1MZBA

Ferric uptake regulator
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
134
structure length
133
Chain Sequence
MVENSELRKAGLKVTLPRVKILQMLDSAQRHMSAEDVYKALMEAGEDVGLATVYRVLTQFEAAGLVVRHNFDGGHAVFELADSGHHDHMVCVDTGEVIEFMDAEIEKRQKEIVRERGFELVDHNLVLYVRKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ferric uptake regulation protein
publication title Architecture of a protein central to iron homeostatis: Crystal structure and spectroscopic analysis of the Ferric uptake regulator
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Gene regulation
total genus 36
structure length 133
sequence length 134
ec nomenclature
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1mzbA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1mzbA02
1R1TA 1ZAOA 4YFKF 1CGPA 3WE3A 2NRAC 1QQIA 2FA5A 3K1MA 2J5PA 2OD5A 5H20A 3Q5FA 3L00A 5LGTA 4GCVA 2FOKA 4M6XA 1IN4A 2O6GE 1OYYA 3E6BA 3QAHA 2NAZA 1WKMA 4HOBA 1S6LA 1ZG1A 3RYRA 1U5TC 2YSRA 5L3GA 2RQPA 4PDKA 3TOAA 2P8TA 5DUIA 2EV5A 5CVVA 1LDKB 2O03A 3GF2A 2M45A 5DCMB 2MLGA 4A6DA 3NRVA 3V8LA 1IXCA 3ZPLA 1WWXA 1DUXC 1IAWA 1OYIA 2Q2EA 2V79A 4HX7A 1S29A 1YW7A 3OOPA 2JPBA 2VT2A 2ZFWA 2FBKA 3JAMZ 2W25A 2BGCA 2L3DA 2XAJA 2XAGA 4RAZA 2V1DA 3HIFA 2H09A 4IXAA 5ICGA 4MQVA 2JT1A 3L2CA 4L9NA 4U0WA 4P55A 1A04A 4U7DA 4HDVA 5L3CA 5FD6A 3LFKA 2EJRA 4M6YA 2NS0A 3OV8A 2GXGA 2P6TA 3O2PE 5LHHA 1J5YA 2ESNA 5HS7A 1YW8A 4HLXA 5HLGA 1FBUA 1O7LA 2FRHA 4NB5A 1S7AA 5ICCA 5BOXA 2Z3YA 2DPDA 3WTUC 2EA4A 3HSRA 2MA3A 3TO6A 4KNYA 4OIQF 4LD5A 2LF7A 4O6JA 4IPAA 2G7UA 5HS9A 3BP8A 1AWCA 1LJ9A 3SHFA 3I58A 1R5HA 2K4JA 4XLPF 3LWFA 1E2XA 2HGCA 4P9FA 2IA1A 1ZGJA 3MZHA 2ETHA 1XGMA 4KN7X 3L7WA 5JR3A 4QLCU 4IJAA 5KK1A 1XSDA 4M9XA 3O6BB 3AAFA 3K69A 4GGGA 2K27A 4L5JA 2A61A 2EFNA 1I27A 4ENNA 4Z2YA 1JHFA 1OPCA 4LG0B 2YR2A 3E6CC 1ZLKA 2IA2A 4EJWA 1FP1D 5EEGA 3NEUA 1ZG3A 3GFJA 5AONA 3QPHA 1FLIA 3SXYA 1RZ4A 3IRRA 3ULQB 4Q47A 4OOIA 3ZP5A 3ZMZA 1ZRFA 1B4AA 1IXSB 2HEOA 4KUMA 3FMRA 2FMYA 1KQ8A 2ZMEB 2PEXA 3JSPA 4EV0A 5ERIA 5A2QK 4CGZA 2RDPA 2BE5F 3CUQC 5BQTA 3IWFA 1YW9A 5JVTA 3REOA 4F7ZA 5K1YA 1IRGA 3DFGA 3J7AO 3M1EA 1USTA 4P9UA 5ED4A 1U8RA 3LQRA 2GXBA 2OZ6A 2EWNA 2XUBA 3HRTA 1DPRA 1G4DA 5D5XB 1XD7A 1FY7A 2STTA 2DQLA 4RS8A 3VFZA 3MEXA 5E1ZB 3ZMVA 1T0FA 3TGNA 1OYWA 5ILVA 1BI1A 3W6JB 3B02A 1XMKA 2LDUA 1BC8C 1P4WA 4I0AA 5J8CA 5KVRA 1O7FA 3I64A 3GX4X 3MFKA 3RIRA 3ZMDA 3ABTA 1P6RA 3BDDA 3WTSC 1J2XA 1FSEA 4B09A 4KMFA 1F1ZA 2EA2A 3LSTA 3P9KA 2DPUA 3H3ZA 5K5QA 2O0YA 2E7WA 2JTVA 3ML6A 1XB4A 4LB6B 5D5WB 2EK5A 4KT5C 3MQ0A 5HDGA 4LB5A 4I98B 2VODA 2BEOA 1U6GA 1FBSA 5CVUA 4KIBA 4A5MA 3DEUA 2P7CB 3WU1B 3FX3A 4RAYA 2FNAA 2H27A 3BJAA 5E17F 1IZ1A 5E1XA 3ERED 5AIQA 2IJLA 4Q48A 1R1VA 1T2KA 3Q9VA 1O3RA 4KDPA 2MC3A 2P5VA 3HSEA 2OBPA 5JFRA 1WQ2A 2GAUA 1BBYA 4BHCA 1BI0A 1MD0A 2M30A 1FX7A 2ISZA 3GZ6A 4RGXA 1IW7F 1FT9A 4HW0A 1HBXG 4G94A 5E8IA 4M72A 2XAFA 4EM2A 1R58A 1TW3A 5D4RA 1UHMA 5BPIA 1LDDA 2X0LA 4HF2A 3HRUA 1RNLA 2DBBA 4KYWA 3I53A 2CW0F 6PAXA 4BHPA 2A69F 3VOEA 2Z9OA 2Z5UA 4XSXF 5BMZA 3DXJF 4PGGA 1BIAA 2FU4A 4KICA 4FHTA 3WTXC 2HKXA 3WTVC 2B0LA 3VEPA 1KGSA 1ULYA 2M87A 2P5LC 5E20A 3BROA 1XCBA 4CZZA 3RKYA 2FXAA 1S8NA 3IKTA 2M1BA 3RI4A 3CUQB 1HKQA 1ZGAA 3ZN0A 3CDHA 1ZH5A 2WTEA 1MZBA 3PFIA 1DDNA 3EYYA 3IL2A 2LNBA 2DK8A 1RUOA 4E70A 4L9JA 3KP3A 3LAJA 2XKOA 4UHTA 4EJOA 2UZKA 2QUFA 4CXFA 1EH7A 2PMUA 3HSFA 1B59A 3CJNA 3BJOA 2CYYA 3JTHA 3HHHA 3K1PA 3FM5A 2J5OA 3ECOA 4ESBA 3IKVA 2HWVA 4G7OF 1UHWA 1BI3A 2F2EA 3QOPA 1Y0UA 1QZZA 3CTAA 2XKPA 1T38A 1YO5C 4M71A 1J9IA 3FMQA 1H0MA 4WXCA 2F5DA 4EJTA 4HYEA 1Z6RA 3N4MA 2A5YB 3M8EA 1P2FA 1KU3A 1QZYA 2STWA 1ON1A 4OIOF 5D4SA 1IXRC 2KRFA 4HA8A 3GUDA 2R3SA 2XHKA 4HX8A 3R0AA 2XROA 1JGSA 4WXHA 2IPQX 1IRFA 4L5IA 1PP7U 2VN2A 4LG0A 1OR7A 2BBYA 4RB2C 4UXNA 1U3EM 2H6BA 4IF4A 2V6CA 1G6NA 1BI2A 2VBWA 3SFZA 4EJUA 5DD4A 2A6EF 1K79A 4ZYEA 4FT8A 1G3TA 2KIUA 4YG2F 3HTSB 3KP5A 3SZPA 1P92A 1W4MA 3B73A 3L09A 3KZZA 1JHHA 3GWZA 3J80K 1BC7C 4CICA 1OKRA 4IHSA 2JSCA 3R60A 3CLOA 1G3YA 4WK8F 4AD9A 5D6EA 2H94A 3WTTC 1TQIA 1U5TA 5D6FA 1UFMA 5HVQC 1SAXA 5FB2A 1TQPA 4KIFA 1IN8A 3WG9A 3F72A 4Q5SF 2MH2A 1I1GA 5FD5A 3ECHA 3I59B 5FLXK 3V8KA 2LSOA 1KU9A 1BJAA 4ZYDA 4R1HA 4MNUA 4N9IA 4R8HA 3S2WA 4LLLA 3RKWA 2DT5A 4HLYA 2X4HA 1ZYRF 3P9CA 5K5RA 2OU2A 4MHGA 4Y15A 2OZUA 2HYGD 3IHUA 2HS5A 1Z6TA 2HDCA 5A2QZ 1WI9A 1P4AA 1J59A 3E6MA 3V7CA 1S7OA 1K7AA 3WTYC 1Z7UA 4G6QA 2CSOA 2GA2A 3LQQA 1CF7A 2RKHA 2OQRA 5LHIA 1XCVA 4UNOA 3JTGA 1TBXA 4G6DA 5BPDA 1C0WA 1K78B 1G3WA 4G9YA 1FP2A 4O5VA 4L18B 4GYIA 1QGPA 2XIGA 1LB2A 1LNWA 3GFIA 2BV6A 3QP6A 2UWMA 2RV8A 3O3KA 1Q1HA 3TOBA 3L9FA 2KJBA 4OMYA 1OMIA 1T6SA 1RI7A 2FE3A 1B9NA 3ROUA 4CO8A 3K2ZA 1D3YA 2QM3A 5EEHA 4N9HA 3K1NA 2HZTA 2EFQA 4YFNF 2D1HA 1YS7A 1MDMB 2DO7A 2IT0A 2HTJA 2EFWA 1HSJA 5LBQA 2HKOA 4I02A 2COMA 1R36A 1NHAA 4P96A 3HUGA 5F1RA 1PP8F 1GVJA 3TDZC 2MH9A 2ZJ2A 3K0LA 3HTUA 1SFXA 3T8RA 2FQ3A 4HQEA 2XAQA 3N97A 5LHGA 2IVMA 1USSA 4RGUA 3J81Z 1R22A 3WTZA 2XASA 4AWXB 1KYZA 3QP5A 3MZYA 2RN7A 5J8FA 3COAC 4MGRA 1IN7A 4ENJA 3DV8A 2CO5A 5JHUA 2ZKZA 5L3FA 2FBIA 3KCCA 1ZN2A 3VODA 1ZHFA 1F5TA 