1MZBA

Ferric uptake regulator
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
134
structure length
133
Chain Sequence
b'MVENSELRKAGLKVTLPRVKILQMLDSAQRHMSAEDVYKALMEAGEDVGLATVYRVLTQFEAAGLVVRHNFDGGHAVFELADSGHHDHMVCVDTGEVIEFMDAEIEKRQKEIVRERGFELVDHNLVLYVRKKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ferric uptake regulation protein
publication title Architecture of a protein central to iron homeostatis: Crystal structure and spectroscopic analysis of the Ferric uptake regulator
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Gene regulation
total genus 36
structure length 133
sequence length 134
ec nomenclature
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mzbA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1mzbA02
2GA2A 2HZTA 3LWFA 4A0YA 5K5RA 2Z33A 2DBBA 3EQLF 1MDMA 1XGNA 4ETSA 2DPDA 2QZ8A 3KLNA 2XAFA 4A0XA 4M74A 2FEZA 1R1UA 4Y17A 5CVVA 1T6SA 1F1ZA 2K4BA 2HEOA 4MTDA 3KEQA 1FSEA 1BBYA 3RDIA 4YFXF 2Y48A 4RGXA 3CDHA 4BAYA 1Z91A 5LGUA 3CUQB 3M8FA 2EFNA 4LGWA 5J6XA 1O7LA 4U0WA 2OAZA 5ILSA 1CF7B 4ENMA 1FWZA 2PMHA 2L4AA 4ENKA 3H3ZA 4K2EA 2BYVE 3ZN1A 1U2WA 2STTA 1IRGA 2IP2A 2L02A 1LDKB 1IXRC 2STWA 2E1CA 1R1VA 3GFIA 6PAXA 1IUYA 5H20A 3GVAA 5DEQA 2F2EA 1XCVA 3L09A 3R0AA 2PI0A 1J5YA 3I0TA 1STZA 3ZMUA 2QBYB 3GZ6A 2HGCA 2XGXA 2A68F 1ZGAA 2O8XA 2ACJA 2OU2A 3I4PA 2XAQA 4D0PA 3DFGA 1R1TA 5L3GA 2HS5A 3LA7A 3HHHA 3CTAA 4B09A 2XVCA 4L18B 1EV7A 4I0AA 3O3KA 1Z05A 1OPCA 1FBUA 1RNLA 4EJUA 2KIFA 2FQ3A 1JXSA 3HSRA 3I54A 3HRTA 2IA0A 3CUQA 2EFOA 3KP6A 4ZYDA 2ZCWA 3ZMDA 4EJVA 3TO6A 1R58A 2RGVA 1IN8A 4I09A 1FOKA 5J8FA 3K0LA 3ECOA 1P6RA 1FSHA 2ZMEA 1P4XA 4QLCU 2OQGA 2OZUA 4G94A 1SD6A 3DPTA 1RIOH 1DPRA 5L3BA 3L7WA 3ABTA 2JRTA 4HV5A 4M9SA 2PFBA 5J8CA 3HYIA 2IRFG 2HOEA 1XN7A 5LBQA 3JTHA 3P9KA 1YFHA 3G3ZA 4XLNF 4Q5SF 2OQRA 4BYYA 1T0FA 2QBYA 5DUKA 4BHCA 4UV9A 4ZZDA 2TDXA 3BWGA 5DCMB 2W85A 1S3JA 3E3VA 3TO7A 1BI3A 4RB1A 3Q9SA 3GX4X 5FGMA 1TQPA 3ZQ7A 4L5JA 4U0VA 4IXAA 4IRHA 1LB2A 2EWNA 3LQQA 1ZAOA 1FX7A 1TQIA 2BGCA 4BHPA 2W25A 3HRUA 3BDDA 2OA4A 1QO0D 2GAUA 2NRAC 2YPRA 3I58A 4LLLA 1X3UA 1TW3A 2IT0A 3TKYA 2QUFA 5HS7A 3QRFF 4HYEA 5H6QA 1B9MA 2XIGA 3SHFA 1F9NA 5F64A 4IVNA 4HDVA 1T38A 2P4WA 1AWCA 3IC7A 1ZRCA 4L0YB 1R00A 1XSDA 3HRMA 3HIFA 3CO6C 2IW5A 2C6YA 2R7DA 4P55A 2KRFA 3OOPA 5D5UB 4N9IA 4PZJA 2F5FA 2EFWA 4CZZA 1S7AA 2K86A 2V1XA 3WTXC 4CHUA 3JW4A 2Y75A 4EM0B 4O6JA 3WTUC 3PQJA 4LFUA 4ZZLA 5LGTA 3HSEA 3IWZA 4A12A 3WTYC 4I98B 4MEYF 3J80K 3COAC 1LEBA 2LF8A 3CJNA 3REOA 2RNJA 3KLOA 4KIBA 5TJJA 3ULQB 4NB5A 5HDKA 4HX7A 2EA4A 4MEXF 3KE2A 1YYVA 2B0LA 2MD5A 4NHJA 5H6RA 4CXFA 3GFJA 3WTSC 1T98A 4GO1A 5HLGA 1IN5A 5FLXZ 2ZO4A 2XAJA 1Z9CA 1R5HA 3S2WA 3WTZA 5DD4A 4I01A 1WSUA 2A6EF 2BEOA 5JR3A 3ZMSA 1U6GA 2OBPA 2COMA 1KQ9A 1U5TB 2VOPA 5BMZA 4MQVA 3EETA 2HTSA 2AS5F 4G7ZF 1S7OA 4ZH4F 2DQLA 3R6SA 3TOAA 4Y15A 4IPAA 3TQNA 1OYYA 5TRDA 1FP1D 2FE3A 2DQRA 3BJ6A 2O6GE 1H0MA 4EQQA 4EVIA 3BPVA 1B1BA 1FYKA 1EH8A 5HLIA 3HUGA 3GFLA 1LJ9A 2GXGA 3CLOA 2XHKA 2H6CA 1MJAA 5E1ZB 4OINF 1XD7A 5AONA 3R4KA 3FMQA 3L00A 2VC1A 2G7HA 4CGZA 3TGNA 1RUNA 1XSXA 1E17A 1TNTA 2L54A 3FHZA 3HOTA 3KZZA 5A2QZ 3J7AO 4KMUX 1K7AA 1ULYA 2D45A 5DD8A 4LK1F 4HLXA 3GEZA 4YFKF 2GA1A 4G8XA 3F23A 3T0YA 1L0OC 5FD6A 2NYXA 1D8JA 2A69F 4G6DA 1KGSA 2CW0F 1SFXA 4L5IA 3E6DA 2IJLA 3K2ZA 4HX8A 2MC3A 4L9JA 4M9XA 1FC3A 3WTWC 4A6EA 2A07F 2PN6A 3FM3A 5FLXK 2HWVA 1BI1A 2KKOA 1HKSA 1HQCA 4RS8A 1GXQA 3WU0A 1R36A 4KUMA 2LDUA 3HTSB 4LLGF 4Q48A 3I59B 4A0ZA 2QM3A 4RB0A 4L9NA 4Y13A 1YTYA 3JAMZ 4LG0B 1ZGJA 5JHUA 2JSCA 4ON0A 5HVQC 2IA1A 5AIPA 3P9IA 5KVRA 1ZN2A 3RJPA 2WV0A 5EEGA 2DFIA 1Z1DA 2NNYA 4M6YA 3H92A 2LKPA 4WXHA 3IKVA 5LEJA 2Z99A 1KYZA 1XMAA 2WWYA 2V9VA 5L3CA 3WTVC 4MTEA 1FNNA 4RGSA 3HHGA 1GHCA 2O61A 4LK0F 5K1YA 4ZYGA 2HTJA 3GZ5A 2QYOA 3I5UA 4GYIA 5IT3A 3RKWA 4OIOF 3WU1B 3FMRA 1HSTA 4IRGA 1YS7A 5A2QK 2X4HA 1HW2A 3LSTA 3QPTA 2VODA 1WQ2A 4AIHA 3P7NA 2J5OA 1UCRA 5D6EA 2ADUA 3QP5A 1MZBA 3MCZA 1QBJA 2QQAA 1IXCA 1IN6A 4HX4A 3LFKA 3WGGA 2KIMA 3R60A 4WWCA 4HA8A 5L3EA 2E7XA 1J59A 1FT9A 3E5QA 3F21A 2Z5UA 2DT5A 4N0BA 2XROA 3DXJF 4A5NA 3I59A 2EA2A 3SZPA 1J75A 3PQKA 1IXSB 4LG0A 1FP2A 2MBFA 1BM9A 4MQ9F 4UVAA 3N97A 3QPHA 4KYWA 2FXAA 1FLIA 1W7PA 1MKMA 1QZYA 5BQTA 5HS8A 3FF5A 1KQ0A 2R3SA 5DUIA 1PP7U 2IVMA 4ASNA 3QP6A 1EH7A 3E5XA 3DKWA 2W24A 3T8TA 3O2PE 4P9FA 2NNNA 2ETHA 4KA4A 4RAYA 1K6OA 4YG2F 2ZKZA 4AIJA 1S29A 3ERED 1R5GA 4HZFA 2DK8A 1D5VA 1O57A 1XGSA 3E5UA 1QPMA 3KETA 2LNBA 3VFZA 3MAJA 3V7RA 3GXOA 5LLQA 3D5LA 3SXYA 2YR2A 2H6BA 2VT2A 2RKHA 3F8BA 5E8IA 1YS6A 2RN7A 2RQPA 5D4RA 1TW2A 2HR3A 1ZRDA 1CF7A 1G3WA 2LSOA 4N9HA 1USTA 1L3LA 3VODA 2Q2EA 3KP7A 3QU6A 4HF1A 3J81Z 4TV7A 1XDSA 2RDPA 4FT8A 3QU3A 2M30A 3NQOA 4LJZF 2VONA 3Q9VA 3FXRA 1FYLA 4PGHA 3CUQC 3GYHX 2QVOA 5CVIA 2GIVA 4HW0A 4AVPA 1UFMA 1LNWA 1I27A 1W5SA 5FD5A 3C1DA 4XSXF 1IW7F 3WE3A 3BP8A 4EJTA 2FU4A 2P6TA 4Q47A 4KT5C 5LHHA 2VBWA 4IRIA 5CVJA 4UNOA 1R22A 5E18F 1G3TA 3F6OA 3HRSA 1E2XA 4KIGA 3KEOA 4ZYEA 1C0WA 1WRJA 2YU3A 2A61A 1XSVA 4AIKA 1P92A 3HSFA 2JPBA 1AOYA 1Q1HA 1TLHB 4GGGA 3BOQA 4KFCA 1ZHFA 2DLLA 2XUBA 1HSJA 4LLNA 