1MZHA

Qr15, an aldolase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
225
structure length
225
Chain Sequence
b'MIDVRKYIDNAALKPHLSEKEIEEFVLKSEELGIYAVCVNPYHVKLASSIAKKVKVCCVIGFPLGLNKTSVKVKEAVEAVRDGAQELDIVWNLSAFKSEKYDFVVEELKEIFRETPSAVHKVIVETPYLNEEEIKKAVEICIEAGADFIKTSTGFAPRGTTLEEVRLIKSSAKGRIKVKASGGIRDLETAISMIEAGADRIGTSSGISIAEEFLKRHLILEHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxyribose-phosphate aldolase
publication title Crystal Structure of Aquifex Aeolicus Aldolase, Northeast Structural Genomics Consortium Target QR15
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, aldolase
total genus 86
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1mzhA00
2F7FA 1OFBA 2QDHA 2CLHA 4JDBA 4NX0A 3GYEA 2QCDB 1PHQA 5EL1A 4Y9AA 3P67A 3EX4A 1K8XA 2DZUA 1MEIA 4PODA 3W83A 1YXYA 3KVLA 3RFAA 3PM6A 3LCIA 2EKCA 3IGUA 1QAPA 3TSBA 1R2RA 2V2CA 3MI3A 3N14A 4KWWA 5D2XA 1G4SA 2J24A 5D02A 3W74A 3NPVA 4HNUA 1I2RA 2QUVA 1XDMA 2EHHA 4RCXA 1H61A 4WOZA 1VJIA 3PULA 5CPNA 3TSMA 1W37A 4CCEA 1V5XA 3C2EA 2CLMA 1VC4A 1YDNA 3C4UA 3Q2DA 4XZ9A 3IIOA 3LRKA 3O07A 3NPXA 5C6MA 1I4NA 5K3VA 3B03A 1DHPA 1VHCA 2V5LA 2R8WA 1RQHA 4EWND 1KM2A 5HUOA 2X1RA 4JX5A 2XN0A 2GPTA 1B57A 2C6QA 3TA6A 2A7PA 2J27A 3SSJA 2WO5A 1KW1A 1JR1A 3HBLA 2CLKA 2CZEA 3QC3A 2DJXA 2QF7A 2Y6ZA 2WKJA 4NX5A 3OBKA 4RZ5A 1WBHA 2E6FA 3W7OA 4EOUA 2PC4A 3S1VA 3NYZA 5D2VA 4IUOA 1LCOA 5SWUA 1M7OA 2CZ5A 2G95A 3NEVA 2FDSA 5G2HA 1IIGA 4ALDA 1RVGA 4O57A 2A1YA 3MP3A 1JVNA 3NQDA 5AHMA 5IBXA 2DZXA 1TV5A 4NJIA 1OX6A 4NNBA 3CM4A 1LTDA 5I3HA 4MY8A 3WK1A 1W5PA 1TO3A 5E93A 1KLZA 4DBEA 3Q58A 4O13A 1TREA 2Y62A 1KFEA 5G1YA 3TR2A 1FX6A 2E68A 2E5BA 1TPWA 5HULA 1TYGA 4MFDA 3IV3A 1MZHA 5BOOA 2OJPA 4DO5A 3UWQA 1WAUA 3MJYA 4UFLA 2F84A 2RH9A 3OA3A 3R5EA 4MVAA 1G7UA 1UJPA 3L5AA 1I2NA 1J4EA 4UMAA 3DXIA 1FXPA 4UR8A 1OYAA 2B7QA 1VPXA 2OT0A 3TSDA 4WY0F 4H6KA 5F2LA 3C2VA 4GC4A 1MEWA 4KFPA 3GVGA 5EPDA 3FFSA 4GRSA 2VEMA 4O8RA 4UTLA 1FWTA 3G1VA 5I3JA 1LOQA 2W79A 3O8AA 1FXQA 2NX3A 3M1ZA 1JCJA 2ZZ1A 3G1XA 1TJRA 3MHGA 2NXHA 3U6WA 2QJIA 2A6LA 4A22A 5LHFA 3GDTA 1YADA 2NV1A 3BGJA 5HJLA 1O5KA 1JJKA 1YDVA 3CWNA 5C2XA 3G1FA 3WJSA 1DJNA 2HSAA 3O6CA 5C54A 2JBMA 3S5NA 1UBSA 4XUGA 4IX2A 2DZTA 3BPWA 1YTDA 3T7VA 4BWLC 2ZRVA 4HPJA 3QW4B 1X8FA 2WSRA 4CQ8A 3BW4A 2V5BA 2Y85A 1OFRA 3DFQA 3P82A 3QFEA 4TR9A 4H4IA 2ZZ3A 1VCFA 3E49A 5F2GA 1XBVA 4XBSA 4C1LA 2JKPA 3LBCA 3TQKA 5CPMA 1R2SA 2FIQA 4JXCA 3T4CA 4IGHA 3IVSA 4LC8A 3W23A 4JY8A 4JTGA 2PURA 2A0NA 2WNQA 4E38A 3DFTA 5KZDA 3N2MA 2XN1A 1Z42A 3VKJA 3P80A 3W7GA 3LHTA 2WSYA 1P0KA 2VEKA 3RK8A 4Z0JA 5BMWA 2YYTA 4UNKA 1RV8A 2H3DA 4WOQA 3A9IA 1GVRA 5I3FA 1IIHA 3M5ZA 1HO1A 2B7NA 5CGQA 3W7EA 3Q37A 4MIMA 1GVFA 3NM1A 3PUEA 2WOQA 3CEUA 4JD4A 2FQIA 3ATYA 2C14A 3NQAA 2QCLA 1I2OA 3FKRA 2FLIA 1Z48A 4XWUA 3DENA 4YLWA 1FUYA 4IXHA 4P2VA 3CWOX 3WK0A 4WXZA 3HPSA 3CB8A 4UFKA 1QO5A 2ZDRA 2E6YA 3PBYA 1TPC1 1XL9A 4OWGA 2GJNA 4BK9A 3STGA 1LBFA 3RLVA 4NJGA 1GG0A 2C19A 4NQ1A 3BG3A 1QFEA 3PC0A 3QM3A 3S6DA 3W75A 4O11A 1FCUA 1KBJA 4LTSA 4WQ6A 5FEWA 3B04A 2E5DA 3U2OA 2FTPA 3W2LA 3M47A 4QAIA 2HMCA 3E96A 3EX3A 3VNDA 3W1PA 1JRBA 1N55A 4N9EA 2OMAA 1FDYA 3L68A 3LHVA 3NQ8A 1QMLA 3LB0A 5DELA 3TIMA 3L9CA 4HSOA 5H2ZA 1KTBA 5FF2A 3LLDA 3UPWA 1GJPA 4NJHA 1BTMA 5FF0A 1KFKA 2A5HA 5K4ZA 1K8YA 5G4WA 3W76A 2VXNA 1FCQA 3GR8A 4FEZA 1SO6A 3DI0A 4RKAA 1L9WA 4TX9A 4WUIA 1RQBA 1OX4A 2P1FA 4MFEA 2AGKA 4QISA 4ZQMA 3TDFA 3VI2A 4K39A 1OFAA 4PH6A 1ZHAA 4POCA 2H8XA 5IBXC 3UXDA 1VGAA 3LRLA 1AL7A 3GKFA 2TPSA 2VOMA 3O1NA 3DH7A 4N2YA 3GZ3A 3HG3A 2CLOA 2J9XA 1THFD 1FWRA 1QOQA 4EIVA 3P5ZA 3N34A 3P8IA 3N2XA 4Z1BA 3W22A 3BVJA 1J2WA 3PWAA 5G5IA 1TMHA 4K7VA 1DKWA 1SW3A 3MBDA 5EBUA 4OT7A 3LM7A 2EAWA 1QPQA 1SSGA 2E1DA 4O14A 2BLEA 1TPFA 1OYBA 3S8HA 2JK2A 3FJLA 5I3GA 5K4XA 4MJZA 4JGDA 3W1NA 4UFJA 3UWYA 5KINA 4WY0A 4O17A 2YW3A 1OJXA 3C6CA 2KZHA 2O7SA 3S0CA 4FO4A 2Z6JA 1RD5A 3C8FA 1DOSA 3W72A 1SO3A 4LVGA 4CQ9A 2HTMA 4K37A 5FI8A 2B4GA 3O15A 2Q8LA 3EKLA 3PR2A 1ME8A 3LI1A 4RXFA 1UUOA 1D3HA 1WV2A 3W7KA 3TFCA 4ONVA 1OFDA 2CU0A 2V82A 3CIXA 3CLMA 4O15A 3PG8A 4JN6A 5F4XA 3W1UA 1ZAIA 1BEUA 2QCGA 3NOEA 4LU0A 4NU7A 2ZZ2A 2QCNA 3W2NA 3G3MA 1A53A 2Z1BA 3TU9A 2ZFAA 5LSMA 1EIXA 4QNEA 3M5XA 1XM3A 1OX4B 1SZFA 2V30A 1KTCA 3OVPA 3W1RA 3PAJA 4O1AA 3WK2A 3SIZA 1LRTA 3SJ3A 4GXMA 3UQNA 4BF9A 4Y90A 1B3OA 2YXGA 1PE1A 3I65A 3LCFA 3V1PA 1TPB1 1YXDA 2X2GA 4ZQRA 1A5BA 1W5OA 5J5RA 3S1WA 5AHEA 3O6YX 1L2UA 1MEHA 4S1FA 5C55A 3IIPA 2NX1A 1SO5A 1U83A 2QAPA 4O1CA 4ZZ9A 2EGZA 4UCGA 1A5AA 3PUOA 1M7PA 5C5YA 3CTLA 3M0ZA 4UFIA 4UTKA 4LVDA 1G4TA 3KVJA 5TIMA 3QSRA 3FYOA 4PC8A 1EX5A 4EF8A 4MKNA 4HN4A 1Z44A 4MZ1A 4PA8A 4WY0B 3SGUA 3CEPA 4X9SA 4UIOA 5H91A 3IVUA 5AHIA 4YMZA 3EWZA 4ZQOA 2FPVA 3UXAA 5LNUA 2OCZA 2R94A 1SO4A 3SW6A 2VELA 4IWWA 4BR1A 1F5ZA 4X22A 4R7JA 3HO8A 3M16A 3GNNA 3N9RA 2ZRUA 3LI0A 1AW5A 1TQXA 1TRDA 3G3DA 2RFGA 2V9DA 1F76A 3QJAA 3GDMA 1YYAA 3IGSA 4GUJA 1K02A 1TV8A 5BW6A 1G6CA 3W86A 1WYIA 4NZJA 1K8ZA 3GXPA 1JCLA 1ICSA 2R14A 4MJMA 2RKXA 5FEZA 3RU6A 3BLFA 3GXTA 1R30A 3G1DA 3L66A 3JS3A 3W87A 1HL2A 4JTUA 2V0TA 3PBVA 2C13A 