1MZHA

Qr15, an aldolase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
225
structure length
225
Chain Sequence
MIDVRKYIDNAALKPHLSEKEIEEFVLKSEELGIYAVCVNPYHVKLASSIAKKVKVCCVIGFPLGLNKTSVKVKEAVEAVRDGAQELDIVWNLSAFKSEKYDFVVEELKEIFRETPSAVHKVIVETPYLNEEEIKKAVEICIEAGADFIKTSTGFAPRGTTLEEVRLIKSSAKGRIKVKASGGIRDLETAISMIEAGADRIGTSSGISIAEEFLKRHLILEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxyribose-phosphate aldolase
publication title Crystal Structure of Aquifex Aeolicus Aldolase, Northeast Structural Genomics Consortium Target QR15
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, aldolase
total genus 86
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1mzhA00
3W1LA 3CIXA 2TYSA 1VCVA 4AF0A 1DVJA 3I7RA 3HB9A 3W7JA 2GPTA 3TC7A 4IXHA 1F5ZA 4NU7A 2Q3RA 4MPQA 2PURA 3G1SA 5CSRA 1AW5A 1PE1A 3TFXA 1W0MA 1AL8A 3DHFA 5TBOA 4AWUA 3PM6A 1SU5A 1FXQA 2JKPA 4ADUA 2QJHA 4HPJA 3BG9A 3LXBA 1LCOA 4IOTA 4AWSA 4O19A 3UY7A 1AW2A 2ZCGA 3LB0A 2QKFA 3BGJA 4UUIA 1SZEA 3P84A 4DEFA 4O8RA 1JCLA 1ZY9A 4Y96A 3C2RA 4KFPA 3WK0A 4RV8A 5HR7A 3L0GA 2B7PA 1P5BA 5CSSA 3W2NA 4PA8A 2WV8A 1OX4B 4JTHA 4POCA 3IGSA 3G1FA 3W7OA 1PCKA 3CWOX 3G3DA 3P60A 1QPNA 3QRHA 3HIJA 4K39A 1OYBA 2ZTKA 1LBMA 4LC6A 4M6QA 5CPLA 2Q8ZA 3LTPA 3L5AA 2JBMA 4U28A 1DJNA 3CTLA 1XCFA 5HUOA 5KSWA 1UB3A 3GZ3A 3ATZA 2QDHA 1PVNA 1YLVA 1JCYA 1P0KA 5HWMA 3SSJA 1GG0A 4ZZ9A 1M6JA 1UJPA 3QZEA 4MY8A 3WJWA 5D04C 1K8XA 4CLMA 2WSQA 2A85A 3PSVA 3CM4A 4KFOA 2FDSA 3S5NA 1H60A 3W1PA 3NO5A 1DQWA 3LGEA 4CQAA 3N73A 3SI9A 1O95A 1TPUA 2NUXA 4GBUA 4ZQMA 2VEKA 5F1UA 2QUTA 1YTKA 2NUYA 6ALDA 1FX6A 1DV7A 1K3UA 3H54A 5DLCA 3TFCA 1FCBA 1QDSA 4DQWA 1VS1A 2FPYA 4ML9A 1M7OA 4N9CA 3NQ7A 2R94A 2DZVA 1J5TA 3QM3A 4HSNA 3ZFHA 4NX5A 3TDFA 1KTBA 2CLHA 4XWUA 1D3GA 5U4NA 3TIMA 1NEYA 1XDLA 4HSOA 3IGXA 4GFSA 5LNRA 3HGSA 3KHJA 8TIMA 1E51A 4JIPA 4QIUA 3Q37A 4WUIA 5EBUA 4O1AA 1K03A 1OHLA 2E09A 3EKZA 5DCEA 4IXXA 1ICPA 1JRCA 4J9JA 4W9TA 1J2WA 4NQ1A 1KV8A 4TMBA 3TH6A 3LM7A 4Y8FA 3T4CA 3HO8A 4UFHA 4HNNA 2W6RA 4NJHA 3TW7A 1W54A 3TQ0A 1OVDA 1YTEA 3W6YA 1OFQA 3PB2A 1ONRA 4LV9A 3M1ZA 2R91A 1JUEA 1R47A 3NYZA 4MUZA 5CKSA 2FQIA 2V0TA 1U5JA 2Y62A 2FIQA 4MJMA 4ORMA 1LRNA 3OA3A 4KWWA 1LM1A 3WJYA 3M6YA 3P81A 3T7VA 4LC8A 3W87A 4LT9A 4FB7A 2Y7FA 2ZRWA 3CEPA 1KFEA 1TJPA 1T96A 3C61A 4JDYA 5CPMA 1H7OA 1W3TA 4WY0B 2GUUA 1DHPA 1H51A 4AF0B 4MZ1A 2QCDA 3M0ZA 3CT7A 4OGZA 4C1KA 3FJ6A 2YDAA 1XBZA 2HTMA 3F4NA 2RKXA 2J88A 4UTWC 1VH7A 1VZWA 1X8FA 2PRMA 1XXXA 1ZNNA 4GUFA 4DO6A 1JCMP 1OJXA 3W7NA 3PS7A 4HNUA 2B7OA 3T40A 2X1TA 3LLFA 2HS8A 1FDJA 5K3VA 1DBTA 4JXCA 3GVGA 5DXYA 3NM1A 3BLFA 4LVAA 4MFDA 5C6MA 3QMSA 3QQ1A 3PB0A 2NZLA 1XUZA 3Q58A 3PBWA 4AB4A 3EWUA 4S2BA 4XBKA 1TV5A 2PC4A 3DFSA 4ZMGA 4NNBA 4MY1A 1I2QA 4AHQA 3ZS4A 5HWJA 2Z2UA 4UFLA 5F2IA 1NF7A 2H3BA 2WPBA 5BRBA 4IPJA 2XN0A 3S1VA 3S8HA 4NUWA 3WJZA 3WJXA 3OIXA 