY3D 2B1AL 4LY4A 1DQLL 1YUHB 4XNXH 4JDZA 2ZUMA 2A73B 2F08A 3FQ1A 4HUKB 1Q6GA 4L3CB 3FSVA 4LQFH 4Y4FC 1XQLA 2X1UA 2ZDRA 5DDHB 4AWSA 4WK0B 4HCRL 1RPUA 1P1XA 4JX5A 4KEVA 1Q3NA 4PTDA 4B5VA 1FVCB 2QADC 2XG5B 3ARGB 1E6RA 5BOFA 3ZQWA 2WD0A 2KERA 3RWCB 4KJYA 1G6RA 1G1YA 4JQXA 4KGLA 2A4CA 3L95B 4FTVE 1JPFB 4L5FL 4OM0H 5SWSA 3SDYH 4IMKC 4MXWL 4D9RD 4NZUL 3ULVF 2PXYA 4OZFG 3CUJA 2CWXA 1KGUA 7PCYA 5MENE 4DETA 4S1QH 4XN9A 1LEIA 1A6ZB 2G30A 1GZGA 3N42B 1JQXA 3C2OA 3C2AH 4AF0A 2XPGB 2NPLX 1X38A 2POTA 2BIOA 3PWNA 2B0MA 5KVGH 4LEOB 4OJYA 2SFPA 3PHAA 4QM1A 2HJLB 3UBXA 1U42A 3TR9A 2VDRH 3NA9H 4Z0XA 2NY6B 3RDTA 1W32A 3K2UH 4UZSA 1BFTA 1QEWB 5DQDH 5J13C 1MZRA 2J7GA 3CUPA 3M8OH 1FH8A 1FQ0A 1XGQA 1J1PL 3GMMB 3OV6A 1DQQB 2WO4A 2YUVA 3L3DA 2Q87A 1XYBA 4ZXBD 4OZHA 1K4CB 3EOUA 4ZL1A 4KFPA 3SAZA 2C4FU 4AIEA 4NILA 1SR9A 4QHUA 3CBKB 5IQLA 2Y8VA 3V4VL 5AVHA 4YEEA 3S5LA 3B2VH 5AAWC 3K4WA 3W29A 2Y7LA 2XPYA 3BP6B 1OQOA 2X4OB 3E6HB 2ILLA 1JNHB 2IG2L 5DHVH 5EYWA 3S97C 3UPWA 3Q7JA 4OD3H 3RURA 3KOWA 1TPXB 4R26H 2WZPD 1JNNL 2FGWL 3F4DA 2K3TA 2JTDA 4XN4A 5EU5A 3TVMB 3B8DA 3ZL4L 4F15C 1I75A 1WS7A 3K6NA 3EXTA 3RKDC 1ZCCA 4L8BA 3THDA 2OXHB 9CGTA 3L6FA 5HDOA 4GSXA 4X6DE 4C4BA 4Z7NB 2NQCA 3W11D 1OGGA 2H1LM 3HW7A 1UEYA 1KLZA 3VWKB 4M5ZH 3SOBL 5BWFA 4ZQOA 4RSYA 1ZD6A 1A6WL 4XH2A 1L0YA 4R6UA 4RDBA 1ZANL 1K77A 1NFBA 5SX5K 4FXSA 1SF5A 1P4IL 2HT3C 3TOYA 4NP4L 3CHRA 2XGBA 1BYDA 3A4FA 2AK4A 4KDWA 5AEAA 5AYBA 1D5ZB 3ANYA 4BH8A 5GS1A 5F96H 1XBZA 2ICSA 3UG8A 2WGXA 2YSWA 4QRBA 2I27N 3DJTA 1WBYB 2NTFB 4A2MA 2ZZ7A 2C5DC 5AQ0A 1L9MA 3OG6B 4QAWA 2ED9A 2A6DA 4GW5A 4Y1TA 1UD2A 3R8BB 1V6YA 4AOFA 3KPQA 4FKHA 3IMBA 3P40A 1TTUA 