The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
36
|
sequence length |
134
|
structure length |
133
|
Chain Sequence |
MVENSELRKAGLKVTLPRVKILQMLDSAQRHMSAEDVYKALMEAGEDVGLATVYRVLTQFEAAGLVVRHNFDGGHAVFELADSGHHDHMVCVDTGEVIEFMDAEIEKRQKEIVRERGFELVDHNLVLYVRKKK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Architecture of a protein central to iron homeostatis: Crystal structure and spectroscopic analysis of the Ferric uptake regulator
pubmed doi rcsb |
| molecule keywords |
ferric uptake regulation protein
|
| molecule tags |
Gene regulation
|
| source organism |
Pseudomonas aeruginosa
|
| total genus |
36
|
| structure length |
133
|
| sequence length |
134
|
| ec nomenclature | |
| pdb deposition date | 2002-10-07 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01475 | FUR | Ferric uptake regulator family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Arc Repressor Mutant, subunit A | Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | ||
| Alpha Beta | 2-Layer Sandwich | Dna Ligase; domain 1 | Dna Ligase; domain 1 |