3STFA 1GVOA 1IXOA 4DF1A 1ME7A 3ZS4A 4O1BA 4Z1AA 4FNUA 3C61A 3G24A 1K03A 3C52A 1ZAJA 2H6RA 3ABOA 5HR6A 3HPXA 1QR7A 1YTEA 4UFMA 1WX0A 4KWVA 5ABTA 3I6RA 1MSSA 1EUAA 1GQNA 1F6PA 5FESA 4LVBA 1I2QA 2CLFA 1K7XA 2GQ9A 2RDWA 4RXGA 3M5VA 3P5YA 1VYSX 4UTWA 4PEKA 4LWWA 1EP3A 3CQ0A 1TB3A 4K8EA 2X30A 5EMUA 3K30A 3I7QA 1KFLA 4HIBA 2QDGA 3QRHA 4I7VA 5IM51 3QMRA 4FX6M 3KVMA 3RLUA 4O4WA 3HB9A 2P10A 4UTHA 1DL3A 1P4CA 2NWSA 1X1ZA 3LCHA 1TV7A 2A21A 2ZZ7A 4Z0SA 3P84A 5AC6A 1DQWA 3MHFA 2Y7GA 1YLVA 3DAQA 1O95A 3FS2A 3ATZA 3TNOA 5D33A 1EWEA 3FOKA 1LLZA 1M5WA 2AAMA 3NL2A 2PRHA 4N4PA 1TPH1 4DF2A 1WOBA 4CNOA 1OYCA 2ZRXA 1T96A 2ZBTA 1JQXA 4LOCA 2QR6A 4YCPA 4ADSA 1O4UA 5G2IA 3W1MA 4B5NA 3GK0A 5D2TA 3W2JA 4RR4A 5E1QA 3MUXA 3EX2A 1DORA 3MMTA 4O54A 2OX1A 2G97A 4I7UA 4PFMA 4IPJA 3UY8A 4NT0A 4IQLA 2Q8ZA 4AHQA 1NF7A 3LCLA 4QJ1A 1I2PA 1ZENA 3S5ZA 1QOPA 3EEGA 3ZWTA 3NQFA 5HQEA 2YCEA 1LORA 3TC6A 4LT9A 3W7DA 4Q4KA 4DBDA 1OFPA 3M41A 1JULA 5EA9A 2ISSA 3W85A 3L2IA 3NL5A 3QF0A 3E02A 3BW2A 2QKFA 3M5YA 3O05A 1OFOA 1YDOA 3QEZA 5L9FA 1LDCA 1KM4A 5CSRA 1FDZA 3N9SA 1S5VA 4LY8A 1UASA 3F4NA 4JTLA 4UMBA 1NVMA 5AHNA 1H63A 1GTEA 2GQ8A 1GOXA 1H1ZA 1PV8A 3KAOA 2Q3OA 1GZGA 4ML9A 4GE8A 1KM3A 3LHYA 3LCXA 4ZQCA 3UNDA 4D2JA 1IXQA 2QUTA 3T44A 2YPIA 5BMXA 1BWKA 3MO7A 5EY5A 4HSNA 3C2RA 3EWUA 3EWYA 4TU1A 4DQWA 2DZPA 2NX9A 4M5PA 1G4PA 5AHFA 2A4AA 4UXDA 4WXYA 3IIXA 5AYYA 4FF7A 2Y89A 1VS1A 4HNNA 1G69A 3DKLA 4ZMGA 3S9YA 4GBUA 2V81A 3GAYA 3BW3A 4FHAA 3S1XA 3E9AA 3TQVA 3A24A 5DBUA 2YX0A 1T8XA 4GUIA 1TPUA 5E0KA 5J5DA 3G22A 5D32A 1P5BA 2UV8G 4O53A 1O94A 1X7FA 1PHWA 5AYXA 1SW0A 3BV4A 1JCMP 3SGZA 4O52A 2Y70A 1NAL1 3NA8A 4X3ZA 3TK7A 4JTKA 2I14A 3CU2A 3FA5A 2A7NA 4N9DA 3I68A 1A5CA 2JGYA 1LOLA 1RPXA 2AQWA 5KZMA 1SQ7A 1SFJA 5LZLA 5CZ0A 3W1LA 1A5SA 1TPVA 4N6FA 5D30A 4MLRA 2B0MA 3W7HA 1KM5A 1T0OA 3W6YA 3QSTA 4NXSA 3T78A 3GB6A 6ALDA 1LZOA 1BKSA 3EXSA 3PS7A 5LGZA 3ANYA 1TSIA 3NVTA 2A6NA 4OQVA 3ZFHA 3L5LA 1R47A 1VRDA 1L6YA 4PL2A 5DCDA 5D09A 1K3UA 1P0NA 1TRIA 1VH7A 1OFQA 5T26A 1HTIA 4C1KA 1BWLA 4JDYA 4N9CA 1LP6A 4CQAA 2FPTA 1ZALA 1ZNNA 1OK6A 4M19A 4DPPA 3PB0A 3PUDA 3YPIA 4FXSA 5CPOA 4K36A 2OT1A 4U28A 1QDSA 1LM1A 3G1YA 3KVKA 5K7JA 4HNVA 1JRCA 3TJLA 3QMSA 4LS1A 5F4WA 3OVRA 4M6VA 3NQCA 3ABSA 1G4EA 4KKXA 4RK8A 1B9BA 1GYLA 5HWJA 3UD6A 4Y96A 4O4VA 3ABRA 3GAKA 3RNDA 3KHJA 5D03A 4EF9A 1C8VA 1RZMA 3NQEA 5TQLA 5HMSA 3M6YA 1TTIA 3G8EA 1J5TA 5I3IA 1FWNA 4XQ6A 2CLIA 2VEIA 5LNVA 3A23A 2Z6IA 1M6JA 2R91A 4JTFA 1EUNA 1H62A 1YPIA 5DY2A 3SR7A 2LLEA 4UTWC 4KFNA 4UTIA 3QPZA 3QH2A 1FQ0A 4TMBA 4K8HA 3W84A 4DXVA 3O16A 5D05A 3HJZA 2QCFA 2VFEA 3GKAA 3W7IA 4UTJA 1VZWA 2C15A 1L6WA 3M43A 4JEQA 5D2WA 2JGQA 3USBA 2C1HA 3C56A 3NZRA 3LHUA 3P60A 4JX6A 3BGGA 5G1TA 1K7EA 5F1VA 2Y7DA 4ZQPA 4N02A 3W7NA 4MYAA 4Z1CA 2YFNA 2QCMA 2FJKA 1B4EA 3A5VA 3LHZA 1KLYA 3E12A 3QQ0A 4RLIA 2WJZA 3W2UA 4GFSA 4DEFA 3NQVA 1XC4A 5DCBA 4S2BA 1X1OA 3G18A 2ZCGA 4JICA 4ZQNA 1P1XA 3NO5A 5L6UA 3SZ8A 5HWNA 1CX9A 2Y88A 4O50A 3A5FA 2DJLA 1FCBA 3PB2A 4QITA 1EWDA 4WD0A 4WX2A 3GLCA 2VC6A 3R2GA 1GEQA 1AK5A 3TC7A 2NUXA 4CLMA 2DZWA 1PCWA 3TX9A 1WA3A 5DY3A 1TTQA 3HF3A 5DXXA 3OEXA 3UWZA 1JUBA 2QEZA 2BWGA 3DGRA 3HQ1A 3UWVA 3NQMA 1H60A 2ZTJA 3NR0A 1ADOA 2D73A 1YTKA 1KFCA 2YZRA 3WJWA 1GVQA 5AFDA 3EWBX 1DVJA 3DFOA 4NNCA 4OHQA 3EX6A 3TAKA 5D04C 3TJXA 4NJJA 2H90A 1N8FA 2WV8A 5A8GA 4N6EA 3BO9A 3UZ5A 1OG0A 2EF9A 4IOTA 4JTHA 3LXAA 3NXFA 5D2YA 2VFHA 3B0UX 2DORA 1GYNA 3BLEA 2E5CA 4ZVJA 4UTTA 2WPBA 3VE7A 2Y7FA 4E2DA 3W1TA 1MO0A 4LV9A 3IIVA 4MUZA 2VEPA 5BNKA 5FEPA 2XN2A 2E6AA 3LLFA 4Z08A 4FNTA 4O16A 1D9EA 1ZY9A 4LRSA 3KXQA 4J9JA 4MY9A 1LBLA 4PTNA 1VHNA 5LNWA 2DP3A 2I1OA 2DU2A 3DFSA 4HKPA 3W9ZA 1OK4A 1VCGA 3THAA 1TTPA 3OHIA 5AC7A 1YXCA 3PBWA 1H7WA 4Z1DA 1XXXA 3CPRA 3PY2A 3HGSA 1W56A 2X16A 4GWEA 2Y7EA 4IMDA 4AWUA 4AH7A 1R2TA 5CZTA 2NZLA 3IGXA 2X1SA 2ZRZA 3NQGA 5EKYA 4BI6A 2GUUA 3LCWA 5F2MA 2IQTA 4FNSA 1XI3A 2ZA1A 1H7PA 4QIUA 2XFWA 3G0SA 4UFHA 4DELA 4IPIA 2CFFA 2Q3RA 3EWWA 2GQAA 1NF0A 1L6SA 5FF7A 2E09A 2WQPA 1WBJA 4NXKA 3TFXA 3EX1A 1R46A 3MI2A 4JR5A 4IMFA 1UB3A 4QSHA 4IXXA 7TIMA 1Q6OA 3R13A 4JIPA 5F2IA 2H8ZA 1H50A 1WOAA 2O7QA 1Q3NA 2ATSA 3C2FA 2QAFA 2W6RA 3TAOA 4EVZA 3F1QA 1CW2A 5CSSA 2FB3A 3MYPA 4MOZA 2GVJA 1C9DA 3AO0A 1NSJA 4FNPA 4HNTA 4AHOA 2J6XA 4MZ8A 1ALDA 4OBTA 3WJYA 2J9ZA 3TMQA 2JKEA 4GUHA 5F1UA 3Q94A 2ZYFA 1Q45A 1F73A 5AHLA 1U5JA 3IVTA 4Q33A 2J88A 3B06A 2OZ0A 3H54A 3C2OA 3HOJA 2CZDA 2CLLA 4K6AA 1JQVA 2A2IA 3WJZA 1KV8A 2BZNA 2YYUA 3LERA 5LHEA 5MHBA 1FWSA 1Z41A 3S5OA 3W2MA 1OX5A 1OABA 1W5QA 4O18A 3WJXA 1D3GA 4BFAA 4R33A 2Y63A 1LRQA 1OHLA 3VE9A 4O19A 4PCFA 1QCWA 4AVFA 4RX0A 1QPOA 5LNRA 4FIRA 4IMCA 5CKSA 3P8JA 4XBKA 1WQ5A 5LGXA 3D0CA 1ME9A 2QCHA 3MHUA 3MYOA 3FEMA 5TBOA 1IXNA 1ML1A 1VLIA 3H53A 3GNDA 3GX9A 1VYPX 4MYXA 1Q6LA 2YGYA 3TQ0A 3OVQA 5AC8A 1LBMA 4K7YA 2PRMA 1SR9A 2WNNA 3TCEA 3GIYA 2ZA3A 4YCOA 1KA9F 1QO2A 2QCEA 1FBAA 4ORMA 1RQEA 2QJHA 1FCVA 3M44A 2NUWA 1PS9A 3TROA 5D37A 1IGSA 4ICNA 4LC6A 3FYPA 1FDJA 3C3NA 3KFTA 4AHPA 3NNTA 2QUUA 3G8RA 5HNRA 3G1AA 3DI1A 4LV4A 1I45A 5LKYA 3KRUA 2RDTA 5AOUA 1SW7A 4M6PA 3TW7A 1AMKA 