1AG1O 1KTKE 2X4PB 4JE0A 2LU5A 5EU6B 3RFRA 2XXMB 3KHQA 3VX0A 5JIDA 3TBTB 3T0TA 3RYSA 1JZ4A 4N2AA 3FU5A 1E4XI 4AV4A 1J8RA 5AZ1A 1U58A 1AFVL 5CD5C 4R83A 1NLDH 5GGTH 2PEVA 1QAWA 1ASPA 5I18H 2LVEA 3NP3A 1MJ8L 3V6OE 4LSQH 1UP3A 2D23A 3BGGA 2V6AA 4F3FB 2IOMA 2YL8A 2E7MA 2V9TA 2DMBA 12E8L 1RURH 1BF6A 5AZ2H 5E8PB 1FUYA 5C2UB 3J27A 4JBSA 1MEWA 3S3SA 4XP4L 1MNSA 2QV4A 4MAYD 2QYGA 4HK6A 5AALA 4DLMA 4U1KB 2IANA 2GSIA 3OKDA 3G6MA 4IKIA 2ITFA 1YECL 2CBIA 2X9ZA 4PBWD 5E9DD 1QEXA 4H8NA 3FUMA 1IT7A 1U3HB 5ESAA 3KVPA 2P52A 1RFDL 3HBZA 2FT7A 1BYOA 1RSCA 5AB0A 4TLKA 1ICPA 4G6AC 1E51A 2IIJA 4H9UA 1R3LB 5K69A 1OEPA 3IIZA 4IRZL 3HRZC 1NDZA 1IAOB 1K9DA 3PUCA 3M41A 3BIKB 5F2LA 2RCSH 1LNUA 2AQWA 4KROD 4R4BB 3UC2A 5A69A 4MMYB 4WKHA 3OJDB 3ZE2E 2V2WA 1XIHA 4Q9QH 1KCVL 1CFQB 4X6CF 2SEBB 4WJ5A 3F6JA 4AEHH 1I9RL 2I60H 2WLKA 4RGMB 5B39B 4XBMA 3KZPA 5DLCA 4FQIL 3UBXI 1G67A 5IMLA 4I18A 4Z7NE 2Z1PA 4DOHE 1HJQA 5L9DL 3QCUH 1WXZA 5EIVA 3GKFA 5I15H 1V6UA 4B53A 4H4NA 5LQBH 4FNLL 5I1IH 4M5TA 1RHCA 3DMMD 1U3HD 4YTQA 3T3PE 4OKVB 2H9AB 3CIWA 5B4MC 5M03A 4ZRGA 1QNZH 3PP3K 1MN4A 1AH1A 4JIPA 4D8ZA 1RCYA 3RFAA 5DS8B 3W3OA 1FVEA 3WIFB 1HKJA 4Q33A 2A6JB 4FEZA 2PTTA 3IRCA 2YDSA 1CDYA 4XISA 5AZ0A 2WIMA 4JB9L 1CICA 5DLLA 1ZLSH 4MRCA 4XNQA 3KWSA 2GJRA 5I3FA 3CHOA 3T4AA 4L8CA 3I85A 2EIZA 1S2AA 4N0UA 1T1ZB 5KG9B 5LHFA 2E5DA 4AZ7A 1MJ7H 3HIZA 5DRXB 1BGXH 2J56A 4I0CC 2ABBA 4GFTB 3CQFA 4GYPC 2D2JA 2ENJA 3OTTA 3TO2B 3NDOA 3WLMA 1NEZA 3HV8A 3ARWA 4ZPTB 1RIHL 3UO1H 1TJ1A 3F5JA 4M6NH 3GWJA 3QULA 3NM1A 1ESOA 3GM8A 3SDAD 1TOXA 3TJPA 4X2UA 2PP8A 4F9LC 4XZBA 4OT1H 3VKDA 3LKNB 3D0VB 4NSKA 3T4YA 3TLRA 4DWSB 5KBDA 4I2XB 5HDWA 3HUJE 