3HG2A 3O07A 1TJRA 3LCIA 3UY8A 1A5BA 3NQDA 5BMWA 2CZEA 1ZENA 1H1ZA 3I6RA 1FWSA 4UFMA 1RQBA 3RK8A 1O5XA 4OHQA 3S42A 3STGA 5F4XA 3IVUA 4CNOA 1EX5A 2TSYA 3PBUA 4FNRA 4ICNA 4XTDA 2ZRYA 2NXIA 2VXNA 1K02A 4E38A 4IGHA 4GNJA 1W5OA 5FF4A 3L2IA 4UTTA 1UBSA 1YPIA 3M5VA 4WY0F 2QCGA 3FFSA 4QJ1A 3MW7A 3RLVA 4M7TA 1YXCA 3FKKA 5HR6A 1Z44A 4QM1A 3CPRA 4O4WA 2B7NA 1GTEA 3EX1A 1TQJA 1WDWA 1JULA 3THAA 1XFBA 4UCGA 5K9DA 4Z1AA 6TIMA 1F73A 1EEPA 1GOXA 2HS6A 1VRDA 4XKYA 5F2MA 3PWAA 4IX2A 3A22A 1VQTA 2WNNA 1A5AA 5LGZA 3P5ZA 3EWWA 2V2DA 2I1OA 4O28A 3C0JA 1F74A 1EA0A 2ISSA 5AFDA 1QAPA 3OVQA 1SFJA 4DPPA 1VLIA 2P1FA 1RZMA 3N14A 3GNNA 3KFTA 2QF7A 3LHWA 2C16A 1OFDA 2FFCA 1KTNA 4EF8A 4RLIA 1BWLA 3W1NA 5K9XA 4S2CA 4ORIA 4GXMA 1PV8A 3HGRA 3M5ZA 1GG1A 3LTYA 1JVNA 4ZQOA 3MUXA 3QPYA 4IWWA 1K8ZA 2NX3A 2ZQ0A 4LUIA 3DFOA 1XUUA 2Q8LA 1PIIA 3A5FA 1HFBA 3EX3A 5CPOA 1BEUA 2CLKA 3W85A 1EUAA 2E6DA 1YDNA 1EWDA 1FQ0A 3M43A 3L65A 1IXOA 5D33A 4JD4A 4GUIA 4PC8A 4UTLA 1KLZA 1GTHA 3EXSA 5EA9A 1PS9A 3G8RA 3M16A 4AVFA 1EB3A 2ISWA 3U2OA 1DOSA 5K2ZA 3EXTA 1KBIA 1ZALA 1WOAA 3M5XA 2A6LA 1TREA 2VC6A 3LOTA 4K6AA 5CG7A 4FIQA 4WXYA 2NX9A 5D09A 1GQNA 5EKYA 3L0NA 1SR9A 3SZ8A 4ZQPA 1DORA 5I3JA 3ZWTA 4M5PA 4UTMA 3R12A 3AJXA 4JEQA 4PL1A 4NVTA 4FNUA 4N6EA 1G4SA 5F4WA 4JYFA 4MJZA 2YYTA 3S1XA 2EAWA 1TPDA 2A4AA 4MIMA 3UWVA 2QCDB 3SW6A 4H6KA 4OBTA 1WV2A 3MI3A 2QR6A 3VCRA 2E6AA 4IUOA 4WX2A 1HO1A 4MOZA 2GOUA 5HMSA 3KRZA 2ZYFA 3FJLA 5HNRA 1TTJA 4AHPA 3C2VA 2TMDA 3ABRA 3W88A 2KZHA 1EP1A 1Q6RA 4YXGA 5K4XA 3RFAA 3W2JA 3G1HA 1F05A 1ZJIA 1X6UA 3T78A 2C3ZA 4O50A 3BVJA 4Q4KA 3IEBA 5EY5A 1TV8A 1R46A 2F7FA 1V5XA 3EX6A 3TSBA 4Z0SA 3G3MA 3DAQA 3TJXA 1U83A 5AOUA 2QAPA 3M7WA 3BGGA 3QMRA 1S5TA 4K7YA 4O4VA 2RHGA 4DBDA 4TO8A 5D2YA 1FDYA 3W2LA 2G97A 3QEZA 1G4EA 2Y88A 3IIVA 3W7MA 1XL9A 5H2ZA 3HGJA 5E93A 1XM3A 4R33A 1SW7A 2OZ0A 4HPXA 3E0IA 3W1RA 4DPQA 1VJIA 1B4EA 4DF1A 4Z1CA 5LNVA 2ZRXA 1FCQA 5KMYA 1JRBA 5G4EA 4UTJA 1PL9A 4DF2A 3A24A 2WSYA 2ZZ7A 1FWRA 3DKJA 2ZA2A 3KAOA 1CI1A 2B7QA 2WJZA 4BWLC 1TTIA 1Z42A 3DI0A 5BNKA 4JY9A 1I45A 3I68A 5D2VA 1DQXA 1KM2A 2C6QA 4XKYB 1GWJA 1W3IA 3NQGA 1KBJA 2E5CA 3W86A 3KVLA 3BG3A 4PH6A 5DBUA 2ZZ1A 4OU1A 5F4SA 2A5HA 3W84A 2QCFA 3LBMA 3MHGA 1TV7A 3G1YA 3ZR4A 4ONVA 3L9CA 3CWNA 3PULA 4JGDA 4NNAA 3I65A 1F7BA 2C15A 3TMQA 5DCDA 1C29A 2I14A 1I8JA 4OQVA 3MBFA 3W71A 5IBXA 4HNVA 4O15A 2ZRUA 4FEZA 3P5YA 3FYOA 1VC4A 3R89A 3MI2A 2V5LA 3QJAA 5AHMA 4FNTA 4N9DA 3O1NA 4DF0A 2V5BA 2WO5A 3TKFA 2CZFA 4DO5A 2V2CA 3W1TA 1H1YA 3LDVA 1C9DA 4RXFA 3DGRA 1SO3A 4KFNA 4LVGA 5SWUA 4FX6M 4LRTA 3P74A 3SR7A 1MO0A 3INPA 3N2MA 4O53A 2E6FA 3UZ5A 2YX0A 2ZZ2A 2R8WA 1GVFA 4UR7A 3LV5A 3NZ1A 3SGUA 3NG3A 3DENA 3B06A 4TIMA 4NX0A 4TU1A 5LHEA 4Q33A 2OJPA 4MYAA 1ZCOA 4LS0A 1LROA 4A2RA 5D02A 4D2JA 1RQEA 4Z0JA 4TX9A 1IXQA 3GB6A 3L67A 3W3OA 3NZRA 3TAOA 5FF7A 2NWRA 1LYXA 3LHVA 5AB3A 