4RB2C 1H9TA 3EYIA 4DNCA 1Y0UA 3TDUC 3M9AA 4CO8A 5LHGA 2PJPA 3NEUA 4Z2YA 1RUOA 5DDGA 5CYVA 3ZMTA 4HF0A 3K1NA 2FRHA 2LF7A 4KICA 4LD5A 2HDCA 1ZARA 2FBHA 1J0RA 1IN4A 3R0JA 2HQRA 1SFUA 4IHSA 2HFHA 2P5VA 2E7WA 3F8CA 2V1UA 4UUVA 5F1RA 5DV5A 2H09A 5IT9Z 4HF2A 4WX9A 4HQMA 4XRFA 5ILVA 1JHFA 3WGIA 3BY6A 2M87A 1PDNC 1MJ9A 4MHGA 2Z9OA 5BPIA 2NS0A 1SD5A 5CVUA 3J81K 2XASA 1FPQA 1XCBA 1BC7C 3V8LA 1BI0A 1J2XA 2CSOA 2ZJ2A 4XSZF 3ISPA 1Z6RA 5ICFA 3T1BA 2X0LA 4L9TA 1BI2A 2P7CB 2PQ8A 2ESHA 3P9CA 5DCMA 3RKYA 5E8GA 2DTRA 2BBYA 3ZMVA 2MH2A 3AAFA 3L9FA 3BPXA 3GO5A 1YW7A 1W5TA 5AIQA 1GVJA 1D8KA 2FMYA 5D8KB 3F8MA 1XGOA 4I0BA 4O5VA 2RV8A 3ZP5A 4ZYHA 1V4RA 1QGPA 2EV0A 3LAJA 2KJCA 3K1MA 2H27A 5CJ9A 5BPDA 5D6FA 3ELKA 2G7UA 3CO7C 3K9TA 2DAOA 3IL2A 1DUXC 3ML6A 3RIRA 1A04A 1OMIA 4OIQF 2DI3A 2A5YB 2KIUA 4G6QA 2QQ9A 4AD9A 3GF2A 3FZVA 1DPUA 2PMUA 5BS6A 2MLGA 3BROA 2JPCA 2IPQX 3KZYA 2ZBKA 2RVCA 3IKTA 4HDUA 3MZHA 1J7KA 1ZRFA 2VE9A 4NQWA 3ECHA 4U88A 2L01A 1OYWA 4WCGA 1MD0A 5IT9K 1FBSA 1YIOA 1B9NA 4YFNF 1F5TA 4M73A 1I1SA 1EH6A 2HYGD 1ON2A 1ZLKA 1B59A 1XGMA 2M45A 3F8NA 1IAWA 3F72A 2FBKA 2VBZA 3VB2A 4Q4ZF 2FOKA 2CWEA 2Q0OA 3RTRA 2VBYA 3FXUA 1ONVA 2PLYA 4L9VA 4HOBA 1SMTA 1P4AA 4WK8F 3EYYA 5LRRA 2VXZA 4JK1X 2O03A 2XV4S 5E17F 1MDMB 4QWQA 5FB2A 4LMYA 4UV8A 2FNAA 1ZLJA 5E1XA 1OKRA 3GUDA 4EGZA 4KMFA 3HOSA 1HBXG 2PG4A 3T5XA 4EV0A 5LEKA 3TDZC 1REPC 1U5TA 2MLKA 3H3UA 4I2OA 1KU9A 2P6SA 1WI9A 1D3YA 2HKOA 3VEPA 2CFXA 1Z6TA 1G3YA 3KP2A 2QLZA 4UXNA 2D1HA 2BE5F 1WWXA 1TQMA 4B8XA 3HTUA 2M1BA 3FXQA 1YW8A 2XRNA 5ILUA 1USSA 1KQ8A 4E70A 3JSOA 1B6AA 1BIBA 2OD5A 4HAMA 4FHTA 5JI6A 4G7HF 5HLHA 2DPUA 2FF4A 4M72A 2D1VA 1BOAA 4OIPF 4U7DA 2EB7A 1LEAA 2UXXA 5K5OA 3BJAA 3F8FA 2EJRA 4ESJA 2P5LC 3MZYA 2G9WA 4U7BA 3CUOA 4BHBA 1U3EM 2WC2A 2K02A 3R61A 1LDJA 2UWMA 3U9GA 5ICEA 1FZPB 1MJBA 4M9ZA 1T39A 3FX3A 4H0EA 3N4MA 4OMYA 2V1DA 4RGUA 3M1EA 2FSWA 4KN7X 5EEHA 2ESNA 2XAGA 3V8JA 3KFWX 4U0YA 1YQAA 1PP8F 4R1HA 2L3DA 1MGTA 1B4AA 3V7CA 2VN2A 2P7VB 3ABUA 4PDKA 5D5WB 3RYRA 3EUHA 3GWZA 1HXDA 2CGPA 2K27A 2ZMEB 2ZXJA 5FFXA 3JTGA 3V4GA 1S6LA 3E97A 5K5QA 4EM2A 5LRSA 3JAMK 3OV8A 4P96A 3BZ6A 3WGHA 3E6MA 4GCVA 4G7OF 2W57A 2DO7A 3G73A 2BV6A 2H94A 5ICCA 2EFPA 4I7HA 2DW4A 1K78B 2QQBA 2EK5A 3SQNA 2F5CA 3JSPA 1I6XA 4S05A 1ZREA 2VBXA 3F6VA 1J9IA 3TO9A 4OIRF 2ZFWA 3EDPA 4HV6A 5HDGA 3K1PA 1YW9A 5E20A 2HQNA 4LB6B 4RB3C 4HBLA 1TTYA 4KIFA 3QOPA 4DQ2A 4CICA 2K7LA 4CDGA 2J5PA 2ISYA 3NRVA 2YSRA 5CLSA 4MNUA 3KCCA 2P5KA 3I64A 1DP7P 1HW1A 1SMYF 1NHAA 4M6XA 5BOXA 3M8EA 3ZPLA 1O3RA 2UZKA 2WTEA 1RZ4A 3B73A 4JQFA 1SD4A 1SAXA 2D2WA 3MEXA 2GWRA 5D4SA 5E1WA 1ZG5A 1W7PD 4PGGA 2CO5A 4BXUA 3U2RA 2QENA 5FFZA 2DK5A 1IZ1A 3V8KA 5F6FA 3WG9A 1KYWA 1Z7UA 4R8HA 4GXOA 2OZ6A 1K78A 1WKMA 1RI7A 3KP5A 1KA8A 1YLFA 4P9UA 4UVBA 1G4DA 3WODF 4WXDA 3J80Z 3TOBA 1ODDA 2ISZA 4XLPF 2PEXA 1TNSA 2YX7A 4FX4A 2ELHA 3LA2A 5HS9A 2FA5A 5LGNA 3GW2A 5DYMA 3SFZA 3E6CC 2JT1A 3W6KB 4XBFA 3RYPA 3C7JA 4I02A 2K4JA 4OOIA 1BJAA 4A2UA 2M8EA 5D5VB 2JZYA 5HOOA 1CGPA 1R23A 2QWWA 1SD7A 3DPLC 2A6HF 4LB5A 2Y0MA 1S8NA 4FX0A 2CYYA 4UHTA 1SFEA 4YIFA 3K69A 2R7FA 1VTNC 3LQRA 1ZG1A 1ZH5A 2GZWA 3DV8A 1UHMA 3I71A 2UXNA 4ENNA 2E1NA 1BIAA 2FBIA 3DP7A 4PCQA 1QQIA 3FMSA 4EJWA 1U78A 3M7GA 5HDNA 1HW5A 2M5WA 3RI4A 1W4MA 1G6NA 3ZMZA 4BH9A 5L3DA 4F7ZA 3U1DA 4A6DA 1IN7A 3C18A 2VE8A 1DDNA 2DU9A 1OR7A 3F3XA 3GLXA 2FMLA 2RC4A 1YG2A 3IWFA 2P8TA 4ESFA 4IJAA 5JVTA 2EV5A 1OYIA 1UHWA 2V79A 1ZYRF 5DCFA 2EFQA 4CYDA 2NAZA 3FM5A 4G9YA 4EGYA 1O7FA 1GXPA 2XKOA 2W84A 3DF8A 4MGRA 4IF4A 1I5ZA 4RGRA 3VOEA 1K79A 1XB4A 5D5XB 5KK1A 4OU0A 2VOOA 4OMZA 3ZN0A 3DEUA 4UVCA 3T8RA 1V3FA 1JGSA 4HQEA 2EV6A 1G3SA 2GQQA 3GFMA 3Q5FA 4R79A 5L3FA 2ZNZA 1LVAA 2JTVA 3W6JB 1JHHA 3QAHA 2VC0A 4GYGA 2XKPA 1U8RA 2VT3A 4KDPA 2GXBA 3RPQA 4WF2A 3O6BB 1JE8A 3L2CA 2O3FA 3KP3A 1QNTA 3WE2A 3MQ0A 3E6BA 1R7JA 1LQ1A 3F22A 3MWMA 5ED4A 4KNYA 5ICGA 2F5EA 4A5MA 3D0SA 1KU3A 2F5DA 3IRQA 1BN5A 1LDDA 2ZNYA 2PBIA 5FO5A 1QZZA 2HKXA 4L0ZB 3V7SA 4KN4X 1IF1A 1KU2A 1KU7A 1ON1A 1T2KA 1IRFA 1FBQA 3I53A 2MH9A 2XAHA 3BJOA 3SZTA 2CG4A 3DQVC 1FY7A 3LAPA 4WXCA 4AWXB 2V6CA 2YX4A 2MA3A 2Q8KA 1O3TA 5CVRA 3IHUA 1O3SA 1I1GA 4ENJA 1HKQA 3IRRA 4O3MA 4EJOA 3C3WA 3FWEA 4JBAA 4S04A 5D8LB 2KJBA 4P5OA 4HLYA 4YIIA 4IHTA 4EMSA 3MFKA 1F4KA 4EM1A 1ZG3A 1XMKA 2O0YA 2FNPA 1BC8C 2Z3YA 2L4MA 1HKTA 1XDUA 2A3SA 1H9GA 5LHIA 5JFRA 3B02A 2AXLA 4RAZA 1U5TC 1YO5C 3RPUA 2HYFA 1UB9A 1P2FA 1FYMA 3ROUA 3LA3A 4BQAA 1W7PB 1TBXA 3PFIA 1PUEE 5ERIA 3KP4A 1O3QA 2CQKA 4ESBA 1P4WA 3WTTC 4BNCA 2IA2A 3RKXA 4M71A
chains in the Genus database with same CATH superfamily