1ICQA 3LDVA 1EB3A 3GR7A 2VKZG 1OVDA 1SFLA 2V2HA 3C0JA 1RR2A 2QCCA 1SU5A 1XUUA 2ZRWA 4AB4A 2YSWA 1AW1A 3L21A 5I3KA 3W7QA 4RZ6A 1ZJIA 3G0UA 3U8GA 3W07A 3WK3A 2E6DA 3LV6A 4JTSA 3P81A 1VR6A 1XKYA 3GXNA 1SZEA 4OV4A 4JTIA 3SFKA 4FX7A 3TKFA 4AF0A 3HGRA 1MXSA 4XKYA 3EB2A 2VENA 1XDLA 2YFOA 3P61A 5EYWA 4KFOA 2ZZ5A 1TQJA 3NAVA 4LS0A 6TIMA 1XUZA 1PL9A 3MP4A 4NVTA 5AN7A 4BI7A 1TPEA 4FNQA 3UYCA 3NPUA 1OF6A 1F6KA 4UTTC 3F03K 3W70A 1SPQA 1KTNA 1QPNA 3QQ1A 4FNRA 3R8RA 1Y0EA 4RV8A 2E77A 1SUXA 3TW6A 1EPXA 1W5NA 1IXPA 1DJQA 4CNNA 1H5YA 3SY5A 1LYXA 3R89A 5KITA 4LNYA 2ZTKA 3NQ2A 3ZWSA 4H3DA 1K7FA 4OGZA 5KSWA 3M9YA 3L65A 1TJPA 4W9TA 4JNMA 1LRNA 1W5MA 2W0UA 3HG4A 1OF8A 3L67A 4GUFA 3VFLA 1F2JA 4LS2A 1ZAHA 3RF9A 4DO6A 3HG5A 4LUIA 4RZ4A 3INPA 4NNAA 1ONRA 3DU0A 3JR2A 4MZYA 4R53A 3DBPA 1H7NA 2TYSA 3LBMA 4ZL1A 3NGJA 4M7SA 1HUVA 2TRSA 3LGEA 1H1YA 3G0XA 3IEBA 1SZNA 3UPBA 3MW7A 4A3UA 4UMCA 2NXGA 2VFGA 3P74A 4YL2A 4PL1A 2V8ZA 3JRKA 1W3IA 3FJ6A 3E0IA 4JIQA 3TXZA 3DFPA 1LLWA 4JS3A 2CWNA 4NZFA 3G1SA 2BTMA 4RJEA 2C0AA 3B05A 2WSQA 4LUJA 2V2DA 4AF0B 3KX6A 3PF3A 3EWXA 4FIQA 4E0CA 4XKYB 4OV9A 3N73A 3UWWA 3ZR4A 3GDRA 1S5TA 3UWUA 4S2CA 3NQ7A 1XCFA 4UTUA 5U4NA 3NPWA 2FB2A 1O5XA 2CLEA 4UTMA 4WZHA 5DXYA 3S5YA 2I9EA 1DV7A 5HUPA 3W7MA 1T99A 3W71A 2WNZA 4O1DA 3W7LA 1O60A 3HIJA 1UCWA 1VCVA 4QNWA 3NZ1A 1PIIA 5FF4A 1FWWA 3LXCA 3BLIA 4NUWA 3QPYA 3LHWA 3HG2A 4A29A 3R12A 4MLJA 1G67A 1LROA 1N7KA 3BK0A 4HT3A 1AL8A 1Q6QA 3MWAA 2C3ZA 1TPDA 1JCYA 5K9CA 1A50A 4M6QA 4ADUA 1XBZA 3UY7A 3PG9A 1VLWA 2BSLA 4TMCA 2G5WA 4CCDA 4LVFA 3LV5A 5A5WA 4Y8FA 3HGOA 3TH6A 5CPLA 4IJBA 4LVAA 4MY1A 4K38A 3VCRA 3N3MA 1KM6A 3O6DA 2GVGA 2B7OA 4JTTA 2TMDA 4R34A 3GDLA 3W7RA 2ZRYA 3L0KA 4HHPA 5G2WA 4I7WA 2NWRA 3MBFA 1OFEA 2DZVA 4AMAA 2DZSA 2CW6A 2YR1A 3PSWA 3UZJA 2BXVA 3HGJA 1PCKA 3QMTA 5K2ZA 3KRSA 3BG5A 3DHDA 1VQTA 5LNSA 4OU1A 4LW7A 3A21A 5DLCA 2YW4A 1EA0A 3DKJA 4E2BA 4JYDA 3W1AA 3MI6A 3G1HA 3P7YA 2HS6A 3HMJG 4YXGA 1XBXA 1TIMA 4U4MA 4P61A 4I9AA 3DZ1A 1KBIA 3LRMA 3N19B 2Z2UA 2J9YA 8TIMA 3W3OA 3DFNA 3EXRA 4YWIA 3IIZA 4CCCA 1VYRA 2GOUA 4X2RA 3CHVA 4O28A 3NG3A 1CI1A 3W7JA 3B4UA 4JYEA 2H3BA 2TSYA 5K9XA 3W73A 2G96A 3KOFA 4O12A 1HO4A 3RMJA 3F4WA 3L5MA 1JCNA 4GNJA 5AB3A 4IX0A 2P0OA 4IMGA 1KM1A 3ABQA 2BX7A 2ZZ6A 1W3TA 4AWTA 2PE4A 5HR7A 5CZJA 5GVJA 4AEOA 1Q6RA 4A2RA 3HPZA 3NQ6A 4QQ3A 2GVLA 3NL3A 1ZFJA 3OIXA 2NLIA 4FX8A 1H7XA 3W2KA 2A7RA 1AW2A 4UR7A 1H51A 3WFAA 3PBUA 3ELFA 2X1TA 4HPXA 4JX4A 1IF2A 4BI5A 1LOSA 4N4QA 4Q32A 3SI9A 4AXKA 4O0KA 4UC5A 4XTDA 4QM1A 1W31A 4DF0A 2JKAA 3NL6A 4GUGA 2ABBA 2B7PA 1HFBA 2ZA2A 3B8DA 3W7CA 1TTJA 4Y6GA 1C29A 3STEA 3KRZA 2QJGA 1EEPA 2ABAA 3M7WA 4TO8A 5AYZA 4AWSA 4N9BA 2FPYA 3TMLA 1S3HA 2C16A 4JY9A 1B4KA 2NXIA 5DN1A 5KMYA 3W1XA 3CT7A 1V7YA 2RHGA 3W7PA 1GG1A 4ORIA 4O0ZA 4FB7A 3W1QA 1QPRA 3LTSA 1W3NA 4A21A 3W88A 1SZGA 1W8SA 4MPQA 1GTHA 4JTJA 3H55A 1UUMA 3LX9A 2C18A 5CG7A 1WXJA 3O63A 5BRBA 2QCDA 1WDWA 3PSVA 2EPHA 1QWGA 1S5WA 1SSDA 1EP1A 3I7RA 2NUYA 4NJKA 1GPWA 1KV5A 2Y61A 3IRDA 3CIWA 1G7VA 3QW3A 5DBTA 1YPFA 4TIMA 1GWJA 3THQA 1JUEA 4M7TA 1KFJA 3LXBA 4AAJA 4LRTA 4UUIA 2GJLA 1NFBA 4DPQA 1GVSA 1XFBA 2Z0IA 4CNPA 1F74A 1DQXA 1W1ZA 1TCDA 2VFIA 5HINA 5U7SA 1XBYA 5KZEA 3EKZA 3AJXA 3B0PA 2NV2A 4BWLA 2ALDA 3FIGA 3PVFA 1PVNA 2YDAA 3FKKA 3TE9A 2VFDA 4JTEA 2ISWA 2A85A 3LTYA 3QYQA 3SECA 3TUUA 4GJ1A 3CC1A 5FF3A 2RDUA 3O06A 5HWMA 4L4MA 2ATMA 3LCGA 3V75A 4A2SA 2ISVA 3NDOA 3P62A 4DO4A 2CZFA 1JCXA 1GT8A 2X1UA 2PRLA 3FLUA 5CZSA 1W0MA 3S1UA 3BG9A 4L4LA 3BARA 5D38A 5G4EA 5KTLA 4G1KA 1HG3A 1ICPA 3DHFA 4O10A 1X6UA 5DCEA 5F4SA 5FEXA 3GDKA 4WJEA 5K9DA 1EP2A 2ZQ0A 3L0NA 1F7BA 1NEYA 1JUKA 4OE7A 4UNLA 2FFCA 3I7SA 3NM3A 3OG3A 4ADTA 3TXVA 1W54A 1ZCOA 2ZZ4A 3S42A 3LOTA 4XTIA 2HS8A 1KFBA 3QZEA 3MP5A 3L0GA 1H7OA 4IMEA 3T55A 1H7RA 3B0VC 1AG1O 1FY6A 1KM0A 1I8JA 2PCQA 1QNVA 3A22A 4FXRA 3STCA 1DBTA 4JYFA 3EXTA 1E51A 3LTPA 2VFFA 1F05A 3T40A 3TV8A
chains in the Genus database with same CATH superfamily
1US3A 1V79A 4H6RA 1RY0A 1EJRC 1E1FA 3N2CA 2CLHA 4NX0A 3SCSA 4J28A 2QCDB 1PHQA 2WBKA 4HJFA 2EJAA 1PTDA 1K8XA 1UQYA 1MEIA 1AZ2A 1YXYA 1EC7A 3T2OA 3KVLA 4X0VA 3LCIA 1QW9A 4WSKA 2EKCA 1VIZA 4XB3A 3TSBA 4FF5A 5C9WA 3QVQA 3N14A 4XZWA 5D2XA 1G4SA 2J24A 5D02A 3P93A 4HNUA 1I2RA 2D3LA 1I0DA 4LCSA 2HBXA 1YX1A 5CPSA 4J40A 3CZJA 3C2EA 4R85A 1S39A 2OVLA 3B40A 4J3TA 2Z29A 2CLMA 1YDNA 2XSXA 3EOOA 3LSCA 4CCZA 2CLPA 2DT2A 3CL7A 4H6EA 3UGVA 1HJVA 1XIBA 1TJ2A 3CL6A 1MZRA 2AQVA 9RUBA 3VUSA 3B03A 1DHPA 1VHCA 2R8WA 3IV8A 1KM2A 3UF9A 4TTGA 4JX5A 3N6HA 1XYFA 1B57A 2C6QA 2WO5A 1KW1A 2VO5A 3TTEA 3F5JA 4HK7A 2PZ0A 5C2GA 4GYFA 2Y6ZA 3SB0A 4NX5A 3OBKA 4HNLA 2OZTA 4B3LA 2CNCA 3WY1A 2PC4A 3S1VA 3NYZA 2CEQA 1P43A 5SWUA 3FV9A 1M7OA 4QGCA 3U4AA 2XGIA 2FDSA 3B9AA 3SCWA 2CC0A 4H9ZA 4B9ZA 4C7FA 1F9CA 1RVGA 4PMRA 1NWUA 4NZ3A 1XX1A 2CHNA 4PULA 2PCEA 5AECA 3V35A 4NJIA 4B91A 3DC8A 3N13A 4NNBA 3CM4A 3EDJA 3DYPA 1F3EA 5E93A 3H12A 1R38A 4O13A 1TREA 1AH4A 5HULA 2QVHA 3S6TA 1RVKA 2ACQA 5JUVA 3IV3A 3B9EA 1RCOB 4DO5A 1XYZA 1HZYA 4Q7BA 2RH9A 3OA3A 3R5EA 3L5AA 1R7AA 2ZX8A 4EPKA 1J4EA 4JFWA 3WDRA 4UMAA 1FXPA 4ZOBA 