1MZBA

Ferric uptake regulator
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
134
structure length
133
Chain Sequence
MVENSELRKAGLKVTLPRVKILQMLDSAQRHMSAEDVYKALMEAGEDVGLATVYRVLTQFEAAGLVVRHNFDGGHAVFELADSGHHDHMVCVDTGEVIEFMDAEIEKRQKEIVRERGFELVDHNLVLYVRKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ferric uptake regulation protein
publication title Architecture of a protein central to iron homeostatis: Crystal structure and spectroscopic analysis of the Ferric uptake regulator
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Gene regulation
total genus 36
structure length 133
sequence length 134
ec nomenclature
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mzbA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1mzbA02
3V8JA 3ZMUA 2E1CA 4NB5A 1FOKA 2XIGA 3KFWX 5BPDA 3DEUA 3H92A 3RYPA 4R79A 3KEOA 1W4MA 4AIJA 1O7LA 1ZRCA 3ULQB 2ZJ2A 2DK8A 1BI0A 2VC1A 3CO6C 5A2QZ 2O0YA 2GZWA 1DPRA 4KUMA 2JPBA 3DKWA 1G3WA 3KETA 2VOPA 1BI2A 1J9IA 5DUKA 1U2WA 2PFBA 4Q47A 2P6SA 1USSA 3ABTA 4AVPA 4UHTA 4A12A 3GZ6A 1R00A 2H09A 2O3FA 5FFXA 5JI6A 1B9MA 4M74A 3CO7C 3GYHX 4G6QA 4Q4ZF 2EFOA 2CG4A 1T6SA 1VTNC 3RKYA 3BJAA 3WU0A 3FXQA 2VXZA 1ZGAA 3FX3A 5DEQA 4EMSA 4NQWA 3DFGA 5ICEA 3ERED 1SFEA 1XGOA 3I71A 1UHMA 5CVIA 3DV8A 3P9KA 3MAJA 5FB2A 2R7FA 4ESFA 2M87A 3ZMVA 4GYIA 2EFWA 2EV5A 3J80Z 1R1VA 3I5UA 2XASA 4BQAA 2ZMEB 4B8XA 1OMIA 3WTTC 4HW0A 2RC4A 4LK0F 5ICGA 1V3FA 4HDUA 4CZZA 2BE5F 1YTYA 2MLKA 3DF8A 2IP2A 1XCBA 2IW5A 4CICA 3T1BA 3EUHA 2QQBA 2NS0A 3FXRA 1LVAA 4HQMA 3QRFF 1MJBA 2FMLA 1I6XA 2ZCWA 2FXAA 3SFZA 2FE3A 4PGGA 2QWWA 1E2XA 3V7CA 3J81Z 3QPTA 1IUYA 4P9FA 1FNNA 1G6NA 2IJLA 1ZG1A 3E6MA 3BOQA 3P9CA 5FLXZ 3HRSA 3EYYA 5CVJA 4OOIA 5CVVA 5LGTA 2COMA 3HSRA 2PI0A 4L0ZB 4IVNA 2A68F 1IW7F 5CLSA 2IA1A 3QU3A 4GCVA 1ZGJA 1S6LA 1XSXA 1IXCA 2YX4A 4ESBA 3V7SA 1TW3A 1IZ1A 4L9TA 3FM3A 5H6QA 5E8IA 1KU3A 4O3MA 1T39A 5HS8A 1MJAA 4IXAA 1B1BA 3FZVA 3WGGA 3B02A 3K69A 4EM1A 3IRRA 2UWMA 3F3XA 1JHHA 3FF5A 1J75A 1ZN2A 2XGXA 4K2EA 1FSEA 3REOA 5LEJA 2RNJA 2V79A 2ZKZA 2DQRA 2DT5A 2OD5A 3F8MA 5DD4A 4HA8A 1GXQA 2VBWA 1FWZA 3K2ZA 4ZH4F 5JVTA 1S7OA 2DI3A 3GUDA 3BP8A 4E70A 2Z3YA 5KK1A 2VODA 1I5ZA 5ED4A 3EYIA 2LSOA 1XGSA 2ZNZA 1FYKA 1QQIA 1FBUA 2J5OA 3P9IA 4UVAA 2F5FA 5HLIA 1OYWA 4N9HA 3ECOA 3MFKA 4A2UA 2Y75A 1R23A 4I7HA 4ENKA 1UCRA 3L9FA 3R0JA 4G7HF 1ZYRF 4IRGA 4HZFA 1FYLA 4L18B 1PP7U 2GWRA 2XAFA 4IPAA 3DPLC 1WRJA 4RS8A 3FWEA 3I0TA 4R1HA 2EV0A 3IWFA 1JHFA 4L0YB 2MD5A 1AOYA 2MC3A 4PGHA 1PUEE 4JK1X 4OIPF 5EEHA 2ESHA 4DQ2A 2FU4A 5IT9K 5A2QK 1P4AA 2AXLA 1P6RA 4YIFA 3GXOA 3TO6A 1LEBA 2WC2A 1YG2A 5FFZA 3KEQA 4XBFA 1BC7C 4A0ZA 1HKQA 1HSTA 1U5TC 2FMYA 5E17F 4HF1A 3LQRA 1UFMA 2V1DA 1IAWA 4LD5A 5KVRA 2JT1A 2EFPA 4BXUA 4WWCA 3PQKA 2BYVE 3D0SA 4R8HA 2ACJA 3TKYA 3I4PA 2FQ3A 2RKHA 4O6JA 4DNCA 3N4MA 3J80K 2F5DA 5DYMA 1MZBA 1T0FA 1K78A 3V8LA 2YR2A 2PN6A 3MWMA 4MGRA 4S05A 1LQ1A 4D0PA 1FBQA 4XSZF 3ZMZA 2O6GE 4MEYF 5L3DA 2L54A 4XLPF 5HS9A 3CUOA 3RYRA 2XAGA 1K78B 2DW4A 3H3UA 5LGNA 4L9JA 1QPMA 5HDNA 2P8TA 1EV7A 2DU9A 3D5LA 3BJOA 3SZPA 3C18A 2W84A 1T2KA 1K79A 5ICFA 5TJJA 3W6KB 1Z9CA 3JSPA 1IN6A 1XD7A 2ISZA 1U78A 3LAPA 3VOEA 1CF7A 2BV6A 2RDPA 2K27A 1AWCA 1SAXA 2CGPA 5K1YA 1TQMA 4BH9A 4LG0A 3O3KA 3RPQA 4ENJA 2M1BA 3T5XA 1DP7P 1BIBA 3TGNA 2HR3A 4CO8A 2IA2A 2DO7A 3HUGA 1MD0A 1CF7B 3KLOA 2X0LA 4Y15A 1FSHA 5JR3A 1IF1A 4LG0B 2GQQA 2ETHA 3K1MA 4U0VA 4AIHA 3OOPA 3HSFA 3DPTA 1ZLJA 1LB2A 1D5VA 2HKOA 1MGTA 4M72A 2HYGD 3WTVC 4P5OA 4EGYA 1D8KA 2P4WA 2P7CB 5D8KB 2Q0OA 1LJ9A 2D1HA 1YFHA 1HW1A 4YG2F 3V4GA 3QP6A 2ELHA 4WK8F 1S7AA 4BHCA 2VONA 2CSOA 5K5QA 2A6EF 3GF2A 1NHAA 1K7AA 3BDDA 3F21A 1ZG3A 4I2OA 3ISPA 1JGSA 4MHGA 5AIPA 4M9SA 1QZZA 2RVCA 3KP5A 5IT3A 1OKRA 2R3SA 1BI1A 1O3RA 5F6FA 1ONVA 1BJAA 1X3UA 4XSXF 4KDPA 3JTGA 2KKOA 1HSJA 1R5HA 3EQLF 1KQ0A 2KJBA 1P4XA 2C6YA 4Z2YA 1RIOH 3RIRA 1GXPA 3QAHA 4P55A 3WTWC 4G7OF 3IRQA 1SD7A 3GEZA 3E5XA 2UXXA 4L5JA 2EV6A 3GZ5A 2H6BA 4M6XA 4EJWA 2XAJA 3O6BB 2KIUA 1OYIA 2QENA 1L0OC 1LEAA 4KN4X 2VBXA 5ERIA 5E18F 2UZKA 4XRFA 1SMYF 3VODA 1HBXG 5DDGA 3NQOA 3TDUC 5BMZA 1IN8A 4G94A 1J0RA 4MQ9F 2RV8A 4P96A 1ZLKA 2DK5A 5FO5A 2VE8A 4YFKF 1RUOA 4S04A 1XGMA 3NEUA 1WKMA 3ZQ7A 2ZBKA 2O61A 2K02A 2CQKA 2KIFA 4A5MA 2A5YB 4HDVA 2FF4A 5HVQC 2HTJA 4LLGF 5JHUA 1XGNA 3U1DA 2IVMA 4RAZA 2O03A 4UUVA 1LDDA 3RKWA 4UVBA 1YYVA 3WGIA 1B59A 2EFQA 1GVJA 3PFIA 4FX4A 3JAMK 2QM3A 2OQGA 3WU1B 1YW9A 4AD9A 4LFUA 3GO5A 3K0LA 2DQLA 1H9TA 3I58A 2XUBA 3V7RA 3KP7A 5EEGA 1ZREA 3F8FA 1FP1D 3TO7A 3QOPA 1V4RA 2Q8KA 1FYMA 1TNTA 3ROUA 4KMUX 1STZA 1QBJA 1IXSB 5HDGA 4WXHA 2W24A 1KGSA 2UXNA 1RZ4A 4AWXB 2P5KA 2XAHA 3HTUA 2H6CA 4HAMA 4M9ZA 1XCVA 4KIFA 4WXDA 1OPCA 2IPQX 3WTSC 4OIOF 4LMYA 1P4WA 2L02A 3TOBA 3CUQA 1U6GA 3E5UA 1MDMA 2Z99A 5FD5A 4HOBA 1S3JA 4ZYHA 3R0AA 3RJPA 3KZYA 2LF8A 3AAFA 2KIMA 1U8RA 5BPIA 1TNSA 2Y48A 1YIOA 1KQ9A 4OMYA 3CUQB 2FA5A 3WODF 1YQAA 1USTA 2V1XA 1RUNA 2IT0A 3I54A 1BN5A 1MDMB 3R6SA 1FPQA 3I64A 3N97A 4HBLA 1BI3A 2V1UA 4EJUA 5D5VB 1DUXC 5HS7A 3ZN1A 5ICCA 3LA7A 1D3YA 2GAUA 4U0WA 5HLGA 4EQQA 5H20A 2IA0A 1S8NA 2FSWA 5LEKA 1I27A 4ZYDA 1Z6RA 5K5OA 