1MZHA

Qr15, an aldolase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
225
structure length
225
Chain Sequence
MIDVRKYIDNAALKPHLSEKEIEEFVLKSEELGIYAVCVNPYHVKLASSIAKKVKVCCVIGFPLGLNKTSVKVKEAVEAVRDGAQELDIVWNLSAFKSEKYDFVVEELKEIFRETPSAVHKVIVETPYLNEEEIKKAVEICIEAGADFIKTSTGFAPRGTTLEEVRLIKSSAKGRIKVKASGGIRDLETAISMIEAGADRIGTSSGISIAEEFLKRHLILEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Aquifex Aeolicus Aldolase, Northeast Structural Genomics Consortium Target QR15
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, aldolase
molecule keywords Deoxyribose-phosphate aldolase
total genus 86
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1mzhA00
2ZZ1A 2NUWA 1Z42A 4NJHA 2A4AA 3QC3A 1ONRA 3NG3A 1UB3A 3E02A 1TQJA 4LRSA 4JDYA 4E38A 5L9FA 5CPOA 2ZDRA 4UTTA 5CSSA 1BWLA 2B4GA 4O28A 1BTMA 1RD5A 1A5CA 3QQ0A 4LWWA 1QOQA 3U8GA 5G4EA 1OFBA 5AB3A 1O95A 3GX9A 3QPZA 4DBDA 1HL2A 2FB3A 1A5BA 3HGSA 3E0IA 3HF3A 2GPTA 2WPBA 3GAKA 1H61A 3FOKA 4ADSA 4HNTA 2ZQ0A 2BXVA 3P84A 4Z1DA 2QDHA 5HUPA 5DBTA 2DZUA 1QR7A 3NR0A 3BO9A 3E9AA 2Q8LA 5DCDA 1GVQA 3B04A 1C29A 3KVKA 1KLZA 4IX0A 5FEPA 4BR1A 1T8XA 4ONVA 3FYOA 1JCNA 1U5JA 3TROA 4KWWA 4O14A 3PB0A 1VPXA 3L9CA 1KV5A 1XDMA 5HR7A 2BZNA 4IGHA 2E09A 3LX9A 1H1YA 3QRHA 3SGZA 4UFMA 3SECA 3CB8A 4GUGA 4BI7A 4MZYA 3TJXA 2BWGA 3TX9A 4N9EA 5IM51 2RH9A 1YLVA 3TSBA 1TQXA 2A85A 2QCNA 3QQ1A 1QPOA 3L5AA 3UXAA 3W1LA 4NJKA 4JTTA 2GOUA 3F4WA 3L5MA 3S42A 1NF7A 4FNTA 2YYTA 1F5ZA 1TTQA 1J2WA 4M7SA 4DQWA 3BG9A 4O1BA 4ZQRA 3M0ZA 1IXQA 1FUYA 4WUIA 4PTNA 2QCCA 5K3VA 3DKJA 3G0XA 4OHQA 3RMJA 2IQTA 3THQA 4HNUA 5FEWA 4JTKA 3NA8A 3NZ1A 1XUZA 1G4PA 3QZEA 3W2NA 3U2OA 3L5LA 3NXFA 1D9EA 2E5CA 2CLMA 5TIMA 1TPUA 3L0GA 3PF3A 4MOZA 2LLEA 4YXGA 3JRKA 3G0UA 1EWDA 2A21A 3LRKA 5D2YA 5LNWA 2QJHA 3P61A 3SFKA 4FIRA 1OJXA 3IIVA 1W0MA 1TO3A 2H6RA 1N55A 1G69A 3DBPA 3W75A 3O05A 4UTIA 1F2JA 4O1CA 1VLWA 3NEVA 4IQLA 1KTNA 1THFD 3STCA 5K4XA 2Y62A 4I7UA 2EPHA 2OX1A 3GNNA 4FX7A 3IIXA 4AAJA 5A5WA 5IBXA 4AH7A 3PBVA 1QAPA 4JDBA 1TREA 3DZ1A 3A23A 3INPA 4M19A 2CZ5A 3AO0A 4IJBA 2VKZG 2YFOA 5LNRA 3W2KA 4ZMGA 1FCVA 3NNTA 3AJXA 5I3JA 3F1QA 1H60A 4NX5A 1NAL1 3DGRA 4A2RA 1JVNA 2HS8A 3DXIA 4ZQOA 3T55A 4PL2A 1XL9A 2A7PA 1FCQA 1QCWA 3EWYA 4O8RA 5TBOA 3TXVA 1YTDA 1O4UA 3HGOA 4LU0A 2DU2A 4JD4A 2JKPA 1OFPA 3W1AA 3CLMA 3ANYA 3C52A 1LOSA 3DFOA 5DXXA 4TMCA 4WXYA 1LOLA 4XZ9A 3F4NA 2CW6A 1JRCA 3OBKA 5F1UA 3KX6A 4UTKA 3VI2A 1M5WA 3W1TA 2H90A 3L67A 2TYSA 3R8RA 1I2NA 1ZENA 2DZPA 1H51A 1EA0A 2F84A 3WJZA 3UNDA 1MZHA 4DELA 1LDCA 2FJKA 3LBMA 2PURA 2CLFA 4UR7A 1GTHA 1F73A 2V2DA 3E12A 4S1FA 3IIOA 6TIMA 2TSYA 5KINA 1ALDA 2X16A 4UFJA 3S5OA 3G1SA 2H3DA 3IGUA 4O0ZA 3S1WA 4HNVA 4UC5A 1W37A 3W7IA 4GRSA 4LUIA 2YGYA 2O7SA 3W2MA 2WQPA 3M43A 1M7PA 3VKJA 3QPYA 3LTPA 4AHQA 1N8FA 2NX1A 2NXHA 3ATZA 3L66A 2Y6ZA 1OF8A 3FS2A 1OYCA 5BMXA 1MO0A 2Y88A 2H3BA 3LERA 3BW2A 3EWUA 3GDMA 5D30A 3C2EA 1EB3A 3EXRA 3DHFA 3B0UX 1D3GA 2QJGA 1PHQA 3UZ5A 4RZ4A 3GDTA 3NL3A 3QMRA 3PM6A 2NX9A 4IMGA 2WV8A 3GDLA 2V8ZA 1I8JA 4LS1A 2VFFA 2WNNA 2YDAA 3C61A 1H63A 5H2ZA 3W7RA 3O63A 1SPQA 3WJYA 4UNKA 3FFSA 2J9ZA 3MJYA 4JIQA 4JNMA 3FJLA 3HGJA 3PUDA 1OX4B 4KFNA 3LXCA 3JS3A 1GYLA 1YXCA 4MZ1A 3TH6A 1XUUA 3GXNA 3HPSA 3BV4A 3BARA 1R2TA 3Q58A 3TC7A 1W3IA 3W71A 5AHEA 1XDLA 1WOBA 2Y85A 2AGKA 4RK8A 4RR4A 4C1LA 1C9DA 4UNLA 4ZQNA 3DENA 4Z08A 1FQ0A 4ZZ9A 3W2UA 2ZZ3A 1JJKA 2ISWA 4CLMA 4ICNA 2YW3A 2W6RA 1FCBA 3H53A 3W2JA 2VFIA 3W2LA 2F7FA 2V30A 4GC4A 1KFCA 4DF1A 3GXTA 1W8SA 4TR9A 1W5NA 1FWRA 1WOAA 5LZLA 4GBUA 4QQ3A 4GFSA 3GXPA 1GJPA 4OQVA 2QCMA 4BWLA 3P5ZA 4N9CA 1K3UA 2X2GA 2FQIA 4TMBA 5CG7A 3KFTA 5CKSA 4IMEA 3RK8A 5D37A 1LLWA 3UY7A 3KAOA 1EUAA 4LVFA 1NSJA 5E0KA 4MUZA 4O16A 4JIPA 3DFTA 3I65A 1TPDA 1GEQA 2P1FA 1EUNA 1KM1A 2C19A 1J5TA 2GJNA 2V5LA 2YFNA 1TJRA 1ICSA 2A6NA 4LY8A 4AMAA 3TE9A 2B7PA 1TV8A 3LXAA 3HPZA 3PUEA 1SO4A 2VXNA 3B4UA 5DXYA 1Q6LA 3DHDA 3VNDA 2Y7EA 3EWWA 4G1KA 1DKWA 4UTJA 5G5IA 3MHFA 4LW7A 5D05A 3DI1A 2RKXA 4TO8A 3NQ2A 1PCWA 3MBDA 4WY0A 4WY0B 4TX9A 4ML9A 1QPRA 3LRLA 4O53A 1OYBA 3WJXA 3EXSA 3MW7A 1HO4A 5AHLA 2GUUA 4ZVJA 4PA8A 4R53A 4XKYB 1JUEA 2HTMA 4Q32A 3C4UA 2E5DA 2FIQA 4M5PA 1PS9A 2J27A 1AMKA 1FDJA 5D2TA 2PRLA 5AHFA 5DN1A 3LCWA 2NWRA 1OF6A 3L0NA 1X6UA 4N4QA 4XQ6A 3F03K 5EKYA 1EPXA 2G5WA 3QMSA 3QFEA 3TA6A 2J9YA 4UR8A 7TIMA 2OT1A 3Q2DA 3WK3A 3TUUA 4QIUA 2E77A 2X1TA 5H91A 1YDOA 1PIIA 3LV5A 4DXVA 4QNEA 3A5FA 1W3NA 3OA3A 4DBEA 1SR9A 3FJ6A 1KM4A 3TV8A 1G4SA 2ZRWA 4Z0JA 3CEUA 3YPIA 4WD0A 1FXPA 4QAIA 4YCPA 2JBMA 2HSAA 3W3OA 2VEKA 1K8ZA 1P0NA 2Z2UA 5KSWA 3MI6A 3GB6A 2OJPA 2J24A 1Z44A 4WJEA 1WYIA 2OZ0A 4GWEA 2VFEA 3STFA 3LCLA 4H6KA 5AN7A 3I7QA 4P61A 1KFEA 4OBTA 1UJPA 2P0OA 3LCIA 5AHMA 5L6UA 1EP3A 5KZMA 1W5QA 1W1ZA 1OYAA 2NZLA 5KZEA 1H50A 2NXGA 1ME9A 1SZEA 3W70A 1I4NA 1KFLA 3GR8A 2C16A 5FF0A 2WOQA 3G3MA 3DAQA 4UTTC 4YL2A 4MZ8A 3LHTA 3LTYA 1DBTA 2CZEA 2Q3OA 4LC8A 4XWUA 2FLIA 2V9DA 3DH7A 1JCMP 2E5BA 2J6XA 3CPRA 4N02A 1X7FA 2NUXA 4UMAA 1A5AA 4IPJA 2PRMA 3KVJA 4Y8FA 1I2PA 4N2YA 4ORIA 3W1XA 2A7RA 1XKYA 1MEWA 5CPNA 5KITA 1K02A 1GG1A 2ZZ4A 3PWAA 2NUYA 1RQBA 1R46A 