2HTSA 1HQCA 3E5QA 2K7LA 2FBHA 4U7BA 3FZVA 3CO6C 2PI0A 2VC0A 1W7PB 2G7HA 1T98A 1SFEA 3KP6A 4ON0A 2DFIA 4K2EA 4EJVA 1D8KA 2QLZA 2QBYA 2BYVE 2A6HF 3NQOA 2G9WA 3T8TA 2IW5A 3PQJA 2P5KA 1GXPA 4EGZA 3SQNA 4U0VA 1DP7P 2CWEA 4XLNF 2XGXA 4O3MA 1UB9A 3ZMSA 4UVAA 5LRSA 3DPLC 2Z33A 4ESJA 1J7KA 4EVIA 3HOSA 3I54A 3RKXA 1STZA 4AIKA 4UVCA 5CVIA 2VC1A 1QNTA 2F5FA 3FXUA 3V7SA 2GIVA 2FF4A 5H6RA 3V7RA 4ZZLA 2YPRA 2WWYA 3KEOA 1AOYA 5L3EA 4OIRF 1XMAA 2PBIA 4A0ZA 4CHUA 2DQRA 1IN6A 2RNJA 5DEQA 3WE2A 1FYMA 2W85A 2XRNA 2R7DA 2M5WA 3KETA 4HX4A 2ZNYA 3VB2A 2GA1A 1MKMA 1SD7A 3RPUA 3DKWA 4RB3C 1IF1A 1TNSA 1R1UA 1B6AA 1KQ9A 3ABUA 4LLNA 3DP7A 2FNPA 2DTRA 2A68F 2PN6A 3RJPA 2CGPA 1DPUA 2E7XA 2WC2A 5DCMA 3BPXA 4ETSA 4EMSA 2ZO4A 3TO9A 3F23A 1FZPB 3R4KA 1FBQA 1W5SA 2D1VA 3P9IA 4HF1A 4RB0A 4DQ2A 1O3TA 2L01A 2KIMA 3WTWC 1MJ9A 3FHZA 2QZ8A 3DPTA 5LEJA 2O3FA 4NHJA 4M9ZA 1LDJA 5LGUA 2NNYA 1F9NA 3LA2A 4JK1X 3E97A 2V1XA 4XBFA 2RGVA 3F3XA 4A5NA 3EETA 1J0RA 2QQAA 3J80Z 4YIIA 5D5UB 5ICFA 3EQLF 3KP4A 2FMLA 4I01A 4PZJA 4BQAA 3M8FA 2UXXA 1TLHB 2A3SA 1O3SA 3G73A 2QVOA 1QO0D 4Y13A 2E1CA 4UV8A 5LRRA 2OA4A 2V9VA 2WV0A 4KFCA 3RYPA 1JE8A 2HQRA 4LMYA 2O8XA 4I0BA 1GHCA 3EUHA 4MEXF 1B1BA 3FM3A 5FLXZ 2Y48A 4I09A 1TTYA 3GO5A 5D8LB 1O57A 1I6XA 4G7HF 3T5XA 5FFZA 2MD5A 2QQ9A 3R6SA 4MTEA 3D0SA 5DUKA 1R5GA 2Y0MA 4BNCA 5L3BA 1BIBA 1SD5A 1K78A 2DW4A 1YLFA 1GXQA 1EH6A 4HDUA 5FFXA 3K9TA 4G8XA 2PLYA 5FGMA 2Q0OA 1Z05A 3C1DA 2RVCA 5D5VB 5DYMA 4BYYA 3TQNA 3JW4A 2LKPA 3F8BA 2L02A 3GLXA 2EV0A 4M73A 3I4PA 3U9GA 1ZREA 5HLIA 3H3UA 4I2OA 4AIJA 4WXDA 4TV7A 2PQ8A 4IRIA 4IVNA 1HXDA 4QWQA 4OMZA 1MDMA 1KU2A 5IT9K 2HQNA 5E18F 2ESHA 1B9MA 4MQ9F 1FNNA 2ZXJA 1XDSA 2VBXA 1D5VA 3GW2A 1TQMA 3BOQA 4EGYA 1R23A 4M74A 3HRSA 4OU0A 2PJPA 4ZYGA 1YQAA 3M9AA 5F64A 1YS6A 3ZMTA 3FMSA 3F8NA 4EM1A 3C18A 4HQMA 1QPMA 4U0YA 4RGRA 2EFPA 3EYIA 3BWGA 3F22A 2NYXA 3H92A 2L4MA 1XGOA 3IRQA 2PG4A 4FX4A 2ZMEA 2DI3A 4HV5A 3WGIA 3FF5A 1SMTA 5D8KB 4KN4X 2YX4A 3MCZA 3WU0A 3GFMA 1MJAA 4CYDA 4UVBA 2NNNA 4RB1A 4A0XA 2K4BA 2OQGA 3ZMUA 1W7PA 4KA4A 4HV6A 1YFHA 4Y17A 5LGNA 1MJBA 1HW5A 3V8JA 4B8XA 4U88A 3JSOA 4WCGA 3BPVA 2XV4S 2VONA 4S05A 2PFBA 4PGHA 3E5UA 2DAOA 2VE8A 4LLGF 2GQQA 1ON2A 3E6DA 2ZBKA 5DCFA 4HAMA 2Q8KA 4EM0B 1I1SA 1T39A 5HOOA 1MGTA 3G3ZA 2UXNA 2FSWA 1G3SA 2IA0A 4R79A 3QPTA 4ASNA 4BH9A 4H0EA 1WSUA 3F8CA 3TO7A 2VOOA 4ENMA 3QU3A 2F5EA 3CO7C 3LA3A 1KQ0A 1R00A 2CFXA 2D45A 5CVRA 2QQBA 5J6XA 3TDUC 1V4RA 5DDGA 1RUNA 1L0OC 5CLSA 3P7NA 4A6EA 1HSTA 1HW1A 3U1DA 2ACJA 2O61A 4UV9A 5ILUA 1YYVA 3HOTA 3ZN1A 3W6KB 1W7PD 1KYWA 5JI6A 1LEAA 2W84A 4EQQA 1SD6A 2LF8A 5HDNA 5F6FA 3LA7A 2P4WA 1REPC 2C6YA 2L54A 1FOKA 3HHGA 4JBAA 2MLKA 2CQKA 3R61A 2VOPA 2KJCA 2ZNZA 4CDGA 5LEKA 2GWRA 1Z9CA 5IT3A 5K5OA 3RDIA 4A2UA 5ICEA 1JXSA 2QENA 3R0JA 3I71A 3JAMK 1O3QA 4IHTA 1E17A 1L3LA 2MBFA 2QYOA 3EDPA 3MAJA 3KZYA 1W5TA 5CYVA 1YIOA 5LLQA 3QU6A 4AIHA 5FO5A 1YTYA 1U5TB 4L0YB 3F6VA 5E8GA 1HKTA 3WODF 1VTNC 2F5CA 1EH8A 1Z91A 1HW2A 1J75A 2HYFA 4N0BA 3I5UA 1BM9A 3DQVC 4MTDA 4GXOA 4LGWA 2EB7A 5BS6A 2XVCA 2JZYA 4IRGA 1XN7A 1U78A 1R7JA 2V1UA 1EV7A 2D2WA 3ELKA 3IC7A 3GFLA 1ONVA 1QBJA 1I5ZA 3CUQA 4OIPF 1BN5A 3ISPA 1XSVA 3WGHA 3KLOA 2IP2A 4WF2A 3GXOA 3F8FA 3DF8A 2ELHA 2A07F 1ZLJA 2EFOA 5AIPA 2VBYA 3FWEA 1ODDA 1D8JA 4MEYF 3C3WA 3U2RA 3MWMA 1KU7A 3GYHX 2AS5F 4ESFA 1FPQA 3ZQ7A 2L4AA 3BJ6A 2P7VB 3FXRA 5CVJA 1XGNA 1KA8A 1CF7B 3F8MA 3I0TA 4LK0F 4HBLA 1F4KA 4GO1A 4NQWA 1PUEE 1XDUA 4IRHA 1ZRDA 3F21A 3KLNA 4KIGA 1PDNC 3CUOA 4LFUA 5TJJA 1YG2A 4PCQA 1P4XA 3V4GA 3SZTA 1FYKA 4I7HA 5DD8A 4RGSA 5HS8A 1XSXA 3FXQA 3TKYA 2E1NA 1HKSA 2KKOA 4BXUA 2HOEA 4L0ZB 3KP2A 2W57A 1SD4A 4KMUX 2PMHA 4WWCA 2DLLA 2VXZA 1UCRA 3T0YA 1LVAA 5L3DA 2QWWA 4XSZF 4YFXF 1S3JA 4JQFA 3WGGA 1ZG5A 3RPQA 2RC4A 3J81K 3D5LA 1TNTA 3GZ5A 1FC3A 1RIOH 2JPCA 2KIFA 2W24A 5H6QA 4ZYHA 2TDXA 1SMYF 1SFUA 1V3FA 2AXLA 2DK5A 4LJZF 3M7GA 2H6CA 4AVPA 1LEBA 1U2WA 1X3UA 1FYLA 5E1WA 4P5OA 5IT9Z 1ZARA 1Z1DA 4HZFA 4S04A 2ISYA 2VT3A 2YU3A 2P6SA 2GZWA 4ZH4F 3KFWX 1WRJA 4LK1F 4BHBA 2R7FA 3C7JA 3PQKA 3Q9SA 4M9SA 4HF0A 4BAYA 3I59A 2Y75A 3T1BA 3GVAA 3HYIA 4WX9A 2Z99A 3QRFF 2HR3A 1LQ1A 3GEZA 2QBYB 4A0YA 3BZ6A 3LAPA 1XGSA 5DV5A 4ZZDA 4FX0A 4G7ZF 2CG4A 3RTRA 2YX7A 4A12A 1BOAA 4GYGA 1H9TA 4Q4ZF 2K02A 3E5XA 5TRDA 1ZRCA 2VE9A 5CJ9A 5HLHA 2ADUA 2OAZA 4ENKA 3KE2A 3HRMA 1FWZA 3F6OA 4XRFA 4D0PA 4UUVA 2JRTA 4DNCA 2VBZA 2ZCWA 3KEQA 2FEZA 5ILSA 1H9GA 3KP7A 1K6OA 1IUYA 4YIFA 5HDKA 1TW2A 2XAHA 2EV6A 2IRFG 1IN5A 3IWZA 4L9TA 3BY6A 2DU9A 4OINF 1FSHA 2M8EA 2HFHA 2K86A 3E3VA 4L9VA
chains in the Genus database with same CATH superfamily