1QO0D 1U5TA 1EH8A 1RNLA 3QPHA 1B6AA 5D5WB 3HRTA 4MTEA 4IJAA 2OZ6A 5J8FA 4WXCA 3T8RA 4I0AA 1UHWA 3FXUA 2HKXA 4HV5A 1ON2A 4OINF 1U5TB 4M6YA 1YS7A 2XV4S 3VB2A 1O3QA 1XDUA 1H0MA 3RKXA 3NRVA 1KYWA 4FT8A 5HDKA 2EA2A 1B9NA 4G6DA 4Y17A 5D6EA 4A0YA 2OA4A 3G73A 2W85A 2RGVA 3FMQA 3T8TA 4ZYGA 3WTXC 2YSRA 3KP4A 1O7FA 1QGPA 4RGSA 2F5EA 3BZ6A 1XB4A 4GYGA 4OMZA 3IWZA 1GHCA 2D1VA 2PEXA 2B0LA 3BPXA 1BIAA 3HOTA 4LJZF 3R60A 4EM0B 1R58A 5BOXA 5ILSA 2HDCA 3TQNA 4L5IA 4YFNF 2K4JA 4BAYA 3FMRA 3ZN0A 2V6CA 2HYFA 2A61A 2LKPA 1IRFA 2FNAA 4YIIA 2HQNA 3SXYA 2DPDA 5TRDA 4HF2A 1HKTA 2HZTA 2Z5UA 2JZYA 4OU0A 3WTYC 2OAZA 1R1TA 4I09A 1WI9A 2WV0A 1EH7A 3TO9A 2HTSA 2FBIA 3L09A 4G8XA 4BHBA 2HS5A 1SD6A 2WWYA 5L3GA 3K1PA 3KLNA 1EH6A 3C7JA 2LF7A 5L3BA 5D4RA 2D45A 5HLHA 1KA8A 2ISYA 5LHIA 3EDPA 1YW8A 2FNPA 3FMSA 3HIFA 2QBYA 1LDKB 2P5LC 3LFKA 2ZFWA 2PBIA 2TDXA 2EJRA 2P7VB 1W7PD 3ZMDA 3JSOA 3BWGA 4UV8A 1CGPA 3F8BA 2MLGA 2M45A 3J81K 2Q2EA 1ZAOA 3PQJA 3KE2A 4YFXF 5AONA 4G7ZF 1HXDA 2H94A 4IHTA 4LLNA 4EVIA 3IC7A 1JXSA 4P9UA 5FLXK 1O57A 3SHFA 4EJOA 1J59A 2W57A 3WE3A 4BNCA 4U0YA 5L3FA 4RB3C 4RGRA 4KYWA 3E6BA 1I1SA 3LSTA 4KIGA 4HLXA 3W6JB 5DV5A 3E5QA 2NNYA 2J5PA 5LLQA 4U7DA 1R5GA 1BOAA 4IRHA 3L2CA 3HHGA 5D6FA 4LLLA 1WQ2A 3QP5A 1ZH5A 5F64A 4UXNA 4ZZDA 3M9AA 4QWQA 3CJNA 1SD5A 2QVOA 2FRHA 1XSDA 1OR7A 3RDIA 1G3YA 1Y0UA 2NYXA 5E1WA 5D4SA 2NAZA 1ZHFA 4RGUA 2KJCA 2EK5A 1G4DA 2JTVA 2DPUA 2MH9A 4U7BA 1KU7A 2WTEA 3IKTA 3CDHA 3E6DA 2VOOA 3G3ZA 3MQ0A 3FM5A 3R4KA 4UVCA 1WWXA 1TTYA 3LWFA 1REPC 2Z9OA 1IN4A 3JW4A 1LNWA 2YU3A 2YPRA 3SZTA 2ZO4A 3I53A 3ELKA 4UNOA 4JQFA 2E1NA 4G9YA 5K5RA 3Q9VA 4KA4A 2E7WA 1KU2A 2MA3A 1MJ9A 4N0BA 4MTDA 1KYZA 5LHHA 1KU9A 2EB7A 1SFUA 4MEXF 2VBYA 4XLNF 3M8FA 4CGZA 1YLFA 3MEXA 3MZHA 5IT9Z 3E97A 2NNNA 5DCMA 5L3CA 2VBZA 5E20A 2STTA 2VN2A 1F5TA 5BS6A 1OYYA 2LDUA 1Z6TA 1J7KA 1BM9A 2NRAC 4HX8A 2K4BA 4IHSA 1I1GA 4UV9A 4EJVA 4HV6A 2QZ8A 4EJTA 1IXRC 5DCMB 4RAYA 4OIQF 3RTRA 3R61A 4B09A 1XN7A 3ABUA 4HYEA 5D5XB 5LRSA 2XHKA 2RN7A 3F22A 1QZYA 3HSEA 2GA2A 1IN5A 4KNYA 1XSVA 2ZMEA 4A6EA 4FHTA 6PAXA 4M9XA 2BBYA 1FT9A 3RPUA 1IN7A 1QNTA 4PZJA 3DXJF 2Z33A 2ESNA 1IRGA 2FOKA 3KP6A 5ILUA 4CYDA 4FX0A 1T98A 2K7LA 1ON1A 2YX7A 4HX7A 1Z91A 4Q48A 1FX7A 1HQCA 1YS6A 3F23A 5LHGA 3Q9SA 4ENNA 3HRMA 3I59A 3GWZA 4L9VA 5E1ZB 4HLYA 4ESJA 2XKPA 4KFCA 2KRFA 4Y13A 2G7HA 5DUIA 2L01A 3I59B 1BC8C 1R7JA 3HOSA 1F1ZA 3COAC 3B73A 3F72A 1LDJA 4N9IA 2D2WA 2A69F 2ZNYA 3GFJA 2DTRA 1TQPA 2VC0A 2XVCA 3L00A 1C0WA 5J6XA 4A5NA 5E8GA 4I02A 5CJ9A 2GXGA 1YW7A 3F8NA 3U9GA 1H9GA 2V9VA 4KT5C 1L3LA 3ZPLA 1A04A 4F7ZA 2DAOA 1ZARA 5LGUA 2BEOA 2W25A 1U3EM 2ADUA 1D8JA 4BYYA 1WSUA 4I01A 1S29A 2HEOA 4A6DA 1TBXA 2CFXA 1B4AA 4EM2A 4KMFA 5L3EA 1HKSA 1HW5A 2HGCA 2STWA 4Q5SF 1SMTA 1PP8F 2CYYA 2A07F 2JPCA 2QQ9A 3JTHA 3TOAA 1YO5C 5LRRA 2R7DA 4HF0A 2EA4A 4A0XA 2EFNA 4KIBA 2IRFG 1TQIA 2P5VA 2F5CA 4NHJA 5HOOA 4O5VA 1XMAA 4TV7A 1K6OA 3BY6A 4I98B 2M5WA 2LNBA 3L7WA 3IHUA 3BJ6A 4CXFA 3WG9A 2CW0F 5CVUA 3SQNA 1SD4A 1TW2A 3GFIA 2M8EA 4KN7X 1O3SA 2L4AA 2HOEA 4LB6B 2RQPA 5DCFA 1DDNA 1Z7UA 2OZUA 3ZMTA 3H3ZA 4IRIA 3VFZA 2ZXJA 4ZYEA 1Z05A 2L3DA 2PMUA 3WE2A 2HFHA 5LBQA 4ASNA 3CUQC 3KP2A 4ENMA 2XAQA 4ETSA 3BPVA 3GFLA 3EETA 3FHZA 3KCCA 4GO1A 3KZZA 5H6RA 1XMKA 2VE9A 3DQVC 1O3TA 1J5YA 3GVAA 2L4MA 1R22A 4RGXA 3ZMSA 2E7XA 3CTAA 3F8CA 3MZYA 3HRUA 4HX4A 2QYOA 2DFIA 2VT2A 3K1NA 4RB0A 4WCGA 1ZG5A 4MQVA 3TDZC 3M7GA 4LK1F 2OQRA 4QLCU 4U88A 1HW2A 1ODDA 5DD8A 3ZP5A 1DPUA 2PG4A 2PLYA 4H0EA 2HWVA 1FY7A 2P6TA 5E1XA 2GIVA 2JSCA 2BGCA 2H27A 3T0YA 3E6CC 4ON0A 1PDNC 3DP7A 3C3WA 5CYVA 2MBFA 1W5SA 1FC3A 2GA1A 3ECHA 3K9TA 3P7NA 3JAMZ 1MKMA 3F6VA 3M1EA 3Q5FA 4CHUA 1KQ8A 3F6OA 2JRTA 4WF2A 4M71A 5JFRA 3IL2A 4M73A 3IKVA 5D5UB 1W7PA 4I0BA 1T38A 3GW2A 3CLOA 2MH2A 1SFXA 4L9NA 3ML6A 4LB5A 5FD6A 4PDKA 3GFMA 2HQRA 2A3SA 1XDSA 2F2EA 3LA2A 2QBYB 5D8LB 3QU6A 2FBHA 1ZRFA 5J8CA 4RB2C 1W7PB 1E17A 4AIKA 1FBSA 3WTUC 1R36A 2CWEA 1P2FA 3WGHA 3GLXA 5FGMA 4EGZA 2XRNA 1Q1HA 1ZRDA 2G7UA 2K86A 2G9WA 5F1RA 4ZZLA 1BBYA 4KICA 2OBPA 1FZPB 4MNUA 2AS5F 2XKOA 1JE8A 3V8KA 2O8XA 1TLHB 2QLZA 3U2RA 3LQQA 4IF4A 5BQTA 4HQEA 1UB9A 3VEPA 1J2XA 2XROA 3LAJA 4BHPA 4JBAA 4WX9A 2DLLA 2A6HF 3M8EA 2PQ8A 3LA3A 2CO5A 4GGGA 3GX4X 1F4KA 2VT3A 3OV8A 5AIQA 5CVRA 2GXBA 3RI4A 1FP2A 2Y0MA 4EV0A 4PCQA 3MCZA 2PMHA 2X4HA 3O2PE 2DBBA 3HYIA 1RI7A 1P92A 3C1DA 2EWNA 1G3SA 1Z1DA 2QQAA 1ULYA 3KP3A 1W5TA 3HTSB 3J7AO 4LGWA 1G3TA 3E3VA 2FEZA 4CDGA 1R1UA 3WTZA 4RB1A 2OU2A 4GXOA 4OIRF 2M30A 3S2WA 3HHHA 1FLIA 1F9NA 2PJPA 3BROA 5ILVA 2QUFA 2FBKA
chains in the Genus database with same CATH superfamily