1HO1A 1FX6A 2H8ZA 2VC6A 3G8RA 3OIXA 5D32A 2QEZA 3ZR4A 4L4MA 3UWVA 3N9SA 4E2BA 2Z1BA 1OX6A 3NQ8A 1LRQA 4ZQPA 4DPPA 4K37A 3G1XA 4UIOA 4PL1A 3T78A 2CLIA 4JXCA 5AC8A 1G7UA 1FWNA 4MYXA 3IV3A 1O60A 1PCKA 3DFSA 3O15A 3WJWA 3L68A 1C8VA 4U28A 2W79A 3ELFA 4MY1A 5LNSA 1YPFA 1DHPA 4EWND 1PVNA 1QNVA 1Z48A 4FX8A 1LOQA 3M5VA 3NM1A 5FEXA 3W6YA 1OK6A 2C14A 5FI8A 3BGJA 2CFFA 4NUWA 2BTMA 3OVRA 5D04C 4IUOA 3W7JA 4N6EA 2Y61A 2OCZA 3TK7A 2WSQA 3PBYA 3M1ZA 4NJIA 5FF2A 5LNUA 2V2CA 1F05A 3G1FA 4UTWA 1GOXA 4LOCA 1ME7A 2DZXA 3BLFA 3LBCA 5I3KA 1H1ZA 4UMCA 1KA9F 2ZA3A 1XXXA 1F6PA 1VCVA 5HWJA 3WK1A 3EWZA 1VGAA 4FXRA 3NM3A 1Q6OA 1F76A 4LS0A 2V81A 3W87A 5HINA 1I2OA 4BK9A 3NAVA 1I2RA 3O07A 1H7WA 1EP1A 1FXQA 3O06A 3VE9A 2RFGA 2CZFA 3TAKA 3O6DA 3K30A 3EX2A 5BRBA 2BSLA 3R13A 1VQTA 3HJZA 3EX3A 5I3GA 4K39A 2QAFA 1DJNA 5F1VA 1V7YA 3BVJA 2YX0A 3L21A 3EX1A 1VHCA 1K7FA 5HMSA 3IRDA 3EWXA 2ZZ5A 1HUVA 5CZ0A 3TAOA 4AVFA 4PC8A 5CSRA 1Z41A 4RX0A 1CX9A 3G22A 2ZRXA 2X1RA 1KM3A 3MYPA 3MI3A 3PBUA 2Y7FA 5K2ZA 3OVPA 1GTEA 3HG4A 3N3MA 4Y9AA 4UFKA 1OHLA 1SW7A 3GNDA 1KFJA 4MYAA 3LHWA 3KRUA 2V2HA 3KHJA 1SFLA 5EBUA 4JEQA 2C0AA 2QUTA 3DKLA 4BF9A 3UD6A 1GVSA 4MPQA 3W83A 3I6RA 1QOPA 3P7YA 1R30A 3C3NA 5AHNA 1VCGA 1SZGA 3S9YA 2ATMA 1XC4A 1KM2A 4A21A 1OABA 1SQ7A 2WSRA 4LV4A 2C6QA 3IGSA 1ZY9A 3W88A 1T96A 4HN4A 4WXZA 3MP5A 3GR7A 3BG3A 1P1XA 3W74A 3UWWA 1KTCA 4NNBA 4O18A 5DBUA 5F4WA 4LVAA 1ICPA 1UUMA 1SO3A 3W73A 1OFRA 5AYZA 1LCOA 1W56A 3OVQA 3PSWA 1QDSA 3W7QA 3LGEA 4JS3A 3DFNA 4O57A 1JCXA 4UTLA 3HB9A 3N19B 2CZDA 1TTPA 4UUIA 2ZRVA 4Q4KA 2NV1A 1XBXA 4CNPA 2RDWA 3R89A 4EVZA 3LDVA 4X9SA 1QMLA 1S3HA 4C1KA 3W86A 1DQWA 2QAPA 3TFCA 2GQ8A 2Y7DA 1QPQA 3BPWA 1G6CA 3BK0A 3FEMA 2CLOA 2OT0A 4OT7A 2Y63A 1DOSA 5AFDA 3R12A 4GUJA 3QSRA 5G2IA 3GAYA 3PC0A 2E68A 1VCFA 2ZTKA 3NQGA 3ZFHA 1UUOA 4Z1BA 3O1NA 1QWGA 5CGQA 1H7XA 4LT9A 1W5PA 5F2MA 2WKJA 3IIPA 2QCLA 2W0UA 2VFHA 3LHUA 2UV8G 2ZYFA 4UTWC 4I7VA 3LRMA 2CLEA 3ABOA 1T99A 3M47A 2R91A 4ZQCA 3V1PA 4JTUA 2DJXA 3W07A 1RZMA 4UFLA 3G0SA 3QSTA 2NLIA 3N34A 3LI0A 1KBIA 1KM5A 2B7QA 1TPH1 1O5XA 3CIXA 4GUFA 3TXZA 4JY9A 4CQ8A 1SZFA 1VYSX 3NOEA 3I7SA 5E1QA 3W85A 4K8HA 4EIVA 3P8IA 1L6SA 1K8XA 3W76A 1KFBA 4O13A 3S1VA 1PV8A 5ABTA 3WJSA 2R8WA 3UWZA 1P5BA 4O19A 4IMDA 2C3ZA 2I14A 4CQ9A 3R2GA 4FHAA 8TIMA 2AAMA 4LTSA 4NVTA 3W1NA 1LRNA 3EWBX 1TB3A 2YSWA 2C15A 3NPVA 4LNYA 1TV5A 2J88A 3TCEA 4R33A 4IXXA 1X1ZA 3RLVA 2A5HA 5LHEA 4RXGA 3DFQA 2QKFA 5CZJA 2QDGA 5G1TA 5DY3A 2DZSA 5KZDA 3UPBA 4OGZA 3GKFA 3KRSA 3HO8A 3M44A 3WK2A 1CI1A 5FESA 2R14A 1VJIA 3NPUA 1J4EA 2FTPA 3S5NA 4FNUA 1MEHA 1RPXA 4XUGA 3CWNA 1EIXA 4FB7A 3O8AA 3S1XA 4X22A 4LVDA 3EKLA 1JCYA 1TRDA 2Q3RA 1A50A 3W84A 2ZZ6A 1NVMA 2BX7A 2GVGA 3Q37A 3M6YA 3UQNA 3LHZA 3SW6A 3LI1A 4ADUA 3LXBA 1QPNA 3U6WA 3BW4A 1VRDA 2RDTA 1VR6A 4Z1CA 3TW7A 5EA9A 4ZL1A 1ZAJA 4HSOA 3O16A 4NNAA 5G4WA 3GIYA 1V5XA 4IX2A 4R34A 4UXDA 1F74A 3THAA 4XTIA 4GNJA 4BI6A 3P74A 1A53A 1F6KA 4MIMA 4GUHA 1VC4A 4Y6GA 4YCOA 4GE8A 1ME8A 3DFPA 4AWTA 5LGXA 3FA5A 1WAUA 1UBSA 4IPIA 2YCEA 3T44A 4JTJA 3H54A 3PG9A 1R47A 1KM0A 4JYFA 4X2RA 4WZHA 4KFOA 4FNPA 3W7LA 3B03A 4IMFA 3RFAA 3LCXA 3P8JA 1LYXA 2XN1A 3M5ZA 2ZZ7A 1FWSA 1TCDA 2C18A 3ABRA 4CNOA 4HSNA 1P4CA 1YTKA 1T0OA 2NV2A 5LGZA 4JGDA 4CQAA 2EKCA 1JQVA 1TV7A 2QUVA 4NU7A 3MWAA 1W5OA 3NVTA 2YR1A 1DVJA 1YYAA 4UFHA 3EX4A 4Z1AA 3EEGA 1WQ5A 5D2XA 3MMTA 3TKFA 1H7NA 3GDRA 3HGRA 4FNSA 1TMHA 1NF0A 4FEZA 3TMLA 4RJEA 4PH6A 3TU9A 4MY9A 1XBYA 1JUBA 4O0KA 1VH7A 2TMDA 4UTUA 5DY2A 3NO5A 1G4EA 1Q6RA 4AXKA 3IIZA 1ZAHA 3HIJA 4NJJA 1GVFA 1WBJA 4O52A 4DO4A 2GQ9A 4JX6A 2Z6IA 3P81A 3HG2A 5A8GA 2XFWA 3TW6A 4NT0A 5HWNA 4K36A 2G97A 4BI5A 2PE4A 3IGXA 4MFDA 3TQKA 5HQEA 5F2GA 1I2QA 2TPSA 3QH2A 2A7NA 3MBFA 4FIQA 4Y90A 4M6QA 1M7OA 3I7RA 3QF0A 1TJPA 4LVBA 4FO4A 4XTDA 3RLUA 1EEPA 4OV4A 3G1VA 3VCRA 4JX4A 5CPLA 3NQVA 5K7JA 5C55A 3C56A 3H55A 5C2XA 2V0TA 1NFBA 3LOTA 3GKAA 2FPVA 3W1RA 4OE7A 3VFLA 2E6YA 3S5ZA 3UYCA 1F7BA 2XN0A 1JRBA 4Q33A 4PFMA 4LRTA 4UMBA 2GVLA 3OEXA 2QCEA 4NXKA 4HHPA 3T4CA 1WV2A 2DP3A 6ALDA 3W1MA 3PG8A 4KFPA 1B3OA 2DZTA 1TPWA 3B8DA 1AL8A 2QJIA 3LM7A 3A24A 3W72A 3W7HA 1S5TA 3A9IA 3CTLA 3PSVA 3NQFA 1S5WA 5J5DA 1FDZA 3SSJA 1KBJA 2ZRYA 3I68A 1ZAIA 2QR6A 5CZSA 1FWTA 1R2SA 5FF7A 1KTBA 1GG0A 3CWOX 5AYYA 3M41A 3GK0A 1RQHA 4OWGA 4GXMA 2ABBA 4KKXA 3A22A 3GVGA 3CU2A 1GWJA 3DU0A 2G96A 1GVRA 4MFEA 4E0CA 1FDYA 2YPIA 1W3TA 3M16A 3G24A 3TNOA 3R5EA 5T26A 3C2VA 2KZHA 3G18A 1Y0EA 4MY8A 5EMUA 1RVGA 4LUJA 2I9EA 4CNNA 1TPC1 3N2XA 5U7SA 1SSGA 3KVMA 1L6WA 4I7WA 3M9YA 4RXFA 1AW5A 2G95A 2X30A 4A2SA 4RV8A 2E6FA 3MHGA 1EP2A 1KFKA 3LHVA 1TPB1 1VZWA 1XFBA 4RZ6A 5D2WA 2Q8ZA 1R2RA 3SGUA 3MO7A 3P60A 4AWSA 1K7EA 1O5KA 3G8EA 3W7DA 4O15A 4AHOA 2V82A 2NX3A 2QCDA 1KV8A 1FY6A 2QCHA 2PC4A 2JK2A 1K8YA 1B57A 1SO5A 4IOTA 3T40A 1LLZA 1GZGA 3P82A 1LP6A 4I9AA 3FKKA 2FPYA 1LBFA 3E96A 1JCJA 1GT8A 2XN2A 4DF2A 4JTFA 3L65A 5GVJA 3STEA 2WJZA 5BOOA 2C1HA 4JYEA 3V75A 2X1SA 3LB0A 1SW3A 1IXNA 2B7NA 3LLFA 1TPEA 3KVLA 5D09A 3NQ7A 4D2JA 4N4PA 4MKNA 1BEUA 1OX4A 3B06A 1ZALA 3PAJA 1K03A 1PL9A 1AL7A 5EL1A 1YDNA 4QJ1A 3QMTA 3S8HA 3CQ0A 3C0JA 