2ANUA 2V0TA 2YL5A 3CV2A 3E0WA 4JNXA 2FPVA 4FXKC 1N3NB 1JTTA 1OANA 5EO0B 4G70B 5FUCE 4TQPA 2WMPA 1MY5A 4LCCB 4YLCA 4Y4FD 3HUJF 5LN8A 3C2YA 3HE6D 3SIMA 1PS9A 3VRLE 4PZVA 3DWTA 4EI5B 1HXYB 1KRBC 5SWQB 3TJEL 1L7IH 1CXHA 3UFYA 5DTFB 5IDIA 4HHAB 3KWVA 5JNYA 3BDKA 3H7UA 1SVZA 4KH2A 5TE6L 4HDIB 5EBMB 1XR8B 4MAYB 4XZ9A 2F9BT 3LKRA 4L2YA 4D7BA 3W1MA 5EZJA 1UC5A 4FNQA 5E4EB 3T5WA 1EWEA 3GR8A 1ZNNA 3V18A 1BVLA 5G5DB 2R7EB 1IIGA 2MTPA 4ZD3L 4ZMLA 3M7OA 1ISZA 1DVFA 4IG2B 2H9GB 2NQ9A 1SY6L 3U5YA 2E77A 1CU4H 4GIYA 4G8TA 2R0WH 3FTYA 1GTNA 2NMSA 2H6PB 3O8XB 4OLZL 5T3ZH 2XUCA 3EXJA 1LE9B 1BQLH 3QGAC 1BEYL 1FNGB 2HLFD 5FYKD 3ITVA 1CT8B 2VOMA 1BZ7B 4DGYL 4XD3A 3FQNA 3PDOA 3UYIA 2GCYA 2ZNWA 2J8GA 5AHIA 3H3PL 4GQQA 3SRHA 4HQQH 3RWEA 2APTA 1WS8A 4GKZB 1VP5A 1NMAL 4JRYA 4P07A 2Q3OA 3MUXA 5TNVA 2GK0A 2AV1A 3H6AA 1RH8A 2Z0BA 5JHMA 4L8SB 4U33A 3RWJB 4YHKH 3QVAA 5FGBA 1FNEB 5EU9A 5EMMA 2K9UA 1K3IA 5F44A 3X3FL 2X87A 5HJXA 3B0VC 2B3RA 4PG2C 2F2HA 1N2RB 1E4LA 3TIDA 3DOPA 5F6HJ 2DKSA 4C4KT 2DDQL 1NFPA 2V2CA 1BVWA 4M6OL 3WEMA 1H9VA 1CFBA 3EH2A 2W38A 4I9WD 4WHYH 2DYPD 5ALBH 5KAQF 4KNQA 2GFBA 1OCJA 4ZQTA 3FSWA 5TDOA 1BP3B 4X6FB 3ZTJG 3GJFB 1LCOA 4TS6A 4X63A 4G8FB 1O9WA 1ZTXE 1ICQA 3DX8A 3MZ2A 5INDA 2HX7A 4Y9AA 4UM9B 3OIXA 3GXIA 3NJ3A 4ZK8A 4ONVA 5E4EC 5GRVK 1UYQA 3BMWA 1L0XA 3LRGA 3KPRE 4PTUB 4ZS7H 3MLPA 1EFXA 2PLCA 5JIKA 5AVRB 3APDA 2IDQA 4LLVB 2EP6A 3GLDA 5AVQB 4HJJL 4FOJA 1XD1A 3TMLA 2JKRM 1AJ2A 2EEAA 4B5TA 3P0YL 1H1YA 3RL2B 3S6CA 3QFWA 2D3JA 2WJDA 1N0LB 2ADJA 3NNTA 3BGFC 1DIEA 1NWOA 1FG9C 1F56A 1XL6A 2Q8BH 3NFNB 4OLVH 1DO6A 2O4QA 4HXBH 5JR1H 3VIJA 3PFUA 5DRNA 3BO8A 3VO0A 4KKBD 2FX9L 5DVMA 4BK4A 2EG6A 