1MYKA

Crystal structure, folding, and operator binding of the hyperstable arc repressor mutant pl8
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
47
structure length
47
Chain Sequence
KMLQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure, folding, and operator binding of the hyperstable Arc repressor mutant PL8.
pubmed doi rcsb
source organism Enterobacteria phage p22
molecule tags Transcription regulation
molecule keywords ARC REPRESSOR
total genus 15
structure length 47
sequence length 47
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03869 Arc Arc-like DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 1mykA00
2GPEA 2BNWA 2BJ1A 3GXQA 2KELA 2WVDA 2WVEA 1B01A 2K29A 3VEAA 1EA4A 2BNZA 2K6LA 2CAXA 2HZVA 2CAJA 2BJ7A 2HZAA 4FXEA 4D8JA 3QOQA 2CA9A 2H1OE 1P94A 2WVBA 1Q5VA 1MNTA 2CADA 1MYKA 2K5JA 3H87C 4ME7E 2WVCA 3LGHA 1ARQA 1BDVA 1X93A 2JXGA 2BSQE 3VW4A 1IRQA 3OD2A 2CPGA 2AY0A 2RBFA 1B28A 2WVFA 2BJ8A 1NLAA 2JXHA 2K1OA 4HV0A 2JXIA 2BJ3A 1ARRA 2BA3A 3FMTA 1BDTA 3VEBA 1PARA 3FT7A 1U9PA 2BJ9A 2K9IA 1MYLA 1QTGA 1BAZA
chains in the Genus database with same CATH superfamily
3GXQA 3G5OA 2K29A 4LQ3A 3LJPA 2HZVA 2CAJA 2BJ7A 1P94A 4MJWA 3H87C 1OHNA 2BSQE 1IRQA 3OD2A 3BSNA 2UUWA 3UQSA 2WVFA 2JXHA 2A2BA 2JXIA 2UUTA 2JBVA 3NAHA 1ARRA 2ADLA 1U9PA 1MYLA 1B01A 2B43A 2BNWA 3QIDA 1EA4A 4NRTA 2BNZA 4LQ9A 2CAXA 4FXEA 2H1OE 2CA9A 2WVBA 2CADA 2K5JA 4LRVA 2WK4A 3LGHA 2AN7A 3BSOA 2CPGA 4AAIA 2RBFA 1B28A 3H5XA 2BJ8A 1NLAA 4HV0A 4O4RA 2BJ3A 3FMTA 1BDTA 1PARA 1QTGA 3UR0A 3VW4A 1OG7A 2GPEA 2BJ1A 1SH2A 2WVDA 2WVEA 3VEAA 2K6LA 3IR7A 2HZAA 3QOQA 1SH3A 1Q5VA 4ME7E 1Q16A 1BDVA 2AY0A 2KOEA 2BA3A 4QPXA 2K9IA 1SH0A 3NO7A 3NAIA 3NNEA 2KELA 2Q2KA 3UPFA 2CKWA 4D8JA 3SFUA 3H5YA 1MNTA 1MYKA 2WVCA 1ARQA 2KKEA 1X93A 2JXGA 3SFGA 2H3AA 1SIWA 4NRUA 3VEBA 3FT7A 2BJ9A 2K1OA 1BAZA
chains in the Genus database with same CATH topology
2GPEA 2BNWA 2BJ1A 3GXQA 2KELA 2WVDA 2WVEA 1B01A 2K29A 3VEAA 1EA4A 2BNZA 2K6LA 2CAXA 2HZVA 2CAJA 2BJ7A 2HZAA 4FXEA 4D8JA 3QOQA 2CA9A 2H1OE 1P94A 2WVBA 1Q5VA 1MNTA 2CADA 1MYKA 2K5JA 3H87C 4ME7E 2WVCA 3LGHA 1ARQA 1BDVA 1X93A 2JXGA 2BSQE 3VW4A 1IRQA 3OD2A 2CPGA 2AY0A 2RBFA 1B28A 2WVFA 2BJ8A 1NLAA 2JXHA 2K1OA 4HV0A 2JXIA 2BJ3A 1ARRA 2BA3A 3FMTA 1BDTA 3VEBA 1PARA 3FT7A 1U9PA 2BJ9A 2K9IA 1MYLA 1QTGA 1BAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GPE A;  2BNW A;  2BJ1 A;  3GXQ A;  2KEL A;  2WVD