1L6YA 1IGSA 1H5YA 4UCGA 3TJLA 3LTSA 3P62A 3LHYA 5HR6A 4JTSA 1RV8A 1W54A 4GUIA 3TDFA 1PHWA 2CU0A 1U83A 3E49A 4ZQMA 1IF2A 3L2IA 4QM1A 1JULA 1WXJA 1DORA 2Y7GA 5C5YA 4UTHA 2Z0IA 4UFIA 5LNVA 5DCBA 2WNQA 3P67A 2E6DA 2WO5A 3P80A 4AEOA 4JY8A 4N6FA 5BNKA 3FIGA 3LV6A 1H7OA 4PEKA 5EY5A 3W7NA 1TPVA 2J9XA 1LTDA 4K6AA 3WFAA 3OG3A 2DZWA 2H8XA 1XCFA 1JCLA 4NXSA 1W31A 2B0MA 1ZHAA 1TRIA 4J9JA 5K4ZA 3T7VA 4A22A 3W7KA 1KLYA 1S5VA 2DJLA 3Q94A 3TIMA 4DF0A 5KMYA 4KWVA 5D33A 4POCA 5D38A 1LBLA 3NYZA 1DQXA 4N9BA 2DORA 1MEIA 4AF0A 4L4LA 3M7WA 2A1YA 3HOJA 1GYNA 4O4WA 3ZS4A 5F4SA 4MJZA 1GPWA 3BLEA 4RLIA 3PR2A 3SY5A 3LCGA 3NDOA 1EWEA 1DL3A 3FLUA 1OFQA 4AB4A 4RZ5A 1LROA 4GJ1A 4EF9A 1BWKA 5EYWA 1SZNA 3CT7A 3PY2A 4O11A 3S6DA 5HNRA 4YLWA 4JICA 3SJ3A 3A21A 2A0NA 2X1UA 2ALDA 3QW3A 4WY0F 3TFXA 4A29A 5HWMA 1XBZA 3UY8A 5AC7A 2FB2A 4WX2A 1ICQA 1OFEA 3BGGA 4LV9A 3TMQA 4S2BA 4M6PA 3NQ6A 1JR1A 3CM4A 3WK0A 5I3IA 1E51A 3SR7A 3GYEA 1G4TA 2VENA 5F2IA 5E93A 2I1OA 3RF9A 3W1QA 1ZNNA 5MHBA 3G1AA 3SIZA 3STGA 4FXSA 2Y89A 1KM6A 3G1YA 5FF4A 4X3ZA 4NZJA 2GVJA 4HT3A 5J5RA 2QUUA 1WDWA 5AC6A 1Q6QA 4ORMA 4N9DA 3MUXA 2YXGA 2C13A 1FBAA 3NPWA 2YYUA 1TPFA 1AW2A 2A6LA 1SU5A 1IXOA 2E6AA 4O17A 3DI0A 3W7MA 3UWYA 2ABAA 1N7KA 3TQVA 1YTEA 2FFCA 3QM3A 5CPMA 3MP4A 4HPXA 3KRZA 1VS1A 2FPTA 4XBSA 5AYXA 1IIHA 3NQCA 1VLIA 1OFOA 3TC6A 2ZRZA 5BMWA 3N14A 2PCQA 3BLIA 1ADOA 2O7QA 4AF0B 2NXIA 3B0PA 2P10A 3PBWA 4FF7A 4IMCA 3NL6A 3PVFA 4TIMA 1OX5A 4JN6A 3G3DA 1DJQA 4QNWA 4W9TA 3W7CA 1H7PA 4XKYA 1HTIA 5AHIA 1JUKA 4FNRA 2JGYA 3HG3A 5D03A 4CCCA 1D3HA 2NWSA 3CC1A 1YDVA 5I3HA 2EF9A 1X8FA 1UASA 3QEZA 3QYQA 3S0CA 2A2IA 4HPJA 4DPQA 3B05A 2QCFA 3SI9A 5TQLA 3BW3A 5LSMA 3FYPA 1BKSA 2WSYA 2ZBTA 4K7YA 2YZRA 4O54A 4NX0A 1H7RA 5D02A 3IVSA 4PCFA 2V5BA 3N2MA 1VHNA 1OK4A 2ISVA 2ZCGA 1TYGA 2ZZ2A 4ADTA 2OMAA 3C2OA 3GZ3A 1MSSA 2HS6A 3HG5A 1XM3A 5IBXC 4A3UA 1P0KA 2D73A 3W7OA 2E1DA 3PULA 3G1HA 1RQEA 1TTIA 1X1OA 2VEPA 5CZTA 5HUOA 5U4NA 4HIBA 3UXDA 1YXDA 3NZRA 5EPDA 3GDKA 1EX5A 3ABSA 1SO6A 5C54A 5LKYA 2CLKA 1H62A 3TR2A 2EGZA 3HPXA 3C2FA 5HULA 2CWNA 4EOUA 5D2VA 5SWUA 3UZJA 5BW6A 3JR2A 1QO5A 4CCDA 3NQAA 2QCDB 2CLHA 4DO5A 3W23A 1VYRA 3C8FA 4K38A 2ZTJA 1YPIA 5KTLA 2ATSA 1MXSA 4JTEA 4H3DA 4JTGA 4OV9A 1TIMA 4WQ6A 3M5YA 2AQWA 4LS2A 2ISSA 4QITA 2VEIA 2ZFAA 1LBMA 5AOUA 4DO6A 2DZVA 3S5YA 3MP3A 4MLRA 4YWIA 3S1UA 1LRTA 3C2RA 1SUXA 2JKAA 4YMZA 1I45A 4B5NA 1G67A 1WA3A 3RU6A 4O1DA 4JTLA 3TSMA 1HFBA 3KXQA 4U4MA 1VYPX 3NQEA 3CIWA 4MJMA 4Z0SA 3HBLA 1JQXA 2VFGA 3M5XA 4H4IA 4O50A 1LM1A 3NQDA 4MLJA 1B9BA 1QFEA 4LC6A 4NNCA 2EHHA 1HG3A 3W22A 4S2CA 2VOMA 4BFAA 4M7TA 1ZJIA 3TQ0A 4MVAA 5HJLA 4CCEA 4K8EA 4QSHA 1SW0A 3W1UA 4Y96A 3W1PA 3ZWSA 4XBKA 4BWLC 3B0VC 4E2DA 4WOZA 1O94A 2RDUA 4ALDA 5C6MA 1KW1A 2VEMA 1XI3A 4LVGA 5FEZA 4O12A 3TSDA 3W7PA 3P5YA 5G2WA 2Y70A 3C6CA 3RNDA 4EF8A 1QO2A 1TTJA 1B4EA 3KOFA 3SZ8A 4M6VA 4AWUA 5I3FA 1GQNA 5F2LA 2FDSA 5F4XA 4O10A 2QCGA 3IVTA 2VELA 3O6CA 4QISA 1AK5A 1IXPA 3ZWTA 4O4VA 3A5VA 1SSDA 1IIGA 4FNQA 4TU1A 5FF3A 4DEFA 2ZRUA 3HMJG 2EAWA 1LZOA 1WX0A 2JKEA 3UPWA 4FX6M 3UWUA 3ATYA 4JX5A 3EKZA 2GQAA 3G1DA 3UWQA 1GVOA 1OFDA 3FKRA 5K9DA 3USBA 2R94A 3L0KA 4RCXA 3QJAA 3O6YX 3VE7A 5G2HA 4NJGA 4WOQA 1YXYA 4NZFA 1Q45A 1A5SA 2GJLA 2ZA2A 2B7OA 1B4KA 3IEBA 3W9ZA 1FWWA 2HMCA 3MHUA 3NL2A 4IWWA 3EXTA 1YADA 1ZFJA 4JTHA 5DELA 1FCUA 2WNZA 3LCFA 3W7EA 1AW1A 1ML1A 3D0CA 1AG1O 3N73A 3W7GA 1K7XA 4JTIA 1PE1A 3PS7A 4UTMA 3BG5A 5LHFA 3LCHA 1G7VA 4IXHA 2PRHA 4K7VA 3EX6A 4P2VA 2Z6JA 3PB2A 2RHGA 2YW4A 1TSIA 4PODA 3MI2A 5DLCA 3N9RA 2BLEA 5K9CA 3LLDA 5G1YA 1CW2A 3EB2A 4HKPA 2ZA1A 3NL5A 1M6JA 3PUOA 4AHPA 1OFAA 2QF7A 2CLLA 3CHVA 1XBVA 3NQMA 4JYDA 1W5MA 1OG0A 1NEYA 1OVDA 3ABQA 1RR2A 1ZCOA 5K9XA 1UCWA 2JGQA 3MYOA 3IVUA 4NQ1A 3OHIA 1WBHA 4HNNA 1L9WA 4RKAA 1L2UA 2TRSA 4JR5A 4OU1A 3NPXA 4R7JA 5DCEA 4O1AA 3GLCA 3NGJA 1LORA 1SFJA 3CEPA 1Q3NA 3HQ1A 2VFDA 3QW4B 1DV7A
chains in the Genus database with same CATH superfamily
4XUYA 1XRVA 2J62A 3T2QA 2A4AA 3QC3A 2XH4A 3B8SA 3KBVA 3H2NA 4JDYA 5TNVA 2HPMA 2F8QA 3T81A 1EDTA 5CSSA 3N4AA 1CDGA 1BTMA 1W17A 1J0YA 1B30A 2OGYA 5G4EA 3COTA 4DBDA 1MNZA 1E9YB 3ZT6A 4AUBA 1IT7A 1FA2A 3HGSA 2ZUUA 2GPTA 3GAKA 3ABZA 4QAWA 2XWDA 1QT1A 5I5RA 4K8GA 4ADSA 1TVPA 3VU2A 2P3ZA 1IZKA 2BXVA 1HVXA 1WZLA 3LD5A 3GXIA 2J66A 1OT1A 2BFGA 2DZUA 3BO9A 2NVCA 4GCAA 1UZ1A 3U7BA 1SJDA 4FR6A 2JE8A 4KESA 4E3VA 1T8XA 5D9NA 3V3WA 3KLLA 3TROA 1BSIA 3KL0A 4XZBA 1XYBA 3LENA 3ZOAA 1KV5A 5HR7A 3CZLA 5I06A 1D8CA 4BQ2A 2VWSA 1H1YA 1BXCA 4C6NA 3WH8A 3QRHA 3U4FA 4UFMA 3BQ6A 3CB8A 3QTPA 4BF5A 4GUGA 2BWGA 4LSBA 3TX9A 4I9MA 3M0VA 1R0MA 1TQXA 2GJRA 1O1ZA 3QQ1A 3OA5A 2QYGA 2FZ9A 2GOUA 2WSPA 3L5MA 4FALA 4AG0A 4FNTA 2YYTA 1EDQA 1TTQA 1K9TA 1B3YA 4HP5A 5IOBA 3E2VA 3BAWA 1IXQA 3LY0A 4B5SA 4ZR8A 5K3VA 1LQ2A 2IQTA 2AQVA 3THQA 1BYDA 2OYMA 2WCGA 3NZ1A 2XDFA 3L5LA 2CLMA 2O9PA 5TIMA 5D8WA 4MOZA 2HBVA 4BEUA 2ANUA 1W3KA 3CV6A 4JHMA 1U5VA 3RJXA 3SFKA 4Q8NA 3IJIA 3FAXA 2NVDA 1W0MA 1TO3A 2PDIA 2H6RA 5CZKA 1X39A 2O9RA 7ENLA 3IJ7A 2J7CA 3NEVA 1THFD 5K4XA 1HW6A 1E1EA 4I7UA 1W1PA 5EMMA 4AAJA 1QAPA 3LZ3A 1B3XA 3A23A 3OB8A 