5H80A 2GA2A 1N33H 2HZTA 2CS3A 3LWFA 2EH3A 2HDDA 4A0YA 1X3ZB 5K5RA 3FK7A 3PL8A 4O3OA 2Z33A 3GTGA 4E7HA 1BNCA 1ULZA 1MBEA 5E3MA 2RDIA 2DBBA 1W36C 5KFBA 4CCNA 1X1BA 2OCEA 3EQLF 1MDMA 5B3SH 3K4NA 1XGNA 1XMXA 4ETSA 1E3PA 2DPDA 5DGAA 2YCHA 3CVZA 2QZ8A 2L5QA 3V4ZA 3KLNA 2XAFA 4A0XA 4M74A 2FEZA 1R1UA 2TCTA 4Y17A 5CVVA 4H4KC 4BY1G 2R6FA 1B72B 1RC9A 1T6SA 1F1ZA 2DPJA 3GTJA 2K4BA 2HYJA 1WZ2A 3H4BA 2LK2A 1OQYA 2HEOA 3O8GA 4MTDA 3KEQA 1FSEA 1BBYA 3BZKA 3HL2A 3I4NG 2XRLA 3RDIA 1IG7A 1PVEA 4YFXF 3MFHA 2FP4B 1X1DA 2WE6A 1BR1A 2Y48A 4RGXA 2Y0SN 5J3LA 1JKQC 4E4HA 2LKSA 3CDHA 2CV0A 4BAYA 3RB6A 2AO9A 1Z91A 5LGUA 2BQUA 3CUQB 3M8FA 1POGA 2EFNA 1HDDC 4LGWA 5J6XA 1O7LA 4U0WA 2B63J 3OY9A 2X6WA 2OAZA 2M05A 5ILSA 4DYQA 3BTIA 5JLXA 2VQFH 2P81A 1VS0A 2RDJA 1CF7B 4ENMA 1FWZA 4AYBA 4C5BA 2PMHA 2FPIB 2L4AA 3PSIA 4ENKA 4RDUA 2XF7A 4IHVA 2UUBH 3Q8PB 2L7ZA 3H3ZA 3DKYA 4K2EA 2BYVE 4LFBH 3S1NJ 2QQ8A 3ZN1A 2Q2EB 4CZCA 1A5JA 1U2WA 2STTA 1IRGA 2IP2A 2L02A 1VKZA 1LDKB 1IXRC 2STWA 1DP3A 2E1CA 4DV2H 4F4XA 1R1VA 3GFIA 3GTOJ 6PAXA 1VBGA 1IUYA 2HVQA 3WO0A 5BMVF 3V42A 3LSGA 2VQLA 3OSPA 4J9LA 2GBYA 5H20A 4ECZA 3GVAA 3H9QA 2KISA 1V55H 1X19A 5DEQA 2F2EA 1G8XA 1VQMI 1XCVA 5GADJ 2Y0SA 3L09A 5FLVA 3R0AA 4C2UA 1PX2A 5KFJA 4PJMA 2K85A 1VQ6I 2PI0A 1J5YA 1WCMJ 3I0TA 1STZA 1ZQ3P 1GSHA 2MCTA 3GLKA 5KG7A 3ZMUA 3BCBA 5J1UA 2XF6A 1EF4A 2KSWA 2QBYB 3EUHC 5FKOA 3GZ6A 1U8BA 4OX9H 2VKEA 4IAJA 4BS9A 3H20A 3H5RA 2HGCA 1SAUA 4TUYF 5J2UF 2XGXA 1B8IB 4BU2A 3CCEI 4XKWA 5E3NA 2A68F 2VUGA 1ZGAA 2JA5J 3K70D 2O8XA 4RM3A 2ZB9A 5M3FJ 1ZHQA 2ACJA 2E2HJ 2OU2A 5KT3A 5C3EJ 3I4PA 2XAQA 3JRXA 5GAEJ 4D0PA 3DFGA 2ASJA 2JA7A 1R1TA 5FKKA 5L3GA 3S3MA 3ABLH 2HS5A 1X9NA 4UB8C 2CFOA 3ZQLA 3PUFA 3LA7A 3PW7A 5IY5H 3HHHA 3KPHA 2PMZE 2W6MA 3CTAA 2XB5A 5KFTA 2QEXI 2DJNA 2L7KA 4F55A 4O2BF 5GTHC 5DQIA 3QQAA 4B09A 5C5JA 3EUKL 2YUSA 3MR2A 4AM3A 2XVCA 4L18B 1EV7A 4HNUA 4J9MA 5F08A 1IDYA 2X85A 3T5HA 5KFRA 4I0AA 3O3KA 3WG7H 1OWTA 3ASNH 1Z05A 4J0MA 1OPCA 5FPRA 1FBUA 1RNLA 3OIQA 5M3MJ 4EJUA 2R0QC 3PO3J 3J7AK 2KIFA 2C28A 4PFOA 2FQ3A 1SFOJ 1JXSA 4A3JG 3HSRA 4BL0B 3I54A 3HRTA 5IYCJ 1YJNI 1TWGA 4JX6A 5IYDG 2IA0A 3U9TA 3CUQA 1K1QA 2EFOA 4JV1A 3TW7A 3KP6A 4J9KA 5LP6F 4ZYDA 4IR9A 1FMVA 2ZCWA 3R5HA 3B6AA 3OYGA 3ZMDA 4HR7A 1IGNA 4JOMA 4A3GG 3T1HH 3K4KA 1TT0A 4EJVA 4X65H 3G6XA 1N48A 1U0JA 4X1EA 4Q8EA 3TO6A 1R58A 2LR8A 2FB9A 2RGVA 1IN8A 4I09A 1FOKA 5J8FA 2K3FA 3FDYA 3K0LA 3ECOA 1P6RA 1FSHA 2ZMEA 1P4XA 2IEKA 4ZI7F 5KFGA 1XS9A 5E79C 4A3BJ 2VJIA 1JTYA 2JA8J 3GQCA 4QLCU 5FROA 4P1WA 2OQGA 3SDBA 2OZUA 4G94A 1SD6A 3DPTA 4HPQA 1RIOH 1DPRA 5L3BA 1QU3A 5E3LA 3H0GG 3L7WA 3ABTA 2JRTA 3HKZN 4HV5A 3BR5A 2VJ4A 1RESA 4M9SA 2BXYA 2PFBA 4EG0A 5J8CA 3E7LA 1FJLA 3CCUI 1NH3A 3ZQFA 1E3HA 5KT6A 5EG0A 1IBMH 3HYIA 2IRFG 1Z21A 2HOEA 1XN7A 2RQQA 3W2WA 2VUMG 4QWEA 5LBQA 4D9JA 3HOXJ 1AU7A 2H8WA 3JTHA 5KFUA 2O8KA 3P9KA 3S1RJ 1YFHA 3G3ZA 3C0FB 4J9PA 2E19A 4XLNF 4Q5SF 5KFFA 5GPCA 3LSMA 4MIMA 3WU2C 2OQRA 4RZRA 4BYYA 1T0FA 3KXYT 1A31A 2QBYA 3OIPA 4NUBA 3CJRB 1VQOI 4CCKA 2EIMH 2RF4A 4PFPA 5DUKA 1VAJA 4O4IF 2G0EA 4BHCA 4IOCF 4YAJB 4UV9A 4ZZDA 2TDXA 1B8IA 1JLLB 3BWGA 5DCMB 2W85A 1S3JA 2KPMA 2W1OA 2BR0A 3NAUA 3JRBA 3E3VA 5KG5A 3TO7A 5IP6A 3NWTA 2RGRA 1HF0A 1BI3A 3SI8A 4RB1A 3QWLA 3PFYA 4I50F 3FXMA 3Q9SA 3IG0A 3GX4X 5FGMA 1TQPA 3ZQ7A 1KJJA 2R7ZA 4L5JA 4U0VA 3S2HJ 1PK8A 3BR3A 4BQNA 4IXAA 3T5JA 3FXLA 4IRHA 3GIMA 1LB2A 2EWNA 5FJ8J 3LQQA 1ZAOA 1FX7A 5J1YA 1TQIA 4Z6YA 5LYJF 2BGCA 4BHPA 3GLLA 5F1JA 3QZ8A 1WJCA 2DWCA 1ACIA 2MW8A 2IS1A 1OCPA 4IL6C 2W25A 3HRUA 3MKYB 2YU9J 2Y30A 3BDDA 4II3A 3CZ6A 2PJRB 1HCRA 3RQ4A 4HRIA 2F48A 2OA4A 2ZJQF 3N40P 1QO0D 2GAUA 2NRAC 2YPRA 2FMAA 4DLKA 4X66H 3KHRA 3V6JA 5M5XJ 3I58A 4LLLA 4CC6A 3T5LA 1LVKA 3FKIJ 1X3UA 1TW3A 2IT0A 4U87A 1GT0C 1DV1A 3A02A 3TKYA 2EZLA 4C9YA 2QUFA 4GKJH 1Y1WA 5HS7A 4FU0A 1OISA 3QRFF 4HYEA 4WBNF 3D5RC 1H89C 5H6QA 1B9MA 2XIGA 3SHFA 3R23A 2WAFA 1VQLI 1G2HA 1KJIA 1WH2A 1F9NA 5F64A 4JV2A 2A6TA 4O3SA 3ZOBA 2DCEA 4IVNA 1BW5A 1JT0A 2R8KA 4HDVA 2ME0A 1T38A 2LBFA 2P4WA 5F9LA 3G6YA 3CC4I 1E0EA 1AWCA 2ZJPF 3IC7A 1KJQA 1ZRCA 4L0YB 1EUDB 1R00A 1U9NA 1X3WB 3QFFA 1XSDA 1BR2A 3HRMA 4JV0A 3G1OA 1J5EH 1N75A 5KG2A 3HIFA 3R5FA 1IBKH 1EA3A 4PJJA 4JX4A 3CO6C 2IW5A 4HG2A 5IYBJ 2C6YA 2R7DA 4P55A 4ZYAA 4NQWB 2KRFA 5KT5A 4BE1A 3OOPA 5D5UB 3CF5F 2IGMA 4N9IA 4PZJA 4G3IA 2JK3A 2DMNA 2FX0A 3D1NI 3Q2OA 3GIIA 2OJED 2F5FA 3VYUB 1A0IA 3S1MJ 2EFWA 4X64H 1X2MA 4CZZA 2ECBA 1S7AA 1XMQH 2R7VA 4DV4H 3S1QJ 2K86A 2D5VA 2V1XA 2WAQN 3WTXC 3H35A 4CHUA 2FKLA 4F4WA 4FS1A 1N77A 3JW4A 2Y75A 4ZDOA 1GUUA 3G71I 4AVZA 1O75A 4XX0B 4EM0B 2DA6A 4O6JA 3FBIB 3WTUC 4FTHA 3QPSA 1S0NA 1XNRH 3PQJA 1MW7A 1MMNA 2BY2A 4LFUA 3DF7A 4ZZLA 2EZKA 5LGTA 4Q43A 1FTTA 3M07A 2VKVA 3BR0A 3HSEA 5GP9A 1DGRM 1T08B 4J9SA 3IWZA 4BE0A 3TW6A 4J9OA 5CAEB 3SEQA 4IWYA 1DV2A 5L9XA 4DV0H 2Y9ZA 4Y4RA 4R7RA 4A12A 3WTYC 4EATA 3FIWA 4I98B 4MEYF 3J80K 3COAC 2MD0A 1IO2A 3AFHA 2LF8A 3PUBA 4X0GA 3CJNA 3REOA 1LEBA 4ED0A 3RB3A 4IQJA 3GTKA 4RMNA 2RNJA 4XN3A 5LOVF 3KLOA 4KIBA 2IXSA 3OR2C 2IGKA 5TJJA 5KG0A 3ULQB 4YP3A 5GAHJ 4EFEA 3Q0VA 4XOTA 1I3QA 1WJ5A 1UC8A 4F4YA 4NB5A 5HDKA 4MV3A 2JVGA 3KALA 4DL2A 4A3EG 4E7LA 4HX7A 3T5KA 3MJFA 2EA4A 4CCMA 3MKZA 4YR0A 4MEXF 3KE2A 4PK4A 4ECTA 4DL3A 1YYVA 3BR2A 1RKTA 2B0LA 2MD5A 1VQ5I 4NHJA 5H6RA 1OR7C 4CXFA 2WAQA 2Y31A 3M4IA 4YBZB 2L7MP 1ETVA 3GFJA 3WTSC 1VFCA 1IDZA 1T98A 2Y69H 4GO1A 4DJAA 4BBSJ 1TWCA 2UUCH 1WJBA 1IN5A 5HLGA 5FLXZ 4ECSA 1XPXA 2XGDA 2ZO4A 3BQ2A 1X1PA 1J09A 2DA1A 2XAJA 1Z9CA 2CW7A 3KYLA 3ETJA 2DMUA 1R5HA 2QGUA 2WA0A 3S2WA 3CMMA 3WTZA 5DD4A 4M3GA 4I01A 1WSUA 2A6EF 1JDBB 4GC7A 4M3EA 3RKQA 4I76A 2BEOA 1R4NB 