2EO7A 1O68A 2B7QA 1VPXA 3CJPA 1R7OA 3V5FA 5F2LA 4S39A 1VJSA 3I6EA 4GC4A 2YXXA 4H7CA 4I3GA 1W1YA 5EPDA 1XS2A 5GPRA 3PNZA 1TWWA 4GH1A 1LOQA 3ARVA 3RILA 3RJXA 3U6WA 2QJIA 3IGHX 3GDTA 1YADA 1XIHA 4BZYA 2CIPA 4ZENA 3UCQA 1VBJA 3WLKX 3WBYA 4ZR8A 5A6KA 1Z69A 3ANVA 4XAPA 1DJNA 3O6CA 5C54A 2JBMA 3SN4A 5CC5A 1YBQB 3EDDA 3CQHA 2PGWA 4L64A 4BWLC 3CV7A 1BF2A 2JQXA 2YL9A 3H2EA 1QHOA 2ZZ3A 3E49A 1K9FA 1XLGA 4ENLA 2ZXBA 4X60A 5CPMA 1R2SA 4JXCA 2CITA 3T4CA 1H4PA 4IGHA 3IVSA 3W23A 4JY8A 3CMGA 1J0IA 2BV9A 2A0NA 1WUFA 5HQLA 4RPQA 1G1YA 3DFTA 4E3TA 1Z42A 4MG4A 1Z32X 1IIHA 3L12A 3O0KA 1W9DM 3ZVIA 4Z17A 2H9AB 2XFYA 3GQYA 1E40A 4A35A 3OQEA 1GVFA 1JYWA 3NM1A 1IT8A 3PUEA 3CEUA 4PUUA 3KL0A 2QCLA 2VZUA 1I2OA 2CKRA 4XWUA 4L7ZA 4E6MA 1ZQ5A 3WK0A 3HPSA 3CB8A 2WSKA 4UFKA 4MKSA 1QO5A 2OLHA 4OWGA 4BK9A 2ZVIA 4JAWA 1TKKA 3M7SA 1T8QA 2OKOA 2UZ9A 2V5DA 2Z2AA 4J7RA 3DG3A 4LTSA 1V51A 5HK4A 1R85A 3M07A 3U2OA 3KL3A 3OHMB 4FPSA 5A6BA 4C6QA 1A5LC 5EB8A 4LAUA 1ELSA 3E96A 3W1PA 4EAMA 1JRBA 1FHVA 1XLDA 2FGZA 3N15A 1N55A 4N9EA 2JEPA 3L68A 3LHVA 3NQ8A 3TIMA 3L9CA 1SVDA 1UROA 3LLDA 4QBXA 1H5VA 3UPWA 1GJPA 4F9JA 1XC6A 4NJHA 5FF0A 4I9MA 4AZ7A 4L1GA 4CU8A 4AIBA 2VVNA 4WUIA 1XSJA 4Q22A 5B80A 4CEUC 4AZ5A 2P1FA 2Y0FA 4ZQMA 3VI2A 4GCAA 1A5OC 1OFAA 1ZHAA 5IBXC 1PJ9A 2Z25A 3LRLA 5CH9A 3GKFA 1UMLA 1E70M 2PS2A 3DH7A 2UY2A 4L9ZA 1RA0A 4JTQA 3BGAA 3S6OA 3QYSA 1QOQA 1T5AA 3VABA 1NY1A 3N34A 4WKFA 3W22A 4GQBA 2YA0A 4XZLX 2INEA 1BHGA 1SW3A 3QHNA 2BLEA 2I16A 1OYBA 2JK2A 5J04A 4J2MA 5K4XA 1IEIA 2RGLA 2VZVA 3ZVHA 1RBOB 1I0BA 4JIIX 3VIFA 3LBOA 1E4IA 3U5YA 4NI8A 4GLEA 4LNCA 2KZHA 2WC7A 3EA3A 2QGYA 4JN8A 3C8FA 4LPCA 1DOSA 3T2PA 1H2JA 4LVGA 2HTMA 3VINA 3WN6A 5FI8A 2B4GA 3O15A 3EKLA 3PR2A 2CHOA 4PMYA 1XFCA 4AWEA 3OBEA 2YZ5A 4LXFA 4AFYA 2O92A 3VGEA 4DNMA 3WUBA 1PWMA 4W8AA 4MNJA 1ISXA 5F4XA 4GMEA 2QCGA 4UB9A 1W9BM 2IPFA 3KTSA 2QCNA 1K6AA 2Z7KA 4Q4RA 1MDRA 2O4QA 5LSMA 1D7FA 4QNEA 4XD4A 3M5XA 4BKNA 1OX4B 3RPMA 2V30A 2EG8A 1HJQA 1KRAC 3OVPA 1NDYA 4YS1A 1R5YA 4O1AA 5GJNA 5T9BG 1U1HA 3ZJ8A 3R11A 2PTXA 1PZ2A 1TPB1 1YXDA 5J5RA 1A5BA 2J79A 2YCLA 3G77A 3S1WA 5AHEA 5BOEA 1L2UA 2G0WA 5C55A 3L2MA 4ZFCA 3ZMRA 3P3BA 3ERPA 4UFIA 1G4TA 3KVJA 4KBXA 1BD0A 1EX5A 4NG3A 1A4LA 4PA8A 2Z26A 4BHYA 3WZ0E 1WXZA 2XIOA 3IJ6A 2A3BA 1KBBA 2E9MA 3IVUA 5AHIA 4YMZA 4ZB5A 4ZQOA 2FPVA 3UXAA 1JDCA 5LNUA 4V33A 2OCZA 2R94A 4L61A 3SQLA 1O12A 3BJTA 4IP5A 2VELA 1RSCA 1K4GA 3HO8A 4R7JA 2EJ1A 4MB4A 3VD9A 1UIOA 1TQXA 2VR5A 3T42A 1F76A 3QJAA 1JG9A 4GUJA 1K02A 1GQLA 5CQ1A 1U5HA 3GXPA 3RU6A 3WELA 3GXTA 1R30A 1NARA 3W87A 3JS3A 1K1DA 4JTUA 2WVVB 4HMCA 4QP0A 3SN1A 4Y9MA 1FHLA 3BH4A 4WDWA 4GY1A 2Q71A 3NJ3A 3L4UA 4Z1AA 3RJYA 1C7SA 2CBVA 3C61A 4S3CA 1D8CA 3B8SA 3G24A 3C52A 4RV3A 4RZBA 1S2VA 1SR0A 3I6RA 4PUNA 3PZMA 3IACA 2BVWA 3P5YA 1VYSX 4LWWA 3MKVA 3VU2A 4ZODA 3CQ0A 5A8OA 4YTUA 4DJDC 2VM8A 3I7QA 1K6WA 4DUWA 2QDGA 2VGGA 1I1XA 3CUZA 5IM51 4GY0A 1XIIA 3RLUA 5IDIA 2P10A 2XFFA 2PGRA 5HAOA 2ZZ7A 3CASA 5FJIA 4FALA 2Y7GA 1YLVA 5IOBA 3KOXA 5FJTA 4H9MA 3TNOA 3ZSSA 2EBNA 3FOKA 1GUVA 1LLZA 5H8UA 4N4PA 1HXJA 2DSWA 4DF2A 2FHFA 3LPFA 2ZBTA 4LOCA 1M04A 4YCPA 1O4UA 3WLQA 4MSSA 1QW7A 5D2TA 3W2JA 3WX7A 2XTKA 3WQPA 3PWGA 3MMTA 3ENLA 2AOSA 2G97A 1VPYA 1ZBWA 2QIWA 2IPGA 4IQLA 4AHQA 3LCLA 1ZENA 3GNPA 4NAFB 4CQBA 3RRXA 6TAAA 5HQEA 2J74A 3M0IA 4LT9A 3BC9A 4DBDA 5E9XA 1OFPA 3A6OA 4HU0A 3W85A 1BYAA 1XG4A 3U2CA 3L2IA 5FD0A 1XF0A 3VA8A 3QF0A 4GISA 3E02A 2QKFA 1UPMB 3M5YA 3O05A 4MWAD 2F38A 2YL6A 4NASA 5CSRA 3L4WA 2O9OA 3BQ5A 1GOIA 1XCWA 3ZT6A 4D6CA 2P3ZA 4LY8A 1B9ZA 1UASA 4CD6A 2QDDA 1EEXA 2G4JA 4JTLA 1NVMA 5AHNA 3W6MA 5I00A 2BHZA 2Q3OA 1GZGA 2OODA 2FGLA 3WLLA 3M0HA 1UH3A 1KM3A 4P8XA 4LUTA 3UNDA 4H01A 3ARQA 3T44A 5EU9A 3XIMA 3M0VA 5C9UA 4C7DA 4HSNA 3DESA 4WKHA 3FCPA 3ID7A 4M5PA 1R3VA 3FDKA 1PB0A 4DM1A 3N17A 4WXYA 1TR1A 4IZGA 2VRJA 3WUEA 1UP3A 4DYKA 1KWGA 4ZMGA 3S9YA 4M3PA 4PCPA 3BW3A 4FHAA 3S1XA 1J2BA 3TQVA 3A24A 4GYPA 1TPUA 3C3UA 1IT0A 7PTDA 3AXIA 3VPLA 1POJA 1J01A 4IGNA 4YVPA 3WG6A 4CU7A 2VEGA 3TK7A 1S2WA 4JTKA 3DEQA 2I14A 3FA5A 1XG3A 1ZP3A 3I68A 1A5CA 5TAOA 2PU0A 3AJ7A 2AQWA 4I6KA 4M24A 1SFJA 2HK1A 5CZ0A 4IG2B 1TPVA 1XRVA 1T0OA 3A4JA 2EPKX 1XYMA 1E1CA 3KCLA 3T78A 4ATLA 4TVCA 5LGZA 1BKSA 3ANYA 1UZDA 4OQVA 4B4FA 3L5LA 1L6YA 1JXJA 1VH7A 1TRIA 1OFQA 2EXOA 5T26A 4C1KA 1V3KA 1OCBA 3FHAA 2FPTA 4K8GA 3GTXA 4DPPA 1CECA 3YPIA 1F3TA 2PDLA 3CHDA 4FXSA 4QX4A 4K36A 1POKA 1LM1A 5K7JA 1KQZA 1JRCA 3VOGA 2BODX 3E3HA 3QMSA 3ITVA 2VRQA 4O1EA 1B3ZA 3NQCA 4JFTA 5FCZA 2X0YA 3ABSA 1JFXA 5CAKA 1B9BA 4O0QA 4AY1A 3UD6A 4Y96A 3GAKA 3RNDA 5M5DA 3AICA 4GJIA 4CQDA 1PPIA 1PYMA 4HYWA 5IDZA 2HVNA 4XQ6A 3CHEA 2CLIA 1M6JA 1P6CA 4PMJA 3SR7A 3W02A 3VFCA 4UTIA 3QPZA 4RUBA 1FQ0A 4K8HA 3WD4A 3CB3A 4PMXA 3O16A 1KRCC 3HJZA 1C8XA 4HHLA 3GKAA 3W7IA 5BU6A 3QY6A 1E6SM 4QFUA 1XGEA 3WMSA 5D2WA 3USBA 3MUAA 2WM1A 1XDJA 3P60A 3B4YA 2BG5A 5TD4A 1SZRA 3WQOA 4N02A 3SRFA 1P1MA 3CT2A 2YFNA 4ECLA 4DJFD 1YRRA 3IJDA 3VIJA 2YJQA 4FLQA 1U33A 4D6HA 2DZBA 3EOUA 1B4EA 3E12A 4RLIA 3DYMA 3W2UA 1U30A 3NQVA 2DIEA 3IUDA 1X1OA 3E1F1 2R6OA 1P1XA 1T7LA 1CX9A 1AJZA 1UWIA 