2HGSA 2ALZA 1R1TA 2WA0A 1ZAOA 1RESA 4M3GA 4YFKF 1CGPA 3Q0UA 3WE3A 2NRAC 4G3IA 4DR3H 1QQIA 2M7BA 1TA8A 2DA7A 2FA5A 3G2BA 3K1MA 4B3RH 2J5PA 2KRCA 4H4KC 2OD5A 5GONF 5H20A 1JDEA 2QGUA 2GXAA 2QQ8A 4PUSA 4TUYF 4J9LA 2R87A 3LOCA 3WHBA 1VQPI 4OAYA 3Q5FA 2WY7Q 3L00A 3QPLA 3HOWG 5LGTA 5J4VA 4GCVA 2FOKA 4M6XA 1E4FT 3N41B 1AHDP 3JRAA 1IN4A 3Q3SA 1OYYA 3HG9A 3WHCA 3E6BA 2O6GE 2VQEH 3QAHA 3GTMA 4A3CJ 4IEJA 4N4OB 4EBDA 4LF5H 4NXNH 5KFCA 2NAZA 1WKMA 4HOBA 4HPQA 1S6LA 1ZG1A 4LSXA 3RYRA 1DU6A 3J80W 3H40A 1RETA 1U5TC 2YSRA 5L3GA 2RQPA 4PDKA 3TOAA 4XN3A 4BJ6C 2PN1A 3J7YJ 2P8TA 5DUIA 5FLMG 4FBTA 2EV5A 1C3OA 3RQIA 4ED3A 5CVVA 1Y1WA 2BHZA 1LDKB 2O03A 1S68A 3GF2A 4A3EJ 1B8IB 2DXIA 3GTQJ 2JSPA 3P5JA 4ZDLA 2C35B 2M45A 2ZMEC 1RKWA 5DCMB 2MLGA 4OAZA 2B9SA 3J7AY 2V6EA 4C5BA 4A6DA 3NRVA 1N33H 3V8LA 3ZQLA 1IXCA 3GTPA 4JX6A 1WWXA 2CW8A 3ZPLA 1QVUA 3S3OA 4E7IA 2HOTA 2WY8Q 3OYBA 1DUXC 2VPQA 1HLVA 4A3FG 2X6YA 1IAWA 2DMNA 1OYIA 2P81A 3BCBA 3PO2G 2Q2EA 2R5ZA 2V79A 5IYBG 4HX7A 2RF4A 2CV0A 1S29A 1AKHB 1YW7A 3OOPA 1OLTA 5FLXW 2JPBA 1EF4A 3PFYA 5HBRB 2VT2A 5KFTA 2VKEA 1P7JA 3BC8A 3A2KA 2C22A 2ZFWA 4A3KJ 3H3VK 1SFOA 3H0GJ 2R86A 2IEKA 2HQ5A 3A03A 1DU0A 3B6CA 4Z6YA 2GOMA 3FDYA 2R7ZJ 2ZJTA 2FBKA 1D1CA 1FTTA 3JAMZ 2W25A 1DIKA 2BGCA 2L3DA 2XAJA 3MZ8A 5KT7A 3HOUJ 3HKZE 3BR1A 3R5HA 3TBIA 2XAGA 2MD0A 4O4HF 3TINA 4EGJA 2B63A 4RAZA 4WBNF 3ZR8X 2V1DA 3C2HA 3HEFA 1WZ2A 3HIFA 3WNZA 1RRJA 2H09A 5K7HA 4IXAA 5ICGA 4IAJA 4MQVA 2JT1A 3L2CA 5BPHA 4L9NA 2WDTA 4U0WA 4HYKA 3JCUC 1YRNA 5J1YA 3CVZA 3MR6A 4UB6C 1MMDA 1ZTRA 2UU9H 3ESWB 3H9JA 4P55A 1A04A 4PJNA 4U7DA 4J19A 5JUMA 1V51A 2AGPA 4HDVA 2XPWA 2W82A 4V2GA 4ECZA 1HC8A 4ECRA 5L3CA 2R8IA 2QSGX 5FD6A 3LFKA 4NUBA 3A0HC 2EJRA 4M6YA 4N4NB 2NS0A 1LKXA 3OV8A 1M6VA 3FMAA 5KT4A 2GXGA 2JWTA 4JUZA 2P6TA 3O2PE 5J1RA 2MCTA 5LHHA 1J5YA 4IQJA 4IX7A 1S9FA 2ESNA 5HS7A 3E5NA 2KP6A 1YW8A 3I9V2 3HOXJ 4HLXA 3TP0A 2WB1A 5HLGA 1EUDB 2ZFUA 4Y33A 5EG0A 2L9VA 1FBUA 1Z3XA 1O7LA 3H0DA 1ETXA 2RGRA 2KFDA 3O8HA 4XKCA 2FRHA 4NB5A 3JSLA 4J9PA 1EKEA 4W1UA 1MBKA 1S7AA 5ICCA 5BOXA 4CCJA 3VPCA 2LREA 2Z3YA 2DPDA 4II2A 5B3SH 1X2NA 4FQGA 3LSRA 3WTUC 1JKQC 2EA4A 5C3EG 3HSRA 2MA3A 3TO6A 4KNYA 3RUPA 1CQTA 4OIQF 4P1WA 2FP4B 4A2AA 4YR2A 3L2WA 1BJTA 3HM5A 5IP9J 1BA5A 1WI3A 4LD5A 3CCQI 2LF7A 4O6JA 2EH3A 4IPAA 5F9NA 2NU9B 5JLWA 2G7UA 2WAQA 5HS9A 2X9DA 3BP8A 2KRHA 3LSIA 1LJ9A 4AU7A 1AWCA 4R7RA 3SHFA 3TIGA 3I58A 5KG7A 5DG8A 1R5HA 2EINH 5IOYA 3JSNA 1X4OA 2K4JA 1IOVA 2W71A 5D8DA 2LBFB 2R7NA 4XLPF 3LWFA 1E2XA 2HGCA 4V2FA 2OJED 3OTOH 5B66C 2R8KA 4C2MJ 4P9FA 2GBYA 5F04A 5KCMA 2IA1A 1ZGJA 5JVGF 3CESA 3MZHA 3ETHA 2ETHA 1XGMA 3CMYA 4ZI7F 4KN7X 4LF6H 3L7WA 3I56I 4IRDA 1IC8A 3PW2A 1Z3YA 1Y8QB 5JR3A 1VS0A 3JRIA 1KJ9A 2P0AA 4QLCU 2JA6A 4IJAA 1FMVA 1KONA 5KK1A 1XSDA 1PUFB 4M9XA 2XGCA 3O6BB 1FVIA 1MNDA 3AAFA 2L9RA 3AG4H 4BDZA 3K69A 3IUOA 1H88C 4GGGA 2K27A 1K1QA 4B47A 4L5JA 3M3YJ 2A61A 2EFNA 1I27A 1X2MA 5KFQA 4ENNA 1RKTA 1IO2A 1HR0H 4Z2YA 4XLFA 1X1BA 3DU6A 1JHFA 1O4XA 1OPCA 4LG0B 2YR2A 4F50A 1YIJI 2OTLI 4QSHA 2HOAA 3E6CC 4ZHQF 1ZLKA 2XSJC 1I50J 1EYZA 4RMNA 2DMQA 2R7OA 2IA2A 4EJWA 3MWDA 1FP1D 5IP7G 2Y2ZA 1ZELA 3OIPA 4DW6A 3G6YA 3FKIJ 4IHVA 5EEGA 2BHYA 3NEUA 3OR2C 1ZG3A 1V5FA 3GFJA 5EZGA 3HOYG 2NVYJ 1ERDA 4CA0A 1ZHSA 3ORRA 5AONA 2FK1A 3QPHA 1FLIA 3SXYA 2M2EA 1PX2A 1WH5A 4I6ZA 1RZ4A 3IRRA 1RC9A 2VJ5A 1I6HJ 3ULQB 3EPGA 5EDNA 1HNXH 3K3VA 3RB4A 5B5EC 5FPOA 4EG0A 4Q47A 3SE7A 4ECVA 2UVWA 4OOIA 3ZP5A 3GTJJ 5K2MA 3ZMZA 1ZRFA 1B4AA 1WVRA 3A4CA 3LL7A 2R7LA 2SCUB 1IXSB 2HOSA 1IGNA 5JVDF 3BG7A 4WD3A 2MFZA 3CJQB 3GTLJ 5LA6F 4O3OA 3IAS2 2HEOA 4XNFA 1MMSA 2M8GX 2XCLA 1KBLA 1JTXA 5EOYA 2V9WA 4KUMA 1RJRA 3FMRA 1ZR2A 4XICA 2FMYA 3IH2A 5FKNA 1KQ8A 2C2EA 4IZOA 2JEJA 2HYJA 4G12A 2KDZA 2ZMEB 1TWGJ 5TISC 2PEXA 2DMUA 1CQJB 4KITB 1G59A 3JSPA 2EIKH 4EV0A 1LFBA 3MFHA 4DL5A 1GSOA 4R8UA 5ERIA 5A2QK 3GTGJ 3S2HJ 1W96A 4CGZA 3DCFA 2ZXWH 2RDPA 4AQYH 2BE5F 3CUQC 4EBEA 4GDFA 5BQTA 4FETA 3IWFA 1YW9A 5JVTA 3REOA 4F7ZA 3CMMA 3OWTA 3SI8A 5K1YA 1E0EA 1IRGA 3DFGA 3J7AO 3RB0A 3M07A 3M1EA 3CCJI 3JRFA 1USTA 4OWRB 1K6YA 3HB9A 3S32A 4P9UA 5ED4A 4XRSA 3CCMI 1U8RA 1A36A 1I3QJ 3KHLA 3OIOA 2K3FA 3LQRA 2GXBA 2OZ6A 3QYFA 4IL6C 2GLOA 2EWNA 4ZQIA 3K70C 2XUBA 2WV1A 3HRTA 2R7RA 4NNJA 5FKKA 4A3GG 3BR3A 1DPRA 1G4DA 1XC5A 3M1CA 3GIPA 5D5XB 4DV7H 3S16J 1UC8A 4YY3H 1PVEA 2CQ7A 3GIJA 1XD7A 2NS8A 1FY7A 2STTA 2DQLA 3E0JB 1DGWY 4RS8A 2DFEA 3VFZA 3D1NI 4AYBE 5DGAA 3MEXA 1GUUA 5E1ZB 3ZMVA 1T0FA 4A3IG 3TGNA 1OYWA 5ILVA 1BI1A 4A3DG 4RDUA 3W6JB 1BL0A 3H20A 3B02A 1XMKA 3GV8B 2LDUA 4BQOA 1BC8C 1APLC 1P4WA 4I0AA 2BXZA 2OCEA 5J8CA 4IZZA 4EEYA 5KVRA 4JI6H 1O7FA 2DTZA 1ZQ7A 3I64A 4RNMA 4X0GA 3GX4X 3MFKA 3RIRA 3ZMDA 3ABTA 3GIQA 1D0ZA 3JRCA 4DUYH 1P6RA 3BDDA 3WTSC 2R4GA 2EPFA 2E5LH 1J2XA 1FSEA 4B09A 4KMFA 5KFNA 3Q8PB 3RKQA 1F1ZA 1JX4A 1I94H 1VI0A 2EA2A 2HQAA 2VXDA 1QA6A 3ORQA 3LSTA 3P9KA 2UXBH 2DPUA 2W6OA 3H3ZA 5K5QA 4CCMA 1T08B 2O0YA 2E7WA 2XPUA 5J40A 5M5YJ 2JTVA 4DJAA 4XN0A 1ETOA 3DU5A 3ML6A 1D0XA 1XB4A 4QTRA 4LB6B 5EZYF 5D5WB 1HDPA 2EQRA 3W2AA 2F48A 2EK5A 2VPSA 4KT5C 2DT6A 3SFIA 1VNDA 1IUFA 3MQ0A 5HDGA 1M1EB 1PJRA 1I7LA 2FKLA 1IDYA 4MV9A 4QJFA 4LB5A 5KX5F 4CH7A 3OS2A 4I98B 5LOVF 4J9QA 2VODA 2BEOA 2DOAA 1U6GA 1SC7A 1FBSA 1YJ9I 2CQYA 4MV1A 5CVUA 3ZCOA 3BG5A 4KIBA 4A5MA 5M5WJ 3DEUA 1JKOC 3JRHA 5BR8H 2P7CB 3T1HH 3WU1B 1TZLA 3FHNA 3FX3A 1K4TA 4M3BA 2ASLA 4RAYA 3I4NJ 2FNAA 2H27A 3BJAA 5E17F 1GVDA 3PIPF 1VFCA 1IZ1A 5HNHA 2XF6A 2V59A 5E1XA 3ERED 3CZ6A 2AQ4A 5AIQA 2CW7A 2IJLA 4Q48A 4C5CA 2M4KA 2FMAA 1SVOA 3G6XA 2HI3A 4UCTA 2YL2A 3HBLA 1R1VA 1T2KA 2M05A 3Q9VA 4M3FA 1WJBA 1O3RA 4KDPA 2MC3A 1C30A 5CAEB 3EPIA 