3HJZA 1Y6NR 4JY4B 3KDMB 5HDRA 5KJ7E 1N9PA 4EIGB 3BP7B 4ZFFA 5FWRA 3T0EB 5GS2H 3RX8A 3WY2A 2JIWA 3BIAX 1A21A 1T89A 4LEOA 4F37F 4RNFA 4GY7A 5CBEA 4FFVD 2PUQT 4Y9PA 3QUZD 1F90H 3P4OA 1H49A 3LAFA 1T2QH 4UFKA 3ITLA 5D9OA 1BXXA 3N1MC 3JWDH 3EX6A 1KB9J 1KV3A 3S5ZA 4O02A 3MRFB 2EDNA 4GG6B 2IUZA 3JV4B 1UA6H 1WT5C 3B2XA 3QIWB 5XINA 3EB3A 3PY9A 4IPLA 3CLEL 1JPKA 5F7UA 3PABA 5FA3A 3WN5C 2GWNA 4JN6A 3AU6A 2J7HA 5DJYB 3EWZA 4Y4HB 1KFEA 2NVDA 1XISA 1MWAA 2GIMA 3CTTA 4N2HA 4Y9BA 2NY4B 2OS7A 2V7NA 2BJML 5DD6B 4AD1A 1N6QL 4GB9A 2N59A 2B16A 4LUSA 4O1CA 1G43A 3WHE1 3MLYH 3IGUA 3ABGA 2N7AA 1ZPLA 2HN7B 4FHKA 3US1A 2VRQA 1YKWA 1JF1A 3IJHA 35C8L 2WLIA 4C6QA 4ODHL 1YC7A 2H26B 3NPSC 1V0MA 3IDIA 4NT0A 4J4KA 4Z1BA 4ADJA 5C0CD 3R4RA 3FCSB 5BO0D 3QUZB 1KZYA 5BRZB 2NY5L 1CLXA 5EIIB 2X4UA 3RDTD 3TFBA 6TIMA 1T22B 2NCEA 4Y5VA 4FB7A 2A6KB 4PBVC 1YW1A 1M2VA 5HGGS 1UM5L 4M8QA 3AG4B 1CTNA 5CBIA 5FGCE 3ULVD 4Q6IA 1MDRA 3RCNA 4HS3A 2XJ7A 4ALAH 1I60A 3AWEA 3ZE1B 1I8IB 1M4KA 4NFDA 3G04A 4BE5A 1N5YH 3BLBA 1ZXKA 1KFCA 3Q37A 3PWUB 4KO9A 1SZFA 4Q74A 2L7JA 1JPTH 4N1EA 3K91A 1ACYL 5H35B 1MOEA 3ZGIA 1SO3A 1XEDA 2CUIA 2QGDA 1RUML 3PG2A 3GB7B 3H7BB 1WC7A 1U3HC 2A2QT 2A6DB 3TAKA 3FB7B 4UTKA 1L8NA 2OWCA 2PCPB 2E74C 2B2XL 3QI9A 2DWDB 4IIQA 5DWUH 3MRIA 1IEBA 3P4NA 1BTCA 1V7YA 5LGKA 1YPFA 2W27A 3UR8A 4EDWH 4I1PA 4RMWA 1GOXA 3QXAA 4H88H 4E9SA 1XFBA 2CLLA 2PTXA 2V82A 2X0HA 4MD5B 3CFBB 5CJBA 1KG0B 1U58B 3INOA 5JQ9A 3VD3A 1I7UB 3GMRB 4OZIA 2OLSA 2RJMA 1FLRH 3JBG7 5JORB 1IQDA 4J4PC 5EA0H 1XS2A 3OKEB 5BNXD 5I6LA 5CSYA 1XLGA 4KQ3H 5BZWB 1FV1A 3X13A 4QDGA 2FZDA 2GQ8A 4N0UE 1LBFA 1ILSA 4Z7NF 2E6YA 1G5AA 2GBTA 2HMCA 1RULL 2REQB 