4DL3A 3V8JA 3ZMUA 2E1CA 1MBGA 4NB5A 1FOKA 2XIGA 3KFWX 5BPDA 3DEUA 5D8DA 3H92A 4EGJA 1N25A 3RYPA 2JA8G 1LUJB 5LXTF 1FVIA 4R79A 2XF6A 1DU0A 4XMYA 3KEOA 2NOGA 2R85A 3JZIA 1W4MA 3CJQB 4AIJA 1GGOA 3CQZJ 1SFOJ 5KG1A 2W6NA 3ZQFA 5KFMA 1WJBA 1O7LA 4DBRA 1FOXA 5CKTA 4D7NA 3ULQB 1ZRCA 2ZJ2A 3ORRA 2DK8A 1BI0A 1R9TA 2VC1A 3WU2C 5HLTA 3CO6C 5LD2C 5A2QZ 1JTXA 5EDNA 5FLVA 1WJCA 2QQ8A 2O0YA 1PYVA 2GZWA 2JEJA 1DPRA 4KUMA 4W1UA 2JPBA 3DKWA 3BR1A 1G3WA 3K3PA 3KETA 2VOPA 3ZGKA 1BI2A 1J9IA 4LITA 5DUKA 1U2WA 3K5HA 2QA4I 4AIDA 2PFBA 4O2AF 4Q47A 2P6SA 1USSA 2RDIA 3SE7A 3ABTA 4CCMA 3A02A 4AVPA 1EJ9A 4UHTA 4A12A 3GZ6A 1R00A 2H09A 2O3FA 5FFXA 2F4IA 5JI6A 1B9MA 1QHGA 4NC6A 2DA4A 4M74A 3KHRA 3HB9A 3CO7C 3GYHX 4G6QA 3B6CA 4Q4ZF 3GBGA 2EFOA 2E19A 2LVSA 4ANJA 3H9QA 3RQ4A 2DLNA 3DLLF 4IQ4A 5KFCA 4Q8FA 5E3OA 2BY3A 3U1KA 2CG4A 5C4JJ 2BVLA 2HVSA 2R7SA 5J2UF 5KT7A 3DU5A 1B6SA 3U9SA 1T6SA 3OYMA 1VTNC 1B6RA 3RKYA 3BJAA 1U9OA 3WU0A 3OUUA 4WBNF 1OR7C 4F3QA 1S72I 5H80A 3FXQA 1Z3YA 1ZR2A 1FMVA 4IOAF 1VZ0A 1F43A 1YJ9I 1SEIA 2XB5A 2VXZA 3BZKA 1ZGAA 1A0IA 3G8CA 4YEJA 1W0TA 2R7VA 1ETKA 3FX3A 2IGKA 5DEQA 4EMSA 4O4IF 3C2GA 1DGWY 4NQWA 4EATA 5GONF 2XSDC 3DFGA 4A3BG 5ICEA 3RFCA 3ERED 1SFEA 1XGOA 2R93J 3I71A 4A2BA 1UHMA 3IAM2 2GXAA 3C2HA 5DG9A 5CVIA 3DV8A 3P9KA 3MAJA 5FB2A 2DDAA 2R7FA 2HI3A 4ESFA 2M87A 4EBDA 1S10A 3ZMVA 4GYIA 5M3MJ 2EFWA 2EV5A 2HVQA 1R1VA 2JMWA 4P1WA 2DMUA 3J80Z 3I5UA 2XASA 3JRGA 4BQAA 3IN5A 3RTXA 2ZMEB 1U0JA 4B8XA 2JA5G 5KFTA 1MMNA 1OMIA 4HW0A 3WTTC 1WPKA 2RC4A 4BY1J 4BJ5C 4NQWB 1W93A 4LK0F 5ICGA 1V3FA 1LKXA 4HDUA 3E5NA 4CZZA 1WH5A 2BE5F 3KAKA 2VJ5A 5TGTA 3JSLA 3C2BA 2JA8J 1YTYA 1A35A 3L2WA 2MLKA 4I76A 1UZCA 3G4SI 4GKJH 3H0GG 3DF8A 2IP2A 2OLSA 1PUFA 1XCBA 3MKZA 2NU7B 2IW5A 4EFBA 4UUTA 3LSMA 4DUZH 4CICA 3T1BA 3JRXA 5BPFA 1RC9A 3EUHA 3TW6A 2QQBA 2LKXA 2E2IJ 2NS0A 3FXRA 1QVTA 1RPWA 1LVAA 4HQMA 3QRFF 2R6FA 4DV0H 1N33H 4MV4A 2CUFA 1MJBA 2FMLA 1EZ1A 3OR1C 1MMAA 1S5LC 1I6XA 4LH6A 2ZCWA 2FXAA 3SFZA 2FE3A 3I9V2 5DS9A 4JI7H 4PGGA 2QWWA 1JT0A 3ZQHA 1E2XA 2DYRH 3V7CA 3J81Z 4BXFA 1R9TJ 4NDLA 5F9LA 5KX5F 3OMYA 3QPTA 1IUYA 1PUFB 4P9FA 3BCAA 2YCHA 1UG0A 1FNNA 1G6NA 2IJLA 4AYBE 4JI3H 1S9FA 1YITI 4XYLB 2VIXA 2XF7A 3E6MA 1ZG1A 3BOQA 3P9CA 2GOXB 5FLXZ 2COBA 2DJNA 3HRSA 2W48A 4GC7A 3A0HC 3H4DA 3WHCA 3N44B 3EYYA 5CVJA 1MBJA 2XGDA 4OOIA 5CVVA 5LGTA 4E7HA 2COMA 3HSRA 2PI0A 2YS9A 4L0ZB 4Q0YA 5DG8A 4IVNA 2A68F 3GV8B 2C35B 1IW7F 5CLSA 2R7TA 5IP7G 3BC8A 2IA1A 3QU3A 4GCVA 5LMUH 2XPVA 3S1QJ 2YZMA 2IBDA 1ZGJA 3AFHA 1S6LA 5KFNA 3BR5A 4I6ZA 1GSOA 1XSXA 2FLNA 3HOWG 1IOWA 1IXCA 2YX4A 1O4XA 1IRXA 4IKFA 1BJZA 3GTPJ 4ESBA 4A3BJ 3V7SA 3ZQGA 5KNLA 4DV4H 3K3VA 4E7KA 1MBFA 4BKXA 2X9DA 1TW3A 4PK4A 4ECXA 1IZ1A 2HGSA 1KZHA 1T95A 4L9TA 4KISA 3FM3A 2R7LA 5H6QA 5E8IA 1KU3A 3MKWB 2V9PA 1ZKGA 1JUPA 4DR4H 4O3MA 2OCEA 1T39A 2QKMB 4PJJA 2E36A 5HS8A 1I7LA 2VQDA 2PMZN 4XK4A 2YS6A 1MJAA 4IXAA 4RA2A 5KT4A 1B1BA 4EYIB 2E1MB 1U8BA 2JA5J 3FZVA 5M5XJ 3WGGA 2UUCH 2HHHH 3B02A 5KAIC 3K69A 3G2BA 4EM1A 3TQTA 3IRRA 5FPRA 1VQOI 3F3XA 1VQNI 1JHHA 2QCOA 2UWMA 3FF5A 1W96A 1J75A 1I3QA 4II3A 2B7EA 3RIZA 5F0FA 1ZN2A 2XGXA 2XSJC 3QQAA 4LSXA 4K2EA 2R7KA 1FSEA 3REOA 3EPGA 5LEJA 3H0GJ 2VQEH 3QZ7A 3DTIA 2RNJA 2V79A 2ZKZA 2DQRA 4DYRA 2DT5A 2ASJA 2OD5A 1JIHA 3F8MA 1B8IB 4BEHA 3R5HA 3MD2A 5DD4A 4HA8A 1VQ8I 4GC6A 4XRSG 1R6RA 4B43A 5K7FA 1GXQA 2VUGA 2B63G 2VBWA 1FWZA 5IYCG 3K2ZA 2WY7Q 2R93G 4ZH4F 5JVTA 1S7OA 4MFDA 2MYSA 5JUMA 2DI3A 3GUDA 5L1JA 3Q3SA 3BP8A 2ID6A 2Z16A 4E70A 2Z3YA 1GV2A 1TWAA 1XPXA 2MC4A 3OYAA 3BQ0A 5KK1A 2VODA 2PMZA 5F9NA 5HODA 3A03A 3RSNA 1I5ZA 2EZLA 4C9YA 2KDOA 5ED4A 3EYIA 3S1MJ 3KHLA 3GTQA 3GTOA 3K4KA 2LSOA 2CV2A 2NVTJ 1XGSA 4XONA 1BW6A 4Q45A 1OCPA 4UCRA 3PO3G 2ZDHA 3K5IA 2F48A 3G6YA 5KFEA 2ZNZA 1FYKA 3BR0A 2ZXWH 2HPMA 1QQIA 2Y69H 5IYDG 1MMSA 1FBUA 5DLFA 3JRCA 2UV1A 2YUSA 5IP7J 2VL8A 2J5OA 3HOVG 3P9IA 1X4PA 2KFDA 3G6VA 5KFZA 1TWHJ 4UVAA 2F5FA 1K1SA 1MNEA 4ECTA 5HLIA 1OYWA 4N9HA 4CSWA 3ECOA 4RLFA 2IGOA 3CMAI 2R8HA 5J1YA 3MFKA 3CCSI 3HOWJ 4A2UA 1JKJB 2Y75A 1R23A 3BA8A 4LFCH 2EIMH 4I7HA 4ENKA 1UCRA 2R7QA 3L9FA 3R0JA 4N4NB 2QEXI 4UCTA 1IBMH 4G7HF 1ZYRF 4IRGA 4HZFA 2UXCH 3FBIB 1TWCJ 3AKZA 1YHQI 4I99C 2RAEA 2RQQA 1V5GA 1FYLA 4L18B 2JUCA 5KFUA 3RBDA 2DPIA 4JI1H 2JA7A 4JUZA 1X3ZB 5GTHC 2W6QA 2Z2SB 1IUFA 2RDJA 5C4XG 2IS1A 4J9SA 1I50J 3PUBA 2JUGA 5EDWA 3Q0UA 1PP7U 2GWRA 4RU9A 2XAFA 3OSGA 4IX7A 2DA7A 5J4YA 4IPAA 3DPLC 1IV6A 4IRDA 1WRJA 3BR6A 4RS8A 2H1KA 3F9KA 3OIQA 2Y2ZA 3FWEA 4DGWB 3I0TA 1OWTA 2JA7G 2DFFA 3G1LA 4R1HA 2EV0A 4ED6A 1GT0C 3IWFA 5HNHA 1RK6A 1JHFA 5GPAA 4L0YB 1EUCB 5C3EG 2DTZA 2MD0A 2MC3A 2MD5A 4M3BA 1AOYA 2HQAA 4PGHA 1PUEE 4AM3A 2BXYA 5KG7A 1O75A 4JK1X 4OIPF 5EEHA 2ZC2A 2ESHA 3HEFA 3R5FA 5IWAH 1ETYA 4PUSA 3S8PA 2ELKA 3GMEA 2QSGX 4MIMA 4DQ2A 2FU4A 5IT9K 5A2QK 3E7LA 1ETQA 4MAMA 1P4AA 2AXLA 4LH7A 2BR0A 1P6RA 3EPIA 2VQFH 1SAUA 3LMMA 4YIFA 3OYBA 3GXOA 3TO6A 1LEBA 2J6TA 2WC2A 4GKKH 4KJZA 4I55F 4DJAA 4YAKB 1YG2A 2R7WA 1RJQA 4II2A 5D1OA 4A3JG 4AC0A 2B63J 5M3FJ 1V54H 4ED0A 5IYCJ 4GFBA 3GLKA 5FFZA 3KEQA 4HNVA 3LFUA 3T5HA 2FLLA 2UXDH 2K9QA 5DQHA 2IEKA 4XBFA 4PDBA 1BC7C 1VQ5I 2AGQA 2C28A 3HL2A 2ZJPF 2CV1A 4A0ZA 2NS7A 3OYCA 4J01A 2VA2A 1HKQA 2LMDA 1RK5A 1HSTA 1U5TC 2FMYA 5E17F 4HF1A 2J6UA 4V19K 3LQRA 4PSWA 1JI8A 4ZI7F 1UFMA 2V1DA 2YZNA 4LFAH 1IAWA 4LD5A 4O3NA 5KVRA 2QKLB 5D1OB 2JT1A 2EFPA 4U7CA 4M3GA 2NVQJ 3PO3J 4BXUA 2LH9A 5JHFA 4WWCA 2R87A 3PQKA 3HPHA 4UCOA 2HVRA 2BYVE 5IYDJ 4ED1A 3D0SA 4CC6A 1V4YA 3HOVJ 4R8HA 2ACJA 1VI0A 4ZC3A 1FKAH 3OWTA 2X1DA 1Y39A 2JQ7A 4A69C 4BQQA 4D1QA 4FCYA 1D0YA 2N8GA 3S93A 4ZDPA 1N56A 3TKYA 3I4PA 2FQ3A 2PX9A 4XZ3B 3CCRI 5LA6F 