2CW8A 2V58A 5JR3A 1TA8A 3ZMSA 2GIZA 2P0WA 1U6GA 1S72I 2K9QA 3K4JA 2OBPA 2COMA 3S93A 4JI7H 1KQ9A 1U5TB 3MVPA 2VOPA 5EZYF 4E7IA 5BMZA 3CQZJ 1JI8A 2NVXA 4MQVA 3EETA 5KFAA 2CKZB 4C5CA 1BW6A 2OTLI 2HTSA 2AS5F 4DV3H 1UG2A 2OUMA 4BEHA 4G7ZF 4EBDA 4QIWN 4GFBA 1WHUA 3SZGA 1S7OA 4ZH4F 2R82A 5DQHA 2DQLA 2W00A 4CCJA 1YX5A 3R6SA 2M0MA 3TOAA 4Y15A 4IPAA 1GV2A 3S2DJ 1CQIB 3TQNA 2JJ7A 2R7LA 1OYYA 5TRDA 2W8LA 2L9NA 2H1LA 1Q1VA 1FP1D 2FE3A 2DQRA 3DEEA 3BJ6A 4MFDA 2O6GE 1BR4A 1H0MA 4QPOA 1B04A 5KFYA 2WYOA 4EQQA 2LC2A 3ERMA 4EVIA 3BPVA 1B1BA 1FYKA 1EH8A 3G1LA 5HLIA 2QSGX 4ZDPA 3HUGA 3GFLA 2LG4A 4ANJA 4RNOA 1LJ9A 2CUEA 2GXGA 2K40A 3SE7A 1M7JA 5L1LA 4M6VA 2PVPA 3CLOA 3SYTA 3T1YH 1I94H 2XHKA 1MMGA 2H6CA 2YZNA 5KX5F 2XB0X 4TQRA 2X1CA 1MJAA 2R93A 5E1ZB 5H2FC 3C2HA 2X51A 4OINF 2NVYJ 4FCYA 4UCRA 2XCLA 1XD7A 2E2IA 2GXAA 1AA7A 1JJ8C 2UUAH 5AONA 3R4KA 3FMQA 3CCSI 2L0KA 2CQXA 3L00A 2VC1A 2DFEA 2G7HA 3L1PA 3KIOA 3DU5A 4IX7A 4CGZA 3OYEA 3ZQGA 1I3AA 4QIWA 3TGNA 1FMWA 1RUNA 1XSXA 4O4LF 1E17A 1TNTA 2L54A 3FHZA 4IHXA 3HOTA 4EYIB 3RB4A 2C2RA 3TQ1A 3KZZA 3HOZG 5KG1A 4A3JJ 5A2QZ 2VXDA 2J9GA 1I7LA 3J7AO 1C30A 4KMUX 1K7AA 1ULYA 3PR5B 2R8IA 2X9DA 2YZMA 2D45A 1R4MB 5DTDA 3UR3C 5DD8A 3FKJA 4LK1F 4PWQA 4HLXA 3S3OA 3GEZA 4YFKF 3GTOA 1N32H 2GA1A 4G8XA 1T3NA 3F23A 1S9HA 4I55F 4RAFA 3T0YA 2CQNA 1L0OC 2RAEA 5FD6A 4A3GJ 2F4VH 1JKPC 1WR2A 3OUUA 3HOUG 2NYXA 3UQ8A 1D8JA 2A69F 1IOWA 1RK5A 4G6DA 1KGSA 2CW0F 1SFXA 4L5IA 3E6DA 2IJLA 3K2ZA 5F0FA 4HX8A 3IV5A 1TP4A 3JRAA 3RTXA 1MBFA 2MC3A 1E4FT 4JI0H 2WY8Q 4L9JA 1JXLA 4M9XA 5DM6F 4XK4A 1WCMA 1FC3A 3WTWC 4A6EA 2A07F 4EYHB 2PN6A 3FM3A 5FLXK 2HWVA 3GILA 1BI1A 5K2MA 1FOYA 3PW4A 3L4KA 3BQ1A 2KKOA 2E1MC 3H0GJ 2DA3A 1HKSA 1HQCA 4KT6A 5KKNB 4O3QA 3BZCA 1A9XA 4RS8A 3DCFA 4NLGA 1GXQA 2JA5A 3WU0A 1R36A 2DJIA 3IH3A 2CH0A 1ETQA 1TL8A 2R7UA 4KUMA 1GLVA 3BABA 2R87A 2LDUA 2HGSA 3HOWG 1IOVA 2VUMJ 3LNQA 1R49A 3HTSB 4LLGF 2W9AA 1TWFJ 1AKHB 4Q48A 3I59B 4A0ZA 1YIJI 2QM3A 4RB0A 3VMMA 4L9NA 5IOYA 4AUXA 1FJGH 1A6QA 4Y13A 1YTYA 3JAMZ 3JRHA 4LG0B 3EPGA 4FM9A 1ZGJA 4RNNA 1Z77A 5JHUA 4F91B 2JSCA 3CLQA 4ON0A 5HVQC 2JA7G 4RZQA 4BACA 1D0ZA 2W9CB 2IA1A 2JUGA 5AIPA 5EF6A 2KDOA 3P9IA 5KVRA 4A3FG 1FIPA 2R5ZB 1ZN2A 3RJPA 2WV0A 4BGDA 5EEGA 1I6UA 2DFIA 2HDWA 4ECWA 3CMEI 2B9SA 1JJ6C 1EKEA 1Z1DA 3ZGKA 1Y1VJ 2NNYA 4M6YA 3H92A 4ZTFA 2CV1A 1Y14B 2BOLA 3AL0C 2LKPA 4OAYA 4WXHA 3Q0UA 2NOJB 3P5JA 2CMPA 3IKVA 1O4XA 5BPFA 1XTAA 2XCPA 5J2TF 4BQOA 3CCQI 5LEJA 2VL8A 4A3LG 2Z99A 4XRSA 1KYZA 3LP8A 4ZOLF 1ETXA 1XMAA 2DOEA 2WWYA 3HKZE 2V9VA 3ZQHA 2VPQA 3PIPF 4AYBN 5L3CA 3L2QA 4IQ4A 2EZHA 2EIJH 2VQGA 3VPDA 3WTVC 1RJRA 2NU7B 4MTEA 1PYVA 1FNNA 4RGSA 3HHGA 4JI8H 3OYNA 1UC9A 3QYEA 1MMSA 2NVUB 1GHCA 1E4GT 2DA5A 1K1SA 2O61A 2FLNA 4LK0F 5K1YA 2IAIA 1V5FA 2IGNA 4ZYGA 3L2VA 3GTMA 2I8DA 2HTJA 3S17J 2X6OA 2QYOA 3GZ5A 3I5UA 4GYIA 4D7NA 5IT3A 2HNHA 3RKWA 3MD2A 5K7FA 3MWEA 4OIOF 3WU1B 5C4JJ 1KBLA 2J6SA 3FMRA 4Y3OA 1HSTA 4IRGA 1T94A 1YS7A 5A2QK 1ZK8A 3J80W 5IP9G 2NOGA 2HOAA 2X4HA 3ZQQA 1HW2A 3LSTA 3QPTA 2VODA 4NXMH 4DBRA 3LSPA 5CPRB 2R7RA 1WQ2A 4AIHA 3P7NA 2J5OA 1UCRA 5D6EA 1IV6A 3RSNA 4GDFA 1I50J 2ADUA 3QP5A 3L4JA 1MZBA 4YQWA 3MCZA 4DOZA 1QBJA 4LSXA 1JUMA 2AQEA 9ANTA 2QQAA 1IXCA 1IN6A 4HX4A 3LFKA 4PJLA 3WGGA 3RBDA 2EQRA 2KIMA 3R60A 4WWCA 4YR2A 1M1EB 4HA8A 4UCVA 2W48A 5L3EA 4A3IG 2E7XA 1Z7LA 1J59A 2R92A 1VZ0A 1FT9A 3A0HC 3LMMA 3DBLB 3BQ0A 3E5QA 4QTRA 3F21A 2R7WA 2Z5UA 2ME6A 2DT5A 3GTLA 3M8JA 2AU0A 4BXXG 2NU8B 1B6SA 5DQGA 4YB8B 1W36D 3OYCA 5FLMJ 3CCLI 4N0BA 2JSPA 3DU6A 1S9FA 1ERDA 5KCMA 2KL4A 2XROA 3DXJF 2LY9A 3K4BA 4A5NA 1P7IA 3I59A 3H4DA 2I87A 2EA2A 3SZPA 1J75A 2VPLA 1Y8RB 2UXCH 1ENHA 3PQKA 1IXSB 4LG0A 4W1UA 3RGXA 3ORRA 1FP2A 1TAEA 2MBFA 1BM9A 2W6PA 4D1QA 1RYSA 1QVUA 4MQ9F 1QHHD 3HOYG 4UVAA 1V5EA 3LSRA 2R5YB 3N42B 2LLKA 2L9RA 2LRDA 3N97A 3QPHA 4RAGA 3FXOA 4KYWA 1NG7A 2R5ZA 2FXAA 3GCMA 3MFIA 1FLIA 5DM7F 2YRWA 1W7PA 2J6TA 2GM4A 3ZXSA 1V9PA 2R7ZG 1G59A 2YU9A 1MKMA 1QZYA 5EWEA 5EGOB 3KZIC 2ZXIA 2M8GX 5CKTA 1MBKA 5BQTA 5HS8A 3VPBA 2YL2A 3HDDA 3FF5A 1KQ0A 2R3SA 5DUIA 1PP7U 3ABKH 3PNVA 2IVMA 4ASNA 1MMDA 3QP6A 3TBIA 1GDTA 1S97A 2JRMA 3CCJI 4S0HB 4PUSA 3C2GA 1ETWA 4C5AA 5F04A 1EH7A 3E5XA 3AYHB 2MC4A 3DKWA 2W24A 3T8TA 4A3EJ 1WGXA 2UVWA 1JT6A 4JI6H 3O2PE 4P9FA 2NNNA 2R8GA 2ETHA 4KA4A 1TWAJ 4RAYA 2DZDA 3RAXA 3PNYA 1K6OA 4M3BA 1X1CA 4YG2F 3MR3A 1WJFA 2CZGA 2JEIA 2WAQE 5DG7A 2ZKZA 4AIJA 4PJNA 3OYDA 1Y1WG 1S29A 5LFAA 5IPAA 3ERED 4EEYA 4F52A 1JUPA 2B7EA 2EILH 3FISA 4B3XA 1B72A 1R5GA 2MYSA 2MG4A 4HZFA 3JRFA 3JRCA 4UUSB 4AQYH 2DK8A 1M0WA 1D5VA 1O57A 1XGSA 2FQ4A 3E5UA 1QPMA 3KETA 4GLXA 2DFHA 2LNBA 2A5WA 3DPUA 5IP7J 1K83J 3VFZA 3HM5A 3MAJA 3V7RA 3GXOA 3M1CA 2BY0A 2Q2UA 4FQGA 5LLQA 3D5LA 3SXYA 3L2UA 2YR2A 2H6BA 2VT2A 4CH7A 4MA0A 2I10A 4YJ3F 2RKHA 1TC3C 3F8BA 5E8IA 1YS6A 2RN7A 3I12A 2AXTC 2RQPA 3ONQA 2VPSA 5D4RA 3OYIA 1TW2A 2HR3A 2VI6A 3ETHA 4LF5H 1ZRDA 2ZSHB 3K6GA 1CF7A 3H9JA 3CC7I 2ZSIB 5GONF 1TZLA 2IGOA 1G3WA 1OLTA 2LSOA 2DMQA 1V5GA 1D1BA 5EZHA 1S0OA 3CCMI 2MABA 3OIOA 4N9HA 5C44G 1USTA 2VB6A 1Z2NX 4LFAH 1L3LA 3CESA 3VODA 2Q2EA 3KP7A 3GTGJ 1GV5A 2UUZA 4LIUA 