5XIMA 3ESPA 3QGKC 4XOAA 3S9DB 4PULA 3NL3A 2J43A 4WK2B 2AK4D 3MZTA 1UB6B 1NICA 2F7RA 4G6CA 1VJIA 4GY1A 1FNSH 2CYGA 2UZIL 2X4SA 4XE0A 2INZA 5AYYA 2NY2D 3APTA 2WHKA 3TC3A 1RUAH 3BJ91 4C58B 5BV7L 1XW8A 2W59A 1W0WB 2M26A 3BPLC 3D25B 5BOZG 4AQLA 1U8CA 5F9WB 2NZIA 2Z31D 3DIPA 4PCNA 3SCNA 1OCZB 1KCSH 1T0MA 4QHLB 1FZOB 4FKEA 3HPXA 4XPBH 4KI1A 1KWKA 3C6SB 3WS3A 1G0DA 1KT2A 1F4XH 1XF1A 2IWFA 2VKWA 4KZ0A 4ZFOA 2DJMA 4YHLL 3DTUB 3MV8E 2J7EA 3W7EA 5A2KH 2AXJA 2RFXB 3T7VA 2XY1A 1ETB1 3JTTB 2A1WH 2CCVA 3Q65A 5EFIB 3QS3A 1E5ZA 1U8PA 3IDMA 1SMAA 1YZZA 3NIFE 5FKAA 1E8WA 2WOQA 4IIZA 4XKMA 4AX6A 4ETQB 1OHZA 1S7QA 3RYMA 2C9QA 3IARA 3QO0A 3SYOA 3VXSB 5D7SH 2CK0L 2RAMA 3WUZA 4Z9KB 2YR1A 3HKFA 3ZQ9A 2Y1AA 4ZSOA 3Q5YA 2ACQA 1RJLA 5KSAB 1L6XA 3FU6A 1W3HA 2B4CL 3LM3A 4AQAB 1QUNA 4IRSD 4PUWA 1GYUA 1AIZA 2A3EA 4WFED 5E9DA 1D5MA 1SJVA 4UOJA 1MI5D 3TROA 3NIGF 3DO3A 1R3HB 2OL3A 3DRQA 3IB4A 3V7MA 2F7FA 1N19A 1IKFH 1A2YA 1KPUB 4JCMA 3Q1SL 4XMPH 5I6KA 2PU1A 2E67A 5JPNB 1G94A 4YIQA 3UTPD 3D6GA 4DBSA 3SJVD 3L21A 1RD5A 5LAXB 3U4KA 1E6ZA 4MY1A 1B2WL 2R83A 4N6RA 5IB5A 4HWUA 1M3UA 2Y3AA 2NLIA 3VABA 3UTSE 1V3KA 3HFMH 2ZCKH 5I5JA 1MFDH 1U21A 1T1ZA 2X9YA 3FT4A 3WIHA 3U2SB 5EEUA 5E0CA 2B1HL 4F5CA 3FU9A 4OZFA 5CP3H 4M4PA 5FLUA 3V6OA 5I16B 1QVOA 3W70A 4WUUE 2A6IB 3GSRB 1Y5XA 3AU2A 4HSNA 4NQUA 4KXAA 4OB5L 2ZKMX 1R2TA 2FPYA 4XNBA 3WUBA 5JIWA 1ZT4B 1TZ7A 3QISA 2W65B 1R24B 3P73B 2DEXX 3HG1A 2EABA 4J28A 3K0WA 3SGKC 1S2EA 4LDEB 4RIRB 2Q3XA 4TPRH 3BXNB 5ICZB 2GHWB 1DWAM 4XUYA 3OKKB 1GS6X 4NJ9H 1YPZB 1KGJA 1SZEA 1FH7A 2C14A 1U8QB 1OK4A 5K33A 2J7CA 1BZDA 3OBAA 1IGTA 1Q8JA 5C0JB 4L4VB 1JERA 3RJQB 1DDHB 4LBRA 2A3TA 1E9OA 