3CZ6A 2RKHA 2DA6A 5C5JA 3V6KA 3JCUC 4O6JA 4DNCA 3J80K 3N4MA 1WZ2A 2F5DA 1OCTC 5DYMA 2EZIA 9ANTA 3Q8PB 5C4XJ 2V9WA 3EPZA 4K0KH 1MZBA 1T0FA 1K78A 1YX3A 3V8LA 2YR2A 3ESWB 1WSCA 1IBKH 2PN6A 3MWMA 4MGRA 4S05A 1K4TA 3MFHA 3KX2A 2XC7A 2RF4A 3TP3A 1LQ1A 2JA7J 4D0PA 2EILH 4XLCA 4YQWA 3PW7A 1EA3A 2X6YA 1FBQA 4XSZF 3ZMZA 2JK3A 2O6GE 4MEYF 2DMPA 3CCJI 5CQEA 5L9XA 2K9NA 2ME0A 1TT5B 2LFBA 5L3DA 5C3EJ 3OYHA 4CC5A 3OY9A 2L54A 5IY5H 5KAFC 1CQJB 3T1YH 1XMXA 3OL3A 1IDYA 2W9CA 4XLPF 5HS9A 4PFPA 1AHDP 4C2MA 3CUOA 3RYRA 2R0QC 3GZNB 2GPWA 2XAGA 4DL2A 1K78B 3BQZA 4HNUA 3SFIA 1PJRA 2DW4A 4BBRG 3ERMA 2LBFA 3H3UA 5LGNA 3S1RJ 1WCMA 2QSHX 4UCSA 2Q2TA 3K6GA 3LSGA 4L9JA 1MH3A 3Q0WA 1I6HJ 1E4FT 3GTKA 1QPMA 2ECBA 4XICA 2R8JA 4R7RA 5HDNA 2P8TA 2OH2A 1EV7A 4IWYA 2CQXA 2DU9A 2KZGA 3D5LA 3BJOA 2E2JJ 2Q2UA 3SZPA 3C18A 2W84A 4A3JJ 1T2KA 1K79A 5ICFA 1Y1VA 2WAQE 2XCLA 4O3PA 1WCMG 5TJJA 3W6KB 3H5NA 3JSPA 1IN6A 4E7IA 1QVUA 1Z9CA 5IP9G 4OX9H 1DV2A 1XD7A 2ISZA 1U78A 3LAPA 2W9CB 2L9NA 3VOEA 2UUZA 2F4MB 2XGEA 1CF7A 4XOTA 2BV6A 5T14A 2RDPA 4J9QA 1C30A 2K27A 2IMWP 1AWCA 4R8UA 2BZTA 2Y31A 4F92B 1SAXA 2CGPA 5K1YA 1ETOA 1TQMA 4BH9A 4LG0A 2DMQA 3RB6A 2XGCA 2R92A 3O3KA 3RPQA 4ENJA 2M1BA 3T5XA 2M9HA 3DTEA 4QIWA 1ZQ7A 3MWDA 3BTCA 1I94H 3RF2A 1ZHSA 4DL7A 3KHHA 4DV5H 1DP7P 1BIBA 3TGNA 2HR3A 1XMOH 4CO8A 3D5SC 2Y0SN 2ELJA 2DO7A 2IA2A 2E5ZA 3HUGA 1MD0A 5F08A 1CF7B 1JUSA 2IBKA 3KLOA 3R23A 4Q8EA 2X0LA 3DTKA 4F55A 3MMYB 3GTGA 4R8UB 4Y15A 3OL4A 1FSHA 3VYUB 5JR3A 1IF1A 2WB1N 4LG0B 3K4LA 2GQQA 2ETHA 2WV1A 3K1MA 2R7XA 3M4OJ 4U0VA 2AQFA 4AIHA 3OOPA 3FKIA 3HSFA 3DPTA 2C2DA 1ZLJA 1X4OA 1N36H 2VASA 5IOYA 5E3NA 3N6XA 2NXNB 3S16J 2IS2A 1LB2A 4EGQA 1D5VA 3KEYA 4J9MA 4RBOA 2HKOA 4FISA 1MGTA 4M72A 2HYGD 2W6OA 4PJMA 3RGXA 2M7AA 3VSLA 3PNVA 1M0WA 4MV8A 3HUGB 1P9QC 4RAGA 3L1PA 1TZLA 5B1BH 4JYAH 3IAS2 2X6OA 2Y30A 3WTVC 2H8RA 4B3TH 4P5OA 3LSJA 4EGYA 2HNHA 5LOVF 1KJ9A 3CVZA 1D8KA 3M4IA 3FISA 4J9PA 4ABZA 2P4WA 4IAJA 4XOPA 2VUMG 1JGGA 3HM5A 5GAEJ 2P7CB 5D8KB 2Q0OA 5L1KA 4DR5H 1LJ9A 1GVDA 2D1HA 4Z6YA 1YFHA 1SANA 5KFXA 2CQNA 1HW1A 2K3FA 2DA5A 3SYTA 4YG2F 2BHYA 2V4RA 4F4WA 3UNGC 2P0WA 3H3VK 2IS6A 3V4GA 3QP6A 2XCPA 2ELHA 2C2EA 4WK8F 1VQMI 1S7AA 2Y0SA 3GTLA 4NXMH 4BHCA 4FASD 1GLVA 3TINA 3GTJA 2CUZA 2I10A 4RDUA 4BBRJ 2W6ZA 5J40A 2VONA 2FK1A 4F50A 2CSOA 5K5QA 4TQRA 2A6EF 3N43B 1R5ID 3WO1A 3GF2A 5KG0A 1NHAA 2WB1A 3MR2A 4C2MJ 4J19A 1K7AA 1X3WB 3BDDA 3JRFA 3F21A 4RAFA 1ZG3A 5HNFA 4I2OA 3ISPA 1JGSA 1WCMJ 2YYAA 1XMQH 4MHGA 2FPPB 5AIPA 5IP9J 2HOAA 4M9SA 1QZZA 3GTKJ 3PN1A 2HXOA 2HYJA 2RVCA 3KP5A 5IT3A 5EGOA 3GIPA 2AQ4A 2UVRA 3VYRB 2LK2A 2QGUA 1OKRA 2VI6A 3GLLA 5K2MA 4NBQA 2JEIA 3OS2A 3QWLA 2KT0A 2R3SA 1BI1A 1O3RA 4O4HF 5F6FA 4JI8H 1K83A 1ONVA 1H89C 1BJAA 5F04A 2EZHA 3KTMA 1X3UA 4XSXF 4KDPA 1XDNA 1I3AA 3JTGA 3GTMA 1GV5A 1VBGA 3HC7A 2KKOA 1HSJA 5EWFA 4V2GA 3VMMA 2MCTA 4E7ZA 1IV8A 1KEEA 1R5HA 3KAJA 3M9OB 3JRIA 3VYSB 2SCUB 3EQLF 5D1PA 3H40A 1KQ0A 2M2EA 3DLAA 1LPQA 3NGDA 5EGOB 1KJ8A 4MV3A 5BR8H 2NS8A 2JA6A 2KJBA 1B33N 3VPDA 3DWLE 1P4XA 2C6YA 4G3IA 4L5EA 4Z2YA 5KG6A 1RIOH 3BG7A 3QZ8A 5CA0F 3RIRA 1RR7A 3H4BA 3D5RC 5DGBA 1GXPA 2R7OA 2FQ4A 2ZSIB 3QAHA 2A5WA 4P55A 3WTWC 4G7OF 2LREA 1XNQH 2EINH 3F0CA 3IRQA 2CFOA 1SD7A 3GEZA 2L5QA 2UUAH 3E5XA 2UXXA 4L5JA 2LP0A 5EZHA 3CCYA 3HOUG 2EV6A 3K10A 3GZ5A 1BGWA 1OISA 1OCZH 1WGXA 2H6BA 1WR2A 1U9NA 1WH2A 1ORKA 1KJQA 4M6XA 2VPQA 4EJWA 2XAJA 2VPLA 4LSAA 3O6BB 2KIUA 1OYIA 2NOJB 2QENA 2XAUA 3OR2C 3T5JA 2CKZB 1L0OC 1LEAA 4KN4X 4X62H 2VBXA 3PW2A 3CDIA 5ERIA 5M5WJ 5E18F 2UZKA 4XRFA 2K9MA 4RUAA 1MNDA 5J2TF 1SMYF 4BQOA 5CB4F 3VODA 2VUMJ 1AA7A 1HBXG 4X6AJ 5KFRA 2R4GA 2LOOA 3S32A 2FD5A 4QWAA 5DDGA 5KG2A 3NQOA 3RV3A 5JVGF 3VPCA 4ZYAA 2W4SA 3I56I 3TDUC 5BMZA 1IN8A 1G8XA 3DBLB 4G94A 1J0RA 4MQ9F 1V51A 1CQIB 1BXRA 1BR2A 2P0AA 4B1RA 1ZELA 2C2RA 1ZGWA 3IV5A 2OTJI 1A9XA 2RV8A 2KQRA 2KRCA 3N05A 4HNTA 5GADJ 4P96A 1HDDC 1ZLKA 1BL0A 2BY2A 4DZPA 2DK5A 5FO5A 2VE8A 5KFFA 1SEUA 4LFBH 2X1EA 4Y3OA 4U6PA 4BUPA 1EUDB 3MN2A 4YFKF 3LSRA 1K4SA 1RUOA 2LRDA 4S04A 1TA8A 1XGMA 2W1OA 3NEUA 3HKZE 4ZQIA 3GIMA 1WKMA 3PL8A 3ZQ7A 1IGNA 4IRKA 3LL7A 2ZBKA 2MFZA 2O61A 2E34A 2K02A 3ABKH 2CQKA 2KIFA 5CQGA 2A5YB 4A5MA 4HDVA 3S15J 2FF4A 4DL6A 5HVQC 3RB4A 1XX5A 2HTJA 3LSPA 1D5YA 3PJRA 4YJ3F 1JX4A 4FM9A 4LLGF 5JHUA 2B9SA 1XGNA 3U1DA 4BE2A 3A1YA 2IVMA 4RAZA 2HDWA 3RPUD 2UU9H 2O03A 4DV3H 4YR0A 4XR6A 4AYBN 1LDDA 3RKWA 1FJLA 4UUVA 1X1CA 2NU6B 2R7ZA 4C2TA 4UVBA 3FHNA 3N42B 3IH4A 2HQ5A 1YYVA 3WGIA 1VQ6I 3KYCB 4A3KG 1B59A 3RZDJ 4NC7A 2EFQA 3CCUI 1GVJA 3A0BC 1IJWC 4A2AA 4A3CG 1SCUB 1JKPC 4GLXA 3PFIA 4JYKA 4FX4A 3JAMK 3Q1KA 2QM3A 3K70C 3V42A 2F6CA 3SZGA 4UCUA 4ECYA 2F5VA 4CZCA 4XYMB 2OQGA 2R86A 3WU1B 1YW9A 4AD9A 1N48A 3PO2G 4LFUA 3ZCOA 3GO5A 1QU3A 3OS0A 5IT9W 3MVPA 3K0LA 4QSHA 5HBRB 3TIGA 5A2QW 3QYEA 2DQLA 4I50F 1E3OC 1K1QA 3QPLA 5EZYF 2VPRA 3KZIC 3I58A 1H9TA 3H3VH 2XUBA 3V7RA 2R5YA 3KP7A 5EEGA 1ULZA 3OSPA 4EFEA 1ZREA 3L4KA 3F8FA 3HOUJ 1FP1D 2A05A 5KT2A 3AG3H 3TO7A 3FXKA 3QOPA 1V4RA 3RKQA 2Q8KA 3CC7I 2I8CA 4G6TB 1FYMA 4FU0A 4BBSG 3CP8A 1TNTA 2KIQA 3ROUA 3BABA 4ZDOA 2O8KA 4O2BF 3LOCA 5KFSA 