4MZYA 4X2RA 1YDOA 3B4UA 1OFOA 1AK5A 1AG1O 2ZFAA 1SO5A 3MBDA 3W22A 1ZFJA 3UWQA 1QOPA 1VGAA 4NNCA 4CNPA 1Q6LA 3PG9A 2VFEA 4N4QA 1IIHA 1N8FA 3G18A 1L2UA 4AH7A 2H3DA 1YYAA 4O1DA 5LNSA 3GAKA 5J5DA 3L68A 3LHYA 4FNPA 3C3NA 3N19B 3UWWA 3TV8A 3TUUA 5CZSA 4YMZA 1X7FA 3DI1A 1ZAIA 4A3UA 1O60A 3HQ1A 1TPVA 2ZRZA 2NV2A 1A53A 2BTMA 4XTIA 4JS3A 5I3KA 3O16A 1YTDA 1THFD 3OG3A 1TQXA 1MEHA 1FWNA 3M9YA 3IV3A 1IIGA 1G69A 5HQEA 1Z48A 1QO2A 2OMAA 3M41A 3TQVA 1OYCA 4QNEA 2DZSA 4N02A 1W1ZA 1S5VA 1I2RA 3E9AA 3QW4B 2G95A 4GWEA 3MJYA 4UNLA 5IBXC 4LW7A 2O7SA 5CZTA 5G1TA 3W1MA 1H61A 2Y7EA 3LXCA 2H8ZA 3LCGA 1GEQA 1KLYA 3FIGA 2UV8G 1G4PA 2RDUA 2ZA3A 2Z6JA 4EOUA 3O06A 3HF3A 2DU2A 3O05A 5LHFA 2X1UA 2A7PA 4FHAA 1ICQA 1Q3NA 4NJKA 1LRTA 4E0CA 2YFNA 5DBTA 3W7RA 3OVRA 1XBYA 1GYLA 1F2JA 2ZBTA 3RLUA 1LZOA 2A2IA 1NAL1 2HMCA 2LLEA 1LLZA 1CX9A 3W7LA 5CGQA 1TPWA 2VEIA 1ME9A 4UNKA 4RZ4A 3LI0A 1LLWA 2Y7GA 4FX8A 1FCVA 1GVSA 3HJZA 4LWWA 2FB3A 1O94A 1W5PA 3JS3A 3IRDA 5AYZA 2Y61A 1A5CA 3NQEA 4Z1BA 3MHFA 1QCWA 3LI1A 4GJ1A 4JTTA 2YR1A 4PTNA 3BG5A 2QEZA 4QAIA 2DZPA 1FDZA 3GDLA 5DY2A 1EP2A 4BF9A 3S0CA 3P7YA 3GK0A 2FPVA 2YSWA 5G2IA 2EPHA 1G7UA 3C2OA 1AL7A 3GR7A 1VYRA 4LNYA 1TRDA 2QDGA 4UIOA 4RK8A 5G2HA 3TROA 1KFJA 1SSDA 1VCGA 4R7JA 1KV5A 1KW1A 4JTIA 4JR5A 2J9YA 4BI7A 3O6YX 3P61A 4O14A 4JX6A 4ZL1A 2ABAA 2Q3OA 5LSMA 3GKFA 2RH9A 5LGXA 4YL2A 5A5WA 3IIOA 3EKLA 3NQCA 1BWKA 1P1XA 5EPDA 1RPXA 4ZVJA 1H7WA 5HWNA 1UUMA 1P0NA 4N9BA 3W75A 1WXJA 1DJQA 4N9EA 3BLEA 2C0AA 4UC5A 3GR8A 2WOQA 4BR1A 3PVFA 3W76A 1GVOA 3EEGA 5U7SA 2Y89A 2BLEA 3WFAA 1OX6A 3AO0A 3W7GA 2BX7A 1ML1A 1KFKA 4IMCA 3W7DA 2VFDA 5D30A 2H90A 4N4PA 3U8GA 4GC4A 1GT8A 2NV1A 1OABA 2VKZG 3R8RA 1JUBA 1Y0EA 4EWND 3FKRA 1X1OA 1AW1A 4NXKA 2H8XA 2B4GA 2ZZ6A 4I7UA 2DJXA 2GQ8A 1OFPA 1L6SA 4CCCA 5A8GA 3W07A 3W73A 1FY6A 3W83A 4G1KA 2CLLA 1PCWA 1YXYA 4UTKA 3O63A 3TC6A 1WAUA 4LS1A 4AEOA 1NSJA 5TIMA 5BMXA 1TPEA 3E96A 4MYXA 1XDMA 1L6YA 4JX4A 1KM6A 1IF2A 2ZTJA 2Z6IA 4O57A 3W1UA 3K30A 4P2VA 2GJLA 1OYAA 3QPZA 4IX0A 2VFGA 3MI6A 3VE9A 2YCEA 4WJEA 4JDBA 4WOQA 2V30A 4OT7A 4Y9AA 4K36A 2V8ZA 1R2TA 3NQFA 3BARA 1H7RA 4JYDA 5D32A 4XZ9A 3L66A 2PRLA 3BV4A 1TCDA 3NM3A 3LCFA 3L5MA 2Y85A 1W8SA 4O16A 1QR7A 3S5OA 2XFWA 2FPTA 4ZQRA 3G8EA 2C14A 3ABQA 2P0OA 1QPOA 1M5WA 3T55A 3GAYA 4TMCA 3PUEA 3PBYA 4JTKA 3A21A 4KWVA 3WK3A 4Q32A 4IPIA 1FWWA 3W1XA 1KA9F 5MHBA 1T8XA 3OVPA 2WNQA 3HG4A 1N7KA 1OFEA 4K8HA 2NXGA 2GVJA 3R2GA 5K4ZA 1EP3A 3GXNA 3HG3A 4FO4A 4UMBA 1TPH1 2X30A 4NXSA 3CC1A 4WZHA 5AC6A 3DFQA 3IVSA 3NL3A 1G67A 1LRQA 1LP6A 4A2SA 3BW2A 3VE7A 4NJGA 3W1QA 2QUVA 4UFKA 1TO3A 1ZAJA 3VFLA 2V9DA 1G7VA 1NVMA 3G24A 3QC3A 4K7VA 3W2MA 5HULA 3GDRA 3PUOA 2TRSA 1OF8A 3MYPA 4MVAA 1JCNA 4JTLA 1TYGA 3GX9A 3GIYA 1H7PA 4NJIA 4CQ9A 2EHHA 4UTTC 4Z08A 3UWUA 5CZJA 4EVZA 5D37A 1I4NA 3LRKA 1B3OA 3LXAA 1SUXA 3LRLA 3KRUA 1W5QA 3TJLA 2ATSA 2P10A 1TTPA 