1Z89A 2XG9A 4ZMGA 3AJXA 4OBRA 3F1QA 1H60A 2QS8A 4PSPA 4NRSA 5CGTA 4A2RA 3JZEA 3I4EA 5CC3A 3DOPA 4ZQOA 3T55A 4PL2A 2BOGX 4O8RA 1YTDA 2Z1VA 4LU0A 1OFPA 3W1AA 2DSZA 4TMCA 3M46A 1OD8A 3SQMA 4UCFA 1XIBA 3OBKA 5F1UA 4UTKA 3IUDA 3NZQA 1M5WA 3VI2A 3SCOA 1ITCA 1I2NA 4ACZA 4CN4A 1W9PA 3UNDA 1MZHA 4EAYA 1LDCA 5FOOA 2W91A 1E9LA 1X98A 4Q8PA 1Q6EA 4W84A 3GFZA 1F73A 3OBEA 2Q8XA 3ZMRA 2TSYA 5KINA 3S5OA 2H3DA 4IIGA 5C9RA 2PDPA 1TMLA 4DWSC 2GGHA 3IGUA 2WLZA 1ZRQA 4B92A 2ISFA 3W2MA 1CGYA 3M0KA 3VKJA 4A4AA 3QPYA 4JIIX 4AHQA 4CQDA 3ATZA 1OT2A 4H01A 3VOGA 3WLIA 3BCFA 5BMXA 2Y8UA 1XLHA 3IV8A 4HTYA 3GDMA 3C2EA 4J3WA 1TX0A 5LIXX 3EXRA 2VX5A 1ONXA 2QJGA 1PHQA 2TODA 3HV9A 4OFCA 3WF1A 4XAPA 3VOFA 1B54A 1M1BA 1J11A 4A3RA 4IMGA 1HZYA 3RM4A 2NQJA 1DWJM 2V8ZA 1GOKA 4H6QA 1J93A 1K1DA 1Q6DA 3C61A 3U2CA 3VYLA 3SGGA 4UNKA 2UY3A 4CCZA 4JIQA 3ARQA 5DMYA 3LXCA 1R9XA 3JS3A 4MZ1A 1EF2A 1OY0A 3GXNA 1P0DA 4UOZA 3K1GA 3W71A 2G0WA 4EPKA 2Y85A 4C1LA 3B8UA 1LJYA 4ZZ9A 4NI8A 3UJRA 4M80A 2OWXA 4KIRA 4LEQA 3CQIA 4E4PA 2ISWA 4CLMA 3OGVA 2YW3A 2W6RA 1J96A 3BTNA 4AQLA 2BOEX 2F7FA 2GFTA 2REQA 2OEMA 1KFCA 2CEQA 4DF1A 3H26A 1W8SA 4IH3A 4ECLA 2GWGA 4RUBA 1D7FA 5GJMA 8A3HA 4AD4A 4E8DA 3GXPA 1MW1A 4FPSA 1VFLA 3AI0A 3QHMA 5GQBA 3UF9A 2X2GA 5EBAA 5CJ5A 4AZBA 1PTGA 4UOQA 3BH4A 3UNTA 2G3NA 4H8HA 5E0KA 1NSJA 4O16A 4KIEA 1TPDA 2OKTA 3AXIA 3MA8A 1GEQA 2VZSA 1KM1A 1J6OA 2GJNA 4GJIA 1SVDA 1TJRA 1ICSA 1C7TA 1KXHA 4L6DA 3QR1A 1VIZA 2XYLA 1Q7ZA 3ORWA 5DXYA 3EWWA 5G5IA 2BNJA 3B40A 4LW7A 2X42A 5D05A 1NFGA 2RKXA 5BU9A 4TO8A 4IPLA 1HKJA 3L7RA 1SZRA 5DANA 1VFSA 4EXAA 2XFYA 4O53A 3L23A 3BC9A 4TOQA 3MW7A 1HO4A 2GUUA 4P7OA 2HTMA 4K2SA 4GI8A 3C4UA 2E5DA 2FIQA 2OO6A 4HCLA 3V1HA 1YE6A 2ZC1A 2EJ1A 3OLDA 2NWRA 2P0IA 2VJXA 2ZOXA 4I9TA 3F03K 2YDQA 4J40A 3QMSA 2A3HA 3PTQA 2J9YA 1YBQA 4FS9A 5H91A 2QVHA 2J8GA 2O55A 3CXOA 1KM4A 3APTA 1GOOA 3PTMA 3YPIA 3DESA 1EQCA 3CPUA 3S47A 2NQ9A 1K4GA 1ADDA 2G4FA 2VDGA 3GB6A 4P5UA 4IPPA 1WYIA 3CH9A 4FXFA 3LCLA 4H6KA 2VM8A 1KFEA 4G7EA 2SFPA 1UJPA 1Z3NA 1RXOB 1E40A 4LALA 2D2JA 4H2CA 4JFUA 5HK4A 4H7ZA 1H50A 2YL5A 1SZEA 5G1MA 3W70A 3SN1A 1KFLA 1PZ3A 2C16A 5FF0A 2WOQA 3PNUA 2VVNA 1VFMA 1X7IA 4CD8A 8RUCA 1V6VA 1A4LA 4XWUA 1XJBA 2WZEA 4EANA 1JCMP 4OZOA 4XG1A 4LBSA 4FOUA 2QJJA 4UMAA 1A5AA 5A8OA 2G3FA 4WKHA 4DLMA 1PKYA 2G37A 3TA9A 3SRDA 3SB0A 4N2YA 4ORIA 3Q4DA 3WLHA 4V15A 1WDSA 1LG1A 1UMYA 4M3PA 3H7VA 2ZZ4A 3QOKA 1NOFA 4XZMX 3FN9A 3G8RA 3OIXA 2JEQA 3G5EA 2NSXA 3RX4A 4ZQPA 1VENA 3A13A 2Q09A 4C7FA 3MDUA 3K4WA 1KNWA 3T78A 5AC8A 1G7UA 1Z9AA 1CXKA 3SCUA 1PCKA 2R1MA 1C8VA 1GJUA 4U28A 5LNSA 4CU6A 1OG6A 1QNVA 3ISIX 1ZBCA 4HU3A 3M5VA 1WDRA 5FA5A 4IIDA 1OK6A 3K13A 4NUWA 2BTMA 5D04C 3OODA 3RX2A 3ZJ6A 2QIWA 1MW2A 1KCKA 4NJIA 1E0TA 4W8AA 5HPOA 1ME7A 1JYVA 1B2YA 3XIMA 4KW2A 4ZB5A 5I3KA 1H1ZA 1KA9F 2ZA3A 1XXXA 1ADSA 1VCVA 3WK1A 1VGAA 2WMFA 4JOMA 1Q6CA 2I7GA 2V81A 1U1UA 4F0KA 1CGXA 4A8NA 1I2RA 3O07A 3VE9A 3HN3A 1E0VA 1UZDA 2OLAA 4MNMA 1B3WA 1Z69A 3TAKA 3EX2A 2VX6A 2W62A 5BRBA 4DBWA 3HJZA 3HPFA 2IKHA 1XF0A 3EX3A 4K39A 3M64A 3L4UA 3DGBA 5F1VA 2XIMA 6TAAA 3AIEA 4M24A 3EX1A 3S2CA 2ON3A 1G1YA 2XZ7A 3F4DA 1XC6A 1P6WA 3EWXA 2FVLA 5CZ0A 1HGYA 3GU9A 3TAOA 3MC5A 5CSRA 3ZR5A 2ZRXA 4X60A 4DUXA 5A8PA 3LM3A 2Y7FA 3OVPA 1GTEA 1LWJA 3ALFA 1DWFM 3EPOA 4IL0A 5ABFA 4MYAA 3LHWA 4HTBA 4D6EA 4PMJA 3HMCA 1V6TA 1JD9A 1HGWA 4JEQA 2C0AA 5FIPA 4JTDA 2XSAA 2ZVRA 4Z42C 4AX6A 2O92A 1DXEA 2PB1A 5GNZA 1QOPA 1R30A 3VCNA 4B5TA 1VCGA 3C0QA 2EPLX 2ATMA 2IPWA 1GQIA 3CAKA 3KP0A 1SQ7A 4RZBA 2QDDA 1DIDA 1T96A 3CYJA 1PDZA 1TZZA 3W26A 3W74A 3UWWA 3ECQA 4O18A 2BY3A 1Q5MA 1B5TA 4HNCA 1W56A 1H41A 3W6LA 3EB3A 4X9YA 2WLYA 1QDSA 3PTDA 1XICA 5CBIA 4E4UA 4O57A 3AFBA 1CTNA 4HOZA 1PIFA 2RGLA 5ENLA 4ZGYA 2ZRVA 1JGIA 1XBXA 1C90A 2XVLA 1Q8JA 2RDWA 3LA4A 1Q85A 3LDVA 3WLKX 1LL4A 2FKPA 3O9NA 3ZT5A 4JPGA 1WKEA 1F61A 1A0CA 1VAHA 1QPQA 4BKNA 4DN1A 1EF3A 3FDKA 2DVUA 5IFTA 1DOSA 1XGZA 5G2IA 1J12A 1BVZA 2J75A 3FV9A 1BRLA 2ZTKA 1PTDA 2WZIA 3SCWA 3PZNA 3MZNA 4AEEA 4C7GA 1M41A 4LCQA 4M82A 2GUYA 2WKJA 2VFHA 4UTWC 1T99A 3M47A 1DWGM 3G77A 4XAZA 2PBOA 3W07A 1GKQA 2IQ0A 1MNSA 4UFLA 2Q02A 1O1HA 3N34A 1Q7QA 1KM5A 2B7QA 1TPH1 5FJPA 3NOEA 1JYNA 1XS2A 4EIVA 2DIJA 2W5FA 3SADA 3UWZA 1P5BA 4O19A 2I9UA 2VUYA 2QW5A 4FHAA 8TIMA 4LTSA 4H19A 1WAWA 4NVTA 2IKJA 3WUBA 2GWNA 3EWBX 4C7DA 4LB4A 3W37A 4DJFA 3NPVA 3WBYA 1XIEA 4XSLA 1BXBA 2C0HA 1NY1A 4QR6A 1TV5A 2PTXA 1M65A 2J88A 1EHNA 1DJGA 2A5HA 2XISA 3S6TA 3KDOA 3NWRA 1OGSA 3GG8A 3OZPA 4E8GA 5DY3A 3T8LA 3WK2A 1SJAA 1A80A 1VJIA 4DO7A 3AMDA 3CWNA 4FB7A 1U2YA 3O8AA 3GNXA 3UA4A 3J7HA 1XIGA 4LVDA 3H2OA 3W84A 2X09A 1DIOA 2WHLA 3MWCA 3Q37A 3F7JA 5IRPA 1EXBA 3LXBA 1VRDA 1VR6A 4W5UA 2FTWA 4Z1CA 4QDMA 1MUWA 3O16A 4UXDA 3THAA 1X38A 1A53A 4GIEA 4QG6A 4YCOA 1IEWA 2GQ3A 4Y8EA 3TONA 1MVYA 3V4BA 4I8YA 3FXGA 2INZA 3EA1A 1J0HA 4XK2A 3PBMA 4D72A 5HA7A 1EA9C 3H54A 3PG9A 4JYFA 1KM0A 2PWEA 3ES7A 3SUWA 1VJSA 4XAYA 3MS8A 1KR1A 4FNPA 4ROPA 3VCCA 1ENUA 3CUIA 1A5OC 3RFAA 2XN1A 4FLSA 2ZZ7A 1TCDA 2C18A 3SIMA 4HHLA 1P4CA 2VP8A 4FP1A 3WY1A 3FXYA 1Q7MA 3UG5A 2EKCA 1TV7A 3LG3A 4HPGA 2CBUA 2DVXA 