1DGSA 4XN0A 4AYBA 4DUYH 4KMUX 4OWRB 1FTTA 1STZA 1QBJA 1IXSB 5HDGA 3FKJA 2R5YB 3CDLA 4WXHA 2LD5A 2W82A 3V4SA 5EWGA 4A3DG 1WJAA 1UELB 2W24A 1KGSA 3E1SA 3AYHB 1C3OA 2UXNA 4IZOA 1RYRA 1RZ4A 2HPIA 2VOBA 2NVXA 2I5UA 1CE8A 4MLOA 4AWXB 1K61A 2BVMA 3CCVI 2P5KA 4APMA 4RNNA 2XAHA 2ZMEC 2H6CA 3HTUA 4HAMA 1T8IA 2HOTA 1PX2A 4M9ZA 1ZR4A 3LP8A 1XCVA 3PVXA 4KIFA 2ZDQA 4WXDA 5EG0A 1OPCA 2OF7A 2IPQX 3WTSC 4OIOF 4LMYA 1P4WA 2L02A 3TOBA 2WTFA 3CUQA 1YJWI 1S03G 1PVEA 1CS0A 3H35A 4AQYH 1A6QA 3CESA 3JRDA 5KFGA 5J1RA 1U6GA 3E5UA 1MDMA 2Z99A 5FD5A 3L2QA 3M9MB 4HOBA 5BMVF 1S3JA 2BW3A 4LG3A 4ZYHA 3BTIA 2XC9A 3R0AA 3OYKA 1DQUA 4A3FG 3RJPA 4MA0A 2GOMA 3KZYA 1EKEA 2AXTC 3J80W 5L1LA 3FK7A 2LF8A 2CUJA 5TISC 1TWGA 3AAFA 1D1CA 3OYNA 2CRGA 2KIMA 2W8KA 1T56A 5H2FC 5EG0B 1U8RA 4EYHB 5BPIA 1TNSA 2Y48A 3AG4H 1YIOA 1KQ9A 4OMYA 3CUQB 1DIKA 2FA5A 4X65H 3WODF 2VJ4A 1YQAA 1USTA 2V1XA 4IEJA 4A3KJ 1RUNA 3I54A 2IT0A 3N40P 4A3CJ 1BN5A 1MDMB 3FK6A 3R6SA 1FPQA 1KC7A 2ZJQF 3I64A 3ZQLA 1IDZA 1NG6A 2BW3B 1B04A 3OHAA 4DV2H 2R8KA 2P81A 3N97A 1MSEC 3NWTA 4HBLA 1VQ4I 1BI3A 2VKVA 2BOLA 2V1UA 4EJUA 2JVHA 5D5VB 1T08B 1DUXC 3RV4A 3HOXG 1R4NB 2XDVA 1N77A 5HS7A 3ZN1A 1WH7A 3PO2J 5ICCA 3LA7A 1D3YA 2GAUA 4U0WA 5HLGA 4EQQA 5H20A 2C00A 4HEA2 1Z2PX 2VQHA 2IA0A 3K4JA 3X2QH 5HV6A 2E60A 2V4JC 4JX5A 3Q8QB 1S8NA 2FSWA 4JI2H 4MA5A 5EJCA 3GILA 1M1EB 4YELA 1ACIA 1DU6A 4BEHB 3MR6A 5LEKA 3UQ8A 3J81W 1WJDA 2OJED 1I27A 2DA1A 3ZQQA 4ZYDA 3S3MA 1Z6RA 5K5OA 1QO0D 4XX0B 1U5TA 4J0MA 4CCNA 1EH8A 1RNLA 3UR3C 3QPHA 4ECVA 4LOCA 3T5KA 2AGOA 4BBSJ 3BTJA 4CH7A 3HPGA 1B6AA 1ZK8A 5KFQA 4EBEA 4E7LA 2YL2A 5D5WB 3BCBA 2PVPA 3HRTA 3LSIA 2KL4A 4MTEA 4IJAA 1WJFA 4J9NA 5GAGJ 5FLXW 1RESA 2X1CA 3BG9A 5FRMA 3SDGA 2OZ6A 1G2HA 2DOAA 5J8FA 4WXCA 3T8RA 2EBIA 4I0AA 1Z67A 1UHWA 1I7NA 3H9JA 3AL0C 3FXUA 4DW6A 5GTIC 2HKXA 4A3DJ 2KDZA 1Y8RB 1IO2A 4HV5A 2OWOA 1ON2A 4IO9F 4OINF 2FJZA 1U5TB 4M6YA 1YS7A 2XV4S 2ICWG 4RMNA 3VB2A 2L9VA 3FIWA 1O3QA 2FKLA 3DCFA 2E1MC 3HDDA 4ZJZA 1D0XA 3KALA 1FMWA 2X6XA 4XKWA 1XDUA 5E3MA 3ETHA 1H0MA 3RKXA 3CLQA 4TV9F 3GIIA 3NRVA 5J1UA 1KYWA 4ED8A 2R7RA 4FT8A 5HDKA 2EA2A 1B9NA 2MW8A 4G6DA 4Y17A 5D6EA 4A0YA 1VQ7I 4NNJA 2BY0A 2YU9A 2OA4A 3MFIA 4JV5H 3G73A 2QSFX 2W85A 5KCMA 4IHYA 4IOCF 2RGVA 4B3AA 4A3FJ 3FMQA 1AUVA 4E6KG 2ATLA 3T8TA 3HXLA 3CCEI 4ZYGA 1UHSA 2ZJTA 4O3SA 3WTXC 2JSPA 2YSRA 3KP4A 5J4VA 1UC8A 3RUPA 2W7OA 3PUFA 3CP2A 4HSTA 1O7FA 1Y8QB 2IAIA 1QGPA 5B66C 4RGSA 1N75A 2AHQA 4O3OA 4YHHH 2F5EA 3BZ6A 4RUCA 1XB4A 5KFHA 1I3QJ 1NK3P 3SI8A 2X0SA 4GYGA 4OMZA 1WI3A 2CQQA 3IWZA 4XLHA 1R49A 1GHCA 3RBEA 3LSHA 5KFKA 3NARA 2D1VA 4DR7H 2PEXA 3T1HH 3RQIA 2B0LA 3BPXA 2CV0A 1BIAA 2VQCA 3HOTA 4HRIA 4LJZF 4B48A 4IHVA 3IG0A 3H20A 1Z0XA 2ME6A 3HOXJ 2GLTA 2YW2A 3R60A 4EM0B 3JREA 1AN7A 1R58A 1XNRH 2K3PA 4ED3A 2NUAB 5BOXA 1XC5A 5ILSA 2HDCA 4Y4RA 3TQNA 1SYXB 3V4ZA 1Y1WA 4L5IA 1I39A 2DOEA 2MGQA 4YP3A 4YFNF 2DJIA 2K4JA 4YBZB 4BQNA 4BAYA 4F52A 3FMRA 4QW9A 2JA2A 3ZN0A 2V6CA 3BG5A 3MJFA 4J9OA 2HYFA 2A61A 2LKPA 1FOYA 1IRFA 5GAHJ 2FNAA 4YIIA 5FKKA 2FMAA 5LYJF 1TWAJ 4DYCA 2HQNA 3SXYA 5KHDA 2DPDA 5EF6A 4LF7H 3R5XA 2PN1A 5TRDA 2A6TA 3ASNH 1LFPA 1E4EA 3OUZA 4HF2A 1OQYA 1HKTA 3GTQJ 3GTOJ 3FXLA 2HZTA 1GUUA 2CW7A 2ID3A 2JZYA 2Z5UA 2HDDA 4OU0A 3JRBA 3WTYC 2ASDA 1BW5A 2OAZA 2C22A 1R1TA 1V55H 4I09A 1WI9A 4O4LF 2F4VH 4BWSC 4I4TF 1TP4A 2WV0A 1LVKA 4UFZA 3NAUA 1EH7A 3CMEI 5B5EC 3TO9A 5KFVA 2HTSA 2R5ZA 2FBIA 2LLKA 1ZQ3P 2K9SA 3L09A 3T5LA 1S0OA 2H8WA 4IR1A 2FPGB 2JJ7A 4G8XA 4BHBA 2HS5A 1SD6A 2UVVA 4C30A 2WWYA 5L3GA 3K1PA 2LYCA 3KLNA 3CF2A 4MV6A 1EH6A 2X85A 4M9UA 3C7JA 4E4HA 2LF7A 5L3BA 5D4RA 4ZHQF 2D45A 3I55I 4QWBA 2WE6A 5HLHA 1ZHQA 1KA8A 3VWBA 2ISYA 3H5AA 5LHIA 1HNXH 3EDPA 1RJPA 1YW8A 2FNPA 1RETA 1FOWA 3FMSA 2WAQN 2R7NA 4GRIA 3HIFA 1MH4A 2R5ZB 2ZSHB 2QBYA 2WYOA 2TRTA 1LDKB 4EEFG 2P5LC 1N34H 3LFKA 3PR4A 2V1NA 3PZPA 2ZFWA 2PBIA 3IH2A 2TDXA 2EJRA 3OSNA 2DOFA 2HU9A 1TC3C 2P7VB 1W7PD 3ZMDA 4G12A 3RCOA 1BNCA 1DV1A 4IZZA 4ZDLA 4OAYA 2LY2A 3JSOA 4ECSA 3HG9A 2NVYA 2V59A 5JH7F 3V6JA 4O3RA 4BY7G 3BWGA 3FMAA 1D1BA 3ORQA 3A01A 1QRYA 2KLOA 1HCRA 4UV8A 1CGPA 3F8BA 2MLGA 2M45A 1MMDA 3J81K 2Q2EA 1ZAOA 3PQJA 3KE2A 2I8DA 4AU7A 4YFXF 5AONA 4YAJB 4D5FA 4G7ZF 1HXDA 4ECZA 1HR0H 2H94A 2DXIA 4IHTA 4LLNA 3WHBA 5BPHA 4EVIA 2VPSA 2BXZA 3IC7A 5KFOA 2XGPA 1V5EA 1JXSA 3AG1H 5GP9A 4P9UA 2LBFB 1Y1VG 4KITB 3HGGA 5FLXK 1O57A 2KISA 4CA0A 2W70A 3PIPF 2UUBH 3SHFA 5K7ZA 4EJOA 3A01B 4QIWE 1J59A 1OCRH 4FS2A 1OFCX 1GYFA 3CQZA 1SFOA 2WAQA 2W57A 1VFCA 2ZDGA 3GIQA 3WE3A 4BNCA 4U0YA 3UKGA 2XGQA 1M7JA 4XKBA 5F27A 5L3FA 4RGRA 4RB3C 4KYWA 2W6MA 1T3NA 2KMUA 2R92G 2CU7A 3E6BA 3KYDB 4PJNA 4CCKA 3Q8SB 3CCLI 4DL4A 1I1SA 3RZOJ 5LL6b 3LSTA 3OSFA 4KIGA 1N32H 3J7ZI 3K2AA 3S3NA 3JRHA 4HLXA 3W6JB 3BAAA 3PSIA 1JT6A 2DIKA 5DV5A 3E5QA 4FE4A 2NNYA 2J5PA 3U9TA 5LLQA 4U7DA 3JAMW 1R5GA 1D0ZA 3TL4X 2Y9ZA 1BOAA 4IRHA 3L2CA 5KFYA 1QA6A 3HHGA 2IXSA 5D6FA 4LLLA 4RLQA 1WQ2A 2ZXHA 3NWSA 3FKIG 3QP5A 1ZH5A 5F64A 1A31A 1MMGA 4ECRA 3CC2I 4TUYF 3DEWA 5KFIA 4ME6A 4UXNA 1J09A 1ZETA 1MSFC 4ZZDA 3M9AA 4QWQA 2K5CA 5EEAA 1G59A 3CJNA 1Z7LA 1FJGH 4F4ZA 4WD3A 1SD5A 2QVOA 4D5CA 