4PFMA 4IMEA 2CZ5A 2V82A 2D73A 3ELFA 2RDTA 5G1YA 3RU6A 3EX2A 1QMLA 5FI8A 1O4UA 4BI5A 2DZTA 4AMAA 3OHIA 4O0KA 4O13A 3TU9A 3THQA 4LV4A 1J4EA 5K7JA 5F1VA 3SECA 3HMJG 3NL2A 1TTQA 3TSDA 1N55A 2ZZ5A 1A50A 1OF6A 1K7EA 4GRSA 3UD6A 3NQ8A 1WBHA 3M44A 3KXQA 3I7QA 3QFEA 3E12A 3DH7A 3DXIA 2NUWA 1LDCA 4NZFA 3HBLA 5KITA 3TX9A 4JNMA 2A7NA 1F76A 4RR4A 3UPWA 5ABTA 1KFBA 4B5NA 5DY3A 3P62A 5DN1A 3TNOA 4FIRA 4UTUA 5FEWA 3FS2A 2JKAA 4NZJA 4O18A 1MXSA 3MYOA 1R30A 4LUJA 1K7FA 3PC0A 3UZJA 1FWTA 3A9IA 1UUOA 1RR2A 5D2WA 5LNUA 1JCJA 4O1BA 3SIZA 3WJSA 2BZNA 3WK2A 2QCEA 3W9ZA 1RV8A 1R2SA 3FLUA 3QSRA 4M6PA 4A29A 3LBCA 1W5MA 2OCZA 3HOJA 3FA5A 1GVRA 4FX7A 3C8FA 5KTLA 4GUHA 4IMFA 3HGOA 4PCFA 2BXVA 3VI2A 1TRIA 2A6NA 2C1HA 3W72A 3HPZA 3B8DA 1DL3A 3W7IA 1D3HA 2VEPA 3SJ3A 4CQ8A 4U4MA 5D05A 3UWZA 1S5WA 3GLCA 1KFCA 4K8EA 3QSTA 4JTJA 4Z1DA 2GQAA 2E77A 4HNTA 3MMTA 4RX0A 4E2BA 1LOQA 3IIXA 4AWTA 4RZ5A 4UMCA 1SZFA 3TK7A 3QF0A 3TCEA 1D9EA 3M47A 3H55A 4JTUA 4OE7A 4R53A 3STFA 2Y70A 2E68A 2PCQA 1KM1A 3W7HA 5BOOA 4DXVA 1B9BA 5HINA 3WK1A 2ZZ3A 1LTDA 4ZQNA 4LY8A 5L9FA 5J5RA 3EXRA 3NPUA 2OT1A 4JICA 2YGYA 4M6VA 1I2NA 3F4WA 1Z41A 3R13A 5EYWA 4X22A 3PSWA 4CCDA 1IXNA 3LHTA 3G1AA 3KVJA 1K8YA 4HKPA 1QWGA 2Y7DA 1SO4A 1KFLA 1QPQA 3CHVA 1GPWA 1H7XA 3PAJA 5AYXA 1AMKA 2QCCA 5IM51 4OV9A 3GYEA 5BW6A 3TSMA 3PG8A 3P8JA 3C4UA 3GXPA 3L0KA 1YPFA 2YYUA 2OX1A 1BKSA 2NX1A 3S6DA 1WBJA 5AHFA 3UNDA 2YXGA 3V1PA 2VOMA 1FXPA 2ATMA 4FXRA 5E1QA 5TQLA 2EKCA 5L6UA 2Y63A 1MEIA 4OV4A 4UMAA 4YCPA 1OFRA 1B4KA 1OFAA 3P80A 3W7CA 4YCOA 1VR6A 4LTSA 3DZ1A 5I3IA 3A5VA 3C52A 1FBAA 3GNDA 4LU0A 1RVGA 4UTWA 3MP3A 5KINA 3NL6A 1CW2A 1WX0A 3B0PA 1OK6A 3PF3A 3NR0A 3NQAA 2VFIA 4RXGA 1F6KA 2CWNA 4JN6A 3TR2A 1Q6QA 5DXXA 3B05A 2JGQA 5KZDA 2ZDRA 3LCLA 3B0UX 2VELA 3ABOA 3BK0A 4O1CA 3G0SA 2AAMA 4PEKA 4O0ZA 1XKYA 2A7RA 2XN1A 4LVBA 1ZAHA 1ME7A 1RD5A 3ANYA 7TIMA 1MSSA 4LOCA 2YW4A 3ZWSA 1TPC1 1OK4A 2X1RA 3MHUA 3MP4A 3W70A 4LVFA 4WOZA 4N6FA 3Q2DA 5GVJA 4I9AA 2QJGA 3A23A 2CLEA 5FESA 3EWBX 5HUPA 2QCHA 3O8AA 1FUYA 4UTHA 3TAKA 1ME8A 3IIZA 3TXZA 1T0OA 2BWGA 3LV6A 2QCMA 1W5NA 1YXDA 3FEMA 5C5YA 4Y6GA 4TR9A 4RZ6A 5AN7A 3VKJA 1ADOA 4CNNA 1EWEA 3PUDA 5T26A 3UXDA 1LBLA 1I2OA 1SSGA 4O12A 2E6YA 5CPNA 1F6PA 3MWAA 3TQKA 4FF7A 3C56A 3ATYA 3S5YA 1SZNA 3LERA 4EIVA 3CU2A 1XBXA 5FF0A 1G4TA 5D2XA 3SY5A 4AAJA 3G0UA 1TSIA 1VHNA 1M7PA 1SPQA 4JTFA 3CEUA 3FOKA 2JGYA 3ABSA 2W79A 4MZ8A 2GJNA 2CLOA 2QAFA 4WXZA 3SFKA 2OT0A 3QW3A 5AHIA 5K9CA 2H6RA 1A5SA 1H62A 1QNVA 3R5EA 5H91A 2G96A 1YDVA 1H5YA 3BW4A 1TMHA 2NWSA 2ZA1A 3NNTA 5G4WA 3HPXA 2E5DA 3PR2A 1G6CA 1LORA 5AHNA 3L5LA 2RFGA 4ZQCA 4O52A 5D38A 4H4IA 2J6XA 3KVMA 3USBA 1V7YA 4XQ6A 1WOBA 4CCEA 3LLDA 3PY2A 2FLIA 1HUVA 2GVLA 3M5YA 2Z0IA 3G1VA 3NDOA 4L4MA 3V75A 4WD0A 4QNWA 3S5ZA 4HN4A 2RDWA 1EUNA 3DHDA 3S1UA 3NPWA 4HT3A 1SQ7A 1JQVA 4FNSA 5FEXA 1VYPX 1UCWA 3NQ2A 4ADSA 4A22A 