4DUWA 5I2UA 3MWAA 1DVJA 1PBGA 1Z32X 3GTFA 4Z1AA 1BVWA 2OR2A 5CPSA 5D2XA 1OGGA 3VGBA 3RMEA 2ZVIA 5D9OA 4UQDA 4S39A 6REQB 1XLIA 3TU9A 1JUBA 2TMDA 4AYSA 1UYQA 4AXKA 4V33A 4ZBCA 1B3ZA 2F6KA 3WF4A 1WBJA 3DYOA 1NDVA 5A8GA 1L6FA 3AC0A 3TW6A 3AHXA 7A3HA 4BI5A 3IGXA 1YDYA 2TPSA 4FR1A 3PZTA 1F3XA 3MJMA 4M6QA 1P6CA 4IMAA 1M7OA 3A4AA 1DJXA 5CC5A 4XTDA 3RLUA 2QGYA 3G1VA 4JX4A 5CPLA 4XAGA 3NQVA 5K7JA 3GHSA 3T4WA 5C2XA 1NFBA 2OELA 3CZEA 2FPVA 3S5ZA 3CHCA 3UYCA 2FYMA 4AIUA 4Q33A 4HNLA 1U33A 1BSLA 4PFMA 3RX3A 4NZ5A 4AISA 4LRTA 5E70A 2WZMA 3FJNA 3SRHA 3T4CA 3P0XA 1WV2A 6ALDA 2CHRA 1B3OA 1ZJHA 3B8DA 1XCXA 2IPFA 3W72A 1S5TA 1ZGDA 1SFSA 3PSVA 4QP0A 4JQAA 1J2BA 4BQ3A 1ZAIA 4AZ6A 1KTBA 2OLHA 3UGRA 4HK6A 1RQHA 2PLMA 3FHQA 1X8CA 3A22A 4BQ5A 5BZAA 4YS1A 1Q13A 4E0CA 2YPIA 5LIYX 1EOMA 4US5D 3G18A 4MY8A 5EMUA 3T0BA 3EOOA 3R1ZA 4L64A 1JEZA 4A3YA 1H49A 4V28A 5D9MA 4LAZA 1IT8A 1YX1A 2G95A 2EG8A 2VRQA 1KFKA 3PJWA 1QVBA 1Q6FA 1EGMA 2ZUMA 3OYXA 4AWSA 3P60A 2Y1HA 1CXHA 4AD2A 1JZ7A 5XIMA 5BXSA 3H8AA 4AHOA 4NY2A 3TTOA 2QCHA 1PB0A 3WG6A 2JK2A 1MMFA 4IOTA 5A6TC 1WZAA 1XFCA 2WQDA 4QDWA 4QJ5B 1JCJA 2R6OA 2BDQA 5D4YA 4JTFA 3L65A 5GVJA 4D6HA 1UOZA 2QUMA 3V75A 2FVMA 3IPWA 4GYFA 2X1SA 4IIFA 1SW3A 2B7NA 3KVLA 2YDRA 3OBAA 2ACQA 3NQ7A 5BROA 2XHYA 4MKNA 1OX4A 1PYFA 3FX4A 3VDHA 1K03A 4EWJA 3V5OA 4HYWA 4TX8A 1IGSA 3PPGA 5JIWA 2CPUA 4UBPC 5ABGA 1W54A 3TDFA 4O8AA 4WCJA 1U83A 4ZQMA 1ZBKA 1IF2A 3L2IA 2QGHA 4ZA0A 3OZYA 2Z0IA 4DWSB 4BCEA 3BOXA 1JCTA 4EKJA 3NSXA 2WO5A 3P80A 4AEOA 4JY8A 4N6FA 4Y2WA 5BNKA 4V1XA 1PZ0A 2ICSA 3W7NA 1J18A 3BGAA 4ERAA 3JVAA 4W93A 3WFAA 3OG3A 1XCFA 4AYGA 4GK8A 1W31A 1UR8A 3NEHA 4YTRA 4OUEA 4J9JA 4IFRA 3T7VA 4A22A 5C0QA 2WYSA 3W4RA 5MKGB 4KERA 1KLYA 3UJ2A 3Q94A 4POCA 3AIWA 1CB2A 5D38A 4E2OA 3RAOA 3NVDA 1O12A 1G0CA 3GNRA 2DORA 4W8BA 1PKMA 4HCDA 2WVTA 1AD4A 3WQPA 1GHRA 2A1YA 3NZPA 4U2ZA 3H12A 1XV8A 3HOJA 3BLEA 3PR2A 3RU8X 1W1YA 2PDWA 1HNYA 1W1TA 1Z7AA 4RZ5A 1BWKA 1SZNA 1A5KC 2YL6A 5HNRA 4YLWA 3TOPA 3PAOA 1BAGA 2A0NA 4ATLA 2VGFA 5HWMA 3BJFA 1OFEA 3BGGA 5A69A 3TMQA 4S2BA 2PDJA 4M6PA 1EO5A 2DZAA 1TX2A 2WMJA 4AFYA 3H7RA 1NARA 2I1OA 3W1QA 1YNPA 4JN7A 1F8IA 3STGA 1UKSA 2QPXA 1W2PA 3G1YA 1V6YA 3L12A 4HT3A 2QUUA 1E3XA 4HK5A 3KOWA 2PDMA 3WX7A 3GW3A 1TPFA 1AW2A 4ZTXA 1E5JA 4KCUA 2BHZA 1W1A1 2XWEA 2PLKA 4O17A 3AUJA 3UWYA 3F2DA 3PNZA 1B0IA 2FFCA 2WVUA 4JIEA 2RJGA 5FSEC 1VS1A 4U33A 4L6OA 5I7GA 1VLIA 2GGGA 3VPLA 4CU8A 5CAHA 3N14A 3RRXA 3BLIA 5MF5A 1IEIA 3R6IA 5AC5A 2WBKA 4YVXA 2PD9A 3NL6A 4JN6A 1DJQA 2I56A 4XSMA 3HTWA 3AXKA 3SCNA 4XKYA 4AD1A 4QEEA 3BZGA 5J8LA 3WFLA 4DZIA 3AMKA 4G2DA 3HG3A 3WLMA 3R11A 1US0A 3SCPA 3CC1A 3GTNA 3I3DA 4DXKA 3I6EA 4DPQA 3BW3A 5LSMA 3VGDA 1R9YA 4BHYA 2I17A 4YYFA 5HQLA 1R6WA 2YZRA 3FNDA 4L56A 2FFIA 4PUKA 5B80A 1IEQA 3BANA 1NWSA 2ZCGA 1JL8A 3GH5A 4XZHA 4E6MA 6ENLA 4OUIA 1LUCA 1UP2A 3ONBA 2G4JA 3CV7A 3ARVA 1P0KA 4YTQA 3VXGA 2CHNA 4LX4A 4KGLA 3E3HA 3WDPP 4GG9A 3G1HA 2VEPA 1X1OA 3UXDA 3PUGA 4HIBA 2FDMA 3IRSA 3GDKA 1EX5A 3GD6A 3HQOA 2AL2A 3WQWA 5FAJA 1H62A 3TR2A 2EGZA 3HPXA 4KEUA 5HULA 2C71A 3QN3A 5D2VA 4PBEA 2HK0A 2VZVA 3B9DA 4LBRA 2CLHA 3W23A 2DH3A 2BMBA 1BPLB 4OTKA 1ECEA 4W7VA 4WQ6A 4Q7NA 4Q7BA 3TN6A 3HFYA 2AQOA 2AQWA 2ISSA 4PBGA 4QITA 4MWAB 4YHEA 1HXJA 3S5YA 4YWIA 4DM2A 1UP0A 3NFUA 1WA3A 3DBNA 5I03A 4O1DA 1ZU8A 3KXQA 3LYEA 4GI4A 1NH6A 1GQLA 4MJMA 4Z0SA 3GHTA 4LUTB 4OJYA 1LM1A 3NQDA 4QFUA 3IK4A 1SR0A 4MLJA 1QFEA 4NNCA 1XDJA 4S2CA 4WK9A 1TZ9A 4ZO7A 2TAAA 4M7TA 3TQ0A 4MVAA 5HJLA 4K8EA 1VD6A 1XKJA 3W1UA 3ZWSA 2PD5A 3KTSA 4TUFA 4E2DA 3CUHA 2XJ7A 1O94A 4CU7A 2PTYA 2VEMA 1TUFA 5FCZA 1XSJA 5ABEA 3F2BA 1Q2RA 2Z2BA 3W7PA 2BHUA 2Y70A 1AH3A 4QG9A 1P6BA 3C6CA 3RNDA 1VJZA 1B4EA 3SZ8A 5KZ6A 4WKAA 4AWUA 5I3FA 3ALGA 1UROA 4F2UA 1HKVA 2FDSA 4N42A 3OVGA 3OO2A 1T40A 1BGGA 2O9TA 3A5VA 3KCJA 1JFXA 4FNQA 3FY1A 1TCMA 3HMJG 2HNHA 1LZOA 1ZTVA 4QEHA 2JKEA 3TLQA 3UWUA 5PTDA 3TQPA 4JX5A 3WNPA 4LY4A 1OFDA 3FKRA 4PUEA 4JTQA 3USBA 3QJAA 3O6YX 3VE7A 5G2HA 1DQUA 3HQPA 4NJGA 5EMLA 1YXYA 3TYDA 1A5SA 2WCAA 2ZA2A 3SUSA 1LQAA 1B4KA 3BQ5A 5HBFA 2QQ6A 4R9XA 2C7FA 2Y5JA 3OZMA 3EXTA 4JTHA 4MNJA 1AW1A 1JXJA 3D0CA 2YCIX 3W7GA 4PUUA 5M5DA 4JTIA 1XIIA 3PS7A 3ABXA 1VEOA 2PRHA 2Z6JA 1MYRA 2VHLA 4AC1X 4TV5A 3R4IA 2PEVA 3VDCA 1Q2SA 4KCTA 4GD0A 4LJ3A 4DYKA 3WDQA 1XBVA 1YKWA 1OG0A 1DHKA 1CGUA 3PJXA 3IVUA 1WBHA 3BMXA 4RKAA 4LB3A 1L2UA 4JR5A 3V5FA 2VR2A 1XH1A 5DCEA 5A95A 3AIVA 3GLCA 3KBJA 3R8GA 3H6OA 5ABFB 3CEPA 1GW9A 2VD9A 5M1TA 1XLBA 4F0MA 3K46A 4LXFA 1Z42A 1LL7A 1XH0A 1WDPA 3OP2A 4Y9OA 5IDIA 5AKQA 1NP0A 1UQZA 5L9FA 4UTTA 1KGWA 1N8WA 1R3VA 3W27A 2W63A 4RV3A 3U8GA 4NIRA 3GX9A 3QPZA 1EYEA 1VB9A 2PWDA 4B4HA 1E4MM 2Z7KA 3E0IA 1ESWA 1UHVA 1V3LA 3CZJA 3GUWA 3MSRA 1XH2A 4HZ8A 3P84A 1SJCA 4XD3A 3R58A 2Y0FA 3NR0A 3DYPA 3B04A 1Y5WA 2VT0A 3PZQA 6A3HA 2ZDSA 5C9UA 1KLZA 4RDZA 3ITYA 1U5JA 2PI6A 4O14A 5FJJA 1VPXA 4QS6A 2D23A 4PGLA 1XDMA 5H8PA 2E09A 3MCMA 3LX9A 4FZIA 3WMCA 3ZM8A 5E6ZA 4J3TA 2DEPA 2PU0A 3K8LA 3WUFA 4MZYA 4N9EA 5IM51 2VR5A 1NOUA 2RH9A 1YLVA 3TSBA 2A85A 1MW0A 2HEJA 4AD0A 1F4HA 3RYSA 2JALA 3UXAA 4NJKA 2INFA 4JTTA 3BSGA 