2FRHA 1XSDA 1OR7A 1T0FC 5DM7F 3J7AK 5KFDA 3RDIA 1G3YA 5B3SH 1Y0UA 5IPAA 2R7UA 3OYDA 1YRNA 2L7FP 2NYXA 3OYGA 1M0TA 5E1WA 5D4SA 4IRCA 1B72A 5DQGA 2NAZA 4DV1H 1ZHFA 1GSAA 4A3LG 4XLFA 2R93A 4RGUA 4CCOA 2KJCA 2EK5A 2HOSA 1G4DA 2JTVA 2V9KA 4XNFA 3LNQA 2DPUA 1X1PA 2MH9A 3QYFA 4U7BA 4C3JJ 4UB8C 1KU7A 4BY7J 2WTEA 3IKTA 2LY9A 2M0MA 1VS0A 1Y0NA 3CDHA 1OJLA 3E6DA 2CH0A 2WBMA 1UG2A 3EUKL 4CCLA 3BR3A 2VOOA 4L1KA 3WO0A 2DWCA 5IOZA 1YRNB 3G3ZA 3MQ0A 2H1LA 3FM5A 1RRJA 4QWCA 3R4KA 2VKEA 4N4OB 3TEDA 2IP4A 3H36A 4UVCA 1WWXA 1TTYA 3LWFA 1REPC 4Y52J 1FIPA 2DFEA 2Z9OA 1IN4A 3CJRB 3JW4A 3LSKA 5JLWA 3MKLA 3OYLA 1LNWA 4RNMA 2YU3A 2HJWA 2YPRA 1Y1VJ 4M7EA 3SZTA 4DV7H 1BR4A 3M8JA 2CMPA 5KFJA 2ZO4A 3I53A 5EWEA 3ELKA 1XTAA 4UNOA 3ABLH 4JQFA 4XQFA 4DR1H 2E1NA 3RB3A 4G9YA 3FXOA 4YY3H 5K5RA 2Y9YA 3Q9VA 1KONA 4KA4A 2E7WA 1Z77A 2E2IA 1KU2A 4F4YA 5IP6A 2MA3A 2R92J 1MJ9A 4N0BA 4MTDA 1KYZA 1E3PA 5LHHA 1Z2NX 1KU9A 3K4CA 4GDFA 2ZB9A 4BACA 2EB7A 1SFUA 2E71A 4MEXF 2VBYA 2VQGA 4XLNF 3C0FB 4LF6H 1MNMC 1IRZA 3K70D 3M8FA 4CGZA 3DEEA 1YLFA 3MEXA 4QJFA 2Z1DA 3RJ0A 2JA6G 2M05A 3MZHA 5IT9Z 3E97A 2NNNA 2XCAA 4DLKA 5DCMA 5L3CA 5C1PA 2W8LA 2FOWA 2VBZA 5E20A 4AVZA 2STTA 2VN2A 3HGYA 3ZXSA 3GTGJ 1BA5A 3M9NB 2L7KA 4MO7A 5C8YF 2XRLA 4M3FA 4S0HB 3U21A 3D1NI 2AQEA 4F93B 4PJ0C 3S17J 2XPUA 1F5TA 5BS6A 1OYYA 3FKIJ 2HXIA 4XN3A 5IYZF 2EH3A 2LDUA 3CF5F 1Z6TA 1J7KA 1W1WE 4ZTJA 1BM9A 2NRAC 4HX8A 2V7FA 5L1IA 2K4BA 4F91B 1MBKA 2D5VA 4IHSA 1I1GA 3HKZN 3TIIA 2VQLA 4UV9A 3VPRA 4EJVA 4HV6A 2K9LA 2QZ8A 4EJTA 4Y33A 3PW0A 1IXRC 5DCMB 3ZRGA 4RAYA 5CPRB 1SC7A 2L7ZA 4OIQF 3RTRA 3R61A 4B09A 2DDBA 1YX5A 1XN7A 3ABUA 4HYEA 4NUBA 5D5XB 3GQCA 5LRSA 2KRHA 1H88C 1UAAA 1CQTA 3CMMA 4ED2A 4IR9A 2XHKA 3GTPA 4A3LJ 2RN7A 3F22A 2WAFA 3K4NA 1QZYA 3HSEA 3ZOBA 2GA2A 1IN5A 4X1EA 1ETVA 1UC9A 4KNYA 1XSVA 2ZM6H 2ZMEA 5KT3A 3FBNB 3ZR8X 5I47A 3VDXA 4M3EA 4UY8I 1XS9A 3GTLJ 2ALZA 4HQ6A 4A6EA 1POGA 4FHTA 4MFEA 3GTJJ 6PAXA 5KG4A 4M9XA 4O3QA 1DGRM 3W3CA 2BBYA 1FT9A 3G71I 3DF7A 2JA5A 4DYQA 4CCJA 2X6WA 3RPUA 1IN7A 4LF4H 1QNTA 5C1OA 3ETJA 4JV1A 2ZFUA 1HNWH 2V26A 2V4QA 1QHHD 3B6AA 3Q8RB 4PZJA 3DXJF 2Z33A 1UJ8A 5KG5A 2ESNA 3H9GA 3K7AJ 3RAQA 1IRGA 1JLLB 2FOKA 5JQWA 3KP6A 2OV7A 5ILUA 3HKZA 1Z2OX 2DA3A 3H0GA 3RAXA 4CYDA 4FX0A 1X9NA 1ETWA 2UXBH 2RNGA 1T98A 2K7LA 3CJTB 1ON1A 1J5EH 1Y56A 2W00A 2YX7A 1Z91A 3PM1A 4HX7A 4Q48A 2R7ZG 1K6YA 1K83J 1VNDA 3FDYA 2MSYA 1FX7A 1HQCA 4KT6A 4YRVA 1VQKI 5F1JA 2M0CA 2LG4A 3M1CA 1YS6A 2M8GX 2DPJA 3F23A 4F4XA 4A3GG 3L4JA 4B3MH 4B3RH 3GTMJ 5LHGA 2J6SA 3Q9SA 4ENNA 2RREA 3HRMA 3I59A 1GLNA 5LFAA 3GWZA 4L9VA 1HC8A 2QYZA 3TQ1A 4A3MG 5E1ZB 1D1AA 3GIKA 1VQ9I 1HF0A 4HLYA 2JA6J 4ESJA 1SVMA 2CJJA 2XKPA 4QPQA 4DR3H 4IL6C 5GPCA 4B3SH 3ABMH 4QTRA 1JKOC 2E35A 2Q1ZB 3CCQI 2R84A 4FTHA 2L0KA 3DPUA 3IUOA 5KFLA 2WAEA 4KFCA 2KRFA 4M3DA 2CZGA 4Y13A 4YR2A 4A3IG 2ZXIA 3W2AA 1WJEA 2FLPA 3S14J 2G7HA 3I12A 4YB8B 2EPFA 4C5BA 3G1OA 5DUIA 2L01A 1S9HA 3V6HA 1S68A 3I59B 1FIAA 4J9KA 2G0EA 1BC8C 1MIJA 1X1DA 4IQJA 2CW8A 4C5AA 5FRNA 1R7JA 1AU7A 3HOSA 4QW8A 1JDEA 1F1ZA 2WADA 3TMOA 2DZDA 3L2UA 1TWHA 4RNOA 3PNYA 2M4GA 3COAC 3B73A 3F72A 5F0HA 5DTDA 3G6XA 1LDJA 1IOVA 4N9IA 1SVOA 1KJIA 2D2WA 2A69F 3BTLA 2ZNYA 2EIJH 1ZTRA 3GFJA 4BU2A 3TW7A 4D7MA 2DTRA 1V9PA 1OLTA 2DCEA 1TQPA 2VC0A 1X1AA 1H8AC 2XVCA 1TWCA 2RGRA 4BXXG 3L00A 1C0WA 5J6XA 2ASLA 2LC2A 4IHWA 4A5NA 5E8GA 4I02A 5CJ9A 2GXGA 1P7JA 4FE7A 1YW7A 4EG0A 3F8NA 3U9GA 1SFKA 1I50A 4YJ2F 2BQ3A 2VJJA 4JI0H 1APLC 3OHBA 1H9GA 2V9VA 3ONQA 4KT5C 1L3LA 3ZPLA 1A04A 1IG7A 3QPSA 4F7ZA 3W2VA 2DAOA 3AL0B 3M07A 3SEZA 2IS4A 2E1OA 4KHPH 1Y14B 2W7NA 4JV0A 1F36A 1YI2I 3OYIA 3HOYG 1ZARA 4TV8F 5LGUA 2FK3A 5DM6F 4HPQA 1A6IA 2BEOA 2W25A 1U3EM 2ADUA 4UB6C 4BYYA 1D8JA 4DR6H 1B8IA 5EZGA 1WSUA 1Z3XA 2DFHA 4I01A 1S29A 2OCCH 2HEOA 4A6DA 1TBXA 2CFXA 1B4AA 4JX6A 4E4TA 4A3EG 2M3AA 4XKVA 4EM2A 2R7ZJ 1JKRC 3OYJA 3EUAA 3EUHC 3MR5A 4KMFA 4IWXA 5L3EA 1HKSA 2O5RA 2AU0A 2FUG2 3DKYA 4A3GJ 1GSHA 4XRSA 1OCOH 5E79C 4CUGA 1HW5A 1Y6IA 2HGCA 2STWA 1LFUP 2B63A 4Q5SF 3I4NG 4DBQA 3JSNA 4PWQA 1SMTA 4A3MJ 1PP8F 1VQPI 2R8GA 4FETA 2CYYA 5KKNB 2A07F 2JPCA 2QQ9A 3FXMA 2E5NA 3JTHA 4JOMA 2FB9A 3TOAA 1YO5C 2PMZE 5LRRA 4MV1A 3GV7B 2R7DA 2JEGA 5IYBG 2UVWA 4XRMA 1TT0A 4HF0A 2FK2A 2EA4A 3PNTA 4A0XA 3M3YJ 3HBLA 4E7JA 5KT5A 3HOZG 2EFNA 3MR3A 5E3LA 1BOBA 4KIBA 2IRFG 3FDSA 3BZCA 1NK2P 3DBRB 4A3IJ 1S97A 1TQIA 2P5VA 4XL9A 2AO9A 1KBLA 4FBUA 3UFXB 3ZQIA 2EQRA 2F5CA 1JXLA 2DT7B 5FKNA 2V58A 1JDBB 5FKMA 1X58A 4NHJA 5KFAA 5HOOA 4O5VA 1XMAA 3HZJA 4TV7A 1K6OA 2KP6A 3BY6A 3LMLA 4I98B 5FLMG 4PFOA 2M5WA 1DP3A 4LF5H 1ITYA 2LNBA 3A2KA 2GIZA 5CA1F 1RKTA 4BS9A 3L7WA 4J9LA 2KHMA 3BR2A 3IHUA 3BJ6A 4XORA 4CXFA 3WG9A 1HLVA 2M34A 4M6VA 2CW0F 4ITVA 5CVUA 3SQNA 2L9RA 1SD4A 1TW2A 2MG4A 4B3XA 5J47A 1FEXA 4ECQA 3GFIA 4XLEA 3PIOF 2M8EA 3WNZA 4EEYA 4JI6H 4BE1A 4KN7X 1O3SA 2L4AA 4BXXJ 2HOEA 2TCTA 4LB6B 2NU8B 2W9AA 4RZQA 3VPBA 2RQPA 5DCFA 5DLGA 2LY1A 1AKHA 2NVXJ 2AGPA 4C5CA 1DDNA 1Z7UA 1YIJI 2OZUA 3ZMTA 3H3ZA 4IRIA 3GIJA 3VFZA 2ZXJA 3Q0VA 4ZYEA 1Z05A 2L3DA 4NC8A 2PMUA 4C2UA 2QF7A 2DODA 3BG6A 3WE2A 3MWEA 5JVLA 4J9RA 2GLOA 2HFHA 3KP2A 