5DCBA 1I2PA 3P8IA 1LOLA 2EF9A 1W56A 1OFBA 3FYPA 5I3HA 3C6CA 1XC4A 3T44A 3TA6A 4GUGA 1S3HA 2ZRVA 3TE9A 1OX5A 4RKAA 1GYNA 3CIWA 1WA3A 3B04A 4QQ3A 5C55A 3LCHA 3D0CA 3L21A 3TW6A 3BW3A 3STCA 3IVTA 3UXAA 2VEMA 4ADTA 2QJIA 3O15A 1TPB1 2X2GA 2FJKA 3W2UA 4PL2A 2X1SA 3TXVA 2DZXA 4M7SA 3HPSA 3QYQA 5C2XA 3Q94A 3NA8A 1H7NA 5D2TA 4GUJA 1P4CA 5G5IA 1KM5A 2I9EA 3N9RA 5AYYA 3RNDA 3S1WA 3DFPA 2V81A 4WQ6A 2A21A 3GDMA 1QOQA 1VLWA 5AHLA 4UXDA 5LNWA 1O5KA 1NFBA 3LHUA 4YLWA 4K38A 1ICSA 4QITA 2Y6ZA 2QCNA 3NL5A 2VFHA 1GVQA 1UASA 3YPIA 2AQWA 3KOFA 2AGKA 3NPVA 4X9SA 1SW3A 2YFOA 4MFEA 4O11A 4JX5A 1PHWA 1Q6OA 4BFAA 1W31A 4Y90A 4MY9A 2NLIA 1QPRA 4RCXA 4AXKA 1R2RA 1X1ZA 3U6WA 1OG0A 2ISVA 1VYSX 4O17A 2B0MA 3EB2A 2WKJA 5KZEA 2J9XA 1TPFA 3LRMA 1HTIA 1W37A 4UFIA 4FNQA 3UQNA 5I3GA 4O54A 5AC8A 4HIBA 1KM3A 4LRSA 4QISA 3W74A 1SO6A 3NAVA 1Q45A 3UYCA 1JCXA 4JTSA 2C19A 5G2WA 4QSHA 4DELA 1MEWA 2ALDA 3LCXA 1VPXA 3DBPA 3RMJA 4BK9A 3B03A 2WQPA 1QO5A 5F2GA 5FF3A 1K7XA 3G0XA 3KX6A 4JIQA 3W2KA 3O6CA 3EWXA 1JUKA 2YZRA 2ZZ4A 1H63A 3QQ0A 3P67A 1KM0A 3CB8A 5FEPA 3NQ6A 3EWZA 5EL1A 3BLIA 2CLFA 5FEZA 2CZDA 4OWGA 4UTIA 3W7PA 2PE4A 2YW3A 2WNZA 3N34A 1EIXA 5DELA 3QMTA 5I3FA 1RQHA 2GVGA 1ALDA 4ALDA 4P61A 1JQXA 3MO7A 4N2YA 4UFJA 2J27A 4XBSA 2CLIA 2CLMA 4IMGA 4IQLA 1LBFA 4H3DA 1C8VA 3GDTA 4LS2A 1HG3A 3E49A 1IGSA 3C2EA 3DU0A 2EGZA 1WQ5A 3SGZA 3I7SA 2TPSA 3LX9A 4BWLA 1OX4A 1VHCA 4I7WA 4JTGA 3N9SA 4IJBA 1DKWA 2A1YA 4L4LA 2VFFA 2YPIA 1EPXA 3BO9A 3OEXA 2V2HA 1SW0A 3O6DA 4DBEA 1XBVA 4I7VA 3IGUA 1QFEA 5HJLA 3P82A 3DFNA 1SZGA 2J9ZA 3B0VC 2JK2A 4A21A 3W23A 2W0UA 2C18A 5E0KA 4S1FA 4E2DA 2GQ9A 2NXHA 3GDKA 3NGJA 2XN2A 1YADA 3NEVA 3F03K 3BPWA 4AHOA 4R34A 1HL2A 1ZHAA 2ABBA 2FB2A 2QCLA 3KRSA 4MKNA 3LHZA 3HG5A 4UR8A 4YWIA 1L9WA 1PHQA 1LOSA 4NJJA 4GE8A 3DFTA 3JR2A 3TMLA 4LVDA 1TB3A 3GXTA 2C13A 1JR1A 2BSLA 4M19A 3E02A 2DORA 4FXSA 5D03A 3S9YA 2R14A 5F2LA 3MP5A 2VENA 3G1XA 3IIPA 2WSRA 3C2FA 3NQVA 3STEA 1JJKA 1HO4A 1B57A 3N3MA 1KTCA 3NOEA 1WYIA 3NXFA 2PRHA 3W7KA 1H50A 5FF2A 3VNDA 2O7QA 2X16A 3G1DA 1GJPA 1T99A 4EF9A 2DJLA 1MZHA 4MLRA 4RJEA 3W7EA 4C1LA 5CZ0A 3PBVA 2CW6A 1L6WA 2E5BA 3QH2A 1XI3A 5AC7A 3JRKA 2Z1BA 3W7QA 3EWYA 4PODA 4KKXA 4K37A 3LCWA 1NF0A 3UWYA 4DO4A 4JY8A 3N2XA 3CQ0A 3KVKA 1BTMA 3OBKA 2E1DA 2QUUA 4JTEA 3UPBA 1IXPA 2JKEA 2G5WA 4NT0A 3NQMA 2DZWA 2CFFA 2A0NA 1KM4A 4O10A 1W3NA 3G22A 4IMDA 3CLMA 3LTSA 3GKAA 2IQTA 2DP3A 2F84A 5LKYA 3NPXA 3W1AA 4MLJA 5LZLA 1SFLA 3EX4A 2CU0A 3DKLA 2J24A 1GZGA 1FCUA 1TIMA 2HSAA 3RF9A 2FTPA 5C54A 5KZMA 4JYEA 5EMUA 4XUGA 2DZUA 3F1QA 4BI6A 4X3ZA 3H53A 4HHPA 4WY0A 3NVTA 5AHEA 1VCFA
chains in the Genus database with same CATH superfamily