3GRWL 3ARGC 3GMQB 4N3TA 4I7UA 3DIVA 4HTBA 5JDSB 2EF9A 3TH4T 1R5IA 4PGCB 5GQBA 2LTQB 3DRTB 1AI1L 1JPST 3BKMH 1DJHA 3ZTDC 1PLBA 4X6EA 4BSWB 5GISL 1T8XA 3ES6B 3W6MA 3WKZA 3PVFA 4LLUA 1JZHA 4LUTA 3GSQB 3NEXA 4WNQB 4IMDA 5IVOA 2OMXA 4R0LA 4NYUA 4YR6B 1R17A 2H9GA 4X8JA 3SDAA 4L6DA 4B5UA 3DNKA 2F54B 1XF0A 1ZTVA 3U9PL 5DR5L 3HVNA 1I8KA 2K9FB 2WP3O 3KBHE 4JR9H 1E2VA 5CEXA 4J9JA 3GC4A 3RUBL 2GJXA 1AZ2A 4G7RB 3UZJA 3R8GA 2DPKA 4PBEA 2Y61A 4KY2A 4Q6XA 1SYSB 3GBNH 4JM0A 4JFSA 4PCKA 4BXSV 3CWOX 3PGFL 2MCPL 1Q72L 3QUHA 3B8VA 4R7NA 3GKWL 4RH4A 2HCZX 3HE6A 4Y4FA 3GMMA 3U36A 2GEQA 3PL6C 1TPDA 2PDXA 3QG6B 3IUIA 5KMYA 4Z3IA 6FABL 3ULAB 2GK0B 4KXZH 3F8UB 3LPWA 3SDDA 1HKLH 4ZGYA 4Z23A 2JCCF 1OTSC 4TLTA 4LVDA 5FO8A 4IMKA 3AM8A 1SJHB 4F20A 4NN5C 4U1JB 4UMGA 1CLKA 3TIDB 3ICJA 1XUZA 1W9BM 3MCLL 4IPJA 1MCWW 4MASA 1MRDL 1OAKL 1MFAL 1XB3A 2DQDH 2PYFA 2R1YA 4WTZA 5I1KH 1OFOA 3BVJA 4JY8A 4MAUH 4OJEH 5F3BB 4GG6F 1IGCH 1MQPA 2XGZA 4MWAB 5CSSA 4YHPB 4HU3A 3B8TA 1TQJA 3F7RA 4YUEH 3FCPA 3EEZA 4XO4A 1PZ3A 4LGXA 4ADGA 2QPDB 3U7WL 4UQ3A 1EJ7L 4FG2A 4AXWA 4BQ9A 3D0AA 2PZ0A 3V0EA 1L0QA 2H5UA 1TJGH 4OLYL 4U6TA 3WNIA 4M5YL 1U30A 4BZ1A 3IGKA 1R2RA 3DI3B 2A5HA 5A3HA 2CKBA 4E2OA 3GZ3A 1DDTA 1BKHA 1T0NB 4TV5A 4JO2H 4TX9A 3S1WA 4OSUH 4FCHA 1HTYA 3FQWA 4X22A 3UP8A 3VSUA 3WUEA 3CFMA 1Z9MA 1QWHA 2OMZA 1VCFA 3L3GA 2FCBA 4RA3A 2CO7B 2HFFB 2QEZA 3X1BA 3NQBA 4HZMA 4D9LH 4XNZB 1JAKA 4IGBB 1FZMB 3AWGA 1V93A 5JU6A 5A6SA 2GJJA 4FL4B 3FCGA 3MNZA 4AE1A 3MO1B 4GAAA 2ZZ3A 3GNNA 4GG9A 3B7RL 4AC7C 1WBYA 2NTFA 4CVXA 1X9UA 2VDMH 1HHGA 3BKYH 4ZSOE 3UG4A 4YHNB 1UASA 3CLMA 4PODA 3CAFA 1E3FA 3K6SA 1PKQE 1R3KA 2M83A 2OMBA 4JFXB 4NRYA 