1RR7A 3QU6A 4HF1A 2RREA 3GTQJ 3J81Z 4TV7A 4J9NA 1XDSA 2KIQA 2RDPA 4FT8A 4XORA 2LH9A 2V4RA 3S16J 4XLFA 2OV7A 3QU3A 2GPWA 4QWCA 3BG3A 2DIKA 1YRNB 5KFNA 2M30A 2P0AA 3NQOA 4LJZF 3DBRB 1MBHA 2VONA 1HC8A 3Q9VA 4R8UB 1EJ9A 1SVOA 3D5SC 3FXRA 1V51A 5IYZF 4IHWA 3HEFA 4XLCA 1FYLA 5KFVA 4PGHA 2R5YA 3CUQC 3GTJJ 3F0CA 3GYHX 3DLLF 2XSJC 4NBQA 5KAFC 1KZHA 2QVOA 3U21A 2DODA 2QKMB 5CVIA 4HNTA 2ZJRF 1WJAA 2GIVA 4HW0A 3J7YJ 1PJRA 4LH6A 4AVPA 2ECCA 3U9SA 3G2BA 1UFMA 4YRVA 1LNWA 2DA4A 3OYBA 1IJWC 1I27A 1W5SA 5FD5A 3C1DA 4ZC3A 4DIQA 3IN5A 3CJQB 4XSXF 1IW7F 2V5AA 3WE3A 3BP8A 1CS0A 4EJTA 3GTPJ 2FU4A 2P6TA 4Q47A 4KT5C 2ZMEC 5LHHA 4IHYA 1D0XA 2VBWA 2HU9A 4IRIA 5CVJA 4UNOA 1DQUA 1OCZH 1R22A 1YHQI 5E18F 1G3TA 4D5FA 3F6OA 3HRSA 4BJ5C 2WB1E 1E2XA 4YIRX 4TV8F 1LE8B 2R7TA 2W6ZA 3GIDA 1IBLH 4KIGA 3KEOA 2LKXA 3I9V2 3W2VA 4ZYEA 3TP3A 1C0WA 1WRJA 1X4PA 3NARA 4J19A 1E4EB 2YU3A 2R8JA 2YYAA 3GZNB 2A61A 1S0MA 1XSVA 4AIKA 1P92A 3HSFA 4XLAA 4CYCB 1M6VA 4RUCA 3HGGA 3ORQA 3DTIA 3PW0A 2JPBA 1AOYA 4UUSA 1Q1HA 1TLHB 1I39A 2M4GA 4GGGA 3N05A 4CUGA 3CCVI 5BNGA 3BOQA 4KFCA 3N41B 1ZHFA 2DLLA 2XUBA 1HSJA 2DYSH 4LLNA 2W6NA 4RB2C 1H9TA 3EYIA 4DNCA 2UVRA 1Y0UA 3K4CA 3TDUC 4L5EA 5EEAA 3M9AA 3G4SI 4CO8A 4A2BA 5LHGA 1S5LC 2PJPA 2XDVA 3NEUA 4Z2YA 4IR1A 1RUOA 5DDGA 5CYVA 2NU6B 3ZMTA 4HF0A 4J01A 2KRCA 3CF2A 2FRHA 2LF7A 3K1NA 4KICA 4LD5A 3RZDJ 2YZGA 2X6XA 2HDCA 1R6RA 1JGGA 1ZARA 2FBHA 1MNEA 1ZR4A 3A01B 1VI0A 2Z1DA 1J0RA 3WHCA 5DG9A 1IN4A 2PBZA 3R0JA 2HQRA 2MSYA 1SFUA 4B4CA 4IHSA 2HFHA 2P5VA 2E7WA 3F8CA 3TP0A 4BDYA 2V1UA 4UUVA 4MV4A 2JA6A 3QYFA 3G6VA 3V4SA 5F1RA 1FEXA 5DV5A 2H09A 5KFEA 5IT9Z 4HF2A 4WX9A 2M7AA 3RIZA 2M3AA 2HPMA 4HQMA 4XRFA 4YELA 5ILVA 3RV3A 2JA7J 1JHFA 3WGIA 3BY6A 4A3MJ 5JHFA 4A3FJ 2M87A 3SDGA 4DZPA 4V2GA 2LMDA 1PDNC 2VIXA 2R93G 3SEZA 1MJ9A 3LSIA 4MHGA 1Z3YA 1YRNA 1T56A 4DZJA 3GIQA 2Z9OA 3CCRI 5BPIA 2R85A 1P9QC 2IBDA 3RCOA 1D0YA 1GVDA 2NS0A 1RK6A 2ALZA 2UVUA 1SD5A 5CVUA 5GAGJ 5LXTF 4R8UA 5J4YA 4XZ3B 3J81K 4XQFA 2XASA 2WV1A 3TMOA 4K0KH 1FPQA 4XONA 1VBHA 4A3CJ 1K61A 4A3LJ 4C3JJ 4NNJA 2DXIA 1XCBA 1BC7C 3IH4A 3V8LA 1BI0A 1RJQA 3SFIA 1J2XA 2CSOA 2ZJ2A 4XSZF 1JKOC 3ISPA 2J6UA 3S3NA 1Z6RA 5BPHA 5ICFA 4II2A 3T1BA 1XC5A 2X0LA 2ZDQA 4L9TA 2DDAA 1BI2A 1LPQA 2P7CB 2HQ5A 1TWGJ 2PQ8A 2ESHA 1QZEA 3P9CA 5DCMA 2DN0A 3RKYA 5E8GA 4HYKA 2DTRA 2BBYA 1WPKA 2MH2A 3ZMVA 3AAFA 3L9FA 3BPXA 4B1RA 4PSXA 3VDXA 3X2QH 2XC7A 1Y6IA 4BY1J 2M7BA 3GO5A 1D1AA 1YW7A 2ASDA 2V26A 3GIPA 1W5TA 1YE9A 5AIQA 1LFPA 1LE8A 4DUZH 1GVJA 3G1MA 1D8KA 2FMYA 5D8KB 2I5UA 5JVGF 3I4NJ 3WO1A 1S03G 2BW3B 3JREA 3HOVG 3F8MA 1E4EA 1XGOA 4I0BA 1Y39A 5IP9J 4YHHH 1OFCX 1WVRA 4O5VA 2VPRA 2RV8A 4N4NB 4W97A 3ZP5A 4ZYHA 4V2FA 1V4RA 4A93G 1QGPA 4D7MA 2EV0A 2C2EA 2VASA 1AHDP 2BVMA 4HEA2 3LAJA 4IZZA 2KJCA 1TWFA 3GV5B 2QSHX 4XLHA 3K1MA 5B66C 2PJRA 2Q2TA 2H27A 3IAS2 3OMYA 5CJ9A 3HZJA 3TINA 5BPDA 4DUYH 2E5LH 3KAKA 2XD4A 5D6FA 3BTLA 3ELKA 2G7UA 3CO7C 2ELKA 4AYBE 3K9TA 4QW9A 2DAOA 5C3EG 3VWBA 3IL2A 1DUXC 3ML6A 4HSTA 1A04A 1OMIA 3RIRA 4MV6A 2FK2A 4XKVA 2BHZA 2DI3A 4OIQF 3K4MA 3ZQCA 2A5YB 4TQSA 2KQRA 2KIUA 3PNTA 2YS6A 5FRMA 3QPLA 4G6QA 2QQ9A 4AD9A 2PMZA 3GF2A 3A01A 3FZVA 4BJTA 1DPUA 1Y1VA 3OYFA 2EZIA 2XPUA 4NC7A 2CUFA 1FIAA 2PMUA 4QSHA 5BS6A 4KITB 2LYCA 4RBOA 1N25A 2MLGA 1MBGA 1VQ8I 3BROA 2JPCA 2IPQX 2JA2A 3KZYA 5TGTA 2ZBKA 2ATLA 2RVCA 3IKTA 1X58A 4HDUA 1APLC 3MZHA 4XYMB 4RUAA 2E60A 3BR1A 3RF2A 4O3RA 1J7KA 1ZRFA 3K5HA 4A3DG 2IBKA 1OJLA 3JSLA 3OUZA 2L7FP 3PO3G 2VE9A 2Y0SE 4NQWA 3ECHA 4U88A 2R7MA 2ZDHA 5D1OB 3AL0B 1WFXA 2L01A 1OYWA 4WCGA 1KC7A 2HOTA 2R7ZJ 4OAZA 5IYCG 1MD0A 5IT9K 3KHLA 4XRSG 1FBSA 1YIOA 1XDNA 3QOEA 1SANA 3I56I 3BTCA 1B9NA 2QA4I 2IS4A 1BXRA 5KAIC 4YFNF 1IV8A 1F5TA 2IA6A 4M73A 1HDPA 3OSGA 1RJPA 5LA6F 2X6YA 5FPOA 1I1SA 1EH6A 4IO9F 4RLFA 2HYGD 2KZVA 1ON2A 1ZLKA 1MSEC 1BL0A 5JVDF 4I4TF 1B59A 1XGMA 2M45A 3GV7B 1VQNI 3F8NA 3F9KA 2W70A 2OC6A 1IAWA 4JYKA 2ICWG 3F72A 1IRZA 4ED2A 2FBKA 2VBZA 3VB2A 4Q4ZF 1HNXH 4QW8A 1Z0XA 5KFCA 2FOKA 1NTCA 4LF7H 1HLVA 2XGQA 2CWEA 4A3BG 2Q0OA 3RTRA 3PIOF 4UFZA 5JVLA 2VBYA 4B43A 3FXUA 1Y1WJ 1I50A 4LF9H 2B63A 3LMLA 2ZXWH 5L1KA 1ONVA 4FE7A 3KYDB 2KMUA 1D5YA 2PLYA 3BQYA 1Z67A 4L9VA 4HOBA 1K4TA 3VPCA 4EGQA 2GLOA 3OHAA 5M5WJ 4XOPA 1SMTA 4BDZA 3UFXB 2FPGB 1P4AA 1RRJA 3KAJA 2VJ5A 4ECYA 2V7FA 4WK8F 2W7NA 3HOXG 1Y8QB 5EDNA 1ZQ7A 3EYYA 2FLLA 5LRRA 2VXZA 4JK1X 2O03A 3CP8A 1ZGWA 3Q8QB 5IYDJ 4ZTJA 3OYHA 2M4KA 2F6CA 2XV4S 1CQTA 4KISA 4Y7NJ 4MV8A 4LF4H 5E17F 4PDBA 2VQDA 4PJ0C 3VYSB 1MDMB 4QWQA 2R92G 3TIIA 5FKNA 3ABMH 2O7OA 5FB2A 3LSJA 3DEWA 1OCOH 4LMYA 4UCOA 1WI3A 1UG0A 3FXKA 5T14A 2R7QA 3S15J 3JCUC 4RNMA 4ZHQF 4ECRA 1YJ9I 4UV8A 3BLYA 2FNAA 3PSFA 1ZLJA 2QKLB 3LSKA 2FK1A 1H88C 5E1XA 2DA7A 2C2DA 1UNNC 2ASLA 1AN7A 1OKRA 3GUDA 2E5ZA 4EGZA 4KMFA 3HOSA 1RETA 4B3MH 1HBXG 2DLNA 4MAMA 4QJFA 4BJ6C 2PG4A 1CQJB 3T5XA 4EV0A 5LEKA 1IC8A 2R86A 3TDZC 1REPC 4ME6A 1U5TA 2MLKA 3OR1C 3H3UA 4I2OA 1KU9A 2P6SA 1WI9A 5C8YF 1D3YA 4F4ZA 1T33A 2E2JJ 4LG3A 5KHDA 4ZDLA 2E2HA 2HKOA 3VEPA 4MV7A 2CFXA 3GTKJ 5DGBA 3CJTB 5KFSA 3GIKA 3RGZA 2VKHA 1Z6TA 1TWAA 2A05A 1G3YA 3KP2A 1Z2PX 5D1OA 2QLZA 4XLEA 