2F61A 2INFA 1SJAA 1PKLA 1U5VA 1VCVA 2TYSA 2UY3A 4AF0A 2G3MA 1DVJA 1XLLA 3M6DA 1GQJA 3TC7A 3PZVA 5CSRA 3AHXA 3TFXA 3T0DA 1AL8A 2ZADA 3DHFA 4AWUA 2G37A 1RBOB 1OD8A 4EK7A 3BUVA 4GABA 4GKLA 1GKQA 2P5NA 4IOTA 5TNVA 1AW2A 1RY8A 5M1TA 4WGHA 3WLHA 1ZJBA 4JQ1A 3BGJA 1SZEA 3P84A 4AIEA 6ENLA 1JCLA 3T42A 3MUAA 5AC4A 4AIBA 4R9OA 3L0GA 2B7PA 1P5BA 1O5RA 4POCA 1OX4B 4DY1A 2VX7A 1LL6A 1HIZA 4F0HA 1XLGA 4FMVA 1EXBA 3RYSA 1PCKA 2BP1A 3M0XA 2VGIA 4JTCA 1RK6A 2HE8A 3FSUA 4NZCA 1M68A 4FLQA 1OYBA 1LBMA 4LC6A 4M6QA 5CPLA 3VILA 4IMAA 4B5VA 1ADSA 2XTKA 1HGYA 3S83A 2UZ9A 2WMJA 1Q4NX 4DNMA 3AYVA 4XZWA 3KDNA 3ATZA 1E1CA 1GG0A 1OZMA 3W0KA 1UJPA 4MY8A 3WJWA 2YCLA 3TLQA 2WW5A 3CM4A 4KFOA 1XLIA 5C9XA 4FA3A 3W1PA 1RLCL 1DQWA 1EO7A 3OYZA 3LGEA 4CQAA 3N73A 1RP8A 4AD4A 4PMQA 2JIEA 2YB1A 1O95A 3D46A 2WM0A 4GBUA 4ZQMA 2D0GA 1XF0A 3WQVA 3GBDA 2PSNA 1E0WA 3MCMA 4REQB 2BGQA 2O9TA 2QIIA 1KRAC 3HJEA 1W1A1 3WQ8A 2QPSA 3GTNA 4NX5A 2OYLA 1KTBA 3AIQA 4XWUA 2XZ7A 2RGLA 3QV7A 2ANUA 1SJDA 1HT6A 4MNLA 1M03A 5PTDA 3KHJA 8TIMA 4GVHA 3PNUA 4JIPA 2DUZA 3WLQA 2C71A 1QWKA 5DCEA 4IXXA 1ICPA 3AU6A 4TMBA 2YXXA 3T4CA 3KWSA 4XZMX 3LU2A 2PGRA 3EA1A 2ZX7A 1MFVA 1OM0A 2AMGA 4J40A 1IWAA 2VC5A 4I9JA 1DTNA 1U5JA 1NP0A 1TWIA 2FIQA 3D5HA 3UF9A 5LA0A 3OA3A 4LUTB 3WJYA 1VFHA 3T7VA 2A3AA 2OZ3A 4JTQA 3MSYA 3CGTA 1E6SM 2GJPA 2FVKA 2ZRWA 1PKYA 3CEPA 1TJPA 1KCLA 4JDYA 1CXEA 1W3TA 4HZ6A 1NY1A 1XYCA 3NDZA 2GUUA 3V5OA 2Z25A 1EF3A 1UWAA 1H51A 4AF0B 3M0ZA 1KGWA 4OGZA 2B31A 1VZWA 1VEPA 2QMJA 5C9RA 1JCMP 1GOMA 3W7NA 3T40A 4C7DA 1FDJA 3FA4A 1DBTA 2QDDA 3NM1A 3BLFA 4LVAA 4DNHA 3PB0A 1B2YA 1F9CA 4AY8A 3LLXA 3EWUA 5FL0A 3DFSA 4ZMGA 3BAJA 3WLSA 2Y5JA 1Z69A 2OVLA 4D6DA 1D7FA 1H2JA 5GJMA 2H3BA 4G8TA 1AH4A 5BRBA 1XD1A 1V0LA 4H8VA 3S1VA 4NUWA 3OIXA 1BKHA 4TTUA 4DB7A 2E0PA 4WR3A 1J0HA 4NSBA 5BMWA 1KR1A 3QV6A 4AISA 4MF4A 5FJOA 1K4GA 1ZENA 5C7HA 1O5XA 3WLKX 1I9CB 5GNXA 2TODA 1E1CB 4ZO6A 1YNYA 2OLAA 4FNRA 5D8WA 4UQEA 4XTDA 2ZRYA 4OUEA 2YCLB 2NXIA 2VXNA 4PN2A 1K02A 3WQEA 5ENLA 4E38A 4IIBA 3UXKA 3L2IA 1XGZA 1UBSA 3DUGA 3FFSA 4DI8A 4GH1A 3RLVA 4IZGA 1Z44A 4QM1A 1EJXC 2B7NA 4L6OA 3VKKA 1GQKA 2HS6A 3PWAA 2IQ0A 4L5ZA 2V2DA 1KBBA 4O28A 2QPXA 4D8ZA 3NQBA 3WBWA 1IEVA 5AFDA 3TN6A 1QAPA 2X05A 4B3ZA 3OVQA 1SMAA 1SFJA 4DPPA 4LAOA 3H8AA 3RM4A 2YOCA 4A3RA 2XIBA 3N14A 4JPGA 1MW0A 3LQGA 5K9XA 2VZSA 4S2CA 1GOQA 4ORIA 4GXMA 1GG1A 1G94A 3PK7A 4IWWA 2NX3A 4NI8A 2FZNA 4KF1A 4MNKA 4B2DD 4CNUA 4F79A 1UR9A 3CHEA 4XBJA 1ODUA 1K9EA 4YU1A 1EUAA 3CAKA 3MY9A 1EWDA 1FQ0A 3L65A 3GD6A 4PC8A 3WQCA 4UTLA 3CO8A 5EA9A 3M16A 3G8RA 4F4RA 2XJ7A 1KBIA 1WOAA 3M5XA 2A6LA 1TREA 5C70A 4IGMA 5EMLA 3OGVA 5ECVA 1R5YA 1A4LA 1GQNA 3L0NA 4M5PA 4JEQA 4PL1A 4FNUA 2BHZA 4E2VA 1JCTA 4H6KA 1PBGA 4ZCWA 4GMEA 3H4GA 3EPNA 1IEWA 3CZJA 2ZXQA 1US3A 3MI3A 3NGFA 1CB2A 3MZ2A 5HATA 1F4AA 2WNWA 3RCMA 1ECQA 3CZGA 1UC5A 3P0XA 2WWDA 4MOZA 3S46A 4V1YA 5HMSA 3H2OA 2ZYFA 4DXKA 4F0KA 1VD6A 4AHPA 5GJNA 4LAMA 3W88A 1KXQA 4YXGA 1Q6RA 1V6YA 5BRQA 3G1HA 1V6UA 1ZJIA 3VAVA 3CL7A 1R46A 3EX6A 3T1GA 1NIUA 2GGJA 1R3WA 1IHIA 3VOIA 3F4CA 