3OYAA 5EWGA 3Q0VA 1WH7A 1XDNA 3JREA 2P5VA 3ZGKA 3HSEA 4HQ6A 1I39A 2OBPA 4AUXA 2TRTA 3HUGB 4IR9A 5JFRA 4HEA2 1WQ2A 1Y39A 4CCLA 5C1PA 4F4WA 2GAUA 3BQZA 3R23A 2L7ZA 1BBYA 1K83A 3V42A 4BHCA 1GDTA 1BI0A 1MD0A 5E79C 1TWCJ 1JUPA 4BY1G 2G0EA 4Y4RA 2M7AA 2M30A 1DGRM 1FX7A 2ISZA 2QF7A 5FKLA 2YS6A 2BW3B 4RGXA 1IW7F 3GZ6A 1FT9A 1W36D 5DGBA 4ITVA 2R84A 4HW0A 3HGYA 1HBXG 3KXYT 4A2BA 5KG4A 1RYRA 4RA2A 4C3JJ 2W1OA 4G94A 2L2OA 5E8IA 5JQWA 4M72A 1VBHA 2XAFA 2BY2A 4EM2A 1R58A 1E4EB 1TW3A 3OL3A 2CJJA 2JVGA 5D4RA 3TL4X 4A3MG 2V4RA 2DCEA 1ULZA 3SYTA 2HXOA 2W6NA 1UHMA 4M3EA 1RR8C 1KJQA 5L1KA 5BPIA 1LDDA 2X0LA 3BTIA 2KLOA 4HF2A 2KISA 3K4KA 3HRUA 1HA8A 3ZQQA 2OCCH 2PMZN 1RNLA 5JHFA 2DBBA 1N34H 1R4MB 2L0KA 4ABZA 4KYWA 3I53A 4U6PA 4J0MA 2CW0F 6PAXA 4BHPA 5F1JA 2DZDA 2A69F 3W6VA 2F5VA 3VOEA 3LNQA 4X66H 4DR4H 5IYZF 4BJ5C 1ETQA 4C30A 2Z9OA 2Z5UA 2W6QA 1VQ5I 5BMVF 5DG9A 4XSXF 1BNCA 5BMZA 4E7ZA 3DXJF 4PGGA 4QWDA 4GKKH 1MBGA 3DKXA 4BEHA 2Z16A 1BIAA 2FU4A 3GMEA 4KICA 4FHTA 1E3HA 5D1OB 1GT0C 3KHGA 3WTXC 2KIQA 1JI8A 2HKXA 3EUHC 3WTVC 2B0LA 3VEPA 1KGSA 1ULYA 5FJ8G 2JUCA 3SDGA 2R92G 4RUCA 4OX9H 1BJZA 3PNYA 3BABA 2KMUA 2OH2A 2M87A 2P5LC 4YAJB 5E20A 4MAMA 2R93J 4HSTA 1X3ZB 3BROA 3Q8SB 1MMAA 2J9GA 1UELB 4AM3A 3CF2A 2E5NA 3VMMA 1XCBA 4CZZA 4UUSB 3RKYA 2FXAA 1IOWA 3VYUB 2ZDHA 5CA1F 3LSGA 4B1RA 4Y8VB 2W6ZA 1S8NA 4Q8EA 2X6WA 3RV4A 5KFUA 4B3AA 3IKTA 5F27A 2M1BA 3RI4A 1WCMG 3CUQB 3GTOJ 3OOUA 4F4XA 3H4DA 1HKQA 3LMLA 1ZGAA 3ZN0A 3CDHA 3QYEA 3K5IA 2DA5A 1ZH5A 2WTEA 1MZBA 3PFIA 1ZR4A 1HF0A 1DDNA 2VUMJ 3CMAI 3MMYB 1S72I 3EYYA 3A1YA 3IL2A 5DLFA 3RPUD 4O3SA 2LNBA 4F4ZA 2DK8A 1H89C 1RUOA 4LH6A 1JKJB 4E70A 3M8JA 4L9JA 4FM9A 3KP3A 2A05A 4QW8A 3RF2A 3KPHA 1G8XA 3LAJA 2X51A 2WE6A 3U9SA 1WJFA 2XKOA 1CQIB 3RV3A 1ACIA 4UHTA 4XYLB 2IS1A 1Z77A 4I76A 4EJOA 1N36H 3H5RA 5J1UA 1AUXA 2LP0A 2UZKA 4BBSJ 1NK3P 3CQZA 1N32H 2QUFA 3X2QH 4DLKA 5GAGJ 4CXFA 1EH7A 1A6IA 3PO3J 2PMUA 3HSFA 2EZIA 4RLFA 1B59A 3CJNA 3HZJA 5EWFA 1JLLB 3BJOA 2ASDA 5IYDJ 2CYYA 4EGQA 5DTDA 3JTHA 2WBMA 3HHHA 2NVXJ 3PNVA 3QZ7A 2YZGA 1YJWI 2BR0A 2N8GA 1V5EA 3K1PA 3FM5A 3KYDB 4BWSC 2J5OA 2MW8A 1S0OA 3ECOA 4ESBA 3CMEI 1MMNA 2PVPA 3IKVA 2HWVA 2V1NA 4G7OF 1UHWA 4FS2A 4LSAA 1BI3A 2DPIA 2F2EA 3QOPA 2IGKA 3IV5A 1Y0UA 4XYMB 1QZZA 1FJLA 3CTAA 2CMPA 2XKPA 4HSRA 2WADA 5GPCA 1T38A 3N6XA 1YO5C 3GBGA 4M71A 2LY1A 2E5ZA 4XKBA 1J9IA 3FMQA 4D7MA 4IRKA 2IS4A 2D5VA 3RJ0A 1Y56A 5CQGA 4ECWA 1H0MA 1UJ8A 2Y9ZA 2LBFA 2XPVA 4WXCA 2F5DA 4EJTA 2I80A 4HYEA 1Z6RA 2O5RA 1ETYA 3N4MA 1X19A 2Y0SA 2A5YB 5IT9W 3EUKL 3CF5F 1VQ4I 3M8EA 1P2FA 5IY5H 1KU3A 1QZYA 4FTHA 2STWA 3CC4I 2W4SA 1MBHA 1ON1A 4OIOF 3V4SA 2ZXIA 5D4SA 2W9BB 3PUBA 1IXRC 3QODA 4EYIB 2VQLA 4DR6H 2R92A 4PSXA 1TWFA 1OISA 2KRFA 4Q43A 4HA8A 3RQ4A 1OQYA 3O8GA 4F91B 3GUDA 3MKWB 1K4SA 2DLNA 2R3SA 2XHKA 4HX8A 1JKPC 5KT3A 3PW0A 5E3LA 2NU8B 3VYRB 2DN0A 3R0AA 2XROA 2UV1A 2VIXA 1Z21A 1JGSA 3QWLA 1FIAA 4WXHA 3K6GA 2FPPB 5M5XJ 2IPQX 1RPWA 5GADJ 1IRFA 2QKMB 4A3JJ 4L5IA 1PP7U 2R7XA 2DFHA 5HODA 2VN2A 3OYFA 1SVMA 2ME0A 1X3WB 2DDBA 2FUG2 3RZDJ 1IDZA 1M0TA 1OR7A 2BBYA 4LG0A 1WCMA 2RQQA 3WO0A 5CB4F 4UXNA 4RB2C 3MKZA 4YR0A 3T1YH 1U3EM 3F9KA 2H6BA 4IF4A 2NXNB 2V6CA 1G6NA 1AA7A 1BI2A 1MW7A 2VBWA 3SFZA 4EJUA 1H8AC 4JYAH 5DD4A 2A6EF 3IH3A 1K79A 1B6SA 4ZYEA 5E3MA 1IJWC 4FT8A 2A5WA 4GC6A 1G3TA 3JR9A 3L2RA 2HDWA 2DT7B 3GIDA 1S97A 2KIUA 4YG2F 3HTSB 4LFBH 3KP5A 5EF6A 3SZPA 1OCTC 1P92A 1W4MA 3B73A 3L09A 4XLHA 3KTMA 3KZZA 5E3NA 2JA7J 5HV6A 1JHHA 3GWZA 5C44J 4YIRX 1GYFA 2R7ZA 4MV3A 3J80K 1BC7C 2DDAA 4CICA 1OKRA 2JUGA 4QIWA 4IHSA 2JSCA 3I4MG 3ZQHA 3R60A 3CLOA 1XPXA 4O4LF 2OC6A 4LF4H 3RSNA 1G3YA 4F92B 4WK8F 4AD9A 5D6EA 2H94A 3WTTC 1XNRH 1TQIA 1BW6A 3GTMJ 2NU7B 1U5TA 1N25A 4IHYA 5KHDA 4PJLA 1T94A 1K1SA 4ZTFA 1IBKH 2ZXHA 3K3PA 5D6FA 3OS0A 1OCOH 1UFMA 5HVQC 5FB2A 1SAXA 1HOMA 4QW9A 1UZCA 3S17J 1TQPA 1TWHA 2R0QC 4KIFA 1IN8A 5FKOA 1JJ8C 2LFBA 3WG9A 4PSWA 2P0WA 4CYCB 3OYEA 3F72A 3OYDA 2WB1N 3PZPA 1ZK8A 4O4IF 1Y1WJ 5KFPA 4Q5SF 1TT0A 2MH2A 1I1GA 2R8HA 5FD5A 2Y31A 5C1OA 3LSMA 2LG4A 3ECHA 3I59B 2PX9A 3NGDA 2IBKA 1U0JA 4Q45A 2X6OA 3S1MJ 5FLXK 2R7WA 3V8KA 4DR7H 2LSOA 5FKMA 1KU9A 1BJAA 4ZYDA 4R1HA 4MNUA 1VQLI 4PFPA 4JI8H 4UFZA 3VDXA 5KG0A 4N9IA 4R8HA 3S2WA 4LLLA 1AN7A 3FK6A 3RKWA 2DT5A 1DV2A 4HLYA 2JEGA 2YRWA 2X4HA 2LKSA 1ZYRF 4U7CA 5TGTA 1KC7A 3P9CA 5K5RA 3G8CA 2OU2A 4MHGA 5J2TF 1Z2PX 4Y15A 1U9NA 2OZUA 5EJCA 4TQSA 2R5ZB 4GC7A 4MO7A 4DV4H 2W00A 4J9OA 2WAQN 5IWAH 2HYGD 2KHMA 3NARA 1R49A 2FX0A 3IHUA 2HS5A 5LFAA 1LE8B 1Z6TA 2HDCA 3E3VA 2CKZB 5A2QZ 1I3AA 1JUMA 3AG3H 2ELKA 1WI9A 4BQNA 4BJTA 2VOBA 1P4AA 1J59A 3E6MA 3V7CA 2AXTC 1S7OA 2M9HA 1K7AA 3WTYC 4GRIA 1Z7UA 4XLCA 3GLKA 4G6QA 4DGWB 2B63J 3GTKA 2E1OA 4YP3A 1SCUB 2F4IA 2CSOA 3KHHA 5EGOB 2JA6G 1N56A 2GA2A 3LQQA 1CF7A 4A69C 1E3PA 1MBJA 2RKHA 2OQRA 2EZKA 2RDJA 3OYKA 2GLTA 2K3PA 1S5LC 2C00A 5LHIA 1XCVA 4A3BG 4JX5A 3CDIA 1S7EA 3C2BA 4O3NA 4IKFA 4J9NA 4UNOA 3W2WA 4XIDA 3JTGA 3CCVI 1CS0A 1NG7A 1R6RA 1TBXA 4G6DA 5BPDA 2AHQA 1C0WA 4RM2A 1K78B 1G3WA 2FLNA 5KAFC 4G9YA 5HNFA 4HNVA 1VQMI 1BW5A 1FP2A 2W48A 4O5VA 2QYZA 4L18B 2BQ3A 4GYIA 3CCUI 1QGPA 2XIGA 