4ASNA 3CUQC 5LBQA 4ENMA 2XAQA 4BDYA 4ETSA 5KFWA 3BPVA 3GFLA 4YIRX 3S3OA 4TQSA 3EETA 3FHZA 4CYCA 3KCCA 4GO1A 3KZZA 1MBHA 5H6RA 3PSFA 1R4MB 3BQ2A 3MZ8A 2DMTA 3HOYJ 1E4GT 1XMKA 2DA2A 2VE9A 3DQVC 2R7MA 5KG3A 2W9BA 4NXNH 1AKHB 1Z21A 4Y7NJ 1O3TA 4EEQA 1J5YA 1HA8A 1TWGJ 1AUXA 1GDTA 3GVAA 2YS7A 2CQ7A 2L4MA 5LP6F 1P7IA 1VBHA 1YOVB 2BQRA 1FTZA 1R22A 2L7MP 4RGXA 4DZJA 3CD6I 3ZMSA 1S7EA 2E7XA 3CTAA 4A3EJ 1W36D 3F8CA 3MZYA 3HRUA 4CYCB 2CQYA 4HX4A 1JJ8C 2QYOA 5FROA 2DFIA 2VT2A 2ZJRF 1RR8C 2JRMA 3K1NA 1IC8A 4RB0A 4WCGA 2K85A 1ZG5A 3I4NJ 4MQVA 2W9BB 3TDZC 4ED7A 3M7GA 1HOMA 1VKZA 4LK1F 2WA0A 2OQRA 4QLCU 4U88A 4UUSA 4V2FA 3N8DA 1HW2A 2E2HA 5IYBJ 3IP4B 4BL0B 2VA3A 1BR1A 5CAEB 4BJTA 2NU9B 1ODDA 2I87A 4AUXA 5DD8A 3CC4I 2FPIB 1Y1WG 2M4KA 3ZP5A 3HOZJ 1DPUA 2DMNA 3ASOH 2PG4A 4IHXA 3N41B 3Q2OA 4A93G 2PLYA 2BQUA 3A4CA 4H0EA 2HWVA 1X2MA 1FY7A 2P6TA 2JWTA 2X51A 3DKXA 5E1XA 4E7SA 2GIVA 3J7YJ 4DIQA 1JJ6C 1T36A 2W71A 2JSCA 2BGCA 1Q1VA 4J00A 4ZTFA 2H27A 3T0YA 1R71A 4B47A 2GPSA 4UUSB 2LTPA 1YJNI 3OS1A 3E6CC 4ON0A 5FLMJ 1PDNC 3I3LA 3K4MA 3PW4A 3DP7A 2QK4A 4FQGA 5FKOA 3C3WA 5CYVA 3BG3A 1JTYA 1TAEA 2MBFA 2OUMA 4NLGA 1W5SA 1FC3A 2GA1A 3ECHA 1EYZA 1S0NA 5C44G 2DYSH 3K9TA 2O9LA 1N78A 1SVLA 3P7NA 4BDZA 1E4EB 2XPWA 1MKMA 3JAMZ 1KJJA 2IGMA 3F6VA 1VF9A 4XM3A 3H0DA 3M1EA 1ETXA 3BA9A 2JVGA 3Q5FA 4X66H 2UVUA 3K4BA 1TWFA 5BNGA 5M5YJ 1QPIA 4CHUA 2HZDA 1KQ8A 3S1NJ 3DU6A 5FPOA 3F6OA 2VKDA 2R82A 1UNNC 2WDTA 2JRTA 4WF2A 3QODA 2JN6A 4M71A 5JFRA 3IL2A 3H5RA 4M73A 3DBHB 1OCCH 4X0GA 1QZEA 3G1MA 3KYLA 3E0JB 2OPTA 3IKVA 5EYRA 1I6UA 5D5UB 5FJ8G 1W7PA 4EBCA 2FJ1A 4I0BA 1T38A 3GW2A 4Q44A 4ECWA 2JEFA 2YU9J 3CLOA 2MH2A 1W36C 1PK8A 3I4MG 3JRAA 3OIOA 1SFXA 3QYBA 4HG2A 4L9NA 5JVDF 3ML6A 4LB5A 2EZKA 4BE0A 4JI5H 5FD6A 4PDKA 4BJ6C 4QIWN 2XB0X 1XG1A 4QPOA 2ECCA 3GFMA 4HSRA 2M7BA 2HQRA 4OAZA 2A3SA 2L9SA 1LE8A 1XDSA 1EF4A 2F2EA 1LFBA 3VYTB 3W2WA 1E0EA 3LA2A 3KPHA 3LWBA 2QBYB 2V6EA 5D8LB 2OC6A 3QU6A 4H4KC 3MKYB 3TBIA 3JRWA 4XLAA 4QWDA 2FBHA 1ZRFA 5J8CA 4RB2C 1GO3E 1W7PB 1E17A 3ZQCA 2CUEA 4AIKA 1FBSA 1NG7A 2NVUB 3WTUC 1ERDA 5DQIA 4ZOLF 1W0UA 1IBLH 2VR1A 2W7PA 1R36A 2CWEA 3PFYA 4B44A 5EOYA 3H1CA 1V5FA 1P2FA 3JR9A 4LF8H 3WG7H 2WY8Q 3WGHA 1RKWA 3GLXA 2V5AA 5FGMA 1RJRA 3L2PA 4EGZA 3RGZA 3KIOA 2XRNA 4LIVA 1X1BA 4D9JA 2PJRA 3GCMA 1Q1HA 1LE8B 5KFPA 3OYFA 1ZRDA 2G7UA 4ECUA 3J7AY 4JP0A 2K86A 1Y1WJ 3BQ1A 4DL5A 2Q2EB 2G9WA 4C3IJ 1X2NA 5J3LA 5F1RA 4PSXA 4ZZLA 1BBYA 4DR2H 5KFBA 4KICA 1UMQA 3VSKA 4A93J 3BLYA 5K7HA 2OBPA 1FZPB 4MNUA 2AS5F 2E2HJ 2F4OB 3PR5B 2KSWA 1WFXA 4JV2A 2XKOA 3W6VA 1JE8A 3OTOH 1HNZH 4JI4H 1W5CC 1WVRA 3V8KA 5KT6A 2E5LH 2VXDA 3BQYA 4DOZA 2FP4B 1E3HA 2L2OA 4DV6H 2O8XA 3CMYA 3GIDA 4JX4A 1TLHB 2QLZA 3AG2H 3O8GA 1ENHA 2VB6A 3FXJA 4XIDA 3IH3A 3KXYT 3U2RA 3LQQA 5LMNH 4IF4A 5BQTA 4PJLA 4HQEA 2R8IA 4UCVA 1UB9A 3VEPA 2PJRB 1J2XA 2XROA 3LAJA 4BHPA 4JBAA 4RM3A 2K40A 4Q43A 4RZRA 4WX9A 1T94A 1WJ5A 2DLLA 3CCMI 4LF9H 3SDBA 5C44J 3PW5A 1L2ZA 2EIKH 1A5JA 2W6PA 2BY1A 1M6VA 2A6HF 3M8EA 2YRWA 4HR7A 3RB0A 2PQ8A 3LA3A 2CO5A 4GGGA 3GX4X 1YE9A 1F4KA 2YZGA 2PBZA 2VT3A 3OV8A 4FS1A 5AIQA 5B1AH 3S2HJ 5CVRA 2GXBA 1VAJA 2X48A 4YR3A 3RI4A 1FP2A 2Y0MA 3BT9A 4MV9A 4LIUA 4EV0A 4PCQA 3MCZA 2PMHA 2X4HA 4C3HJ 3SJMA 2DN0A 3OOUA 3O2PE 2FX0A 2DBBA 2VUMA 1TWFJ 5F0CA 3HYIA 1RI7A 2GBYA 2VLAA 2VJIA 1P92A 3C1DA 5FJ8J 4U87A 3G6EI 1BJTA 2Y0SE 4IHJF 4MV7A 1HDPA 2EWNA 1EHIA 1G3SA 3I4MJ 1JKQC 1A36A 4W97A 1T33A 2VKHA 1Z1DA 2QQAA 4QWEA 3TP0A 3QFFA 1ULYA 5JLXA 2WB1E 4FBTA 1NH3A 2XD4A 3KP3A 4BGDA 5DG7A 1VQLI 3BJYA 1W5TA 3L2VA 3HTSB 3J7AO 3HJEA 2I80A 4XKCA 2OTLI 4Y8VB 4LGWA 1RYSA 1JUMA 1G3TA 2BHZA 3E3VA 3OIPA 2FEZA 3P5JA 2GM4A 3QOEA 2NVYJ 4RM2A 4CDGA 3L2RA 5DGAA 2DT6A 1B72B 1TL8A 1R1UA 5FKLA 3WTZA 4RB1A 2LR8A 2IA6A 2O7OA 1S0MA 2OU2A 4GXOA 3KHGA 2MABA 4OIRF 2M30A 1NTCA 3S2WA 1P8LA 2J9GA 4X64H 3HHHA 4B4CA 1FLIA 1F9NA 3S2DJ 2KZVA 1MBEA 2PJPA 1WHUA 2LKSA 2KPMA 3BROA 3SEQA 5ILVA 2YRXA 1MW7A 3OYEA 4HYKA 2XF5A 4BY1G 3O8HA 2QUFA 2CS3A 1X19A 3GV5B 2IGNA 2FBKA
chains in the Genus database with same CATH topology
3V8JA 3ZMUA 2E1CA 4NB5A 1FOKA 2XIGA 3KFWX 5BPDA 3DEUA 3H92A 3RYPA 1FVIA 4R79A 3KEOA 1W4MA 4AIJA 1O7LA 1ZRCA 3ULQB 2ZJ2A 2DK8A 1BI0A 2VC1A 3CO6C 5A2QZ 2O0YA 2GZWA 1DPRA 4KUMA 2JPBA 3DKWA 1G3WA 3KETA 2VOPA 1BI2A 1J9IA 5DUKA 1U2WA 2PFBA 4Q47A 2P6SA 1USSA 3ABTA 4AVPA 4UHTA 4A12A 3GZ6A 1R00A 2H09A 2O3FA 5FFXA 5JI6A 1B9MA 4M74A 3CO7C 3GYHX 4G6QA 4Q4ZF 2EFOA 2CG4A 2HVSA 1T6SA 1VTNC 3RKYA 3BJAA 3WU0A 3FXQA 1SEIA 2VXZA 1A0IA 1ZGAA 3FX3A 5DEQA 4EMSA 4NQWA 3DFGA 5ICEA 3ERED 1SFEA 1XGOA 4A2BA 3I71A 1UHMA 5CVIA 3DV8A 3P9KA 3MAJA 5FB2A 2R7FA 4ESFA 2M87A 3ZMVA 4GYIA 2EFWA 2EV5A 3J80Z 1R1VA 2HVQA 3I5UA 2XASA 4BQAA 3RTXA 2ZMEB 4B8XA 1OMIA 3WTTC 4HW0A 2RC4A 4LK0F 5ICGA 1V3FA 4HDUA 4CZZA 2BE5F 3KAKA 3JSLA 1YTYA 2MLKA 4GKJH 3DF8A 2IP2A 1XCBA 2IW5A 4EFBA 4DUZH 4CICA 3T1BA 3EUHA 2QQBA 2NS0A 3FXRA 1LVAA 4HQMA 3QRFF 4DV0H 1N33H 1MJBA 2FMLA 1I6XA 4LH6A 2ZCWA 2FXAA 3SFZA 2FE3A 4JI7H 4PGGA 2QWWA 1E2XA 3V7CA 3J81Z 3QPTA 1IUYA 2YCHA 4P9FA 1FNNA 1G6NA 2IJLA 4JI3H 1ZG1A 3E6MA 3BOQA 3P9CA 5FLXZ 3HRSA 3N44B 3EYYA 5CVJA 