5JLWA 2WAEA 3BG7A 5KNLA 1OCTC 4UXNA 1DU6A 1CE8A 3OS1A 2D1HA 3BCAA 5CA1F 2BE5F 2LTPA 1WWXA 1TQMA 4B8XA 4DW6A 2YW2A 3M9NB 4Y33A 4ED1A 2UVVA 4ECXA 3HTUA 2M1BA 2W71A 1I3QJ 3FXQA 4IWXA 5KG3A 1YW8A 2XRNA 1AUXA 1FVIA 5ILUA 4C2MJ 4PSWA 3J7AY 1USSA 1KQ8A 1K6YA 4UB6C 4E70A 3JSOA 3RUPA 1B6AA 4CC5A 3KHHA 4F93B 1BIBA 4ED3A 1N78A 2OD5A 1SC7A 1UMQA 2W6QA 4HAMA 1BOBA 4FHTA 5KT7A 1X4OA 2BY1A 4M9UA 4O2AF 3KTMA 5JI6A 1KJ9A 1K83A 4G7HF 3LWBA 5HLHA 3L2WA 2DPUA 3BG6A 2FF4A 4M72A 2R7NA 1TWCJ 4IZOA 1SFOA 1UJ8A 2D1VA 1BOAA 4OIPF 4X6AJ 3CP2A 3A2KA 4IRCA 4U7DA 3DWLE 2EB7A 1LEAA 2LREA 4JI2H 3IH2A 2NXNB 5IYBG 4XNFA 5F27A 4C3IJ 2VQEH 4UCUA 2UXXA 2GPSA 1JDEA 2NU9B 2ID3A 2H1KA 2W4SA 2X1DA 5K5OA 4U7CA 1M0TA 3BJAA 3F8FA 4YEJA 3J81W 2ELJA 2K9SA 2EJRA 3EPZA 1FOXA 2LY2A 2C22A 4ESJA 5HODA 2P5LC 4DGWB 2CQQA 1S7EA 2KHMA 3FHNA 1V4YA 2W6OA 1GYFA 2DT7B 3MZYA 3SJMA 2LP0A 4A2AA 4YAKB 4FS2A 2G9WA 2DMTA 3GV8B 3AKZA 1MH4A 4U7BA 1V54H 2X1EA 3CUOA 4BHBA 1RYRA 3GTQA 2WTFA 2FD5A 1E3OC 1U3EM 3HGYA 2WC2A 2K02A 1BJZA 3R61A 1LDJA 2UWMA 2KT0A 2AQ4A 3U9GA 3FDSA 3TEDA 5ICEA 3VYTB 1FZPB 1MJBA 3MMYB 4M9ZA 2EPFA 4BBRG 5CB4F 3H9GA 1T39A 1NG6A 4M3FA 3FX3A 2OWOA 1X2NA 5LMNH 3VSKA 3PO2G 5CQEA 4H0EA 5J4VA 5EZGA 3BR6A 3OYLA 3N4MA 4KHPH 1MNDA 4OMYA 5KFXA 4DV5H 1LKXA 3J7ZI 4J00A 2V1DA 4RGUA 2HQAA 2VOBA 3M1EA 2FSWA 3PN1A 4JI1H 4KN7X 1R9TJ 4B3AA 1HNWH 3I4MG 1XG1A 5EEHA 2ESNA 3G6EI 1EHIA 3PW5A 1RPWA 3M9MB 2XAGA 2K3PA 3V8JA 3KFWX 3MKLA 3HB9A 1K4SA 3S14J 4U0YA 1YQAA 5FRNA 2R93J 4B44A 1PP8F 4R1HA 2XC9A 5HLTA 3CDIA 3GTPA 2Z2SB 3RZOJ 2L3DA 2E2IJ 1MGTA 2VA3A 5KT2A 2JUCA 1MNMC 3K70C 1P8LA 1B4AA 2M0CA 4LSAA 1BA5A 3V7CA 4GKKH 1DIKA 2VN2A 3V6KA 4EGJA 2P7VB 2JWTA 3ABUA 4PDKA 5D5WB 1AKHA 1GSOA 3N44B 3RYRA 4BBSG 4G12A 2E5NA 3EUHA 3R5XA 2H8RA 1QRYA 2GOXB 3HC7A 4MLOA 3GWZA 3JRIA 5LL6b 2AGPA 1HXDA 4EEFG 2CGPA 2K27A 2ZMEB 3RPUD 5K7HA 4E7KA 4F50A 5KFWA 2FLPA 2ZXJA 4J9RA 5FFXA 1Z2OX 1JUSA 2BVLA 3A0BC 4IEJA 3JTGA 2W9CA 3V4GA 1S6LA 3E97A 5K5QA 5I47A 3LFUA 4EM2A 5LRSA 5E3OA 2HJWA 4UCTA 1SVLA 4F92B 5KFHA 4LOCA 2KP6A 4E6KG 4DYCA 3JAMK 1DU0A 2R7KA 3AG4H 3OV8A 2Z16A 3IAM2 4P96A 4FETA 3H5AA 3BZ6A 3WGHA 4ED8A 3E6MA 4GCVA 3RAQA 5EDWA 1WJDA 4G7OF 2CQ7A 4DL5A 4FBUA 5EG0B 4XR6A 2IS2A 3FKIA 3HOVJ 2W57A 4DR2H 2DO7A 4IHJF 3G73A 4U6PA 3HJEA 5LMUH 1N36H 2BV6A 2H94A 5ICCA 1NK2P 3DLAA 2EFPA 1HOMA 4RLQA 4I7HA 2DW4A 2XAUA 1K78B 4Q45A 1S10A 2QQBA 2EK5A 2WADA 3BC8A 3SQNA 4ZQIA 2F5CA 1TWHJ 5D8DA 4Y8VB 5IT9W 4A93J 3JSPA 1I6XA 2OTJI 5KG6A 4S05A 2W8KA 3GMEA 1ZREA 2TRTA 2VBXA 3F6VA 1J9IA 3TO9A 3H0DA 2VJJA 2YRXA 5F9NA 1IRXA 4B48A 3KEYA 4XM3A 1ZTRA 2CRGA 1ZR2A 1QVTA 3Q1KA 4OIRF 2ZFWA 2KFDA 4FASD 1P7JA 3EDPA 4HV6A 3VSLA 2R8HA 2BXZA 5HNFA 1VF9A 2HI3A 5HDGA 4AU7A 4DR1H 3K1PA 1GLNA 1YW9A 1OCCH 5E20A 5KFOA 3M4OJ 2HQNA 2XF5A 2E34A 4LB6B 4RB3C 1GO3E 4HBLA 5BR8H 1YJWI 1TTYA 3M9OB 4KIFA 2NUAB 2LOOA 3QOPA 2JA6G 4DQ2A 4C3HJ 4UUTA 2I80A 2DOAA 4CICA 2K7LA 3OS2A 4CDGA 2J5PA 2DDBA 5EYRA 4QPQA 4IKFA 1T95A 2V9KA 2V9WA 5IOZA 3FK6A 3W2AA 2WDTA 3PJRA 4FBTA 2ISYA 3NRVA 4AC0A 3AG2H 2EIKH 2LFBA 4BUPA 1BGWA 4JI5H 3CCYA 2YSRA 5CLSA 4MNUA 3QYBA 3KCCA 3OS0A 2P5KA 5M5YJ 4A3DJ 1F43A 5KFPA 3I64A 3KHGA 4DL4A 4A3MG 3BT9A 3UKGA 2EINH 1UELB 5KFMA 1DP7P 4V19K 5K7ZA 2CU7A 1HW1A 1SMYF 1NHAA 1YOVB 4M6XA 4LIVA 4HNVA 5DS9A 5BOXA 1EUCB 5DLGA 4RA2A 1R71A 3M8EA 1FTZA 3ZPLA 4APMA 1Z3XA 2LVSA 3FXJA 4CSWA 4EBEA 1O3RA 2HVRA 2ZM6H 2L9SA 3H1CA 2HZDA 4LF6H 2UZKA 4Q44A 2WTEA 1RZ4A 4NDLA 3B73A 2LY1A 4JQFA 1TT5B 4BY7G 3BG5A 3HXLA 3Q3SA 2UV1A 2LBFB 3K5IA 4IRKA 1SD4A 3QODA 1SAXA 4E7JA 3RBEA 2D2WA 3MEXA 2GWRA 3CC2I 3GTMJ 2F5VA 5FLXW 3PR4A 5D4SA 2K5CA 3OYMA 4KJZA 5E1WA 4WD3A 4JX5A 5KG4A 3BJYA 3BG9A 3JR9A 2IMWP 4DR6H 2UXDH 5KFQA 1ZG5A 5C4XG 4C30A 1W7PD 3NWSA 4PGGA 2CO5A 4BXUA 2CUZA 2DMPA 4EEQA 5JUMA 3UNGC 5EGOA 1GGOA 3U2RA 2QENA 3FBNB 5FFZA 1JIHA 3I3LA 3K2AA 4XKCA 4QIWE 5DLFA 4A69C 2V4QA 4XICA 2DK5A 4XMYA 1IZ1A 3V8KA 1SCUB 2BQRA 2OLSA 5F6FA 3WG9A 4XYLB 1KYWA 1Z7UA 4R8HA 1WH5A 3K3PA 2Q1ZB 2ZFUA 4DR7H 4GXOA 4Q8FA 2OZ6A 1K78A 3HOZJ 1PUFB 1WKMA 2XCAA 1RI7A 2CV2A 4AIDA 3KP5A 1KA8A 1YLFA 4P9UA 1UHSA 3HBLA 4UVBA 1G4DA 4LF8H 4DL7A 5KFDA 3WODF 1IUFA 1ZKGA 4WXDA 3K7AJ 3J80Z 5CQGA 3TOBA 1ODDA 3MR5A 2JVHA 2R92J 2ISZA 4XLPF 3CQZA 3PW2A 2PEXA 4JP0A 1TNSA 2DFFA 3DKXA 1NK3P 3HOUJ 2E71A 3GTLJ 3MN2A 5IWAH 5J1RA 4ITVA 5HNHA 4XN0A 3DTEA 2YX7A 3DBHB 3CDLA 2FK3A 4MFEA 1Y1VG 3IP4B 3ESWB 4FX4A 2DA2A 4G6TB 2F4OB 2ELHA 3LA2A 2RNGA 1N34H 5HS9A 3OYAA 2FA5A 3V6HA 2AHQA 5LGNA 2ZXHA 4A3KG 3GW2A 4LITA 4XKBA 1T0FC 5DYMA 3CD6I 2R84A 3HG9A 3SFZA 1WH7A 5EWFA 4NXNH 3HKZA 3JSNA 3E1SA 3E6CC 2JT1A 4NC6A 1LUJB 1ZELA 3W6KB 4XBFA 4RU9A 3RYPA 1A35A 4I6ZA 3C7JA 4I02A 3HPGA 4FISA 1T8IA 2K4JA 1Y56A 2L2OA 4OOIA 1KJ8A 1BJAA 4A2UA 3A4CA 3HOWJ 2M8EA 1EYZA 2DOFA 2E1OA 5D5VB 2JZYA 2XSDC 3JZIA 1SVMA 5HOOA 1CGPA 2VQCA 1ORKA 1R23A 2QWWA 3A1YA 1R5ID 4IRDA 2NVYA 1SD7A 3DPLC 3M3YJ 4UCSA 3HPHA 2QYZA 5B1BH 2A6HF 4LB5A 2Y0MA 2GLTA 1S8NA 4FX0A 2CYYA 4UHTA 1SFEA 2VKDA 4YIFA 3K69A 3TL4X 2R7FA 3IUOA 1VTNC 3LQRA 1VQ7I 2R7XA 1FOWA 5A2QW 3OTOH 1UAAA 1ZG1A 3OL3A 1ZH5A 3BA8A 4MV1A 5J40A 2K9LA 3ASOH 4O3NA 