4XKVA 1FEXA 1LB2A 1LNWA 1VAJA 3GFIA 5KFOA 3HOWJ 3K2AA 2UUAH 2ECCA 3E7LA 2BV6A 3QP6A 3HKZA 2HPMA 2UWMA 2RV8A 3O3KA 1BR1A 4LITA 2UXCH 5F0HA 4JV5H 5KFWA 1VQ6I 1TC3C 5JH7F 1Q1HA 3TOBA 2CU7A 3M9NB 3L9FA 2KJBA 3OSPA 3A0BC 4OMYA 5L1JA 3R5XA 5C4XG 1OMIA 1T6SA 2UUZA 4XRSG 1G2HA 1JIHA 3AYHB 1T33A 1JTYA 1RI7A 4I4TF 2FE3A 1WJEA 2I8CA 1KJJA 4A93G 1B9NA 2O7OA 2LRDA 2VKHA 2FJ1A 3BR6A 1M0WA 2ATLA 2VI6A 1FJGH 2ZB9A 5FLMJ 1I6UA 3ROUA 3Q0WA 4CO8A 3K2ZA 1D3YA 2QM3A 1ETKA 5EEHA 4N9HA 1I50A 3GIMA 4ZOLF 4NDLA 2LY2A 2ZJRF 3K1NA 4UCUA 2HZTA 2W6MA 3N8DA 4E4HA 2V7FA 2EFQA 3BCAA 2ICWG 3MKYB 2MSYA 2K9MA 4YFNF 1GV2A 2D1HA 1WFXA 3JRWA 2E35A 1AUVA 2RREA 1YS7A 1MDMB 2DO7A 2IT0A 2KPMA 2CUEA 4A3FJ 2HTJA 1OFCX 1UAAA 3RAXA 2EFWA 3PO2J 1HSJA 2E71A 5LBQA 1QHGA 2HKOA 2ID6A 5IYBJ 3OYLA 2PJRB 2I87A 5DM7F 4I02A 2COMA 5JLXA 5M3FJ 1R36A 3OY9A 1W0UA 3G4SI 1NHAA 1B33N 5DLGA 4P96A 2YYAA 2MABA 2JK3A 3HUGA 2YU9J 5F1RA 1PP8F 5KG3A 1GVJA 3H5NA 1VBGA 1QZEA 3JAMW 3TDZC 2MH9A 1VQNI 2ZJ2A 3IN5A 3GTLA 2R7QA 3J7ZI 1E4GT 5FRNA 1X4PA 2AU0A 4M3DA 1A0IA 4RU9A 2JQ7A 4YRVA 1MH3A 1S10A 3OR1C 3K0LA 3HTUA 1SFXA 2CZGA 4XKWA 3T8RA 2FQ3A 4HQEA 5LMNH 5KNLA 3FBIB 4QPQA 2XAQA 3K7AJ 3CD6I 3N97A 3TIIA 5LHGA 2AQFA 2IVMA 4BL0B 1XMQH 4DR5H 4PDBA 1Z67A 1USSA 3ABLH 4RGUA 1OCCH 3BA8A 1ENHA 1R22A 1XTAA 3CP8A 2XASA 3WTZA 4AWXB 3J81Z 1M7JA 1Z2OX 1KYZA 3QP5A 3FISA 3KX2A 4MFEA 5B1AH 3VPRA 3L4KA 3BG9A 4DYQA 3MZYA 4JI3H 2BY3A 1FIPA 3PNTA 1FOXA 3BG3A 2RN7A 5J8FA 3COAC 2YZMA 5EZHA 4MGRA 4IR1A 1IN7A 2JA8G 4ENJA 4UUTA 2BQUA 4CC6A 3L2QA 3PUFA 4JYKA 4FASD 2K9NA 4KHPH 3DV8A 2CO5A 5JHUA 2ZKZA 5L3FA 2Y69H 2FBIA 3K4LA 2FPIB 3PW4A 3KCCA 5CQEA 1ZN2A 5J3LA 4YJ2F 4C3IJ 4B3MH 3VODA 1ZHFA 3FXMA 1F5TA 2BVLA 2HTSA 4KISA 2R7KA 3BTCA 2RNGA 1HQCA 3QQAA 3OYIA 4HR7A 3E5QA 2K7LA 1N77A 1D5YA 1TWAA 4PJJA 1JKRC 3U21A 4JI7H 2FBHA 2XGEA 4U7BA 3FZVA 1WGXA 3CO6C 2PI0A 5KG6A 3WO1A 2XCAA 3MVPA 2VC0A 1S0NA 1W7PB 2G7HA 1T98A 2TCTA 2CUZA 4MV8A 1SFEA 5KFKA 2J6TA 3KP6A 3VSLA 2BQRA 1EA3A 4ON0A 2YS9A 3JZIA 5KFVA 5F0CA 3PSIA 2HU9A 4LF9H 2DFIA 2LMDA 4K2EA 4EJVA 1D8KA 1B72A 5KFDA 1L2ZA 1P7IA 2E60A 2QLZA 2QBYA 1T0FC 2NOJB 4C9YA 4DIQA 3A01B 3W2VA 4EEFG 2W7OA 4ED8A 5J4YA 2IS6A 5GP9A 3HOZG 2BYVE 4BXXG 2A6HF 3NQOA 2G9WA 4M7EA 3T8TA 5IYCG 2IW5A 4RUAA 1YRNB 3PQJA 2M3AA 2OWOA 2P5KA 3KEYA 5C3EJ 1GXPA 3Q1KA 2JA5G 4EGZA 3L2PA 1IV8A 4NBQA 3DTKA 3SQNA 3UR3C 5DQIA 3TMOA 1D0YA 1D1AA 3H9GA 3K4NA 1VQOI 4U0VA 2DA1A 3OYHA 1DP7P 3DTEA 1NH3A 3ZRGA 1Y1VG 1OJLA 1UMQA 2CS3A 2CWEA 3K4BA 5FLVA 4XLNF 2XGXA 1TAEA 4O3MA 2M0MA 2W9CA 2K9QA 1UB9A 2DODA 2M0CA 2JEFA 1FOYA 3ZMSA 2FOWA 1Q1VA 3S93A 1GLVA 4UVAA 5LRSA 4A3LG 2NS7A 3DPLC 2Z33A 4D5FA 3WG7H 4BBRG 5EG0B 2JRMA 4ESJA 4I99C 1IRZA 2Q2UA 1RJPA 1J7KA 4EVIA 3HOSA 3I54A 3RKXA 1Z0XA 2AO9A 3OIQA 4LH7A 2RAEA 1STZA 4AIKA 2GM4A 2HHHH 4UVCA 5CVIA 2VC1A 2KSWA 4ZDOA 4ECTA 3BZKA 2OV7A 3I55I 4BY7G 2VPLA 3BQ1A 2LR8A 2RDIA 1QNTA 2F5FA 3FXUA 2BVMA 2L7MP 1BGWA 4DL3A 3DPUA 2VQDA 1YITI 3V7SA 2GIVA 1P8LA 4Q44A 2FF4A 5H6RA 2XDVA 2V4JC 3CLQA 3V7RA 4ZZLA 2R5YA 2YPRA 3OYNA 2WWYA 2FK3A 3M4IA 3M9OB 3GCMA 3KEOA 2C2DA 1ZQ3P 1AOYA 5L3EA 1FMWA 4OIRF 5B1BH 5T14A 3PR4A 1XMAA 2PBIA 3FIWA 4A0ZA 3CJRB 4CHUA 3OL4A 4Y52J 4DR2H 2E2HA 2DQRA 5IP7J 4EFEA 4ED0A 4M9UA 1IN6A 2RNJA 5H80A 5DEQA 4PWQA 3WE2A 2QA4I 3K4CA 1FYMA 2LC2A 4BDYA 2W85A 2XRNA 3MWEA 2F6CA 2R7DA 2M5WA 5IPAA 3HOYJ 2VASA 3KZIC 4PJ0C 3KETA 3HOVG 3V4ZA 2R85A 4HX4A 2H1KA 4ED7A 2ZNYA 3VB2A 2IMWP 3J81W 2GA1A 4Q0YA 2DYSH 1VZ0A 1MKMA 1SD7A 4DV5H 4E7HA 2LLKA 2FK2A 3RPUA 1A6QA 4EEQA 2YRXA 3DKWA 3BA9A 2X85A 4JI4H 3S1RJ 4RB3C 4O3RA 1IF1A 1TNSA 1R1UA 2LH9A 1B6AA 4ECYA 3MR3A 1T36A 1KQ9A 3ABUA 4II3A 3DP7A 4LLNA 2FNPA 5LXTF 2QK4A 4B3XA 3V6HA 2UVRA 2VJ4A 3J7AK 4GLXA 2M34A 5CPRB 3PW5A 2JA5A 2DTRA 4ZDPA 3JRBA 1WH2A 5EWEA 3I12A 4QPOA 1QPIA 2R8GA 1K61A 2A68F 4D9JA 2PN6A 2E34A 4RAGA 3RJPA 2CGPA 4J00A 1B8IA 1DPUA 2E7XA 2GOXB 3TEDA 1Y1VA 2WC2A 5DCMA 3BPXA 3K10A 3DBRB 4EMSA 4ETSA 2PMZE 1A5JA 2ZO4A 3TO9A 1P9QC 3F23A 1FZPB 4GFBA 3R4KA 3FXJA 1HDDC 2DA3A 1V9PA 5KT6A 4C2UA 1FBQA 1W5SA 1EHIA 1R9TA 1UNNC 2D1VA 3P9IA 4HF1A 2WTFA 4RB0A 4DQ2A 3G1OA 4IWYA 1O3TA 2L01A 5KG2A 4MFDA 3M9MB 2KIMA 3WTWC 1MJ9A 3FHZA 4J01A 1AKHA 1FOWA 3UNGC 3ZOBA 1K83J 2QZ8A 2R7TA 3DPTA 5LEJA 2O3FA 4NHJA 4M9ZA 1V4YA 4A3CG 4JI1H 4A3GJ 2BY0A 2X6XA 4DV0H 1LDJA 5LGUA 1XG1A 2NNYA 1F9NA 2H8WA 4Y7NJ 1MMGA 3LA2A 1QHHD 4JK1X 5DG7A 1QRYA 3E97A 2MG4A 2V1XA 2JA2A 2V58A 2RGVA 2VB6A 4XBFA 3F3XA 1NK2P 4A5NA 4EBCA 3EETA 1A9XA 1J0RA 4A3IJ 4CYCA 3H35A 4XORA 1EUCB 1WPKA 5KFJA 4A3DJ 4R8UB 1CE8A 2UUCH 2IXSA 2QQAA 4A3EG 4HNTA 3PL8A 3J80Z 2ID3A 4YIIA 2HJWA 3DF7A 2W7PA 5D5UB 5ICFA 5LMUH 3S1QJ 3EQLF 2L5QA 1XS9A 2ZDQA 2X1CA 2NOGA 2DPJA 3KP4A 2YW2A 3DLLF 1W5CC 2FMLA 4I01A 3R5FA 3TQTA 4PZJA 2HVSA 3S1NJ 3CP2A 4BQAA 3M8FA 1V5GA 4QWBA 2UXXA 1ITYA 4CUGA 3MR5A 1TLHB 1WSCA 2A3SA 2XC7A 3JRDA 1O3SA 3G73A 2QVOA 1QO0D 4Y13A 2E1CA 2QSFX 4UV8A 3UFXB 5LRRA 2OA4A 3T5KA 1X58A 2NVTJ 4DR1H 4YEJA 3PR5B 4G6TB 2V9VA 2ZM6H 2WV0A 1JUSA 4KFCA 2VA3A 3H5AA 4JI0H 4LF8H 3CC2I 3RYPA 1JE8A 3TQ1A 2HQRA 4LMYA 2O8XA 4I0BA 4A3KG 1GHCA 4HNUA 3H0GG 1LE8A 3RB3A 3EUHA 