3QOKA 4W87A 2ICSA 1MW3A 2E28A 4QITA 2YA1A 5TNVA 3R2GA 3HPAA 2PFHA 1OCQA 5DMMA 1ZBCA 2XWDA 3K1DA 1IZKA 4CLMA 3ABXA 1UKSA 1PCWA 3HF3A 2DIKA 2ZUNA 1OG6A 3EKGA 3NQMA 4PCSA 4MPKA 1ADOA 2DZAA 2P3EA 1YTKA 3B97A 3DFOA 4NNCA 4PN2A 3TAKA 4M56A 5D04C 3V36A 3TJXA 3GTFA 2WV8A 1N8FA 5CBBA 4AD1A 3UZ5A 3LA4A 5D2YA 3WQCA 2DORA 1ZJBA 7CGTA 2E5CA 3MANA 3WQ6A 4E2DA 3W1TA 4JTCA 4HK6A 3IIVA 4LV9A 1AQFA 2J4GA 3I6TA 4JKMA 4IT1A 4DB7A 5BNKA 3AMDA 5A8PA 4FNTA 3O9NA 4LRSA 1QI5A 3ES7A 4XZHA 3CLWA 1E55A 4H83A 4EAYA 1VHNA 1AD4A 4D72A 3UPMA 4ZFMA 4M82A 7ENLA 2DVXA 1EJXC 1VCGA 3AZRA 5AC7A 1YXCA 1H7WA 2X0HA 4XBJA 3HGSA 1W56A 4GWEA 3KP0A 4AWUA 2WCAA 1R2TA 5CZTA 2ZRZA 2FZDA 1NWSA 2GUUA 3BCDA 5F2MA 2IQTA 4FNSA 3WDQA 4ATDA 3DN5A 3E5PA 2XFWA 3GVQA 1VEPA 3Q45A 2YA2A 4UFHA 3C0SA 5BZAA 4S3DA 3IJ7A 2Q3RA 1L6SA 1JDFA 5FF7A 1FH9A 4NXKA 7REQB 1S38A 3MI2A 3GG7A 2ZWYA 1UB3A 4QSHA 7TIMA 3FYYA 1Q6OA 3R13A 4NAEB 5F2IA 1WOAA 4X9YA 4KRTA 2ATSA 3C2FA 1RHCA 3PZIA 4MADA 3VTRA 1RCQA 3ORWA 4GY7A 3PZ9A 4EVZA 4RNHA 3WUGA 1AQHA 3SUUA 4JOMA 1C9DA 1L2QA 1M03A 1NSJA 3GSMA 1EKOA 1XISA 4MZ8A 1E9IA 1XIJA 4J1OA 2AGTA 3R4IA 4Q8VA 1E4LA 4FXFA 2WMGA 2C1IA 4UOJA 4D6IA 1V02A 3VDAA 3C2OA 5I2UA 2CLLA 1JQVA 1OQFA 3VX1A 3VIIA 3C2YA 2YYUA 5T9CE 3S5OA 4OKDA 2PP0A 3TYCA 1UR4A 3I4EA 1JDDA 3NSNA 4R33A 3V0SA 4PCFA 4AVFA 3VD7A 4FIRA 2O56A 2EPNA 4LEFA 3FEMA 5TBOA 1IXNA 1U2YA 4GGHA 1ML1A 4J3VA 1VLIA 1WXYA 3SSZA 1HJSA 1L8NA 3GH5A 3USZA 2YGYA 3THUA 3OVQA 4I5UA 3PPGA 4YTTA 1MXDA 3GNOA 3DHUA 1E3ZA 3PFMA 1SJCA 5AVHA 3GIYA 4YCOA 3EBVA 8RUCA 4DIAA 2PI6A 2R1LA 4MB5A 1FBAA 1MRQA 2J8TA 3QGKC 3T0AA 5A2AA 5D37A 1Q2RA 2OZ3A 1LQ2A 1FDJA 3PTKA 1XIEA 2QUUA 3ZIZA 3UT0A 3VNLA 1AD1A 4JHMA 1F8MA 1RXOB 2RDTA 3TJ4A 1QT1A 1V6VA 4P8WA 3TW7A 3GU9A 3PK7A 9XIMA 4JHZA 3LDVA 1EB3A 3GR7A 3RN6A 3XINA 1HL8A 2A3EA 2ZRWA 4XV0A 4YTSA 3U8GA 3W07A 3WK3A 3VC6A 2PDKA 3R0DA 4V1XA 3PANA 3M64A 4A8RA 1MWOA 1SZEA 1RY8A 4Q8TA 1A5NC 2FH6A 3VM5A 3SFKA 1Z7AA 3GHSA 1EA9C 4UNIA 5DO8A 3EB2A 1W91A 1XDLA 2V3GA 4LS0A 4YWSA 6TIMA 1TE1A 3SCTA 4IFKB 4FNQA 1OF6A 2AL2A 2FDMA 3F03K 4RE2A 1KTNA 2QJNA 3R8RA 4RV8A 2QS8A 1SUXA 3TW6A 4CNNA 2GGEA 1NFPA 4HK5A 1GORA 3SY5A 1LYXA 1OZMA 4LY4A 2FMOA 3EB3A 2ZTKA 1K7FA 4OGZA 1TELA 3M9YA 3BXWA 1B0IA 4JNMA 3A4XA 2ZICA 1MW1A 3VFLA 1F2JA 3RF9A 3SEPA 4LUIA 4RZ4A 3INPA 2ZX5A 3DU0A 8XIAA 3F2BA 3U2EA 1W17A 3ZM8A 4MZYA 1GOQA 3DBPA 4P8VA 3LBMA 5E9AA 3VC5A 1EJWC 5I5RA 2Y5JA 3WL0A 3PWIA 4PUEA 4A3UA 1GOKA 3AYSA 2VFGA 1DXIA 4C6DA 2X7WA 1XPYA 3K8MA 3DFPA 3AALA 1LLWA 1EHNA 2CWNA 1F8IA 3H21A 2W3ZA 4ACYA 2C0AA 4LUJA 1LJYA 1UZ1A 5GJMA 3H7VA 3VDGA 1DXEA 3N73A 5PTDA 4S2CA 4GQ0A 1IHIA 3N3TA 2PDGA 2FB2A 2W5FA 3WLMA 3GXIA 1MUMA 2Z1VA 1Q6GA 4W7VA 1DV7A 5HUPA 2OQLA 2V67A 3W7LA 2FKPA 5D9OA 2Y8KA 1X38A 3HIJA 1UCWA 4JTAA 1JGMA 1ITCA 2XG9A 4ZO7A 4HMEA 3BLIA 2PLMA 1M7XA 1SFTA 4ILSA 1UIPA 5AZ1A 3LHWA 2CPUA 3NEHA 4A29A 4AD5A 4HOXA 1G67A 3UCDA 2IQ0A 5FAJA 2NT0A 2ZUTA 5BWAA 4V15A 4M0XA 4UQCA 3N04A 4KS0A 3HGOA 2RJHA 4HA1A 4K38A 3VIGA 5HXMA 2VP8A 2FZ8A 4ACZA 4AYSA 1N8WA 1XLMA 3LNPA 3L0KA 1W9XA 4IF2A 1M9HA 5FL0A 2NWRA 3COTA 1M53A 4DO7A 3MBFA 4Q4OA 2YR1A 4YTQA 2BXVA 4ZTYA 6CGTA 3QMTA 5K2ZA 1YNYA 3EPOA 4OU1A 3GW3A 3KCJA 4E2VA 1Y65A 3C0LA 4LW7A 4KWUA 5DLCA 4L6DA 3OLIA 3B0YA 3GTIA 4PSPA 1ZSXA 2HS6A 1UD5A 4YXGA 1XBXA 3VIOA 2NQJA 3S2NA 2Z1XA 2J25A 4GYJA 3FVMA 4I9AA 3ITTA 3DZ1A 3LRMA 3W3OA 4M1BA 3DFNA 3A3WA 3EXRA 3IIZA 1VYRA 4Y9NA 1FWJC 3CHVA 3UJ2A 5ECVA 1CI1A 1KB3A 4HOWA 3I3BA 2G96A 3KOFA 1E0TA 3BMWA 4O12A 4DRSA 3F4WA 2VWSA 2BHYA 2GJPA 1JCNA 1ZS2A 1BVNP 1WDSA 4L4PA 1KM1A 3ABQA 4KRZA 4AW7A 1XLFA 1W3TA 3EDEA 4AWTA 4B2DD 2C71A 4XIAA 2VEFA 4HBKA 1ZFJA 4S3AA 2GSJA 3E38A 1H7XA 3W2KA 1M3UA 1JNDA 4XSMA 3WF1A 5DMLA 1H51A 2FVMA 1XRSA 3W28A 3HV8A 4HPXA 2DSUA 5HDRA 1V8EA 2NQZA 3BJFA 4O0KA 2ZVRA 4XTDA 4QM1A 1W31A 2Z4GA 1QNQA 1CXKA 4RNFA 2D0GA 3PZNA 4V28A 2VTFA 3W7CA 3H2OA 5BXRA 3T9PA 4OFCA 3TN6A 5D9PA 1MNSA 5EMJA 4B92A 1HNYA 4L1WA 2G37A 1HVXA 3WFZA 2XH7A 3EOEA 2WMFA 5A6JA 1Y5XA 3MV01 4JY9A 1B4KA 2NXIA 3GRIA 1CGYA 3VGGA 1S1RA 1GG1A 3ZO9A 3IAQA 2DPEA 4OUEA 4OOUA 1W3NA 3CUHA 4KIRA 1HKVA 5CGTA 2ZXDA 3LX9A 2C18A 3OIHA 3ICJA 4JFUA 1JGIA 5CG7A 1WXJA 5BRBA 3ZZ1A 2YLLA 4KT2A 3PSVA 4ZO8A 3WLHA 1DJIA 4AZ6A 5B7YA 4NJKA 3KLLA 4I5XA 4AUBA 3QY7A 3CIWA 4UOZA 2X8RA 1ZB5A 2JALA 5DBTA 1KFJA 3LXBA 3KP1A 3S2MA 3T8LA 1F74A 3R58A 2VFIA 1XBYA 5KZEA 5BYWA 2XIIA 4AZIA 2ALDA 3FKKA 2YDAA 4MWAA 3B8TA 2VFDA 1PXGA 2A85A 1EQCA 4A3RA 3BLLA 1ISYA 4KH2A 3CIVA 1JPKA 1VFHA 3CC1A 2XPKA 1PZ3A 1E56A 2ATMA 3LCGA 4DO4A 1JCXA 2QF8A 1GT8A 4UR9A 2PP1A 2PRLA 3ITGA 5H8MA 1W0MA 2PB1A 4L4LA 5G4EA 4O10A 1X6UA 5DCEA 4D8LA 2C1GA 1RPKA 1F7BA 3N4FA 2WVTA 1W1TA 4OE7A 2FFCA 1E5JA 3OZOA 4EX4A 1MYRA 2DVTA 1KFBA 3NURA 1KM0A 1QNVA 3A22A 4UBPC 1V0KA 4E8DA 1DWHM 1E51A 3LTPA 2VFFA 3V0UA 4K1WA 3AYVA 1M65A 2R82A 1W2PA 1OFBA 3TTSA 2PLCA 1JZ5A 3GZAA 3ITCA 4PMZA 3GYEA 1W32A 5EL1A 3EX4A 3K8LA 3VIPA 4PODA 3W83A 3UYIA 3UJRA 3RFAA 3PM6A 4DN1A 4JZ5A 2V2CA 1NM9A 3MI3A 4D71A 5G1MA 2XIJA 1XDMA 4RCXA 2EHHA 4JCMA 1VJIA 3PULA 4LGXA 5CPNA 2Q02A 2PC8A 3M0YA 3VD4A 1W37A 4EANA 2DW7A 1V5XA 