1ETOA 4QWBA 1ITYA 2L9VA 2W7OA 3RJ0A 2GZWA 1OCRH 3ZCOA 5FKMA 3DV8A 1UHMA 3I71A 1I7NA 2UXNA 4ENNA 4HQ6A 4E7ZA 2XPWA 2BZTA 4O4HF 4JI4H 2AGQA 3H36A 2E1NA 1BIAA 2FBIA 2B63G 5EOYA 1YX3A 3EUAA 3DP7A 2BHYA 4PCQA 1QQIA 3FMSA 3E0JB 4BEHB 3K3VA 1L2ZA 4EJWA 2NS8A 3KX2A 4LH7A 3BA9A 2ID6A 2VQHA 1U78A 4F3QA 3M7GA 5HDNA 1HW5A 2M5WA 4MA5A 2BQ3A 3RI4A 1VQKI 1DGWY 4ECUA 1W4MA 4JI3H 1UZCA 3ZRGA 3H3VK 1JTXA 2CQYA 4BWSC 1W96A 2FJ1A 4GRIA 1G6NA 3OYKA 3ZMZA 5L3DA 4BH9A 2NVQJ 2HVSA 4F7ZA 2O5RA 2V1NA 3CMAI 1JKRC 1A6IA 5FLMG 3U1DA 4A6DA 1IN7A 3C18A 2PMZN 2VE8A 2QF7A 3WHBA 2DU9A 1DDNA 5EWGA 1PUFA 3HUGB 1OR7A 3F3XA 3GLXA 2FMLA 2VR1A 3MWDA 1RR8C 2MFZA 2RC4A 3BAAA 4B3SH 2W82A 4GC6A 1YG2A 4XIDA 1F36A 3IWFA 2P8TA 4ESFA 3TQTA 5L1IA 3H0GA 4IJAA 5JVTA 2KDZA 3Q8SB 4M7EA 5J47A 2EV5A 2QSFX 2M2EA 1OYIA 2OCCH 2WY7Q 4XRMA 3JAMW 1XNQH 1KEEA 2PN1A 2CUJA 1ETKA 2E35A 4BBRJ 4CYCA 4RM2A 1WCMG 4DR5H 1UHWA 2V79A 4N4OB 1W1WE 2VUMA 3PO2J 1ZYRF 1WJEA 5DCFA 2EFQA 4CYDA 1BJTA 5EJCA 2DT6A 2NAZA 3FM5A 4G9YA 4EGYA 1O7FA 1SYXB 2C35B 4ED7A 1GXPA 2XKOA 3O8HA 2E1MB 2W84A 3I4MJ 2K9MA 1W93A 3TIGA 3DF8A 2JQ7A 4MGRA 2HPIA 2JA5G 4IF4A 4CCLA 4A3IJ 1W5CC 2UU9H 1MBJA 1I5ZA 1VNDA 5F0CA 2M9HA 4C2MA 2UXBH 4RGRA 3VOEA 1K79A 1XB4A 5D5XB 4LFCH 2KZGA 4OU0A 5KK1A 2C00A 1ZETA 3KYCB 4BXXJ 4YR3A 4BE2A 4X62H 3ZQIA 2VOOA 4OMZA 3ZN0A 2XGEA 3DEUA 4UVCA 2JMWA 3MZ8A 3T8RA 2ZC2A 3OYJA 2Y9YA 1V3FA 4Q0YA 1FKAH 2HXOA 4E4TA 4EFBA 2W7PA 5HV6A 1JGSA 4JUZA 4HQEA 2EV6A 1JKJB 1G3SA 1U9OA 2GQQA 3GFMA 4R79A 3Q5FA 5L3FA 3JRDA 2ZNZA 5C1OA 2F4MB 1LVAA 2AQFA 5FKLA 2W9BB 2JTVA 2V4JC 5IP7G 3W6JB 3HOYJ 3E5NA 1JHHA 2OF7A 3EPIA 3QAHA 2VC0A 4GYGA 2XKPA 1U8RA 2VT3A 4KDPA 5HBRB 2FOWA 4ECVA 1N56A 2JEFA 4DL6A 2OH2A 1DGSA 2GXBA 1D1CA 4M71A 4EBCA 2R7OA 2VA2A 2XGCA 2FJZA 3RPQA 4WF2A 3O6BB 4ED6A 2I8CA 1JE8A 3L2CA 2FPPB 4ABZA 2F4IA 2AGOA 2O3FA 3KP3A 1B33N 1QNTA 3OSNA 4DBQA 5DG8A 1QPIA 4DV1H 2JEGA 4UY8I 3WE2A 4HSRA 1KONA 5F0HA 2LD5A 3H3VH 1MH3A 3I55I 1A36A 3MQ0A 3E6BA 1MSFC 3LL7A 1R7JA 1W0TA 2EBIA 1LQ1A 5D1PA 2WB1N 4NC8A 1ETYA 2QCOA 2JA8G 3F22A 3MWMA 5ED4A 3G8CA 4KNYA 5JQWA 3BTJA 5ICGA 2CJJA 2M34A 1SFKA 3OOUA 2F5EA 1XX5A 2X0SA 4DYRA 2V9PA 4A5MA 2IP4A 3D0SA 1KU3A 1R9TA 2F5DA 3IRQA 4J9QA 1BN5A 1LDDA 3QZ7A 2ZNYA 2PBIA 3JRWA 5FO5A 2HXIA 2BW3A 1B6RA 1QZZA 2HKXA 4CCOA 2O9LA 4L0ZB 3V7SA 4KN4X 2JA6J 5KFLA 3LOCA 3OWTA 1IF1A 1KU2A 1KU7A 2YS7A 3RV4A 1ON1A 4ECQA 3OL4A 3PVXA 2HHHH 1LFBA 1Y0NA 2XPVA 3JRGA 3RB0A 3A03A 1C3OA 2SCUB 2N8GA 1T2KA 1IRFA 3DTKA 1FBQA 2WBMA 5KFIA 5B5EC 3RQIA 3I53A 2V59A 2MH9A 2Y2ZA 5KT4A 4QWAA 2KRHA 3NGDA 2XAHA 4JYAH 4BXFA 4QWDA 1YITI 2OPTA 3BJOA 3AG1H 1RKWA 3SZTA 1LFUP 2CG4A 1YI2I 2JEJA 3DQVC 4ZJZA 1SEIA 4YY3H 1FY7A 3LAPA 4WXCA 4AWXB 3FMAA 1XMOH 2V6CA 3MKWB 1QA6A 4DR4H 2YX4A 2MA3A 3L2RA 2BY3A 2Q8KA 3CMYA 4C2TA 1O3TA 4XL9A 1HR0H 2WB1A 5CVRA 3RFCA 5C44J 4L1KA 3C2BA 4I99C 3IHUA 1O3SA 4CA0A 1I1GA 4ENJA 1HKQA 4B47A 3IRRA 5KFKA 3LSHA 1VQPI 2NS7A 3K10A 4O3MA 3ZR8X 1X1AA 2QK4A 3PM1A 5FJ8G 1T36A 5GTIC 1SEUA 3GIJA 2KLOA 4EJOA 4BY7J 5CA0F 3C3WA 3FWEA 1WSCA 4TV9F 3N43B 4JBAA 4S04A 3N8DA 4DV6H 5D8LB 4FE4A 4DV7H 2KJBA 4DR3H 2XGPA 2W9BA 4P5OA 4HLYA 1TWHA 3VYRB 5JH7F 4YIIA 4IHTA 1W0UA 1EZ1A 1ZHSA 1QHGA 5C4XJ 4EMSA 1JX4A 4D5CA 3MR6A 3MFKA 3W3CA 1F4KA 4EM1A 2JN6A 3FKIG 1S68A 3H5NA 1ZG3A 4YJ2F 4MO7A 3OSFA 2R7SA 1XMKA 2O0YA 2DPIA 3WNZA 2FNPA 1I6HJ 1AUVA 1BC8C 3U1KA 3BQZA 5C1PA 1MIJA 2Z3YA 3OHBA 3PZPA 4MV9A 5B1AH 2L4MA 3S8PA 3VPRA 2HOSA 1HKTA 2DYRH 3L2PA 1XDUA 1VQ9I 1VQ4I 2E36A 1MMAA 2YS9A 5L1JA 2A3SA 1H9GA 4OWRB 4B3TH 5LHIA 2ZDGA 5TISC 4B3RH 3S32A 5JFRA 1HNZH 5GPAA 3B02A 2IS6A 2AXLA 3GBGA 2VLAA 1GSAA 4RAZA 3Q8RB 1U5TC 1YO5C 2ZJTA 2COBA 4IOAF 3RPUA 2HYFA 2FUG2 4BQQA 4O3PA 1UB9A 3W6VA 3H40A 2V6EA 1P2FA 1FYMA 2R4GA 2NVTJ 3ROUA 3N6XA 3K4LA 2PX9A 3AG3H 3LA3A 4BKXA 2MGQA 4BQAA 1W7PB 1TBXA 1H8AC 4Y52J 2DTZA 4M3DA 3PFIA 5KFZA 1PUEE 1HA8A 5ERIA 4E7SA 3KP4A 1O3QA 2CQKA 4JV5H 4ESBA 1P4WA 3WTTC 3B6CA 4BNCA 4A3KJ 2K9NA 5LD2C 3Q0WA 2NVXJ 2IA2A 4A3CG 3RKXA 2GOMA 2X48A
chains in the Genus database with same CATH topology
2GA2A 1N33H 2HZTA 3LWFA 4A0YA 5K5RA 2Z33A 2DBBA 3EQLF 1MDMA 1XGNA 4ETSA 2DPDA 2YCHA 3CVZA 2QZ8A 3KLNA 2XAFA 4A0XA 4M74A 2FEZA 1R1UA 4Y17A 5CVVA 1T6SA 1F1ZA 2K4BA 2HEOA 4MTDA 3KEQA 1FSEA 1BBYA 3RDIA 4YFXF 2WE6A 2Y48A 4RGXA 3CDHA 4BAYA 1Z91A 5LGUA 3CUQB 3M8FA 2EFNA 4LGWA 5J6XA 1O7LA 4U0WA 2OAZA 5ILSA 2VQFH 1VS0A 1CF7B 4ENMA 1FWZA 2PMHA 2L4AA 4ENKA 2UUBH 3H3ZA 4K2EA 2BYVE 4LFBH 3ZN1A 1U2WA 2STTA 1IRGA 2IP2A 2L02A 1LDKB 1IXRC 2STWA 2E1CA 4DV2H 1R1VA 3GFIA 6PAXA 1IUYA 2HVQA 5H20A 3GVAA 5DEQA 2F2EA 1XCVA 3L09A 3R0AA 2PI0A 1J5YA 3I0TA 1STZA 2MCTA 3ZMUA 2KSWA 2QBYB 3GZ6A 4OX9H 4IAJA 3H20A 2HGCA 2XGXA 2A68F 2VUGA 1ZGAA 2O8XA 1ZHQA 2ACJA 2OU2A 3I4PA 2XAQA 4D0PA 3DFGA 1R1TA 5L3GA 2HS5A 1X9NA 3LA7A 3HHHA 3CTAA 4B09A 2XVCA 4L18B 1EV7A 4I0AA 3O3KA 1Z05A 4J0MA 1OPCA 5FPRA 1FBUA 1RNLA 4EJUA 3J7AK 2KIFA 2FQ3A 1JXSA 3HSRA 3I54A 3HRTA 2IA0A 3CUQA 2EFOA 3KP6A 4ZYDA 2ZCWA 3ZMDA 3T1HH 4X65H 4EJVA 3TO6A 1R58A 2RGVA 1IN8A 4I09A 1FOKA 5J8FA 3K0LA 3ECOA 1P6RA 1FSHA 2ZMEA 1P4XA 4QLCU 2OQGA 2OZUA 4G94A 1SD6A 3DPTA 