1A31A 3IH4A 2EZLA 5C5JA 1YX3A 1NTCA 2K5CA 5IP6A 4MEXF 4QWAA 2LK2A 4XONA 1B1BA 3FM3A 3E1SA 5FLXZ 1KJIA 2Y48A 3U1KA 4I09A 2R7ZG 1TTYA 3GO5A 2NU6B 2R7VA 5D8LB 2DIKA 1O57A 3FDSA 2Y0SN 1I6XA 2KT0A 4FBUA 3HOUG 4XL9A 4G7HF 3T5XA 2OF7A 1W93A 1X9NA 1IV6A 5KFMA 2X48A 5FFZA 2MD5A 2J6SA 2DA4A 3G6EI 2CUJA 2BY1A 2QQ9A 3R6SA 3BQ2A 4F3QA 4MTEA 5EGOA 3D0SA 3BJYA 2E2IA 4JOMA 1Y0NA 5DUKA 3GQCA 2JEIA 3VSKA 4NQWB 5FPRA 5BNGA 1R5GA 3OYCA 4DV3H 2Y0MA 2EIJH 4IHWA 3IG0A 4JI5H 4BNCA 4ZTJA 3NWTA 3K4MA 5JVLA 3OUUA 2XD4A 1Z7LA 5L3BA 1BIBA 2KDOA 4S0HB 4O3QA 4J9RA 1SD5A 2YS7A 1K78A 1MBFA 2DW4A 1V55H 1YLFA 4DBRA 3N42B 1MNEA 1Y6IA 3TW6A 1GXQA 2JMWA 1EH6A 4HDUA 5FFXA 2XRLA 2AQEA 4IOCF 4E4TA 3K9TA 4G8XA 4LIUA 2PLYA 2OLSA 5FGMA 3S3MA 3BG6A 2Q0OA 1JJ6C 1Z05A 3C1DA 4MA0A 2L9SA 4BE2A 1MSFC 4BY1J 2RVCA 5D5VB 3OHAA 2LVSA 5DYMA 3H1CA 3OMYA 4BYYA 3TQNA 3HOXG 3JW4A 2EZHA 2JJ7A 2LKPA 5KFIA 3CCEI 3CQZJ 3F8BA 1AU7A 3PIOF 2L02A 3GLXA 2EV0A 4IOAF 2UVVA 4QIWN 5D1PA 4M73A 3I4PA 2JVHA 3MD2A 3U9GA 3HC7A 2LYCA 1ZREA 5HLIA 2FPGB 3H3UA 1U9OA 3ABMH 5M3MJ 4AIJA 4WXDA 4TV7A 4I2OA 2DA6A 2R82A 4XLAA 2PQ8A 3N43B 4JI2H 3B6AA 2W7NA 5DQGA 2QCOA 1OR7C 1PUFA 1VQKI 4XLEA 1HCRA 4IRIA 3RZOJ 4ECXA 4A3MJ 1W1WE 5F9LA 3RB6A 4IVNA 1HXDA 2VKVA 4KT6A 3LMMA 4QWQA 1QU3A 5KFYA 4OMZA 4RNNA 4XM3A 2DOFA 5IP9G 1MDMA 1KZHA 2JA7A 1KU2A 3ASOH 1TP4A 3I3LA 2DA2A 5IT9K 2HQNA 5E18F 4IQ4A 4JP0A 3F0CA 4YB8B 5KG5A 3GV7B 2PJRA 3RFCA 2ESHA 1B9MA 4MQ9F 4O2BF 2C28A 1FNNA 2ZXJA 2CRGA 4XMYA 1SVLA 1XDSA 2VBXA 2XGDA 3DBHB 5L1LA 2V9KA 1D5VA 4O2AF 4JV1A 3K5HA 1VQ8I 3GW2A 5KFFA 1TQMA 3BOQA 1JGGA 4EGYA 1R23A 4M74A 1S9HA 3HRSA 4OU0A 3H0GA 1T95A 1R71A 1SFKA 1R5ID 5BPFA 2X1DA 4JV2A 2PJPA 1YHQI 4X62H 4ZYGA 2ZJPF 3DBLB 1YQAA 3M9AA 5F64A 4C2TA 1S0MA 5KFEA 3PM1A 1YS6A 5FJ8J 3ZMTA 4HG2A 2R92J 3FMSA 3UQ8A 1ZETA 4FISA 1TWFJ 3F8NA 4DL4A 4EM1A 4UCRA 2VQFH 1PYVA 1MSEC 1RYSA 1A35A 1VQ7I 3C18A 4NLGA 4FS1A 3IAM2 4HQMA 1QPMA 4U0YA 3JRXA 4RGRA 2XC9A 2EFPA 2WB1E 2F4MB 3EYIA 3BWGA 4DYCA 1Y14B 2VQGA 3F22A 4YR3A 2LTPA 2NYXA 4X65H 2XGPA 2L9NA 3DKYA 3H92A 2L4MA 5GTIC 1XGOA 3IRQA 3QFFA 2PG4A 1WCMJ 2HZDA 5C8YF 4FX4A 2ZMEA 2DI3A 4HV5A 1MH4A 2CQNA 3WGIA 1DQUA 3FF5A 2H1LA 1SMTA 4XQFA 1LVKA 5D8KB 4J9SA 2CV2A 3RTXA 2E1MC 4KN4X 3BAAA 2YX4A 3MCZA 2Y9YA 2XGQA 3WU0A 3GFMA 1XMXA 1MJAA 3FBNB 2BXYA 4CYDA 3LSKA 4BGDA 2V5AA 3FKIG 4ECSA 1OCRH 2NNNA 4UVBA 4RB1A 2O8KA 2ZSHB 4FCYA 4A0XA 3GTPJ 1SANA 4ME6A 4EYHB 4BEHB 3PSFA 3SEQA 1SEUA 2K4BA 3PJRA 2OQGA 3QYBA 3ZMUA 2WAQE 4PJMA 4ZJZA 2DMPA 1W7PA 4KA4A 4HV6A 2LD5A 1YFHA 2CQXA 1KJ8A 4Y17A 4EATA 2CH0A 4X1EA 4APMA 4B3TH 5LGNA 1SFOJ 4D5CA 1MJBA 5CKTA 1HW5A 3HKZN 3VWBA 3A01A 2BZTA 2OPTA 4DYRA 3KIOA 2R6FA 3RCOA 1DGSA 1TWHJ 4Y3OA 3V8JA 4B8XA 4U88A 3JSOA 2EIMH 4WCGA 3BPVA 1YX5A 3W3CA 4JV0A 3SDBA 2XV4S 2M4GA 3FXKA 2VONA 1GSAA 4S05A 2PFBA 1F36A 3E5UA 4PGHA 3CC7I 2DAOA 2VE8A 3GIKA 4LLGF 2GQQA 3WU2C 4DL6A 4MLOA 1YI2I 1ON2A 3E6DA 2WYOA 2ZBKA 5DCFA 4HAMA 2Q8KA 3T5JA 4EM0B 3LFUA 4FU0A 2YUSA 1I1SA 1SAUA 2XB0X 4RNOA 4ANJA 1T39A 3CJTB 5HOOA 1MGTA 1FTZA 4D7NA 3G3ZA 3MFIA 2UXNA 2XSDC 2FSWA 2L7FP 4E7LA 2NVUB 2Q1ZB 2XCPA 4CCOA 1G3SA 2IA0A 4R79A 3QPTA 3RBEA 4E6KG 2VKDA 4ASNA 4C2MA 4BH9A 1BR4A 4H0EA 2VQCA 3HDDA 1J09A 1WSUA 3V6KA 3RIZA 4XK4A 3F8CA 1LPQA 3TO7A 5KT5A 4MV7A 4RZQA 1POGA 2VOOA 4TV9F 5LL6b 4LFCH 4ENMA 3QU3A 2F5EA 4L5EA 3CO7C 1RR7A 3LA3A 1SYXB 1Z2NX 1KQ0A 3GTKJ 4B4CA 5KFHA 3G71I 1R00A 2VJJA 2CFXA 2D45A 2ZDGA 5CVRA 2HVQA 3Q2OA 3ZQGA 1FKAH 2DWCA 4C5AA 2QQBA 4YQWA 2VQHA 2VPRA 5J6XA 2YU9A 2V9PA 3TDUC 1V4RA 2ELJA 5DDGA 5GTHC 2QEXI 1RUNA 2LY9A 2FB9A 4DL2A 3G6VA 2YCHA 1L0OC 5CLSA 3P7NA 3FKIA 5DS9A 3H9QA 4A6EA 1JT0A 2FD5A 1HSTA 2GIZA 1HW1A 2NVYA 5KFZA 5KFBA 4ECQA 3N40P 3U1DA 2ACJA 2O61A 3S15J 4UV9A 1MIJA 1YYVA 4C3HJ 5ILUA 1XX5A 3LSPA 3ZN1A 3HOTA 4YELA 2I5UA 3I4MJ 3W6KB 1W7PD 2V26A 1KYWA 1W0TA 5JI6A 4DUZH 1UG2A 4LIVA 3L1PA 3H36A 1LEAA 2W84A 4YHHH 3GTJA 4EQQA 3AFHA 4JX4A 3BLYA 3KAJA 2OUMA 4BE1A 1T3NA 1SD6A 4E7JA 2LF8A 1WR2A 5HDNA 2MYSA 5F6FA 3LA7A 2P4WA 1REPC 2C6YA 2L54A 1FOKA 2CUFA 4L1KA 3HHGA 1KEEA 3VPBA 3MR2A 2I10A 4JBAA 2XB5A 3OYGA 4PFOA 2BW3A 2MLKA 2CQKA 3AL0C 4BU2A 3R61A 2HVRA 2VOPA 1TWGA 1ORKA 2KJCA 1MBEA 2ZNZA 4V19K 3OSNA 4CDGA 5LEKA 3I4NG 3AG1H 2W70A 2GWRA 1Z9CA 5E3OA 1ZKGA 3GIIA 5IT3A 2ASJA 1B6RA 5K5OA 3RDIA 3GZNB 4A2UA 3G1LA 5ICEA 1JXSA 2QENA 1E4EA 3R0JA 3GTGA 3G1MA 1VF9A 4DBQA 3I71A 2J6UA 4MIMA 3JAMK 2Z1DA 1O3QA 4IHTA 1ZHQA 4W97A 1E17A 5EEAA 1L3LA 9ANTA 3DTIA 2XF5A 1IRXA 2F4OB 1T8IA 4RZRA 2Y30A 2MBFA 2QYOA 2HPIA 2Q2EB 3EDPA 3KZYA 3MAJA 1W5TA 5CYVA 1YIOA 4F93B 1WJ5A 1GGOA 4YJ3F 3LSHA 5LLQA 1B04A 3H3VH 5A2QW 2E2JJ 3QU6A 1I3QA 4AIHA 5FO5A 1YTYA 4LOCA 1U5TB 4IHXA 3HPGA 3L2VA 3F6VA 2KZGA 4L0YB 5E8GA 1O75A 1HKTA 3WODF 4XZ3B 1VTNC 3OSFA 3MN2A 2F5CA 1EH8A 1Z91A 2WAFA 3PVXA 1HW2A 2XAUA 3ZQCA 2V4QA 1OWTA 1N48A 5KFSA 1J75A 3BR5A 5C4JJ 2HYFA 1WJAA 4AC0A 4N0BA 2W9AA 3I5UA 1BM9A 3DQVC 4MTDA 4GXOA 1UC9A 3OUZA 4LGWA 3KYCB 3NWSA 5D1OA 1VQ9I 3BQ0A 1UHSA 2E19A 4UCVA 1HNWH 5J2UF 1BR2A 1W36C 4BS9A 1JT6A 2EB7A 2Z2SB 3Q8RB 5BS6A 1LUJB 3K4JA 2CFOA 2JA6J 2XVCA 2JZYA 4IRGA 1XN7A 2COBA 3GLLA 1XNQH 