1VBGA 1HGWA 4G7FA 3H26A 3Q2DA 3O07A 3NPXA 1ZJHA 5C6MA 3E5BA 4RW5A 5K3VA 3LQGA 1F3WA 4XVDA 3NWRA 2BFGA 5AKQA 4EWND 3UG3A 4H1ZA 5HUOA 3KHDA 4U33A 4BQ3A 5HJYA 1L8PA 1LUCA 2A7PA 2J27A 4R7WA 3VGBA 3WF0A 1JR1A 3HBLA 3VIMA 2AQOA 2CLKA 5JIPA 2CZEA 3QC3A 2DJXA 1XLEA 4GZJA 4RZ5A 1WBHA 3U57A 3ARPA 2E6FA 2G41A 5JXQA 5D2VA 4IUOA 3ALGA 3CQKA 3M0JA 3SURA 4QJ3B 3UZWA 1WP6A 1RCXB 3ARYA 1KKRA 2A1YA 4HA3A 1WKYA 1CTNA 3MZNA 3AS3A 2DZXA 1TV5A 4BA0A 4Q6XA 1B1YA 1P48A 2VDGA 2A3HA 4C7GA 1TO3A 4G9PA 3Q58A 4EKJA 5G1YA 3KLKA 4DBUA 2OWCA 1TX0A 4MFDA 2BXZA 1MZHA 3BLDA 3GH4A 5BOOA 1OGGA 1LL4A 1NH6A 4DJFA 4HB7A 1UJPA 4F2UA 2DIJA 2YDQA 4QG8A 4UR8A 1BTCA 2OT0A 4WY0F 4HMDA 3H8AA 3VK5A 4L9XA 1OT1A 3DBNA 4KFPA 3CAWA 2EPOA 2VEMA 4RDYA 3G1VA 1VPQA 3F2DA 3MHGA 5HNNA 4AXNA 2GLKA 1B54A 3TEVA 3WF2A 4CD4A 5XINA 4A22A 1NTHA 1R3YA 2NV1A 1C8QA 2ACRA 3V3WA 2QIIA 4X2PA 2XZ9A 1YDVA 2VX4A 3CWNA 2PF8A 4I8DA 1E6QM 1SYTA 1OB0A 3SY1A 1UBSA 5HBFA 2DZTA 3MQTA 3NZGA 2XHYA 5CLTA 3MS8A 5BRQA 4HPJA 2ZRVA 1GJWA 2V5JA 2QULA 3P82A 3RLGA 3SCOA 4TR9A 3L7RA 3DDMA 2FFIA 3CS2A 4C1LA 3TQKA 1MUWA 2Z1SA 2D3NA 2WK2A 2J78A 1OEPA 3RHGA 3SDOA 4LC8A 2PDBA 2FZNA 2HRWA 4JTGA 4M8UA 1JZ3A 4Q4SA 1DWIM 4RNIA 3MA8A 4H8UA 2DT0A 2YBTA 3N2MA 4WGHA 1ITXA 2INFA 4S3GA 4AX6A 1P0KA 2VEKA 1Q8AA 3RK8A 2YYTA 5ABFB 4UNKA 2H3DA 2G3JA 4DAFA 2BGQA 2B7NA 1WDQA 5CGQA 1W9VA 3Q37A 4MIMA 1QWKA 1UPPA 3P2VA 2WOQA 4WJ8A 1A5MC 5CZKA 1UWAA 1RALA 2VGFA 4YIWA 3ATYA 2C14A 3NQAA 2FLIA 2OSWA 1Z48A 1L0PA 5CPQA 3DENA 4YLWA 1CGUA 2E8ZA 4XKMA 5MKGA 2NVDA 3AHVA 8XIMA 4WXZA 3DX5A 2HROA 1TPC1 3WH8A 2WMIA 4U5KA 1OWQA 2C19A 4NQ1A 4QHRA 1QFEA 5HA7A 3S6DA 1YE6A 2HWGA 3AHZA 3LUTA 3XISA 2CXGA 4WQ6A 3B04A 2E5DA 4KWOA 1XD0A 4P8UA 2R9RA 3L4YA 3DERA 3CV2A 3M47A 4DZAA 3EX3A 3VNDA 1PO9A 1UKTA 1MRAA 2KX9A 3UZZA 1Q66A 1EXPA 1FDYA 2GJRA 3DHPA 1AJ0A 1KTBA 5H2ZA 3AU6A 2WHJA 1XWYA 1CGVA 2PDMA 3BL3A 3RPDA 1KFKA 4U10A 2HXTA 3U9IA 3NVDA 3OBAA 3CAQA 3DI0A 1JNEA 3R0UA 3ISIX 3TDFA 1MI3A 2X0SA 4PH6A 1F61A 3OTRA 4GYKA 4UQAA 4IIBA 1BYCA 2V5KA 3GZ3A 3GYCA 3HG3A 2CLOA 2J9XA 1THFD 3P5ZA 3N2XA 2O9RA 4C6KA 1DKWA 3MBDA 5EBUA 3UZYA 3VGHA 1DXFA 4UCFA 2WLYA 2EQDA 4B5WA 1SSGA 1TPFA 1JYVA 4B16A 3FJLA 1MVYA 4QS6A 3MU7A 4I90A 3BCFA 3WLOA 4WY0A 2YW3A 1OJXA 1JYXA 4HZ8A 4FO4A 2PF0A 2WQDA 2VR4A 1DJXA 1FH7A 4HTYA 5HPCA 4CQ9A 4K37A 1B3WA 1XLCA 2IXVA 2Q8LA 4D8ZA 2YL8A 5IXEA 3CQIA 1QW8A 3MC5A 2WC4A 3TFCA 2PA6A 4ONVA 5EFDA 1ZGDA 4GC3A 2V82A 2XWEA 3CLMA 4C6NA 3FXGA 3W1UA 1ZAIA 1RBLA 1BEUA 3A3HA 4LU0A 2OWXA 4NU7A 4NRRA 2ZZ2A 3W2NA 3G3MA 1A53A 1EOKA 2BS9A 2I7GA 3C8NA 2HVMA 1O5QA 2NQLA 2QJJA 2FH8A 1KTCA 4R7OA 3R10A 2ZADA 3SIZA 1LRTA 3SJ3A 3UQNA 4BF9A 4IIDA 3IK4A 2PU1A 4Y90A 1PE1A 2ESCA 3LCFA 1XHGA 2VNCA 1JF5A 2VR2A 5EGRA 4ZQRA 1JD9A 3WH9A 3N9KA 4PUJA 1VEMA 5CG0A 1MEHA 1OCJA 1GKQA 2NX1A 3IIPA 1SO5A 1DQUA 3JW7A 4C91A 4ZZ9A 4LBSA 1QRQA 3AS0A 2W9MA 3M0ZA 4UTKA 1Q6EA 3FYOA 1CLVA 1UG6A 4B3KA 1MQRA 3WEMA 4HN4A 2FTYA 1CCWB 3POHA 4DUOA 1UR3M 1UWRA 4UIOA 1UMYA 4LH8A 5H91A 2P76A 2QYGA 1SO4A 4IWWA 4BR1A 4X22A 2WPGA 1X97A 3HURA 3N9RA 4XZBA 5FKYA 3LI0A 1EDQA 4PBEA 1UWUA 4TQTA 4KQNA 3GDMA 1OIMA 3IGSA 3GXFA 4J3UA 2OLSA 4C5YA 3ARRA 1G6CA 3W86A 1WYIA 3ARWA 1W3LA 3BJSA 3SO7A 1ICSA 3BLFA 3M4HA 5ABGA 3L66A 3W38A 4TX6A 2XH0A 3PBVA 4XAFA 4HD5A 2V68A 3K46A 1R3WA 3TLQA 1ME7A 3ZQ9A 3O0FA 3RLHA 4FNUA 1RBAA 3LQLA 2WKGA 3GU2A 1K03A 3O3RA 1EYEA 2PD9A 2GWNA 4KWVA 3KOYA 3W27A 5CPTA 1W1PA 3MZ2A 4LCQA 2AAAA 3MMUA 4UTWA 4PEKA 1YMYA 1TMQA 4DZHA 4C6CA 2X30A 5EMUA 3K30A 2CWXA 3QRHA 3D46A 3KBVA 1FHDA 4G6CA 4FX6M 3BZJA 6ENLA 3UCCA 1IR1A 1VBRA 1WDPA 4O4WA 1A3XA 5CBIA 6PTDA 4UTHA 5H8PA 4PUKA 1X1ZA 1FWCC 5IHRA 4G7EA 1DQWA 2YDRA 1UUQA 3LGGA 2EG7A 2WHLA 4REQA 3ATZA 4US5D 2GK1A 3PBMA 1NQ6A 3PZVA 1EWEA 1CB2A 1OZQA 4MTVA 1TPH1 3EZ4A 4CNOA 1E15A 2ZDSA 1MW0A 2R1MA 1T96A 1JQXA 4HYRA 2QR6A 2EPMX 4ADSA 3CBWA 4B5NA 2UBPC 3V5CA 3GK0A 1VB9A 2QGHA 3MUXA 3UG5A 4AZGA 3GUWA 3EX2A 2OXNA 4J3XA 2INZA 2WB5A 4I7UA 5IRPA 3UY8A 4GOAA 1KXTA 2D0HA 4QJ1A 2PWFA 1I2PA 1NDZA 2P5NA 1Q4NX 4ERIA 3NQFA 4LQ1A 2YKKA 1PX8A 2YCEA 3EAUA 3TC6A 3T0TA 1UQZA 1EDGA 4Q4KA 3U3HA 2GWGA 3A12A 2MNRA 1E73M 5EA9A 3OJGA 2J7EA 3M0MA 3PJUA 4AVNA 3DUGA 1QASA 1YDOA 1LDCA 1Q85A 5HNUA 1XJBA 3N9SA 5A2CA 1S5VA 4YN5A 4GIRA 1H63A 1GTEA 1GOXA 1H1ZA 1PV8A 3KAOA 3WFLA 3K8KA 4GE8A 2GJXA 2QUNA 1KWKA 4AD0A 1ITUA 2X7VA 4RE3A 2YPIA 5EY5A 4JQAA 3U48A 3EWYA 4DQWA 2NX9A 5AHFA 2A4AA 2BMBA 4UXDA 5AYYA 1PEZA 4FF7A 3EDFA 2ZUSA 3HJEA 4HNNA 3CZEA 5CEWA 3DKLA 2V81A 3PNUA 3JZEA 3CZLA 2HBVA 4PMOA 3WBEA 5DBUA 2YX0A 4PMNA 1F07A 5AYIA 4GUIA 3G22A 5HMDA 1P5BA 3O2LA 3P0WA 1KCLA 3BV4A 1JCMP 3SGZA 1NAL1 4X3ZA 8CGTA 2E7FA 3TTOA 2A7NA 3CWHA 4A3HA 3B8UA 2JGYA 1LOLA 1YEYA 1A5SA 4N6FA 4MLRA 4QJ5B 2B0MA 3W6YA 2FGBA 3QSTA 4NXSA 4DUXA 2WWCA 3GB6A 2ZUMA 2VZOA 2J77A 4QLLA 1GHSA 5ECUA 2VYOA 4N7QA 1IYXA 4JDYA 3WIJA 1BRLA 1V6TA 2PWUA 4D6JA 4A8IA 3VNZA 3WNLA 2D2GA 3VCCA 1E0XA 4ZA0A 4U28A 1YE4A 2FZMA 3BOLA 4MNMA 4FXJA 3M0LA 1S1PA 1A4MA 4M6VA 3QV8A 3WDPP 1G4EA 4ZXOA 4KKXA 2BVYA 1GYLA 4NL1A 1F3XA 4O4VA 3UG8A 5DT7A 4H7VA 1UH4A 1MXGA 1RZMA 3WMBA 2Y24A 4I5RA 4U2YA 