4GXWA 2GVEA 1JYXA 1J2WA 2QHAA 4M7SA 2RDXA 2AAAA 2P76A 2W92A 4WUIA 1FUYA 3PFRA 4PTNA 2P8BA 2QCCA 2DQWA 1WPCA 1KWKA 3BZJA 3LEPA 2D2HA 3RILA 4JTKA 3BURA 4R27A 1XUZA 4HQVA 3WH5A 4WDWA 1D9EA 2E5CA 2OB3A 2NSOA 3L0GA 2AL2B 2X2YA 3PF3A 2LLEA 3LRKA 3P61A 4MPKA 4B9YA 4ICMA 3S3GA 2OWCA 2Y24A 4O1CA 4LYQA 1VLWA 1IEXA 3STCA 2VWTA 3VKAA 1K9FA 3ES8A 2JEPA 4Q4SA 2EPHA 1RBOB 3IIXA 1MFUA 3PBVA 4JDBA 4QDPA 1TREA 3DZ1A 1S5NA 1F6YA 3AO0A 1EJRC 2XIIA 2VKZG 5LNRA 3QTGA 2AMGA 4S3KA 1OCQA 3NGFA 5I3JA 3DGRA 1Y8BA 4BQ4A 3SRKA 1XL9A 1A4MA 2YL9A 1EC8A 3EWYA 1O4UA 4JD4A 4R9OA 2JKPA 1EJSC 3CLMA 3ANYA 3C52A 4WXYA 1LOLA 3F4NA 1GOQA 1XLMA 1R3WA 4BF7A 1JRCA 3KX6A 2ONEA 2H90A 3HA1A 2E9LA 4RW3A 2DZPA 1W9XA 4RDYA 4X2PA 3WJZA 4DELA 4YN5A 3LBMA 2PURA 3EOEA 4UR7A 3P0WA 2OYLA 4S1FA 3THCA 3DX5A 1ALDA 3A6OA 4UFJA 3G1SA 2ZIDA 3CYVA 5C9ZA 3NQBA 2H9AA 1ZCCA 1W37A 4MAVA 3W7IA 1JGMA 3PJUA 3U2EA 2WQPA 1M7PA 5LXXA 1N8FA 2NX1A 2NXHA 3L66A 2Y6ZA 2PDNA 4JIRA 4Q8VA 4PB3A 2J6VA 2WB5A 1MO0A 3KL5A 2Y88A 3UZXA 4NSBA 2PDUA 3AIQA 1OD0A 3TWAA 1LL6A 3QHNA 1EB3A 3DHFA 4ROQA 1D3GA 4R7OA 4WRHA 1HX0A 4H9YA 1E1FA 3RR4A 3DG7A 1VEPA 4MHBA 4GH3A 3GDLA 3H24A 2QULA 2VFFA 2YDAA 4H6EA 4IGSA 3W7RA 3O63A 1RAKA 1RJPA 4XZLX 2VDIA 1UUQA 1PTAA 3FFSA 2J9ZA 3GVRA 3FJLA 2XU2A 2POZA 1N82A 1YXCA 4C6IA 4OBSA 3WQ6A 2GDQA 3PPFA 1XUUA 3HPSA 3BV7A 4D1IA 4TXEA 3Q58A 3TC7A 1W3IA 3AWNA 4EACA 1XDLA 1IYXA 3DFHA 4ZFMA 5E0CA 2AGKA 4RR4A 2XH7A 4UNLA 2G41A 3DENA 1ZB5A 2CWXA 3W2UA 2YL8A 2ZZ3A 1JJKA 2AGTA 3LBOA 4ICNA 3W2JA 3WLJA 2VFIA 2NQZA 3KCLA 2V30A 1CZ1A 4C6KA 2F6UA 4LF2A 1MXDA 3E2RA 1I75A 1VBHA 3ZLFA 2FGLA 1W5NA 3ENLA 1WOAA 5LZLA 3WNNA 2JIWA 2DUZA 4L1GA 3RLGA 1BG4A 3KFTA 2BXYA 2CBIA 4IMEA 1ZL1A 1LLWA 1GYMA 4WDTA 1GOMA 1KKRA 4WSKA 4EP8C 1OWQA 2F38A 4JIPA 5A6BA 2HRWA 2DSWA 3L4WA 1EUNA 4F2TA 3ITLA 4LY8A 1J0IA 3TE9A 1UPPA 5FJTA 4JNZA 3LXAA 3HPZA 3TTYA 3PUEA 2QF8A 1Q6LA 1K8CA 1QRQA 2D1ZA 1QHPA 3VC6A 3GM8A 4H9XA 3N04A 2BXZA 2NQLA 4GIYA 1US2A 1PCWA 2P8CA 4KCWA 4WY0A 2JF7A 4PCSA 1IR2A 1QPRA 1AQMA 3VKBA 3LRLA 3WJXA 3KS5A 3QR3A 4OOZA 5AHLA 1E56A 4ZVJA 1W1B1 2V3GA 3KW3A 4RE2A 2J27A 4HA0A 3CAWA 3SCSA 1V8EA 3L0NA 4N4QA 5EKYA 1D8WA 3ARPA 1WXZA 2DVTA 1IHIA 4QJ3B 1O68A 4EX4A 3WK3A 4QIUA 1FHUA 2X1TA 4GNKB 1YDOA 1H09A 4QNEA 3VO0A 3OA3A 1EH9A 4DBEA 1EXPA 4JQ2A 3FJ6A 3TV8A 1EOKA 1G4SA 2ZRWA 4Z0JA 1FXPA 3PPCA 4HMCA 4MJ2A 1FP9A 3WLOA 3OGRA 1K8ZA 1P0NA 4V1YA 3MI6A 2J24A 3WQFA 4I3GA 5LA1A 2OZ0A 3WQ5A 1UR1A 2G3MA 4AVNA 2EQDA 1IGWA 4J4KA 2IQDA 4OBTA 3TCSA 2P0OA 2ZXDA 1EP3A 1W1ZA 3AQUA 3VIKA 4GACA 4EXBA 5KZEA 1FH7A 1ITUA 4KCVA 2WHKA 1W32A 1KCXA 3G3MA 4UTTC 3LHTA 4IQDA 1DBTA 3VMOA 1BYBA 2Q3OA 1T6MA 3S2MA 3DH7A 4JEJA 4N02A 1E43A 1X7FA 2NUXA 3WSUA 4GJJA 3WBXA 4C6PA 3KVJA 3SURA 4Y8FA 1I2PA 1XKYA 1V3MA 3BLDA 4O1FA 3VAVA 1EBGA 1HJXA 1GG1A 2VDHA 3D46A 4ZFCA 1QOXA 2H8ZA 5D32A 4UOJA 3ZR4A 7XIMA 4E2BA 3KRBA 1LRQA 5A6LA 3MUAA 4F2BA 4MKSA 4UIOA 2XIBA 1C3FA 4JXCA 3QLLA 5LIUX 3IV3A 3T0TA 1O60A 3W38A 1MUCA 4H9TA 3L68A 5H8UA 1YPFA 4EWND 1PVNA 2OQHA 2V63A 3NM1A 2FZBA 4CN1A 3W6YA 2C14A 4QLJA 5FI8A 2BODX 3OVRA 3HQNA 3Q67A 4N6EA 1FH8A 3M1ZA 1E3ZA 5FF2A 1U30A 5LNUA 1F05A 3FDGA 3G1FA 3GG1A 4IP4A 3LBCA 2Z29A 2J79A 5HWJA 1AQFA 3VIPA 4J1OA 1I2OA 3NAVA 1HJWA 1EP1A 4GISA 4S3AA 2RFGA 2CZFA 4W4QA 3VVGA 2BSLA 1UD4A 3VNLA 3R13A 1C8QA 2CHOA 2WBGA 1V0LA 4JFVA 3OLIA 2XVKA 1VHCA 1OGBA 3CZGA 3U0HA 4IIBA 1FWAC 2QMJA 2ZZ5A 4RNJA 1C9WA 3GYCA 3I6TA 1Z41A 2BGNE 2PWFA 1KM3A 3MYPA 3MMWA 3DUGA 5EMYA 3N3MA 4Y9AA 4UFKA 3M0YA 1KCZA 1OHLA 3GNDA 4E8CA 1R3QA 1PKNA 3KHJA 4Q8UA 4NRRA 5D8ZA 1LWIA 5GNYA 2X0YA 4HSHA 3GW0A 5HJXA 2F9RA 4BF9A 3EGJA 4F79A 1UIPA 1GVSA 4MPQA 4NAFB 1V0NA 3C3NA 2KX9A 1SZGA 2XSXA 3VM5A 2OZ8A 4A21A 1OABA 1V3KA 4LV4A 1EC7A 2C6QA 3W88A 3MP5A 3GR7A 1DYSA 4G9PA 3PZOA 4JQ3A 4NNBA 5DBUA 1W9VA 3TYUA 6XIAA 1SO3A 4GKTA 3W73A 1FTXA 1QI3A 3PSWA 4QCFA 4I6KA 5HJYA 3H21A 4KEVA 1NWRA 4UTLA 1E71M 4DAIA 3N19B 3NDYA 1JDDA 1QMLA 4PMVA 5A8NA 1DQWA 3IGHX 3TFCA 2GQ8A 2Y7DA 3BPWA 2X0SA 5H6HA 9CGTA 2OT0A 5AFDA 3VDGA 4DJDA 4W7UA 4ZCWA 3A3HA 1U1HA 3UJEA 3PC0A 3W24A 3URQA 4N7QA 1TUXA 6CGTA 2E68A 4RPQA 5BRPA 4US5A 3ZO9A 1UUOA 4Z1BA 3O1NA 1QWGA 3A3WA 9XIAA 1WZMA 5F2MA 3IIPA 2QCLA 3EB4A 1OC6A 3GBEA 5D9PA 1TMQA 4HGXA 3AZTA 4NYUA 2DJXA 2J7FA 1MRAA 3G0SA 3K8MA 2FZMA 1RLDA 1S2TA 4IG2A 3LI0A 2OYKA 4HOXA 3CL8A 1LQ0A 1CXFA 5HNNA 1RALA 3GTIA 3QGAC 5E1QA 4K8HA 4Q6JA 4EE9A 3S1VA 1XHGA 3R2GA 1RJQA 3ARYA 1CT5A 1L6GA 4NKCA 1TB3A 4S3DA 5A2BA 4LNYA 1ISZA 4Q8QA 4TTUA 2G50A 4IXXA 5DT5A 5LHEA 1FWCC 1PZ1A 1GJWA 5C71A 1MQQA 2QKFA 5A2AA 5LXEA 1VBRA 3RR1A 4A3HA 4XZNX 1GZ1A 2VRKA 3UPBA 4AIBA 1F3TA 2V5JA 2PGRA 3M44A 4MWAE 4GMEA 5FESA 2R14A 1GVYA 2WM0A 3NPUA 1KBLA 2FTPA 1XLFA 4FNUA 4JTRA 4XUGA 1RK5A 3WLQA 5C9WA 1KWGA 3NCOA 3S1XA 3QZAA 1GONA 4X22A 3EKLA 2ZUTA 1TRDA 1A50A 2R1NA 1NVMA 2GVGA 3QV9A 3AYVA 3UQNA 2CITA 3DIPA 3LI1A 4KS0A 1TFVA 2W9MA 3BW4A 3KLKA 3D3FA 4HPNA 1ZAJA 4HSOA 5G4WA 4IX2A 1F74A 2WXDM 1UD8A 4XTIA 1JDEA 4BI6A 1GGOA 1F6KA 4MIMA 4S3CA 2ZUNA 4GUHA 1VC4A 4PUMA 4F9JA 4CEUC 4GE8A 1MDRA 3N9KA 4AWTA 3FA5A 4JBRA 2CESA 2YCEA 2VO5A 2Y4SA 4JTJA 1TVLA 