1DP3A 1U78A 3ETJA 3LWBA 1NG6A 2QSHX 2UUBH 2Q2TA 1R7JA 2V1UA 3DLAA 1EV7A 3IP4B 2D2WA 3S8PA 1VKZA 4A3BJ 4UUSA 2W6PA 2E1MB 1RJQA 4ZC3A 3ELKA 3IC7A 2ZJQF 4NC7A 1J5EH 3HL2A 1LFPA 3GFLA 4X6AJ 1ONVA 1QBJA 3LSJA 1I5ZA 5L1IA 3CUQA 3SZGA 1BN5A 4OIPF 3KAKA 3RBDA 3ISPA 1XSVA 1V54H 3WGHA 1X1CA 3KLOA 3KALA 2IP2A 4WF2A 3HGGA 3GXOA 5HLTA 3PN1A 3F8FA 3DF8A 2ELHA 2ZC2A 3S2DJ 3BR2A 2F4VH 2A07F 1TWAJ 1GO3E 1ZLJA 3CDLA 2IGOA 2EFOA 5AIPA 4B43A 2VBYA 2X1EA 1ODDA 3FWEA 3N05A 1D8JA 2VL8A 2W8KA 1YOVB 4MEYF 1X1AA 3C3WA 3U2RA 3MWMA 1KU7A 3GYHX 2AS5F 2NVQJ 5C4XJ 2IGNA 4ESFA 1FPQA 3ZQ7A 2L4AA 1OCZH 3BJ6A 2P7VB 1N75A 3FXRA 5CVJA 1XGNA 5KFLA 4A93J 4IO9F 1KA8A 4PK4A 2VUGA 1CF7B 2NUAB 2R93G 3F8MA 2BOLA 4DZJA 3I0TA 4AYBN 2XF7A 2DJNA 4LK0F 3DEEA 2ME6A 4HBLA 1F4KA 4GO1A 4NQWA 3M4OJ 1PUEE 2YZNA 1XDUA 4IRHA 3BT9A 3F21A 2IAIA 1ZRDA 1GSHA 4DV1H 3KLNA 5KKNB 4UY8I 2VLAA 2CQQA 5KFXA 2A6TA 3LP8A 4KIGA 3RGZA 1PDNC 4CZCA 2DYRH 2ZSIB 3CUOA 2OTJI 4LFUA 1WHUA 5TJJA 1YE9A 3OYJA 1YG2A 2VUMG 4PCQA 1P4XA 3ONQA 2MC4A 2R7UA 3V4GA 3HJEA 3C0FB 4NXMH 3SZTA 3C2GA 1FYKA 3BR0A 3MJFA 3QZ8A 4DV2H 4I7HA 3VYTB 5DD8A 5KAIC 4RBOA 4RGSA 4ECUA 5HS8A 1XSXA 1N78A 5FROA 5KFGA 3FXQA 1ZGWA 3ASNH 1JXLA 4Q8FA 3TKYA 2E1NA 1HKSA 1TWCA 4O3PA 2AGQA 2KKOA 4BXUA 2AGOA 5K7FA 2PBZA 2QKLB 2HOEA 4L0ZB 3H4BA 4BBSG 1GV5A 2K9LA 1Y8RB 4RM3A 3AKZA 5GAEJ 5DQHA 5I47A 3KP2A 1IG7A 4KJZA 4UCOA 3D5RC 2W57A 3PO3G 3BZCA 1SD4A 4AYBA 2ECBA 5DM6F 2W9BA 3L2UA 4BACA 1WJCA 4XR6A 4D1QA 5IYDG 4KMUX 2PMHA 4WWCA 2DLLA 4CSWA 2VXZA 1UCRA 1X1DA 4XOTA 2GPSA 1BXRA 4M6VA 3T0YA 1LVAA 5L3DA 3CCSI 3OSGA 2O9LA 1ETVA 2QWWA 4XSZF 4YFXF 4J9KA 4CCNA 1X1PA 1S3JA 3KHRA 2JA8J 4MA5A 3N44B 4JQFA 3WGGA 2FJZA 1ZG5A 3RPQA 3PW7A 2IA6A 1IBMH 2RC4A 2C2RA 1HNZH 4IHJF 3J81K 3D5LA 1TNTA 4BXFA 2DFFA 3GZ5A 1MNMC 3D5SC 4LG3A 1R4NB 2E2HJ 1FC3A 3RGXA 1RIOH 4TV8F 4ED6A 4YAKB 2JPCA 2LOOA 3BQYA 5EYRA 4LF7H 2KIFA 3S14J 2W24A 5H6QA 4GKJH 3GV5B 4ZYHA 2TDXA 1SMYF 4UCSA 1SFUA 1T56A 3OYMA 1V3FA 2AXLA 2DK5A 4LJZF 3M7GA 1EJ9A 1ETWA 2H6CA 3QPSA 4HRIA 4AVPA 3MKLA 3K70D 1LEBA 1U2WA 1X3UA 4NC8A 3ZQIA 1FYLA 4B3SH 4FE4A 2MGQA 5E1WA 4P5OA 4TQRA 2R7MA 4IWXA 5IT9Z 1ZARA 3VYSB 3L4JA 2R93A 1Z1DA 4ZYAA 4HZFA 4DOZA 4S04A 3AL0B 2KZVA 2ISYA 2VT3A 2YU3A 4DV6H 3HOZJ 4BXXJ 1RK5A 2HXIA 2P6SA 2VR1A 2GZWA 3QOEA 3ERMA 5IYCJ 3GILA 5GAHJ 2K40A 1TT5B 4A3JG 4ZH4F 3KFWX 4FE7A 2JA5J 1WRJA 4LK1F 4BHBA 2R7FA 5KFRA 3GTOA 3C7JA 3JRGA 1BOBA 3PQKA 2IBDA 3Q9SA 4M9SA 2K9SA 4ED1A 4UB8C 4HF0A 4IRCA 3AG2H 4BQQA 4BAYA 3OS1A 3OHBA 2VUMA 4E7KA 1Y1VJ 2W8LA 3I59A 2Y75A 3EPZA 3T1BA 3FK7A 4CCKA 1XMOH 3SEZA 3GVAA 3TW7A 3HYIA 4CC5A 4XRMA 1S03G 4WX9A 3ABKH 2JA7G 4A3LJ 4F52A 1R9TJ 5C44G 3CCYA 3RAQA 2Z99A 1I7NA 4BBRJ 4J9MA 2LKXA 3BTJA 4B44A 2JN6A 3BTLA 1E3OC 3QRFF 2HR3A 3CCRI 2R8JA 2L7KA 4BKXA 1LQ1A 1B72B 3FXOA 3GEZA 1QVTA 2E36A 5F08A 1LFUP 4XX0B 2QBYB 2IP4A 4A0YA 3BZ6A 5EDWA 4ED2A 2UVUA 2CV1A 2R7SA 3LAPA 1XGSA 2Y0SE 5DV5A 4RLQA 4BY7J 4ZZDA 4FX0A 5CA0F 2IGMA 4G7ZF 2NVXA 2CG4A 3RTRA 3TP3A 2YX7A 2GPWA 4BUPA 2EILH 2VJIA 5KG1A 4A12A 1BOAA 4I55F 3Q8QB 4GYGA 1H9TA 2PMZA 1Y1WG 1WJDA 4B48A 4Q4ZF 5KT2A 1GLNA 5LD2C 3UKGA 1U8BA 5H2FC 1D1BA 4AIDA 3KYLA 1EZ1A 5F0FA 2K02A 3E5XA 5LYJF 5TRDA 4RAFA 4NC6A 3DEWA 4BE0A 2H8RA 2W9CB 1ZRCA 4LFAH 5KFAA 3T5LA 2B7EA 2K85A 3U9TA 2VE9A 2DJIA 2HDDA 3GTQA 4U87A 2DOEA 5CJ9A 1JDBB 5K7ZA 2I8DA 1TL8A 5GPAA 5HLHA 2ADUA 4F4YA 2OAZA 4ENKA 3KE2A 3VPDA 3S3NA 3HRMA 3HOVJ 1FWZA 3NAUA 3F6OA 5IOZA 4XRFA 4D0PA 4UUVA 2JRTA 3A02A 3ZXSA 4DNCA 2VBZA 2ZCWA 3KEQA 5LP6F 4DZPA 2VA2A 3FXLA 4F55A 1F43A 3FKJA 2FEZA 1PK8A 5ILSA 2IS2A 2FLPA 5FRMA 1H9GA 2X0SA 4QWEA 3KP7A 1K6OA 4DL7A 1IUYA 4EFBA 4K0KH 3DWLE 5J47A 4YBZB 3ZQFA 2KL4A 4QWCA 4AVZA 4QIWE 4YIFA 3T5HA 1DV1A 3EUAA 1IBLH 5HDKA 4MV6A 1TW2A 1OCPA 2KQRA 2XAHA 2EV6A 2FQ4A 3CCLI 2R5YB 4I50F 2IRFG 3HPHA 1IN5A 3HXLA 3V6JA 3IWZA 2B63G 4L9TA 5L9XA 2UXDH 3BY6A 1UG0A 4MV4A 2HNHA 3SJMA 2E2IJ 1SEIA 2DU9A 4XOPA 1RK6A 4OINF 2WAEA 2FLLA 1FSHA 2M8EA 4X64H 2EBIA 1YJNI 2HFHA 2K86A 2DMTA 4E7SA 4L9VA
chains in the Genus database with same CATH topology
2HGSA 1R1TA 1ZAOA 4YFKF 1CGPA 3WE3A 2NRAC 4DR3H 1QQIA 1TA8A 2FA5A 3K1MA 4B3RH 2J5PA 2OD5A 5H20A 3Q5FA 3L00A 5LGTA 4GCVA 2FOKA 4M6XA 1E4FT 3N41B 1IN4A 2O6GE 1OYYA 3E6BA 2VQEH 3QAHA 4LF5H 4NXNH 2NAZA 1WKMA 4HOBA 1S6LA 1ZG1A 4LSXA 3RYRA 3J80W 1U5TC 2YSRA 5L3GA 2RQPA 4PDKA 3TOAA 2P8TA 5DUIA 2EV5A 5CVVA 1LDKB 2O03A 1S68A 3GF2A 2M45A 5DCMB 2MLGA 4A6DA 3NRVA 1N33H 3V8LA 1IXCA 3ZPLA 1WWXA 2CW8A 1DUXC 1IAWA 1OYIA 2Q2EA 2V79A 4HX7A 1S29A 1YW7A 3OOPA 5FLXW 2JPBA 2VT2A 2ZFWA 2ZJTA 2FBKA 3JAMZ 2W25A 2BGCA 2L3DA 2XAJA 2XAGA 4RAZA 2V1DA 3HIFA 2H09A 4IXAA 5ICGA 4IAJA 4MQVA 2JT1A 3L2CA 4L9NA 2WDTA 4U0WA 3CVZA 2UU9H 4P55A 1A04A 4U7DA 4HDVA 5L3CA 5FD6A 3LFKA 2EJRA 4M6YA 2NS0A 3OV8A 3FMAA 2GXGA 2P6TA 3O2PE 2MCTA 5LHHA 1J5YA 2ESNA 5HS7A 1YW8A 4HLXA 5HLGA 1FBUA 1O7LA 2RGRA 2FRHA 4NB5A 3JSLA 1S7AA 5ICCA 5BOXA 2Z3YA 2DPDA 3WTUC 2EA4A 3HSRA 2MA3A 3TO6A 4KNYA 4OIQF 4A2AA 1BJTA 4LD5A 2LF7A 4O6JA 4IPAA 2G7UA 5HS9A 3BP8A 1AWCA 1LJ9A 4R7RA 3SHFA 3I58A 1R5HA 3JSNA 2K4JA 4XLPF 3LWFA 1E2XA 2HGCA 3OTOH 4P9FA 2IA1A 1ZGJA 