1KXVA 1TTIA 2XVPA 1J5TA 5I3IA 4JTFA 3H7RA 3HU7A 2Q09A 4R9XA 4KRUA 1KD0A 3CL8A 1SMDA 4G8TA 4E3VA 5D05A 4NZCA 4XD3A 4UTJA 3W24A 2ALRA 3M43A 1TWIA 4MB3A 2FZ9A 5AVNA 2C1HA 3NZRA 3BGGA 1K7EA 1PKYA 1C3FA 1Q6CA 1E6NA 4Z1CA 1FOBA 1JAKA 2BY2A 2DV0A 1B31A 3E2SA 3A5VA 4D1IA 1OCNA 1E6ZA 4DEFA 3AIBA 4ZE4A 3GNRA 4S2BA 2J75A 1BG4A 2D2JA 2ZCGA 1QNRA 5L6UA 4JNYA 4O50A 1V93A 3PB2A 2FJUB 2E9BA 1EWDA 4WX2A 1BQGA 2PDXA 2DZWA 4KPLA 1T40A 2ZTJA 3WJWA 4XIMA 5AFDA 4DBSA 4J3ZA 4OHQA 3L4XA 3EX6A 4QQUA 4DWSB 1XLIA 3BSMA 3RX2A 3WLJA 2H90A 7ODCA 3H2NA 2TAAA 2EF9A 3B8IA 4IOTA 3LXAA 3NXFA 3OGVA 2WC3A 1GYNA 2FMNA 3FAXA 2D69A 2NQ9A 3NQBA 2WSPA 4Q8NA 1DIKA 4MUZA 2DVUA 5FEPA 1G94A 4O16A 1EBHA 4EXBA 4DXXA 2PWGA 1MFUA 2PTWA 4H9TA 4L4OA 5GJPA 3WENA 2QV5A 3DFSA 4HKPA 3W9ZA 2IKJA 1TTPA 2A3CA 4Z1DA 3LM3A 3TVAA 4W86A 1PKNA 2NZLA 3IGXA 2DGAA 3NQGA 3OGRA 4R27A 4HNCA 5EKYA 5C71A 4ZTXA 3URNA 4HCHA 1XI3A 2ZA1A 1H7PA 3OB8A 4TXEA 3KDNA 5E70A 1US2A 4FMVA 2CFFA 3ES8A 4EXAA 3EWWA 1A0EA 1NF0A 1VRXA 2WQPA 1WBJA 3TFXA 4HHMA 2PWEA 5REQB 5EMMA 2RAGA 1RH9A 4WDTA 4NYYA 2WCGA 3ONCA 1Q3NA 1R3TA 1W1A1 3AUOA 3TAOA 2DSVA 3RR1A 1CW2A 1W6TA 3PAOA 5CSSA 2FB3A 2GVJA 4R88A 1S2CA 2J6XA 2O9PA 5F1UA 4HNOA 2ZYFA 3SFWA 3IVTA 5E5CA 4OECA 3MUCA 2OZ0A 3CPUA 3HOJA 2W67A 4K6AA 3T05A 2A2IA 4DJDD 1T41A 2XUCA 5LHEA 1BGAA 1EF2A 3W2MA 2XVKA 5KETA 3V4BA 4O18A 3W4RA 2PDJA 3SUVA 2Y63A 2Z7GA 3P6LA 3VO0A 2REQA 2PODA 4O19A 1FWAC 2GZXA 1UKPA 1EO7A 4PMDA 5CKSA 3P8JA 4DWSC 1QHPA 4XBKA 3MWCA 3GD6A 4FOJA 1IV8A 2QCHA 3WQWA 3LMYA 3BE7A 1PBGA 1JCTA 1HP5A 4DJEA 4WDXA 3ANUA 1VYPX 4MYXA 3VYLA 1PTGA 4C60A 2AMGA 4TVDA 1LBMA 1F6YA 3KTCA 1SR9A 2WZTA 2WNNA 2CBUA 2ZA3A 3KZSA 1K9TA 2QCEA 4ZXLA 3N6JA 1RQEA 2WM0A 3GTNA 2NUWA 2CHRA 2PBGA 3K4AA 4ICNA 1YIXA 4M29A 3BMVA 1U1UA 1UKQA 4XUYA 5HNRA 3G1AA 2OX4A 1WDRA 4V27A 4V1YA 2BGNE 3GG0A 4YVVA 3E0WA 4A8NA 1AMKA 3K1GA 2OELA 4PB5A 3CUXA 2W62A 1RJPA 1P0EA 2YSWA 1AW1A 1ADSA 4L65A 3NGFA 4Q7NA 4TVUA 4AIEA 3F5LA 4PE8A 1ZJIA 3G0UA 4BY3A 2PDHA 1XRFA 2WJDA 2ADAA 4ZSTA 2E6DA 3AXHA 1VR6A 2VGIA 3GXNA 4PZVA 4OV4A 4F2TA 4LSBA 4ROQA 3EMZA 4FX7A 3TKFA 3OP2A 4AF0A 4LYRA 1HKMA 1H41A 4XK2A 3MDUA 4DM2A 2YFOA 1DHKA 2VD8A 4KFOA 1E4MM 1TQJA 3MP4A 1E4NA 3NPUA 2VI0A 4UTTC 4P5UA 1SPQA 3QQ1A 1QNOA 4C6FA 1Y0EA 1RA5A 3EGJA 4GK8A 4F8XA 1XYLA 1IEVA 3PHAA 4V2XA 5KITA 4GZ7A 5FACA 5JQ9A 3TOYA 5KSWA 1UR8A 3L65A 1TJ0A 1TJPA 1PUDA 1CDGA 4W9TA 1W3KA 1XLAA 3PZQA 1W5MA 4NZ5A 4HU4A 4ERAA 4GUFA 4LS2A 4EWJA 1ZAHA 3ITLA 3JR2A 3CO8A 4RL3A 2G3NA 4WJXA 4AEEA 1GVIA 1H7NA 1TA3B 2TYSA 3MSRA 4PSRA 2TRSA 4IICA 3LGEA 1H1YA 4HVXA 3IEBA 1SZNA 3UPBA 4UMCA 3AZTA 2VHLA 3P74A 2VDIA 4C5ZA 4PL1A 3TYEA 3T1GA 1LWIA 4F0MA 5HOSA 1XGZA 1PX4A 3LG3A 1BGGA 4NZFA 5BXTA 2BTMA 1YDYA 4RJEA 1JPDX 2ZE0A 1VD6A 3EWXA 1J6OA 3UGRA 4XKYB 4OV9A 3T0CA 4JKLA 2QJMA 1SFSA 4Q7IA 1UKOA 3NQ7A 4UTUA 1E6RA 4ZOAA 4OZOA 2QW5A 1YNPA 5C70A 4UTMA 3R94A 4WZHA 3H4WA 1UZ4A 3E2VA 2MUCA 1LL7A 2WNZA 4FLOA 1HF6A 5ABHA 4MGGA 1XLJA 3GHUA 1R8LA 3LXCA 3S47A 2J47A 1DEDA 4E8CA 5M2FX 4MLJA 1LROA 5T8GA 3BK0A 1DJHA 3ZLFA 5HQMA 1JCYA 3UETA 1KO0A 1XBZA 4TMCA 1VLWA 1EGVA 2G5WA 2D2HA 4IHCA 4DLFA 4LVFA 1H49A 1JAEA 1PAMA 2XJ7A 5I7GA 3N3MA 3O6DA 3R7MA 1XQKA 2VJXA 2ZRYA 5I78A 1RK5A 3RIKA 1EBGA 2QT3A 4Q8MA 1C8YA 3VMPA 1LQAA 4C1NB 3KRSA 4U2ZA 1V08A 5LNSA 5BCAA 1VAHA 3OQ8A 3A21A 4A3QA 2YW4A 1Y5WA 1K9EA 2VCAA 3W1AA 3MI6A 2P8CA 3QQWA 3UBPC 3GIPA 4U4MA 2IUZA 4S3KA 4P61A 9XIAA 3QBUA 3R8GA 2OFJA 1KBIA 4GKTA 2Z2UA 2GGHA 2CYGA 4CCCA 4JL2A 4X2RA 3AXXA 2QPSA 5I79A 1KGUA 3NG3A 3W7JA 3FGCB 5LA1A 2H3BA 2TSYA 1REQB 4I6VA 5K9XA 1XYBA 3W73A 5I3DA 1HO4A 4OUIA 2BOFX 1X98A 3FVDA 3VOCA 4W88A 3N2TA 2BX7A 3HQPA 5LIYX 5A95A 3VKKA 4AEOA 4ZB2A 3AAMA 4QQ3A 4GD0A 3NL3A 3NZQA 1A49A 1AW2A 3ZT7A 3CYJA 3WFAA 1NDWA 3UJEA 4AD2A 4F40A 1HKJA 1BAGA 3C86A 4JX4A 3P0XA 1DIDA 2CZVA 3LENA 1LOSA 3G5EA 3GBEA 4NZ4A 1K8CA 2P53A 4DF0A 3ARUA 1JD7A 1BF6A 5KZ6A 4GUGA 2VWTA 2ABBA 2ZA2A 1X6LA 1TTJA 4GHRA 1C29A 4TOQA 4QS5A 2XISA 2GL5A 3D47A 1EEPA 2ABAA 3M7WA 3NXLA 3ITYA 4GO9A 3DG6A 7A3HA 4JCLA 2FVLA 1FWBC 5JH1A 4PUMA 2J6VA 4ORIA 3REQA 2MANA 1GVYA 3PZOA 4EACA 1JEZA 4R9OA 3TN5A 3H55A 4HMNA 4H8NA 1WUEA 2QCDA 1WDWA 1BFNA 1QWGA 3AC0A 1SSDA 2NSXA 4NIRA 2OG9A 5C7VA 2E0PA 1DWJM 1GK8A 1UHVA 1G7VA 2W63A 1E3XA 3VUPA 4M7TA 5ENLA 2NV9A 3ZXWA 4AAJA 4LRTA 1CGWA 1NFBA 2J7CA 2Z0IA 1XH1A 1BG9A 1TCDA 3RX3A 5HINA 2D24A 2Y4SA 3AOFA 3EKZA 3H7UA 3B0PA 1HGYA 2NV2A 4BWLA 1S2AA 3FIGA 3AUJA 3A64A 4H2HA 3KCOA 3LTYA 3QYQA 3SECA 3TUUA 2RDUA 4GX8A 5HWMA 3FSTA 4A2SA 4CKQA 3DYOA 2OPJA 2HPIA 2X1UA 3S1UA 3BG9A 2WVUA 5D38A 2VL4A 4G1KA 4CVUA 4YNGA 4TTUA 3DHFA 2OTDA 4B90A 3WF4A 1MDLA 5E0CA 2QPXA 4W5ZA 1RK6A 4RNJA 1TV3A 4QJ4B 4HCDA 3OG3A 4RPPA 3TXVA 4W8LA 1B5TA 1W54A 1ZCOA 1AFSA 1VJZA 3F4DA 4XTIA 3QZEA 4G2DA 3T55A 5HJXA 3B0VC 4K1GA 2PCQA 1JPIA 1DBTA 4JYFA 4J35A 3II1A 1OC7A 4QROA 2F7FA 3DFYA 3A4WA 3WQGA 1OY0A 5CJMA 3R25A 4ZE5A 4PB3A 4Y9AA 1A0CA 1J96A 2QUMA 1P7TB 4IP4A 4C6BA 3KBJA 1PIFA 3IGUA 1QAPA 5A69A 2BDQA 4IQJA 1HKIA 3CZKA 3W74A 4AY8A 1CXLA 3RM8A 2QUVA 2C7FA 3OZMA 1H61A 4LUSB 1U1JA 1J11A 3TSMA 2HEJA 4CCEA 2I56A 3BV7A 