4MDIB 2GUBA 4JIHA 1CF8H 4ZOAA 2BNRD 2OQJB 3F7LA 4WGXA 2G3FA 1LG1A 4L29A 3MMEB 1DVTA 1WQ5A 1KM4A 3QXTA 1EF2A 1EFXD 1FJ1A 1DN0A 5KBMA 4N42A 4TTGA 5FC9A 1GPOL 2MOVA 3CFQA 5HVWA 4WX2A 1MIMH 5MI0C 3CASA 5DT7A 1EWHA 2XKUA 2ZUSA 3SPVA 4JL1A 3LV3A 4H8HA 5D7IF 5TK2A 1W1IE 4GJIA 5I8CA 2JH2A 1GC1H 4AGQA 3GGWB 3K81A 2WNQA 4X80L 4NQXA 3S5YA 5BMFH 3FSUA 2V7HA 4F4RA 3PBMA 3ML8A 4ZUSA 4QRFA 1S78C 5LBVA 1YQVL 1AS6A 3HPFA 2AJZA 1L6YA 5HBFA 1TFVA 1J01A 3IWUA 5CFAA 1UZ8A 4I2XA 1CN4A 1NDGB 3ZKXC 1FRBA 4MNMA 1ZEAL 2FJSA 4RFEA 1IBFA 4TL4A 2GGGA 3DXAA 1EZSA 5DA4A 3SDCD 3CIVA 5C2XA 1K8IA 3B06A 1Z0NA 1NCAH 2BPBA 3EHBC 4PJ5B 4PTTB 4AYEC 3AICA 5IVZB 1F3JB 3KCWA 1C9WA 4KI5C 4MMYA 3OGCB 5FCUL 4Z2JA 1ZVYA 3PJSB 2V2WB 3U7AA 3EYSL 1URZA 1T5XA 1NKOA 2GJPA 5AYUL 4YJ5A 4YX2H 2SEBA 4WJ5B 2EEDA 4ERAA 4Y9EA 2VR5A 4UU9B 1QPXA 4NI3A 4Z7WA 1OY3B 1AW5A 4AM0Q 4Q3MA 4B3ZA 4ZG1A 3CM4A 4X2PA 1KGYE 3S3GA 3TYEA 1K5NA 2FQGA 2UUDH 2FBOJ 4CVUA 1DQXA 4E2BA 3QPXL 1WE5A 2QCMA 3NACL 2QS8A 4AZIA 4H8WC 3A4JA 2RDXA 4QDMA 2H9AA 4J3OH 4ZMQA 4URIA 1OE2A 4J6RL 1MH5A 4YK4C 3ESOA 5LA2A 1KLGA 2BVOA 1ES0B 4I6KA 5M1TA 4ATLA 2AGJL 4B3LA 2VUKA 1QNPA 3FJ4A 4ZW6A 1J12A 1T5KA 3U4EA 3D39A 4FMFA 5JW4Q 3EXRA 3ZTCC 1H15B 5DMYA 3CX5K 4X5WB 1BWLA 1ZLEA 3H26A 3K8MA 1SUHA 5ADPH 4U1SA 2WXFA 4KXBA 4RCAA 4MZYA 4A8RA 5C2GA 5HYSA 2UZXB 3LQZA 1JHLL 3NA4A 2BXVA 2F7PA 3UMTA 5FKYA 4XXCA 5M3WA 3KP0A 2OXHA 5EB8A 1VFMA 2R2HB 3O11B 5D1ZA 5EULV 4RISH 4AEFA 1PD1A 3TO2A 4OCRL 2J75A 2OZ3A 3AREB 4QTIL 2D0FA 5AVYB 2ZUYA 2FZBA 3HZKB 3B7UX 3VWKA 3WTSA 1B0RB 4MQ7B 1JGDB 2JELL 3DX7A 4LASL 4M93B 4NPJA 3LN5A 3HHMA 2HVOA 3H12A 3TUUA 1DR9A 2EIBA 4GNJA 3M86A 2WOYA 3HMWL