4OOIA 5CVVA 5LGTA 2COMA 3HSRA 2PI0A 4L0ZB 4Q0YA 4IVNA 2A68F 1IW7F 5CLSA 2IA1A 3QU3A 4GCVA 5LMUH 1ZGJA 1S6LA 1XSXA 1IXCA 2YX4A 4ESBA 3V7SA 4DV4H 3K3VA 1TW3A 1IZ1A 2HGSA 4L9TA 3FM3A 5H6QA 5E8IA 1KU3A 4DR4H 4O3MA 1T39A 5HS8A 1MJAA 4IXAA 1B1BA 3FZVA 3WGGA 2UUCH 2HHHH 3B02A 3K69A 4EM1A 3IRRA 5FPRA 2UWMA 3F3XA 1JHHA 3FF5A 1J75A 3RIZA 1ZN2A 2XGXA 4LSXA 4K2EA 1FSEA 3REOA 5LEJA 2VQEH 2RNJA 2V79A 2ZKZA 2DQRA 2DT5A 2OD5A 3F8MA 5DD4A 4HA8A 1GXQA 2VUGA 2VBWA 1FWZA 3K2ZA 4ZH4F 5JVTA 1S7OA 2DI3A 3GUDA 3BP8A 4E70A 2Z3YA 5KK1A 2VODA 1I5ZA 5ED4A 3EYIA 2LSOA 1XGSA 4UCRA 2ZNZA 1FYKA 1QQIA 1FBUA 2J5OA 3P9IA 4UVAA 2F5FA 5HLIA 1OYWA 4N9HA 3ECOA 3MFKA 4LFCH 4A2UA 2Y75A 1R23A 3BA8A 4I7HA 4ENKA 1UCRA 3L9FA 3R0JA 4UCTA 1IBMH 4G7HF 1ZYRF 4IRGA 4HZFA 2UXCH 4JI1H 1FYLA 4L18B 1PP7U 2GWRA 2XAFA 4IPAA 3DPLC 1WRJA 4RS8A 3FWEA 3I0TA 4R1HA 2EV0A 3IWFA 1JHFA 4L0YB 2MD5A 1AOYA 2MC3A 4PGHA 1PUEE 1O75A 4JK1X 4OIPF 5EEHA 2ESHA 5IWAH 4DQ2A 2FU4A 5IT9K 5A2QK 1P4AA 2AXLA 4LH7A 1P6RA 2VQFH 4YIFA 3GXOA 3TO6A 1LEBA 2WC2A 4GKKH 1YG2A 5D1OA 5FFZA 3KEQA 2UXDH 4XBFA 4PDBA 1BC7C 4A0ZA 1HKQA 1HSTA 1U5TC 2FMYA 5E17F 4HF1A 3LQRA 1UFMA 2V1DA 4LFAH 1IAWA 4LD5A 5KVRA 5D1OB 2JT1A 2EFPA 4BXUA 4WWCA 3PQKA 4UCOA 2HVRA 2BYVE 3D0SA 4CC6A 4R8HA 2ACJA 1FKAH 3TKYA 3I4PA 2FQ3A 2RKHA 4O6JA 4DNCA 3N4MA 3J80K 2F5DA 5DYMA 4K0KH 1MZBA 1T0FA 1K78A 3V8LA 2YR2A 1IBKH 2PN6A 3MWMA 4MGRA 4S05A 1LQ1A 4D0PA 1FBQA 4XSZF 3ZMZA 2O6GE 4MEYF 5L3DA 4CC5A 2L54A 3T1YH 4XLPF 5HS9A 3CUOA 3RYRA 2XAGA 1K78B 2DW4A 3H3UA 5LGNA 2Q2TA 4UCSA 4L9JA 1E4FT 1QPMA 4R7RA 5HDNA 2P8TA 1EV7A 2DU9A 3D5LA 2Q2UA 3BJOA 3SZPA 3C18A 2W84A 1T2KA 1K79A 5ICFA 5TJJA 3W6KB 1Z9CA 3JSPA 1IN6A 4OX9H 1XD7A 2ISZA 1U78A 3LAPA 3VOEA 1CF7A 2BV6A 2RDPA 2K27A 1AWCA 1SAXA 2CGPA 5K1YA 1TQMA 4BH9A 4LG0A 3O3KA 3RPQA 4ENJA 2M1BA 3T5XA 1I94H 3RF2A 1ZHSA 4DV5H 1DP7P 1BIBA 3TGNA 2HR3A 1XMOH 4CO8A 2IA2A 2DO7A 3HUGA 1MD0A 1CF7B 3KLOA 2X0LA 4Y15A 1FSHA 5JR3A 1IF1A 4LG0B 2GQQA 2ETHA 3K1MA 4U0VA 4AIHA 3OOPA 3HSFA 3DPTA 1N36H 1ZLJA 3N6XA 1LB2A 1D5VA 2HKOA 1MGTA 4M72A 2HYGD 3RGXA 1M0WA 4JYAH 3WTVC 4B3TH 4P5OA 4EGYA 3CVZA 1D8KA 3M4IA 4IAJA 2P4WA 2P7CB 5D8KB 2Q0OA 4DR5H 1LJ9A 2D1HA 1YFHA 1HW1A 4YG2F 3V4GA 3QP6A 2ELHA 4WK8F 1S7AA 4NXMH 4BHCA 2VONA 2CSOA 5K5QA 2A6EF 3N43B 3GF2A 1NHAA 1K7AA 3BDDA 3F21A 1ZG3A 4I2OA 3ISPA 1JGSA 1XMQH 4MHGA 5AIPA 4M9SA 1QZZA 3PN1A 2RVCA 3KP5A 5IT3A 1OKRA 2R3SA 1BI1A 1O3RA 5F6FA 4JI8H 1ONVA 1BJAA 1X3UA 4XSXF 4KDPA 1XDNA 3JTGA 2KKOA 1HSJA 2MCTA 1R5HA 3KAJA 3EQLF 5D1PA 1KQ0A 5BR8H 2KJBA 1P4XA 2C6YA 4Z2YA 1RIOH 3RIRA 1GXPA 3QAHA 4P55A 3WTWC 4G7OF 1XNQH 3IRQA 1SD7A 3GEZA 2UUAH 3E5XA 2UXXA 4L5JA 2EV6A 3GZ5A 1BGWA 2H6BA 1WH2A 4M6XA 4EJWA 2XAJA 4LSAA 3O6BB 2KIUA 1OYIA 2QENA 1L0OC 1LEAA 4KN4X 4X62H 2VBXA 5ERIA 5E18F 2UZKA 4XRFA 1SMYF 3VODA 1HBXG 5DDGA 3NQOA 3TDUC 5BMZA 1IN8A 4G94A 1J0RA 4MQ9F 2RV8A 4P96A 1ZLKA 2DK5A 5FO5A 2VE8A 4LFBH 4YFKF 1RUOA 4S04A 1TA8A 1XGMA 3NEUA 1WKMA 3ZQ7A 2ZBKA 2O61A 2K02A 2CQKA 2KIFA 4A5MA 2A5YB 4HDVA 2FF4A 5HVQC 2HTJA 4FM9A 4LLGF 5JHUA 1XGNA 3U1DA 2IVMA 4RAZA 2O03A 4DV3H 4UUVA 1LDDA 3RKWA 4UVBA 3N42B 1YYVA 3WGIA 1B59A 4A2AA 2EFQA 1GVJA 4GLXA 3PFIA 4FX4A 3JAMK 2QM3A 4UCUA 2OQGA 3WU1B 1YW9A 4AD9A 4LFUA 3GO5A 5IT9W 3K0LA 5A2QW 2DQLA 1H9TA 3I58A 2XUBA 3V7RA 3KP7A 5EEGA 4EFEA 1ZREA 3L4KA 3F8FA 1FP1D 3TO7A 3QOPA 1V4RA 2Q8KA 1FYMA 1TNTA 3ROUA 3BABA 1DGSA 4DUYH 4KMUX 1STZA 1QBJA 1IXSB 5HDGA 4WXHA 2W24A 1KGSA 2UXNA 1RZ4A 2VOBA 4AWXB 2P5KA 4APMA 2XAHA 3HTUA 2H6CA 4HAMA 4M9ZA 1XCVA 4KIFA 4WXDA 1OPCA 2IPQX 3WTSC 4OIOF 4LMYA 1P4WA 2L02A 3TOBA 3CUQA 1S03G 4AQYH 1U6GA 3E5UA 1MDMA 2Z99A 5FD5A 4HOBA 1S3JA 4ZYHA 3R0AA 3RJPA 3J80W 3KZYA 2LF8A 3AAFA 2KIMA 1U8RA 5BPIA 1TNSA 2Y48A 1YIOA 1KQ9A 4OMYA 3CUQB 2FA5A 4X65H 3WODF 1YQAA 1USTA 2V1XA 1RUNA 2IT0A 3I54A 3N40P 1BN5A 1MDMB 3R6SA 1FPQA 3I64A 4DV2H 1B04A 3N97A 4HBLA 1BI3A 2V1UA 4EJUA 5D5VB 1DUXC 5HS7A 3ZN1A 5ICCA 3LA7A 1D3YA 2GAUA 4U0WA 5HLGA 4EQQA 5H20A 1Z2PX 2IA0A 1S8NA 2FSWA 4JI2H 5LEKA 3UQ8A 3J81W 1I27A 4ZYDA 1Z6RA 5K5OA 1QO0D 1U5TA 4J0MA 1EH8A 1RNLA 3QPHA 1B6AA 5D5WB 3HRTA 4MTEA 4IJAA 5FLXW 2OZ6A 5J8FA 4WXCA 3T8RA 4I0AA 1UHWA 3FXUA 2HKXA 4HV5A 2OWOA 1ON2A 4OINF 2UU9H 1U5TB 4M6YA 1YS7A 2XV4S 3VB2A 1O3QA 3KALA 1XDUA 1H0MA 3RKXA 3NRVA 1KYWA 4FT8A 5HDKA 2EA2A 1B9NA 4G6DA 4Y17A 5D6EA 4A0YA 2OA4A 4JV5H 3G73A 2W85A 2RGVA 3FMQA 3T8TA 3HXLA 4ZYGA 2ZJTA 3WTXC 2YSRA 3KP4A 1O7FA 1QGPA 4RGSA 4YHHH 2F5EA 3BZ6A 1XB4A 4GYGA 4OMZA 3IWZA 1GHCA 4DR7H 2D1VA 2PEXA 3T1HH 2B0LA 3BPXA 1BIAA 3HOTA 4LJZF 3IG0A 3H20A 3R60A 4EM0B 1AN7A 1R58A 1XNRH 5BOXA 5ILSA 2HDCA 3TQNA 1SYXB 4L5IA 4YFNF 2K4JA 4BAYA 3FMRA 3ZN0A 2V6CA 2HYFA 2A61A 2LKPA 1IRFA 2FNAA 4YIIA 2HQNA 3SXYA 2DPDA 4LF7H 5TRDA 4HF2A 1HKTA 2HZTA 2Z5UA 2CW7A 2JZYA 4OU0A 3WTYC 2OAZA 1R1TA 4I09A 1WI9A 2F4VH 4BWSC 2WV0A 4UFZA 1EH7A 3TO9A 2HTSA 2FBIA 3L09A 4G8XA 4BHBA 2HS5A 1SD6A 2WWYA 5L3GA 3K1PA 3KLNA 1EH6A 3C7JA 2LF7A 5L3BA 5D4RA 2D45A 2WE6A 5HLHA 1ZHQA 1KA8A 2ISYA 5LHIA 1HNXH 3EDPA 1YW8A 2FNPA 3FMSA 3HIFA 2QBYA 2WYOA 1LDKB 2P5LC 1N34H 3LFKA 2ZFWA 2PBIA 2TDXA 2EJRA 2P7VB 1W7PD 3ZMDA 3JSOA 3BWGA