4PCSA 3DFYA 3N04A 1FHUA 5JH1A 1FDYA 4K3ZA 2G97A 3GNOA 4KERA 3W7MA 5E93A 4D9PA 3HM7A 4R33A 4ZOBA 4HPXA 1JPKA 3E0IA 3W1RA 2R1PA 1RP9A 5LNVA 1FCQA 5KMYA 3FY1A 4ZOAA 6PTDA 5G4EA 4UTJA 2FVMA 3A24A 1LJYA 1BGGA 5HBFA 3DKJA 4LBUA 3CO4A 4H2HA 1R38A 4W8BA 2B7QA 3ZLGA 1TTIA 3GVVA 2W66A 5BNKA 4ROPA 3AMGA 3I68A 1JI1A 1DQXA 3KCLA 1B5TA 4DJFA 3BLLA 1OT1A 2NVDA 1KBJA 1KXVA 1XLFA 1XS2A 4MPKA 4OU1A 5F4SA 3UXLA 4DUOA 3PULA 2RUSA 4P8UA 2XFYA 1F7BA 4XO6A 2I14A 1JZ4A 4OQVA 1HP4A 1T6MA 3W71A 3NSXA 3E0LA 3SY1A 4FEZA 1L2QA 3P5YA 3FYOA 1PX3A 1V3MA 3VIHA 2V5BA 2PDCA 3QTPA 2I57A 4YVXA 1Z7AA 3W1TA 4BKNA 3SM0A 1C9DA 4I90A 4LAUA 4JNYA 5SWUA 4DZAA 4PUWA 1SM9A 2DVXA 3SR7A 3UZXA 3INPA 1GVFA 3VC6A 4S23A 4Y9PA 5GQBA 1UBPC 1J12A 1HX0A 1Q7ZA 2D0FA 3QFWA 3CUIA 1PZ1A 1V6VA 3RJXA 1LG2A 3B0YA 4F2BA 4ZO7A 1C93A 3KUMA 5LHEA 2PLJA 1ESWA 4XKMA 2FZBA 1ZCOA 4AZ6A 1J18A 1LROA 3ITYA 3QGAC 1RQEA 1M41A 1IXQA 3ZR6A 3NZRA 1FOBA 1E5NA 2NVAA 1LYXA 2WKGA 3F2BA 1Y65A 2PDMA 4HD5A 2E7FA 4MZYA 1YDOA 4QE4A 1P0EA 1AG1O 3WQFA 1SO5A 2OYKA 1ZFJA 1UA7A 4IJRA 1QT1A 3CL8A 4CNPA 1Q6LA 5CC7A 3SGGA 1XIDA 4N4QA 4J3SA 1BSLA 1HGWA 3KW3A 3U2ZA 1ISWA 5HNNA 4QS5A 3L68A 3CBWA 1ZPTA 4HMNA 3LD5A 1PDYA 4ACZB 4NIRA 2OWWA 2PLCA 3QTGA 4A3UA 3W28A 2Y8KA 3HQ1A 2ZRZA 2NV2A 1W1B1 4L4PA 3MV11 2HVNA 1F3WA 4JS3A 3TQPA 4YYFA 1YTDA 5A6MA 1K6AA 1G69A 1A49A 1Z48A 1QO2A 3T08A 4LFYA 2PWFA 3NTYA 3T81A 2DZSA 1S5VA 2WVVB 4CU6A 4QDMA 4ASTA 5IBXC 2Y7EA 3LXCA 2H8ZA 4DZIA 3KWXA 4F2UA 1XYLA 4U3AA 3T8QA 4JNZA 1G4PA 2IKGA 2XSBA 2ZA3A 2Z6JA 2YL5A 1T5AA 3HF3A 2ZX9A 5LHFA 2G0WA 2X1UA 2OWXA 1TX0A 4X60A 1XIBA 4NJKA 4E0CA 1W3HA 1F8IA 3WLTA 4K2SA 1LZOA 1MXDA 2E4TA 1IGWA 4FSAA 4PTDA 3TYEA 2OEKA 2HVMA 4XD3A 3ZQ9A 1E6PA 2VEIA 9RUBA 3GC5A 4RZ4A 3LI0A 2GSHA 4FX8A 4LWWA 4C6FA 1ISXA 1CGUA 3WZ0E 4RNJA 1AODA 7XIMA 3JS3A 3W37A 1QCWA 2POZA 3JUGA 1NP2A 4MKSA 4PRWA 3KCOA 1E0VA 4XO7A 3TA9A 5DY2A 4JZ5A 1EP2A 4Q4QA 2Q01A 3P7YA 1EGVA 1JDAA 1FTXA 3FSTA 3E2QA 3W6LA 5G2IA 1V6XA 3MPGA 1J10A 1G7UA 2XH7A 4WHBA 2IPFA 1E15A 1NJJA 1QXLA 1VCGA 1KV5A 4XK2A 3VVGA 4BI7A 2ABAA 2PEVA 5DRCA 5LSMA 1XH2A 3BLOA 5LGXA 1HJUA 1RA5A 4UQDA 5MF5A 2FYMA 1B3XA 4XZLX 2YB4A 2J7HA 4ZVJA 1H7WA 4X63A 2ZC8A 3W75A 4PUMA 1M3UA 1RAKA 4ERIA 3PVFA 1GVOA 4OZOA 4S3FA 5EMYA 3BWWA 5I79A 2PLMA 1C3FA 2PGFA 2XVLA 3WFAA 3WELA 1HKWA 3W7GA 1ML1A 3IJ8A 4IMCA 5D30A 3R0DA 1GT8A 4QQUA 2NQHA 2VKZG 3ZO9A 3QOMA 1ZUAX 3VGFA 4EWND 3FKRA 4H19A 5EMJA 4H9ZA 3E74A 4HA4A 4HJWA 1VPQA 1OFPA 4HOWA 5HJYA 3O9NA 4KCWA 3DEQA 3W83A 3N2OA 3VFCA 4CEUC 4H6EA 3O63A 3BMXA 4LS1A 2O92A 2PFHA 2D2JA 1NSJA 5TIMA 4MWAC 1TPEA 2VURA 4FOJA 4HHHA 1XDMA 3BOXA 4JX4A 4R88A 1IF2A 2ZTJA 3ARVA 1JDDA 4P2VA 2GJLA 3GXMA 4C6EA 1GVEA 3QPZA 3TYBA 3QGVA 4WJEA 3UETA 4Y9AA 3MKKA 2V8ZA 4W93A 1FWBC 4JYDA 3UGVA 3NM3A 5ECUA 1Q65A 1W8SA 4O16A 4V27A 3S5OA 2C14A 3ABQA 4RZBA 4OJYA 4PULA 4TMCA 3PUEA 2FJUB 