1EYWA 1JZ6A 3LRKA 3F5KA 5CSUA 2ON3A 1CWYA 2PSNA 3M46A 4AVOA 5M3WA 1ZRQA 1GKRA 3E2QA 1IEXA 2X1RA 3RXZA 2XN0A 1W9PA 2GPTA 1BQCA 4F66A 1I9CB 2P50A 3DOPA 4M1RA 1VBHA 2UY3A 2QF7A 4AMCA 4KCTA 4DX3A 1M7JA 3H70A 3CUFA 4XAZA 3WCZA 4P7LA 3ARXA 4AZCB 1LCOA 3KBNA 2R1KA 2CZ5A 4F9DA 5G2HA 1YBQA 7XIMA 4ALDA 6REQB 1R86A 3BQ6A 1TCMA 5T91A 4O57A 3FA3A 1YNQA 1V4YA 1V6UA 3NQDA 1CBGA 5IBXA 3QPEA 4LB3A 4QLJA 2WMHA 3WUFA 3LGDA 3CHFA 1LTDA 4AX7A 1ZJAA 4DY1A 3T8QA 3PPHA 5I3HA 4MY8A 3WK1A 4DBEA 3STPA 2Y62A 3TR2A 3RYSA 4D6EA 2YCJA 3ALFA 5LXEA 3G6MA 2E5BA 1TPWA 1TYGA 1HQTA 1PKMA 3W0KA 1ISZA 1E9YB 2OJPA 4GXPA 3UWQA 1WAUA 4UFLA 1HVQA 3TN4A 3BTNA 4HYVA 1G7UA 5BOFA 2OQHA 2QLYA 4PTXA 1AVAA 3DXIA 2WKLA 1FKXA 4QE4A 3TSDA 1PSCA 3N25A 1DE6A 5A8QA 2CBIA 3BOFA 2PWVA 3G1RA 3C2VA 1AJ2A 1VBUA 2H9AA 1MEWA 1FWIC 2DEPA 4GRSA 3LZ3A 1GONA 4O8RA 3DC0A 4UTLA 1FWTA 4MJ2A 3VNYA 5I3JA 3OO2A 3AISA 4PTVA 3DCPA 2ZKMX 2XIQA 2PLJA 1E0WA 3OODA 1TJRA 2XGBA 2NXHA 3VMOA 2F6UA 5FIPA 2EKGA 3QV7A 1CB7B 1XLKA 4F4RA 5LHFA 4JEJA 5HJLA 4C6PA 1JJKA 4EPDC 3FAWA 1D8WA 3I3EA 3WJSA 4M51A 3S5NA 4XUGA 4IX2A 1IT7A 1YTDA 1RD6A 4EE9A 1OC5A 1X8FA 3N4EA 4QRNA 2XM2A 3DFQA 1OFRA 2F6KA 3FY1A 3QFEA 5CCZA 5F2GA 1O1ZA 1TVPA 1XBVA 4XBSA 4A6GA 4CEXC 2JKPA 3LBCA 4PCNA 1DJGA 3HA1A 2FIQA 5XIMA 3EB4A 4KCVA 3F2CA 1CXFA 3S9IA 2PURA 2XSAA 2YOCA 3H2MA 3MMDA 5KZDA 1XH2A 1ODZA 1K9DA 3VKJA 2V3EA 3P80A 3W7GA 1E43A 1E1EA 2RGMA 3GC2A 5BMWA 3WD2A 1IWBA 4WOQA 1EH9A 2JEQA 3A9IA 1GVRA 5I3FA 1JPHA 5BXPA 1HO1A 3CAKA 1G5AA 2VC7A 1VP5A 4MUPA 4HU3A 2FQIA 2Z24A 2B31A 1RJQA 4IH3A 1FRBA 5A8MA 3NIYA 3KZPA 2WMKA 4HN8A 2PTDA 3ZSTA 4IXHA 1L6GA 2GGJA 3WH5A 3SGGA 1E6XM 1JL8A 1LL6A 2V69A 2WNWA 1X7IA 1X6NA 3ITOA 1XIFA 4P7NA 2P8BA 2ZDRA 3TCSA 4AD4A 3PBYA 1QBAA 1OGBA 4ES4A 1LBFA 3RLVA 4HSHA 1GG0A 3GIQA 2X09A 3BG3A 3SUWA 3PC0A 3QM3A 3E6EA 2YBUA 4HHHA 2QV4A 3W75A 4O11A 1FCUA 1KBJA 4KERA 2FTPA 5I06A 1UR2A 3W2LA 2F6XA 2YLAA 4DJDA 2J7DA 1EDTA 1QMLA 5DELA 4HSOA 1CPUA 3GHTA 5JH2A 3S9ZA 3AMGA 4CNUA 4JQ2A 3TQPA 4Z42C 5K4ZA 1K8YA 1B90A 5G4WA 1FCQA 3GR8A 1SO6A 3ZJ7A 4MAZA 3E0LA 3SAZA 3KDOA 5DQPA 1OX4A 3E2RA 3WEZA 4MFEA 3QZAA 4QISA 3B0XA 4NYUA 4K39A 4POCA 1VGAA 1LT7A 1KRBC 2GYIA 2TPSA 2VOMA 3O1NA 3TLLA 5JBEA 1R9XA 4GH3A 3UA3A 1FWRA 5EMYA 4Z1BA 2ZX9A 1J2WA 1PKLA 1Q6FA 3MY9A 5G5IA 3LPGA 4OT7A 1M41A 3LM7A 1SGJA 2EAWA 3GVWA 5BRPA 1QPQA 1CT5A 2VMFA 4QR6A 3UW6A 4O14A 3VD3A 4K68A 3S8HA 3UWEA 1ZLPA 3BCJA 4IPPA 3W1NA 3GDBA 3R6IA 4FZIA 1AQMA 4GJJA 4P7RA 5A6MA 2OWWA 1TVNA 3GG8A 3DG7A 1E9LA 3C6CA 3QR1A 3KBSA 1RD5A 3QTPA 1WCGA 4MKVA 1SO3A 4PCTA 3AS2A 2PZNA 1CYGA 4D8AA 1ME8A 1ECEA 2X2YA 1D3HA 1P6WA 1B30A 4FR6A 1LQ0A 2F8QA 1XYCA 4I9JA 4K3ZA 3CIXA 4AU0A 4O15A 4AC1X 2P0IA 3PG8A 4JN6A 1JYNA 3J7HA 3ZYZA 4QSFA 2VC9A 4E4FA 3NOEA 3R79A 2R24A 3O7UA 2WVVA 2Z1BA 1QK0A 3BMXA 2ZFAA 1EIXA 5A94A 4GZEA 3PAJA 3WK2A 1XGDA 4GXMA 3GHRA 3VIKA 2ACSA 4KMQA 3V1PA 2O0TA 3HQOA 2OSYA 1JI2A 1NIUA 2NVCA 2X2GA 3WQVA 4S3FA 4QCFA 4UWMA 1MNZA 3NO3A 1OD0A 2IQDA 2Z00A 3B9DA 1U83A 4XX6A 2EGZA 4UCGA 5C5YA 3CTLA 3UG4A 1NELA 2WVSA 5TIMA 3QSRA 3PTMA 1MW2A 1HL9A 5JU6A 4PC8A 5EMKA 2NVAA 2OKTA 2DH3A 4EF8A 3ZVHB 3TTYA 2NSOA 4MZ1A 4P7QA 3SGUA 4X9SA 4YHGA 3GM8A 2QNEA 2FTWA 3RCNA 4GI4A 4WSJA 3SW6A 4JTDA 1Q8JA 3GNNA 2ZRUA 2POTA 3BAYA 5FA5A 3G3DA 2BY3A 2RFGA 1XIMA 2V9DA 1AQ0A 4L6OA 2PDIA 1TV8A 4QCEA 4C6OA 3MUZ1 3H22A 4NZJA 2R14A 4MJMA 3VIHA 1PZ0A 3PJXA 1V02E 3A47A 3VD5A 3Q67A 2V0TA 4XO6A 2C13A 3STFA 2QMJA 3EDKA 4KWSA 4NAFA 3POCA 2BP1A 2VQUA 4GKLA 2C79A 1UR1A 4HPHA 5DF0A 1ZAJA 2H6RA 5HR6A 1QR7A 4AD3A 1YTEA 2YCLB 5ABTA 1FH8A 5FESA 4LVBA 4BQ4A 2W91A 2GQ9A 1SJBA 3M5VA 3ZJ6A 2ZE3A 4A4AA 1TB3A 1V03A 5M03A 1C92A 3MCMA 1GOWA 2X05A 2BOEX 2CERA 4ICMA 4GVHA 4LF2A 3HB9A 1CXEA 1GZJA 4LEQA 4F0SA 1DL3A 1P4CA 4CD5A 5CAHA 2FHCA 2VZSA 1KC7A 2V3DA 1BWVA 3EPNA 2GUYA 4Z0SA 3L2LA 3P84A 1OGSA 1GJUA 1O95A 2BGSA 3FS2A 2PDPA 3BWWA 2AAMA 3NL2A 1PDZA 4H8VA 3QY8A 2ZRXA 1ONXA 1EJVC 3HM7A 3VCNA 2ASHA 4C65A 2PDCA 5DRIA 3W1MA 4IFOA 5HANA 2GVYA 1R9YA 3N2BA 3SCRA 1DE5A 1DORA 4O54A 1A0DA 4IPJA 4PFMA 4NT0A 2Q8ZA 1V3HA 3O6AA 1BPLB 1NF7A 3JVAA 3ZLGA 1J0KA 3BSGA 3SADA 3UXLA 1LORA 2IMRA 1J6PA 5DMYA 4Y8EA 1ENUA 2FHBA 3R0KA 4IG2A 1JULA 3NL5A 2YBVA 1R3SA 3BW2A 2ZC1A 3H2CA 4Z2LA 3QEZA 5L9FA 1BKHA 1FDZA 1MMFA 3KOWA 4U3CA 4KCUA 3F4NA 1TV2A 3TNBA 2GQ8A 1KCKA 5H6HA 3HN3A 3T0BA 3IUIA 4ML9A 1YHTA 4BEQA 3LHYA 3LCXA 5JVLA 1IXQA 2QUTA 4GCXA 3GW0A 5BMXA 3IJ8A 3H6OA 2DZPA 3UR2A 1DJYA 4W5UA 1G4PA 1VFOA 3IIXA 1IR2A 1G69A 1FHUA 2J7HA 4HCLA 3MJMA 4IJCA 3E9AA 3VILA 1T8XA 5E0KA 5J5DA 4BQ5A 3LK6A 4O53A 2WMJA 3ZR6A 1X7FA 1PHWA 3WLSA 5AYXA 1KCZA 4O52A 2Y70A 3QXBA 3K2GA 3OLGA 2WZMA 5FJPA 5KZMA 5FSDC 5LZLA 3WQDA 3F4VA 5D30A 1RLCL 2VX7A 2Z28A 3WDIA 4GNVA 6ALDA 1LZOA 3PS7A 3FDGA 2BY0A 1TSIA 3NVTA 2A6NA 3ZFHA 5DCDA 2X1IA 4PL2A 5D09A 1P0NA 3T6CA 1IE7C 1HTIA 4W4QA 1BWLA 3KE0A 4CQAA 1OK6A 4M19A 1EJUC 3PB0A 2NLYA 3PUDA 4CUCA 3WD3A 4S23A 2OT1A 1QDSA 5H1WA 3G1YA 3KVKA 4HNVA 3W82A 2ZX7A 1GQJA 4LUTB 3SIMA 3TJLA 1I1WA 4F2BA 5AYBA 3AIWA 2G8ZA 4RK8A 4U3AA 1JFHA 4H04A 3CYVA 1A3WA 3MPGA 4DZIA 3UEQA 5MF5A 1CZ1A 1TVLA 3KHJA