3SCVA 1GEHA 1DIKA 2V38A 4PMYA 3SUTA 1JDAA 1W2VA 4WZHA 4A05A 1CGVA 1TELA 2I5GA 3WQGA 2CBJA 4IFKB 1LYXA 3H4GA 5M2FX 1EJUC 1YTKA 1T0OA 4PMQA 2NV2A 1XGEA 4CQAA 2C79A 3PANA 2PWVA 2ZE0A 3NVTA 2X8RA 1E6ZA 4HZ6A 4UFHA 5CC7A 1UQYA 5I79A 3EEGA 1UKOA 1H7NA 3HGRA 5A6KA 3RN6A 2VC9A 3L4YA 8CGTA 4DRSA 1NF0A 4PYSA 3TMLA 2A79A 4PH6A 4HMEA 3OHMB 4PRWA 5DY2A 3NO5A 1G4EA 8XIMA 3IIZA 4IQJA 1ZPTA 1O66A 3HIJA 3REQB 1GVFA 4DLFA 1GKPA 3OU8A 1XLJA 4FLQA 2MANA 2Z6IA 1CYGA 2DPEA 3MZ2A 2XFWA 4WDUA 2AKZA 5HPCA 3SO7A 3U3HA 1QXLA 4MFDA 3TQKA 3EDKA 5HQEA 1I2QA 3A4XA 3OTRA 3MBFA 4Y90A 4QHRA 3ZJ8A 2GDVA 4DBUA 2ZKMX 4FO4A 3GQYA 5IDZA 4C5YA 3VCRA 4PZVA 3A12A 1A3XA 4QROA 1XG3A 4C1NA 2E6YA 1XYCA 2VEGA 4DVOA 1F7BA 1JRBA 3ARTA 4EAMA 4UMBA 5A6BD 3OEXA 2QCEA 1DWHM 4U10A 3CIVA 1WO2A 3W1MA 3PG8A 4M56A 2O4MA 2DZTA 1IWPA 4P8XA 3F5LA 1RY0A 2PDCA 1PXGA 3A24A 3O2LA 1JZ3A 3NQFA 3EEZA 3DHUA 1S5WA 1FDZA 3SSJA 2ZRYA 3I68A 3S2JA 1BF6A 2I5IA 1FWTA 5FF7A 1XD1A 5AYYA 1CLVA 3GK0A 1RJRA 1XR2A 4GXMA 4H1ZA 2ABBA 3T1GA 3UW6A 3UZZA 3GVGA 2IXUA 2CETA 3DU0A 4DZAA 2G96A 1W3TA 4PTVA 3G24A 3V7PA 1TJ0A 1ZLPA 3C2VA 4LFYA 4HMNA 1RVGA 4GI6A 5JMUA 4LUJA 7CGTA 3DC8A 3EOSA 1L6WA 4RXFA 2X30A 4A2SA 4DXXA 2E6FA 5AVNA 3MHGA 3LHVA 1VBGA 1V93A 1L8NA 1TPB1 7PTDA 3LU2A 5D2WA 2Q8ZA 1R2RA 4PULA 1F07A 3SGUA 1YBQB 3MO7A 3U7VA 3IJ6A 1K7EA 5I07A 3G8EA 1A0DA 1QATA 3UYIA 2NX3A 1DJZA 1KV8A 2WWCA 1SO5A 4P8VA 4ZEPA 3P82A 5FL0A 4U31A 1E0UA 3RHGA 2HQAA 4R85A 3IS4A 1Y5XA 1E6PA 1TPEA 2WC7A 5IHSA 4LYRA 4NHVA 1OC5A 3B9OA 2O9OA 4C6CA 1K9DA 1BEUA 3AIBA 3B06A 2J7BA 3VNJA 2QMKA 3XISA 4IQEA 3LGGA 1PL9A 1AL7A 2OOGA 5EL1A 4QJ1A 3B8IA 4Z2IA 2Z1WA 3CQ0A 4GLEA 1JIBA 1H5YA 2XM1A 5EU9A 3LTSA 3P62A 4ZODA 4JTSA 4YU1A 3E49A 4QM1A 1IV8A 1JULA 2Y7GA 1JPIA 1XISA 5C5YA 3P93A 3H2MA 3WF3A 5DCBA 2NLYA 1PO9A 2WNQA 1HKMA 1OCJA 5BU6A 3LV6A 5I23A 3O3RA 1ONWA 3APGA 5EY5A 1BYCA 1FWDC 4YVVA 3VGFA 1A5LC 3CL6A 5CBJA 1RUSA 1JCLA 1JFHA 1GK8A 1HP5A 1SM9A 3B97A 3L2MA 2BBFA 2B0MA 2VUNA 4JFTA 2VCCA 5A6MA 1TRIA 2Z2AA 1CPUA 4QJ4B 1S5VA 2DJLA 5JIPA 4IIEA 3R10A 3QKZA 3F4CA 2YLLA 3RXZA 1E0WA 4M81A 3CO4A 3ARWA 3N12A 1ZP3A 4KRZA 4C65A 4KWUA 3SUVA 3RPTA 3EBVA 4E3TA 1E6XM 4Z2KA 3WEZA 3KOXA 2BY0A 1JDFA 3S6OA 2E1WA 5DRCA 2J13A 1DL3A 3FLUA 3JZUA 1JPDX 5DF0A 2NW0A 1LROA 4GJ1A 5EYWA 3UWEA 1LLOA 3S6DA 2CXGA 1VFUA 3SJ3A 2Y8KA 3UY8A 4CVUA 1ICQA 2YLAA 3TW9A 4HU8A 2D22A 3NQ6A 3QXBA 4L5ZA 2QPSA 3AMGA 5F2IA 3Q65A 3U4AA 3CQJA 3RF9A 5MHBA 1ZNNA 4IHCA 1UD2A 1KM6A 2Y89A 1G94A 3BJTA 1LT8A 3MUY1 3UETA 3N4FA 5FF4A 1GW1A 3MSGA 2GVJA 4W5ZA 5AC6A 4GGHA 4ORMA 1OZQA 4N9DA 4EPEC 1VBUA 3NO3A 2PDLA 1EBHA 4J3SA 3UR8A 1W91A 4IT1A 2A6LA 2E6AA 1H1NA 1I1XA 5IFPA 2ZWYA 2ABAA 3BLLA 3W01A 2GGIA 3C8NA 4WSHA 1CCWB 1YTEA 3QM3A 3GC4A 1H5VA 3LNPA 4JCLA 1WB0A 4IL2A 4MNLA 3N25A 3LNMA 4QSFA 3MKKA 1UWQA 2PC8A 1IIHA 3IARA 3TC6A 2ZRZA 5BMWA 4NZCA 1MW3A 3AXXA 2HV5A 3PBWA 3G1RA 4FF7A 4XX6A 4IMCA 4PN2A 4Q4OA 2J7GA 4GNVA 3PVFA 4TIMA 3BAIA 4DWDA 1KGXA 3SCTA 3G3DA 5A1AA 4QNWA 3W7CA 3ITVA 3AROA 2HJPA 1OADA 5AHIA 1GOWA 1JUKA 5HANA 5CAKA 4CCCA 4DWSA 1GVIA 1UASA 3QYQA 2WWDA 3MSYA 3B05A 4KF1A 3SI9A 5TQLA 3WMLA 4S3EA 1XSKA 1V77A 1QJWA 1GVEA 4PCFA 3WCZA 3W6MA 1VHNA 3DG6A 2ISVA 5I0DA 1TYGA 1W8GA 2OMAA 3WQ4A 2PDKA 4ZSUA 5AECA 2BHYA 3RCYA 3TYBA 3PULA 5HUOA 3RG6A 5EPDA 5BWFA 2VI0A 4R5EA 1RK6A 3B8WA 3EMQA 3ARZA 4NAEA 3CHDA 4JHOA 3A4WA 3SQSA 5I6SA 1M04A 4J2MA 5SWUA 3JR2A 1AJZA 4C6MA 1J0KA 4CCDA 3OOQA 4IM4A 1PWMA 3B8VA 3F2CA 3R94A 1GHSA 3C8FA 4K38A 2YA2A 1YPIA 2ATSA 3RUBL 1XLLA 4JTEA 1TVNA 3P3BA 4ZO9A 3R0KA 3E1F1 4XZWA 3ZYZA 4G56A 2VEIA 2ZFAA 1LBMA 3VILA 5AOUA 3MU7A 5HATA 3S1UA 3C2RA 1CXEA 1I45A 1G67A 3PN8A 4JTLA 3AMLA 2FMNA 3TSMA 2GSHA 3MUCA 3U5UA 1JQXA 4O50A 1RPKA 4C6LA 1XQLA 4S3GA 4BY3A 1R7AA 4LC6A 1HG3A 1E72M 1JG9A 4D6IA 1V3IA 2VL4A 4NI3A 2GK1A 4BFAA 4TQTA 1BGAA 4CCEA 3LPGA 5LA0A 1O5QA 4XBKA 3B0VC 3RPMA 1RCOB 3AHYA 1JPKA 4WOZA 1EFZA 4Z2HA 2E8ZA 4ALDA 5C6MA 4G7FA 2VURA 5FEZA 3KTCA 4EK7A 1WXYA 5FJOA 4EF8A 3KOFA 1TE6A 5F2LA 1UH2A 5F4XA 2WPGA 3IVTA 3O6CA 3NUKA 4QISA 3ZWTA 1XCWA 3LPFA 3QQWA 4GZIA 1R3TA 4WJXA 4DEFA 3KOYA 4L61A 2ZRUA 2DIEA 2EAWA 4GX8A 1WX0A 2QV5A 2PP0A 3UPWA 3VNKA 2PDGA 1E6QM 3ATYA 3EKZA 3G1DA 2A3LA 1HJUA 3RO8A 1NQ6A 5K9DA 5CSYA 2R94A 3L0KA 1Q45A 4MWAA 1U22A 4C6BA 3IEBA 2HMCA 3WLLA 3S2LA 3RPDA 4IWWA 1QPKA 1TE1A 1V6UA 4H7CA 3SY1A 1YADA 1QK0A 1FCUA 3UCQA 3LCFA 3OQ8A 3WLSA 4LF1A 5LYRA 3W0KA 1PX8A 5I02A 3OW1A 1PE1A 3MPGA 2ACRA 2V69A 3LCHA 1AH4A 2A3CA 3EX6A 4P2VA 2WJDA 2RHGA 2YW4A 3GXFA 2OSXA 4FLOA 5T9CE 3BAKA 4PODA 2BLEA 5K9CA 5G1YA 1CW2A 1XLCA 2ZA1A 3NL5A 4HKPA 2O56A 1OFAA 2QF7A 4Y9MA 5BXTA 4JYDA 1W5MA 4NZ1A 3KWSA 3WBAA 3ABQA 2OZTA 1RR2A 1UCWA 2JGQA 3MYOA 2OU4A 4L1XA 3RM9A 1GUVA 1HF6A 4OU1A 4O1AA 2X41A 1EJTC 3NIYA 2AOSA 1E5NA 1Q3NA 3HQ1A 3UJSA 2JF6A 4JFSA 1TWIA 4XB3A 1US3A 4UR9A 4NJHA 1ONRA 3NG3A 1UB3A 3E02A 1TQJA 4NAEB 5GNXA 2D0FA 3GE7A 3FGCA 1MZRA 2ZDRA 1H0GA 3DECA 4O28A 1RD5A 3QQ0A 4LWWA 3FAWA 1QOQA 4GA8A 3ITGA 3F4VA 5E6YA 1NTHA 1ZZMA 3H4XA 1XINA 2FB3A 1A5BA 3HF3A 1HJQA 3SCQA 1W3JA 1H61A 2VCAA 3VD9A 3FOKA 4HNTA 2ZQ0A 3WUEA 1WUFA 4B3ZA 