3MZHA 2ETHA 1XGMA 4KN7X 4LF6H 3L7WA 5JR3A 1VS0A 4QLCU 4IJAA 5KK1A 1XSDA 4M9XA 3O6BB 1FVIA 3AAFA 3K69A 4GGGA 2K27A 4L5JA 2A61A 2EFNA 1I27A 4ENNA 1HR0H 4Z2YA 1JHFA 1OPCA 4LG0B 2YR2A 3E6CC 1ZLKA 2IA2A 4EJWA 1FP1D 5EEGA 3NEUA 1ZG3A 3GFJA 1ZHSA 5AONA 3QPHA 1FLIA 3SXYA 1RZ4A 3IRRA 3ULQB 1HNXH 3K3VA 5FPOA 4Q47A 4OOIA 3ZP5A 3ZMZA 1ZRFA 1B4AA 1IXSB 2HEOA 5EOYA 4KUMA 3FMRA 2FMYA 1KQ8A 2ZMEB 2PEXA 3JSPA 4EV0A 5ERIA 5A2QK 4CGZA 2RDPA 4AQYH 2BE5F 3CUQC 5BQTA 3IWFA 1YW9A 5JVTA 3REOA 4F7ZA 5K1YA 1IRGA 3DFGA 3J7AO 3M1EA 1USTA 4P9UA 5ED4A 1U8RA 3LQRA 2GXBA 2OZ6A 2EWNA 2XUBA 3HRTA 1DPRA 1G4DA 5D5XB 4DV7H 4YY3H 1XD7A 1FY7A 2STTA 2DQLA 4RS8A 3VFZA 3MEXA 5E1ZB 3ZMVA 1T0FA 3TGNA 1OYWA 5ILVA 1BI1A 3W6JB 3H20A 3B02A 1XMKA 2LDUA 1BC8C 1P4WA 4I0AA 5J8CA 5KVRA 4JI6H 1O7FA 3I64A 3GX4X 3MFKA 3RIRA 3ZMDA 3ABTA 4DUYH 1P6RA 3BDDA 3WTSC 2E5LH 1J2XA 1FSEA 4B09A 4KMFA 1F1ZA 1I94H 2EA2A 3LSTA 3P9KA 2UXBH 2DPUA 3H3ZA 5K5QA 2O0YA 2E7WA 2JTVA 3ML6A 1XB4A 4LB6B 5D5WB 2VPSA 2EK5A 4KT5C 3MQ0A 5HDGA 4MV9A 4LB5A 4I98B 2VODA 2BEOA 1U6GA 1FBSA 5CVUA 4KIBA 4A5MA 3DEUA 5BR8H 2P7CB 3T1HH 3WU1B 3FX3A 4RAYA 2FNAA 2H27A 3BJAA 5E17F 1IZ1A 5E1XA 3ERED 5AIQA 2CW7A 2IJLA 4Q48A 4UCTA 1R1VA 1T2KA 3Q9VA 1O3RA 4KDPA 2MC3A 1XDNA 2P5VA 3HSEA 2OBPA 5JFRA 1WQ2A 2GAUA 1BBYA 4BHCA 1BI0A 1MD0A 2M30A 1FX7A 2ISZA 3GZ6A 4RGXA 1IW7F 1FT9A 4HW0A 1HBXG 3KXYT 4A2BA 4G94A 5E8IA 4M72A 2XAFA 4EM2A 1R58A 1TW3A 5D4RA 1UHMA 5BPIA 1LDDA 2X0LA 4HF2A 3HRUA 1RNLA 2DBBA 1N34H 4KYWA 3I53A 4J0MA 2CW0F 6PAXA 4BHPA 2A69F 3VOEA 4X66H 4DR4H 2Z9OA 2Z5UA 4XSXF 5BMZA 3DXJF 4PGGA 4GKKH 1BIAA 2FU4A 4KICA 5D1OB 4FHTA 3WTXC 2HKXA 3WTVC 2B0LA 3VEPA 1KGSA 1ULYA 4OX9H 3BABA 2M87A 2P5LC 5E20A 3BROA 1XCBA 4CZZA 3RKYA 2FXAA 1S8NA 3IKTA 2M1BA 3RI4A 3CUQB 1HKQA 3LMLA 1ZGAA 3ZN0A 3CDHA 1ZH5A 2WTEA 1MZBA 3PFIA 1DDNA 3EYYA 3IL2A 2LNBA 2DK8A 1RUOA 4LH6A 4E70A 4L9JA 4FM9A 3KP3A 3RF2A 3LAJA 2WE6A 2XKOA 4UHTA 4EJOA 1N36H 2UZKA 1N32H 2QUFA 4CXFA 1EH7A 2PMUA 3HSFA 1B59A 3CJNA 3BJOA 2CYYA 3JTHA 3HHHA 3K1PA 3FM5A 4BWSC 2J5OA 3ECOA 4ESBA 3IKVA 2HWVA 4G7OF 1UHWA 4LSAA 1BI3A 2F2EA 3QOPA 1Y0UA 1QZZA 3CTAA 2XKPA 1T38A 3N6XA 1YO5C 4M71A 1J9IA 3FMQA 3RJ0A 1H0MA 4WXCA 2F5DA 4EJTA 4HYEA 1Z6RA 3N4MA 2A5YB 5IT9W 3M8EA 1P2FA 1KU3A 1QZYA 2STWA 1ON1A 4OIOF 5D4SA 1IXRC 4DR6H 2KRFA 4HA8A 3GUDA 2R3SA 2XHKA 4HX8A 3R0AA 2XROA 1JGSA 4WXHA 2IPQX 1IRFA 4L5IA 1PP7U 2VN2A 1M0TA 4LG0A 1OR7A 2BBYA 4RB2C 4UXNA 3T1YH 1U3EM 2H6BA 4IF4A 2V6CA 1G6NA 1BI2A 2VBWA 3SFZA 4EJUA 4JYAH 5DD4A 2A6EF 1K79A 4ZYEA 4FT8A 1G3TA 2KIUA 4YG2F 3HTSB 4LFBH 3KP5A 3SZPA 1P92A 1W4MA 3B73A 3L09A 3KZZA 1JHHA 3GWZA 1GYFA 3J80K 1BC7C 4CICA 1OKRA 4IHSA 2JSCA 3R60A 3CLOA 4LF4H 1G3YA 4WK8F 4AD9A 5D6EA 2H94A 3WTTC 1XNRH 1TQIA 1U5TA 1IBKH 5D6FA 1UFMA 5HVQC 1SAXA 5FB2A 1TQPA 4KIFA 1IN8A 3WG9A 3F72A 4Q5SF 2MH2A 1I1GA 5FD5A 3ECHA 3I59B 5FLXK 4DR7H 3V8KA 2LSOA 1KU9A 1BJAA 4ZYDA 4R1HA 4MNUA 4JI8H 4UFZA 4N9IA 4R8HA 3S2WA 4LLLA 1AN7A 3RKWA 2DT5A 4HLYA 2X4HA 1ZYRF 3P9CA 5K5RA 2OU2A 4MHGA 1Z2PX 4Y15A 2OZUA 4DV4H 5IWAH 2HYGD 3IHUA 2HS5A 1Z6TA 2HDCA 5A2QZ 1WI9A 2VOBA 1P4AA 1J59A 3E6MA 3V7CA 1S7OA 1K7AA 3WTYC 1Z7UA 4G6QA 2CSOA 2GA2A 3LQQA 1CF7A 2RKHA 2OQRA 5LHIA 1XCVA 4UNOA 3JTGA 1TBXA 4G6DA 5BPDA 1C0WA 1K78B 1G3WA 4G9YA 1FP2A 4O5VA 4L18B 4GYIA 1QGPA 2XIGA 1LB2A 1LNWA 3GFIA 2UUAH 2BV6A 3QP6A 2UWMA 2RV8A 3O3KA 2UXCH 4JV5H 1Q1HA 3TOBA 3L9FA 2KJBA 4OMYA 1OMIA 1T6SA 1RI7A 2FE3A 1B9NA 1M0WA 1FJGH 1I6UA 3ROUA 4CO8A 3K2ZA 1D3YA 2QM3A 5EEHA 4N9HA 3K1NA 4UCUA 2HZTA 2EFQA 4YFNF 2D1HA 1YS7A 1MDMB 2DO7A 2IT0A 2HTJA 2EFWA 1HSJA 5LBQA 2HKOA 4I02A 2COMA 1R36A 1NHAA 4P96A 3HUGA 5F1RA 1PP8F 1GVJA 3JAMW 3TDZC 2MH9A 2ZJ2A 1E4GT 1A0IA 3K0LA 3HTUA 1SFXA 3T8RA 2FQ3A 4HQEA 5LMNH 2XAQA 3N97A 5LHGA 2IVMA 1XMQH 4DR5H 4PDBA 1USSA 4RGUA 3BA8A 3J81Z 1R22A 3WTZA 1Z2OX 2XASA 4AWXB 1KYZA 3QP5A 3L4KA 3MZYA 4JI3H 2RN7A 5J8FA 3COAC 4MGRA 1IN7A 4ENJA 4CC6A 4KHPH 3DV8A 2CO5A 5JHUA 2ZKZA 5L3FA 2FBIA 3KCCA 1ZN2A 4B3MH 3VODA 1ZHFA 1F5TA 2HTSA 1HQCA 3E5QA 2K7LA 4JI7H 2FBHA 4U7BA 3FZVA 3CO6C 2PI0A 2VC0A 1W7PB 2G7HA 1T98A 1SFEA 3KP6A 4ON0A 4LF9H 2DFIA 4K2EA 4EJVA 1D8KA 1L2ZA 2QLZA 2QBYA 2BYVE 2A6HF 3NQOA 2G9WA 4M7EA 3T8TA 2IW5A 3PQJA 2OWOA 2P5KA 1GXPA 4EGZA 3L2PA 3SQNA 4U0VA 1DP7P 2CWEA 4XLNF 2XGXA 1TAEA 4O3MA 1UB9A 3ZMSA 4UVAA 5LRSA 3DPLC 2Z33A 4ESJA 2Q2UA 1J7KA 4EVIA 3HOSA 3I54A 3RKXA 4LH7A 1STZA 4AIKA 2HHHH 4UVCA 5CVIA 2VC1A 2KSWA 1QNTA 2F5FA 3FXUA 1BGWA 3V7SA 2GIVA 1P8LA 2FF4A 5H6RA 3V7RA 4ZZLA 2YPRA 2WWYA 3M4IA 3KEOA 1AOYA 5L3EA 4OIRF 1XMAA 2PBIA 4A0ZA 4CHUA 4DR2H 2DQRA 4EFEA 1IN6A 2RNJA 5DEQA 3WE2A 1FYMA 2W85A 2XRNA 2R7DA 2M5WA 3KETA 4HX4A 2ZNYA 3VB2A 3J81W 2GA1A 4Q0YA 4DV5H 1MKMA 1SD7A 4EEQA 3RPUA 3BA9A 3DKWA 4JI4H 4RB3C 1IF1A 1TNSA 1R1UA 1B6AA 1KQ9A 3ABUA 4LLNA 3DP7A 2FNPA 3J7AK 4GLXA 2DTRA 1WH2A 2A68F 2PN6A 3RJPA 2CGPA 1DPUA 2E7XA 2WC2A 5DCMA 3BPXA 4ETSA 4EMSA 2ZO4A 3TO9A 3F23A 1FZPB 3R4KA 1V9PA 1FBQA 1W5SA 2D1VA 3P9IA 4HF1A 4RB0A 4DQ2A 1O3TA 2L01A 2KIMA 3WTWC 1MJ9A 3FHZA 2QZ8A 3DPTA 5LEJA 2O3FA 4NHJA 4M9ZA 4JI1H 4DV0H 1LDJA 5LGUA 2NNYA 1F9NA 3LA2A 4JK1X 3E97A 2V1XA 4XBFA 2RGVA