1RIOH 1DPRA 5L3BA 3L7WA 3ABTA 2JRTA 4HV5A 4M9SA 2PFBA 5J8CA 1IBMH 3HYIA 2IRFG 2HOEA 1XN7A 5LBQA 3JTHA 3P9KA 1YFHA 3G3ZA 3C0FB 4XLNF 4Q5SF 2OQRA 4BYYA 1T0FA 3KXYT 2QBYA 5DUKA 4BHCA 4UV9A 4ZZDA 2TDXA 3BWGA 5DCMB 2W85A 1S3JA 3E3VA 3TO7A 2RGRA 1BI3A 4RB1A 3IG0A 3Q9SA 3GX4X 5FGMA 1TQPA 3ZQ7A 4L5JA 4U0VA 4IXAA 4IRHA 1LB2A 2EWNA 3LQQA 1ZAOA 1FX7A 1TQIA 2BGCA 4BHPA 2W25A 3HRUA 3BDDA 2OA4A 3N40P 1QO0D 2GAUA 2NRAC 2YPRA 4X66H 3I58A 4LLLA 4CC6A 1X3UA 1TW3A 2IT0A 3TKYA 2QUFA 4GKJH 5HS7A 3QRFF 4HYEA 5H6QA 1B9MA 2XIGA 3SHFA 1WH2A 1F9NA 5F64A 4IVNA 4HDVA 1T38A 2P4WA 1AWCA 3IC7A 1ZRCA 4L0YB 1R00A 1XSDA 3HRMA 1J5EH 3HIFA 1IBKH 3CO6C 2IW5A 2C6YA 2R7DA 4P55A 2KRFA 3OOPA 5D5UB 4N9IA 4PZJA 2F5FA 1A0IA 2EFWA 4X64H 4CZZA 1S7AA 1XMQH 4DV4H 2K86A 2V1XA 3WTXC 4CHUA 3JW4A 2Y75A 1O75A 1XNRH 4EM0B 4O6JA 3WTUC 3PQJA 4LFUA 3DF7A 4ZZLA 5LGTA 3HSEA 3IWZA 4DV0H 4R7RA 4A12A 3WTYC 4I98B 4MEYF 3J80K 3COAC 1LEBA 2LF8A 3CJNA 3REOA 2RNJA 3KLOA 4KIBA 5TJJA 3ULQB 4EFEA 4NB5A 5HDKA 3KALA 4HX7A 2EA4A 4MEXF 3KE2A 1YYVA 2B0LA 2MD5A 4NHJA 5H6RA 4CXFA 3M4IA 3GFJA 3WTSC 1T98A 4GO1A 2UUCH 5HLGA 1IN5A 5FLXZ 2ZO4A 2XAJA 1Z9CA 2CW7A 1R5HA 3S2WA 3WTZA 5DD4A 4I01A 1WSUA 2A6EF 2BEOA 2CW8A 5JR3A 1TA8A 3ZMSA 1U6GA 2OBPA 2COMA 4JI7H 1KQ9A 1U5TB 2VOPA 5BMZA 4MQVA 3EETA 2HTSA 2AS5F 4DV3H 4G7ZF 1S7OA 4ZH4F 2DQLA 3R6SA 3TOAA 4Y15A 4IPAA 3TQNA 1OYYA 5TRDA 1FP1D 2FE3A 2DQRA 3BJ6A 2O6GE 1H0MA 1B04A 2WYOA 4EQQA 4EVIA 3BPVA 1B1BA 1FYKA 1EH8A 5HLIA 3HUGA 3GFLA 1LJ9A 2GXGA 3CLOA 1I94H 3T1YH 2XHKA 2H6CA 1MJAA 5E1ZB 4OINF 4UCRA 1XD7A 2UUAH 5AONA 3R4KA 3FMQA 3L00A 2VC1A 2G7HA 4CGZA 3TGNA 1RUNA 1XSXA 1E17A 1TNTA 2L54A 3FHZA 3HOTA 3KZZA 5A2QZ 3J7AO 4KMUX 1K7AA 1ULYA 2D45A 5DD8A 4LK1F 4HLXA 3GEZA 4YFKF 1N32H 2GA1A 4G8XA 3F23A 3T0YA 1L0OC 5FD6A 2F4VH 2NYXA 3UQ8A 1D8JA 2A69F 4G6DA 1KGSA 2CW0F 1SFXA 4L5IA 3E6DA 2IJLA 3K2ZA 3RTXA 4HX8A 2MC3A 1E4FT 4JI0H 4L9JA 4M9XA 1FC3A 3WTWC 4A6EA 2A07F 2PN6A 3FM3A 5FLXK 2HWVA 1BI1A 3L4KA 2KKOA 1HKSA 1HQCA 4RS8A 1GXQA 3WU0A 1R36A 4KUMA 3BABA 2LDUA 2HGSA 3HTSB 4LLGF 4Q48A 3I59B 4A0ZA 2QM3A 4RB0A 4L9NA 1FJGH 4Y13A 1YTYA 3JAMZ 4LG0B 4FM9A 1ZGJA 5JHUA 2JSCA 4ON0A 5HVQC 4RZQA 2IA1A 5AIPA 3P9IA 5KVRA 1ZN2A 3RJPA 2WV0A 5EEGA 1I6UA 2DFIA 1Z1DA 2NNYA 4M6YA 3H92A 2LKPA 4WXHA 3IKVA 5LEJA 2Z99A 1KYZA 1XMAA 2WWYA 2V9VA 5L3CA 3WTVC 4MTEA 1FNNA 4RGSA 3HHGA 4JI8H 1GHCA 1E4GT 2O61A 4LK0F 5K1YA 4ZYGA 2HTJA 3GZ5A 2QYOA 3I5UA 4GYIA 5IT3A 3RKWA 4OIOF 3WU1B 3FMRA 1HSTA 4IRGA 1YS7A 5A2QK 3J80W 2X4HA 1HW2A 3LSTA 3QPTA 2VODA 4NXMH 1WQ2A 4AIHA 3P7NA 2J5OA 1UCRA 5D6EA 2ADUA 3QP5A 3L4JA 1MZBA 3MCZA 1QBJA 4LSXA 2QQAA 1IXCA 1IN6A 4HX4A 3LFKA 3WGGA 2KIMA 3R60A 4WWCA 4HA8A 4UCVA 5L3EA 2E7XA 1J59A 1FT9A 3E5QA 3F21A 2Z5UA 2DT5A 4N0BA 2XROA 3DXJF 4A5NA 3I59A 2EA2A 3SZPA 1J75A 2UXCH 3PQKA 1IXSB 4LG0A 3RGXA 1FP2A 1TAEA 2MBFA 1BM9A 4MQ9F 4UVAA 3N42B 3N97A 3QPHA 4KYWA 2FXAA 1FLIA 1W7PA 1V9PA 1MKMA 1QZYA 5BQTA 5HS8A 3FF5A 1KQ0A 2R3SA 5DUIA 1PP7U 2IVMA 4ASNA 3QP6A 1EH7A 3E5XA 3DKWA 2W24A 3T8TA 4JI6H 3O2PE 4P9FA 2NNNA 2ETHA 4KA4A 4RAYA 1K6OA 4YG2F 2ZKZA 4AIJA 1S29A 3ERED 1R5GA 4HZFA 4AQYH 2DK8A 1M0WA 1D5VA 1O57A 1XGSA 3E5UA 1QPMA 3KETA 4GLXA 2LNBA 3VFZA 3MAJA 3V7RA 3GXOA 2Q2UA 5LLQA 3D5LA 3SXYA 2YR2A 2H6BA 2VT2A 2RKHA 3F8BA 5E8IA 1YS6A 2RN7A 2RQPA 2VPSA 5D4RA 1TW2A 2HR3A 4LF5H 1ZRDA 1CF7A 1G3WA 2LSOA 4N9HA 4LFAH 1USTA 1Z2NX 1L3LA 3VODA 2Q2EA 3KP7A 3QU6A 4HF1A 3J81Z 4TV7A 1XDSA 2RDPA 4FT8A 3QU3A 2M30A 3NQOA 4LJZF 2VONA 3Q9VA 3FXRA 1FYLA 4PGHA 3CUQC 3GYHX 2QVOA 5CVIA 2GIVA 4HW0A 4LH6A 4AVPA 1UFMA 1LNWA 1I27A 1W5SA 5FD5A 3C1DA 4XSXF 1IW7F 3WE3A 3BP8A 4EJTA 2FU4A 2P6TA 4Q47A 4KT5C 5LHHA 2VBWA 4IRIA 5CVJA 4UNOA 1R22A 5E18F 1G3TA 3F6OA 3HRSA 1E2XA 1IBLH 4KIGA 3KEOA 4ZYEA 1C0WA 1WRJA 2YU3A 2A61A 1XSVA 4AIKA 1P92A 3HSFA 2JPBA 1AOYA 1Q1HA 1TLHB 4GGGA 3BOQA 4KFCA 3N41B 1ZHFA 2DLLA 2XUBA 1HSJA 4LLNA 4RB2C 1H9TA 3EYIA 4DNCA 1Y0UA 3TDUC 3M9AA 4A2BA 4CO8A 5LHGA 2PJPA 3NEUA 4Z2YA 1RUOA 5DDGA 5CYVA 3ZMTA 4HF0A 3K1NA 2FRHA 2LF7A 4KICA 4LD5A 2HDCA 1ZARA 2FBHA 1J0RA 1IN4A 3R0JA 2HQRA 1SFUA 4IHSA 4DR2H 2HFHA 2P5VA 2E7WA 3F8CA 2V1UA 4UUVA 5F1RA 5DV5A 2H09A 5IT9Z 4HF2A 4WX9A 3RIZA 4HQMA 4XRFA 5ILVA 1JHFA 3WGIA 3BY6A 2M87A 1PDNC 1MJ9A 4MHGA 2Z9OA 5BPIA 2NS0A 1SD5A 5CVUA 3J81K 2XASA 4K0KH 1FPQA 1XCBA 1BC7C 3V8LA 1BI0A 1J2XA 2CSOA 2ZJ2A 4XSZF 3ISPA 1Z6RA 5ICFA 3T1BA 2X0LA 4L9TA 1BI2A 2P7CB 2PQ8A 2ESHA 3P9CA 5DCMA 3RKYA 5E8GA 2DTRA 2BBYA 3ZMVA 2MH2A 3AAFA 3L9FA 3BPXA 3GO5A 1YW7A 1W5TA 5AIQA 4DUZH 1GVJA 1D8KA 2FMYA 5D8KB 1S03G 3F8MA 1XGOA 4I0BA 4YHHH 4O5VA 2RV8A 3ZP5A 4ZYHA 1V4RA 1QGPA 2EV0A 3LAJA 2KJCA 3K1MA 2Q2TA 2H27A 5CJ9A 4DUYH 5BPDA 2E5LH 3KAKA 5D6FA 3ELKA 2G7UA 3CO7C 3K9TA 2DAOA 3IL2A 1DUXC 3ML6A 3RIRA 1A04A 1OMIA 4OIQF 2DI3A 2A5YB 2KIUA 4G6QA 2QQ9A 4AD9A 3GF2A 3FZVA 1DPUA 2PMUA 5BS6A 2MLGA 3BROA 2JPCA 2IPQX 3KZYA 2ZBKA 2RVCA 3IKTA 4HDUA 3MZHA 3RF2A 1J7KA 1ZRFA 3JSLA 2VE9A 4NQWA 3ECHA 4U88A 5D1OB 2L01A 1OYWA 4WCGA 1MD0A 5IT9K 1FBSA 1YIOA 1XDNA 1B9NA 4YFNF 1F5TA 4M73A 5FPOA 1I1SA 1EH6A 2HYGD 1ON2A 1ZLKA 1B59A 1XGMA 2M45A 3F8NA 1IAWA 3F72A 1HNXH 2FBKA 2VBZA 3VB2A