2QDHA 3WBWA 3KZSA 5DBTA 4YTUA 4PEEA 1QR7A 3WNOA 1GNXA 2Q8LA 5DCDA 2XVPA 3CUXA 5REQA 2VX7A 1GVQA 4YJ5A 3S4TA 3KVKA 1PAMA 3E0VA 4IX0A 1G9HA 5FEPA 1X1NA 4ONVA 3OG2A 1FWGC 2YBTA 4PFHA 4DNHA 3PB0A 2ALRA 1UWTA 1MFVA 3GS6A 3L9CA 4HN8A 1M01A 3BJSA 2DW7A 2RUSA 2O0TA 1I0BA 4BI7A 3TJXA 2GLKA 1XG4A 4GCXA 2QNEA 4GOAA 3MKCA 3VX0A 3LS9A 3W1LA 3F4WA 3S42A 3CHFA 3VABA 1NF7A 3WMBA 1ZSXA 1F5ZA 5AZ0A 4DQWA 2W67A 4ZQRA 4M6UA 1JPHA 3G0XA 5BWAA 2XFFA 4HNUA 3NA8A 5E5CA 1G4PA 4RNHA 3NXFA 3WUGA 4XV0A 1FHLA 2QDEA 1TPUA 3PZIA 5DMNA 3BLKA 1R86A 3WQEA 4AD5A 4A8LA 3JRKA 3G0UA 1EWDA 1JAEA 5D2YA 5LNWA 3MO4A 1XIHA 1OJXA 1V51A 3IK2A 3DBPA 3W75A 4LCSA 3FCPA 3N17A 3O05A 1U1JA 4UTIA 3UPMA 1F2JA 2PCEA 4IQLA 1KTNA 4DWSD 3GSMA 2OX1A 1DJHA 1YQ2A 3THDA 4AH7A 3F5JA 2VC5A 3INPA 5HQMA 3KDNA 4R7WA 3GVWA 3EMZA 3NSMA 4XO6A 3LK6A 4KPLA 2ZUSA 4IJBA 3M0XA 2YFOA 3ZJ7A 1FCVA 1EHAA 3NNTA 1XIMA 2X05A 1JXKA 4NX5A 1JVNA 3TN3A 2A7PA 1QCWA 5TBOA 5MKGA 3TXVA 3HGOA 3CASA 2Z4GA 4U3AA 3WLRA 4XIMA 2WW5A 3DFOA 1LOSA 1T7LA 2E7FA 2F2HA 5DXXA 3TYCA 3ID7A 3HPAA 4XZ9A 3IJQA 4AEFA 3WKZA 1GQKA 1UA3A 1ZENA 3IUIA 3ANVA 1D2KA 5EB8A 1OB0A 2FJKA 4GIAA 1S2CA 4LH8A 3I3BA 2XINA 1GTHA 2V2DA 1B90A 6TIMA 1V08A 3MKVA 5CBBA 2PPGA 3UU0A 3SM0A 1KR0A 4LBUA 1IT0A 4O0ZA 4D1JA 2XIJA 2GJXA 4UC5A 4FK9A 3VD4A 4GRSA 2YGYA 3SCRA 2Q6ZA 3WDJA 1O6IA 4B3LA 1LF1A 3M43A 2RJHA 1VP5A 3LTPA 1G5AA 4O1EA 1KO0A 1NM9A 2XUCA 2PBGA 3QV8A 3W53A 3LERA 4U2YA 5D30A 3IJ8A 4H2HA 3CJPA 2D69A 4QRNA 2PMQA 1J10A 4CN6A 3GDTA 1PSCA 3OIHA 1R3RA 3PM6A 4HD5A 3VOCA 2WV8A 3UXIA 1WNOA 1XLEA 2J25A 4LS1A 5DMLA 2BGSA 2YCJA 4PMXA 4ILSA 2GSJA 3WJYA 5EFFA 3VOIA 4D8ZA 3M0HA 4FAMA 2FZDA 3BLOA 3PUDA 2HROA 5CPTA 3TH6A 1I1WA 3WQCA 3TJIA 3BARA 5AHEA 1WOBA 4C6JA 1IZCA 3ZLHA 1C9DA 1PEZA 1QK2A 1AMYA 4ZQNA 3E0FA 4Z08A 2HDJA 3MT1A 4V2XA 1JD7A 3T2PA 8XIAA 3ITTA 3PP7A 1UR2A 1V02E 3H53A 5I3DA 3AXHA 4AD3A 4P7QA 4ZOCA 2X0HA 5HMDA 4TR9A 2Z00A 4QQ3A 4GFSA 4AIEA 5H1WA 3HV8A 3T8QA 3UVAA 2GJPA 2QCMA 4BWLA 3P5ZA 4G5DA 4N9CA 4D71A 1Z6KA 4TMBA 5CG7A 1C8YA 3RK8A 5D37A 2YIHA 2OOFA 3KAOA 4PBFA 2DIKA 1EUAA 4LVFA 3DFTA 3I65A 2Z28A 2IKGA 4ASTA 3CZKA 4WLCA 2P1FA 1J5TA 2V5LA 2VZTA 2YBVA 5BRQA 2A6NA 2B7PA 1DEDA 1KRMA 1GQJA 2OGJA 4H8UA 1SO4A 1WDQA 2J7HA 1EGVA 3DHDA 3AS2A 3VNDA 4G1KA 1S38A 2I16A 3MHFA 3VZXA 1T8QA 1OCNA 1RY8A 3WL0A 3NQ2A 2WC4A 3ARSA 3MBDA 1NDZA 1HIZA 4TX9A 1SJBA 3H2CA 1LWHA 5GJPA 5E9XA 3WENA 1T5AA 1XRFA 4REQA 3EXSA 3ITXA 2YB4A 4DJEC 5T91A 4R53A 4XKYB 5JBFA 4NILA 4YPJA 4Q32A 1JUEA 2B81A 3OQEA 1FDJA 1NWTA 2EXOA 4E4FA 3FEQA 5AHFA 5DN1A 1AD1A 4XVDA 4IIHA 1L8PA 1JAKA 3FHAA 4H8VA 1X6UA 1EPXA 3L4ZA 3V35A 4X61A 1DXFA 2UZ9A 3QVQA 3Q2DA 3TUUA 2E77A 3T6CA 4BJHA 1FHVA 1UWUA 3LV5A 3A5FA 4PMRA 3QHOA 1SR9A 3UXLA 1HL8A 1AA1B 2BG5A 3IACA 4CVWA 2CXEA 2V5CA 3CEUA 4HA1A 2V6AA 4YCPA 2JBMA 2E67A 2HSAA 3MV11 4P7LA 2VEKA 5KSWA 3RM8A 3FSTA 1Z44A 4HHHA 1TR9A 4NF7A 4WJEA 4GWEA 2VFEA 2ZICA 3STFA 3I7QA 4I6VA 4P61A 1E4IA 3E38A 3UGVA 4HHMA 1NFPA 3LCIA 5AHMA 2DSKA 1Q63A 1W5QA 3WLNA 1CLKA 5LIWX 3SUUA 2NZLA 2NXGA 1XLAA 1XLDA 4Z2LA 3TLLA 3E2QA 3AZRA 2OQLA 4YTSA 4A35A 4YL2A 4MZ8A 3VUPA 2HK1A 3CBWA 4MB3A 2CZEA 2FLIA 3D47A 2E5BA 2J6XA 2ZE3A 3BAXA 4M8UA 4IPJA 2PRMA 4IFKA 3UG3A 3ERPA 3W1XA 1VFOA 3WLPA 1I0DA 1MEWA 5KITA 3PWAA 1RQBA 2H9AB 4D6GA 2VC6A 3G6MA 2QEZA 4V27A 3WO8A 4PCNA 3UWVA 2R9RA 4XKMA 3N9SA 2Z1BA 3CHEA 1OX6A 3ONCA 4PMUA 3I10A 3NQ8A 4B5WA 3R79A 4K37A 4XIAA 3QKEA 2DUAA 1BKHA 1AH0A 1FWNA 4MYXA 4DBSA 3LPPA 2GK1B 4PCPA 3DFSA 3WJWA 1EPVA 4MY1A 1W6TA 1DWAM 1D3CA 1C8XA 2YCKX 4S38A 1VRXA 4HZMA 3BGJA 2CFFA 4IUOA 1SGJA 1TWWA 2Y61A 2OCZA 3TK7A 3N4EA 3PBYA 3B0YA 3SY8A 3C86A 4QX4A 2G3IA 2V2CA 1GOXA 1UG6A 5AY7A 2E28A 2HVOA 3BLFA 2VYOA 3TP4A 3MUZ1 2Y2WA 2REQB 2ZX8A 1F6PA 3EWZA 3CUJA 3LMYA 4FXRA 4M51A 1Q6OA 1F76A 5HINA 4B2DD 4NG3A 3VDBA 3MTWA 2DDXA 1FXQA 2PF8A 5IXEA 1E6NA 3AS0A 2DQXA 2W66A 1YPXA 4PTWA 3ZIZA 1S1RA 3PBGA 2GSEA 5I3GA 2QAFA 1WP6A 1QI0A 1UJQA 4F4RA 1FKWA 2V67A 3PPHA 4O0QA 3L21A 1Q8AA 2BGQA 1SFTA 4J5NA 4JL2A 3L4VA 4S3FA 1K7FA 4R88A 1W3HA 3WDHA 5JU6A 1D7KA 3GH7A 3KE0A 4AVFA 1JZ6A 2CLPA 4RX0A 1CX9A 1EJVC 1IEVA 2A3BA 6PTDA 1BTCA 5K2ZA 2POTA 1KRAC 4IJRA 1SW7A 1KGUA 1KFJA 1M3UA 3KRUA 1E9ZB 4IFOA 1SFLA 2QUTA 2EPMX 3DKLA 3DERA 1H11A 3UD6A 2W4XA 3LSBA 2CKRA 3I6RA 4LCRA 4HU0A 2WSKA 5AHNA 1FRBA 1F8MA 4AU0A 3S9YA 3BDKA 4J7RA 5FACA 2VTFA 1KM2A 2C1GA 2WSRA 3IGSA 1ZY9A 5T8GA 4HN4A 4LAOA 4WXZA 4Q8WA 1P1XA 4WGHA 2J78A 1G01A 4MKVA 4DHGA 3GH4A 4PB4A 1OFRA 5AYZA 1WKDA 3KTXA 4PTXA 3W7QA 1RD6A 3LGEA 1DIEA 4PRRA 4B4FA 1R3SA 1JCXA 3WZ0E 4GHRA 3HB9A 3VIFA 5HMEA 2CZDA 2J47A 3GU2A 5BXPA 3S83A 4Q4KA 4CNPA 3R89A 3DDMA 4X9SA 1UZ4A 1C91A 3W86A 3PZMA 2QAPA 2B31A 4FOJA 1G6CA 4LUSA 3T0DA 1JPMA 1B9ZA 4DJFC 4OT7A 4JNYA 2CIPA 1R3YA 3R12A 2PFHA 4KETA 1VCFA 3GIQA 5GPRA 2R1PA 3NQGA 4GQQA 3ZFHA 1QW7A 5REQB 3TTEA 1YW1A 1E70M 4LT9A 2OTDA 1W5PA 3MDWA 3GR4A 2W0UA 3QV7A 4J35A 3QOMA 1QASA 2CLEA 3ABOA 4ZE5A 2R91A 1RVKA 2V3EA 1RZMA 4GGBA 3VGGA 3NTYA 3QSTA 1W9BM 3IUHA 3POCA 1KBIA 3ZLGA 5C70A 3CIXA 5JXQA 4RE3A 1QNRA 4CQ8A 2PWGA 1VYSX 4B16A 1HKIA 5EMJA 1FHDA 3W85A 3UEQA 1L6SA 5JH2A