A;  2WVE A;  1B01 A;  2K29 A;  3VEA A;  1EA4 A;  2BNZ A;  2K6L A;  2CAX A;  2HZV A;  2CAJ A;  2BJ7 A;  2HZA A;  4FXE A;  4D8J A;  3QOQ A;  2CA9 A;  2H1O E;  1P94 A;  2WVB A;  1Q5V A;  1MNT A;  2CAD A;  1MYK A;  2K5J A;  3H87 C;  4ME7 E;  2WVC A;  3LGH A;  1ARQ A;  1BDV A;  1X93 A;  2JXG A;  2BSQ E;  3VW4 A;  1IRQ A;  3OD2 A;  2CPG A;  2AY0 A;  2RBF A;  1B28 A;  2WVF A;  2BJ8 A;  1NLA A;  2JXH A;  2K1O A;  4HV0 A;  2JXI A;  2BJ3 A;  1ARR A;  2BA3 A;  3FMT A;  1BDT A;  3VEB A;  1PAR A;  3FT7 A;  1U9P A;  2BJ9 A;  2K9I A;  1MYL A;  1QTG A;  1BAZ A; 
#chains in the Genus database with same CATH topology
 3GXQ A;  3G5O A;  2K29 A;  4LQ3 A;  3LJP A;  2HZV A;  2CAJ A;  2BJ7 A;  1P94 A;  4MJW A;  3H87 C;  1OHN A;  2BSQ E;  1IRQ A;  3OD2 A;  3BSN A;  2UUW A;  3UQS A;  2WVF A;  2JXH A;  2A2B A;  2JXI A;  2UUT A;  2JBV A;  3NAH A;  1ARR A;  2ADL A;  1U9P A;  1MYL A;  1B01 A;  2B43 A;  2BNW A;  3QID A;  1EA4 A;  4NRT A;  2BNZ A;  4LQ9 A;  2CAX A;  4FXE A;  2H1O E;  2CA9 A;  2WVB A;  2CAD A;  2K5J A;  4LRV A;  2WK4 A;  3LGH A;  2AN7 A;  3BSO A;  2CPG A;  4AAI A;  2RBF A;  1B28 A;  3H5X A;  2BJ8 A;  1NLA A;  4HV0 A;  4O4R A;  2BJ3 A;  3FMT A;  1BDT A;  1PAR A;  1QTG A;  3UR0 A;  3VW4 A;  1OG7 A;  2GPE A;  2BJ1 A;  1SH2 A;  2WVD A;  2WVE A;  3VEA A;  2K6L A;  3IR7 A;  2HZA A;  3QOQ A;  1SH3 A;  1Q5V A;  4ME7 E;  1Q16 A;  1BDV A;  2AY0 A;  2KOE A;  2BA3 A;  4QPX A;  2K9I A;  1SH0 A;  3NO7 A;  3NAI A;  3NNE A;  2KEL A;  2Q2K A;  3UPF A;  2CKW A;  4D8J A;  3SFU A;  3H5Y A;  1MNT A;  1MYK A;  2WVC A;  1ARQ A;  2KKE A;  1X93 A;  2JXG A;  3SFG A;  2H3A A;  1SIW A;  4NRU A;  3VEB A;  3FT7 A;  2BJ9 A;  2K1O A;  1BAZ A; 
#chains in the Genus database with same CATH homology
 2GPE A;  2BNW A;  2BJ1 A;  3GXQ A;  2KEL A;  2WVD A;  2WVE A;  1B01 A;  2K29 A;  3VEA A;  1EA4 A;  2BNZ A;  2K6L A;  2CAX A;  2HZV A;  2CAJ A;  2BJ7 A;  2HZA A;  4FXE A;  4D8J A;  3QOQ A;  2CA9 A;  2H1O E;  1P94 A;  2WVB A;  1Q5V A;  1MNT A;  2CAD A;  1MYK A;  2K5J A;  3H87 C;  4ME7 E;  2WVC A;  3LGH A;  1ARQ A;  1BDV A;  1X93 A;  2JXG A;  2BSQ E;  3VW4 A;  1IRQ A;  3OD2 A;  2CPG A;  2AY0 A;  2RBF A;  1B28 A;  2WVF A;  2BJ8 A;  1NLA A;  2JXH A;  2K1O A;  4HV0 A;  2JXI A;  2BJ3 A;  1ARR A;  2BA3 A;  3FMT A;  1BDT A;  3VEB A;  1PAR A;  3FT7 A;  1U9P A;  2BJ9 A;  2K9I A;  1MYL A;  1QTG A;  1BAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...