1WZLA 2OYMA 1FWWA 3W1XA 4B9ZA 3APTA 2WNQA 2WZHA 1N7KA 1OFEA 4K8HA 2GVJA 1BVNP 2ACSA 1P43A 5M3WA 2FZ9A 5DT7A 1IYXA 3R58A 4FO4A 1R9YA 3MVTA 3WQPA 4BEUA 2ZWZA 4WZHA 5AC6A 3A6OA 4C6OA 5AECA 1CXLA 3BW2A 3W1QA 1BFNA 2JEPA 2QUVA 3WFZA 3MMDA 4UFKA 1Q5MA 5BU9A 3VFLA 1HNYA 4UTFA 2V9DA 4M51A 3W2MA 3ARUA 3GDRA 1AJZA 3R7MA 4C6KA 4S3CA 3AIWA 1TYGA 4HMCA 1EGMA 3WQ6A 3LXAA 3KRUA 1F3XA 3TJLA 2P10A 4WIWA 5A6BA 4DBSA 1PX4A 1K77A 2RDTA 2GDUA 5G1YA 5FI8A 1O4UA 3VGHA 2ISDA 2OKOA 4GYKA 3TU9A 1CXIA 5F1VA 2ZZ5A 1UH2A 1OF6A 1K7EA 1B90A 3UD6A 2PDYA 4XD5A 4PB4A 3BOFA 4NZFA 4EXBA 4JNMA 1OIFA 1FWEC 4RR4A 3WNMA 3UPWA 5ABTA 3WH7A 1KFBA 4NI3A 3VABA 5DN1A 4FIRA 2L5HA 4LUJA 1FWTA 5CXPA 4UQAA 4MB4A 1K9DA 4KETA 5FIPA 1V6TA 1TUXA 3FLUA 4KCUA 4A6GA 2Q02A 3HMCA 1GVRA 4FX7A 3OBAA 1KQYA 5JIPA 3L4YA 4GUHA 1NARA 3HGOA 5CLTA 3PZNA 1Q13A 1KKOA 3HPZA 3E1F1 3SJ3A 3AUOA 3UESA 3GLCA 4JTJA 4D6CA 1JNEA 3MMTA 3GFXA 1CGWA 1XP3A 4RZ5A 2VZVA 4UMCA 7CGTA 4PB5A 4ZFCA 5A8QA 5BWFA 2HK0A 1W9DM 4GI6A 1DJWA 2VTFA 3H55A 2EG8A 3A47A 4OE7A 3STFA 4US5A 2PCQA 1JGIA 1KM1A 4ZOEA 4DXVA 1B9BA 2ZVRA 4F9JA 2CZVA 4U2ZA 5L9FA 5H8MA 6CGTA 3FHQA 4UOQA 5CAKA 2OKTA 4EPDC 4M6VA 1Z41A 3R13A 3N9KA 1DQUA 3G1AA 3AIVA 1K8YA 4HKPA 1TVPA 1XQLA 4H41A 2IS7A 3GTIA 1EQCA 2OEMA 5AYXA 4JAWA 2QCCA 5IM51 1H09A 1AJ2A 1MI3A 3P8JA 3N3TA 3V0TA 3GXPA 4Z2JA 1MUMA 4UR9A 4XZHA 5AHFA 1IZJA 2YXGA 3TLLA 1FXPA 4ZB0A 2ATMA 1HL9A 2Y63A 4IT1A 1B4KA 3WD3A 4LTSA 3A5VA 3GNDA 3LYEA 1EZ2A 4LU0A 1RVGA 4UTWA 1W9XA 3VA8A 3W4RA 1BF6A 1XC6A 3H2FA 1QK0A 5KINA 4CVWA 1UWQA 2WLYA 3B0PA 2QVHA 3NR0A 4RXGA 1F6KA 2CWNA 4JN6A 1Q6QA 2ZWYA 2GUYA 2J13A 2ZDRA 2AL2A 1TA3A 1XINA 2BS9A 2AAMA 1M53A 3WIJA 3XIMA 2XN1A 3VKDA 3AZRA 2Z1SA 3VDCA 1HF6A 1LL4A 1ISVA 5BXRA 3PJTA 2VCAA 4ZBCA 3ZWSA 2PGWA 1DXEA 1QI0A 3PZ9A 1DEDA 3R10A 2QJGA 1KBKA 3RG6A 2ZUTA 4M0XA 4ZE4A 5HUPA 4QR6A 2QCHA 1K4HA 1R7OA 1D8CA 3TAKA 4UQ9A 3IIZA 2IW0A 4UTHA 4FK9A 3CUGA 2XH0A 3N11A 4TUFA 1XGDA 1G9HA 1ADOA 1EWEA 2VD8A 2I5QA 1SSGA 2DIKA 4W7UA 1CB7B 4JTDA 2WCSA 1FH9A 1F6PA 1GJWA 3MWAA 3BAIA 3S5YA 4C6IA 3UR7A 1S1PA 3UGRA 1VFFA 3GWQA 3CU2A 1RPKA 1YPXA 1G4TA 5D2XA 4AAJA 2I5IA 1TJ2A 1SPQA 4DRSA 2PC8A 3IPWA 2WZEA 3TCSA 3ABSA 1EFZA 4DJEA 2QAFA 1C8YA 4R3UA 3HQNA 1A5SA 4HMDA 3MB9A 3MO4A 1TMHA 3QR0A 1MFUA 3NNTA 2E5DA 4O52A 5HPCA 5D38A 4JCMA 5FJUA 2J6XA 3USBA 3HV8A 1WOBA 3LEPA 4CCEA 4JKKA 2CERA 3EEZA 3EOOA 4E8CA 2FLIA 2GVLA 3M5YA 2VR2A 3G1VA 3NDOA 2OB3A 4Q4RA 5HA7A 4WD0A 3S5ZA 3WKZA 2J8TA 3WMLA 3NPWA 1J6PA 2YZ5A 3WD0A 5AY7A 5HPOA 3KP1A 1OIMA 4ADSA 2ESCA 3WX7A 1I2PA 3NO3A 5TAOA 1OBAA 4PUDA 2CC0A 1CPUA 1S3HA 2NT0A 2R9RA 2GVEA 3ZXWA 4F0SA 1XWYA 4CGTA 4EXQA 3TONA 3T2PA 3B04A 1JYWA 5CC6A 4S3DA 3STCA 3UXAA 5D9OA 3W2UA 4PL2A 4U5KA 2DZXA 1QHPA 3QYQA 5C2XA 4MTVA 1EJVC 3NA8A 4E3TA 1TV4A 2JE8A 3RNDA 1UR2A 3SQLA 3OLGA 2PWDA 2V81A 3GDBA 3GDMA 3H22A 1VLWA 3LUTA 1O5KA 4YLWA 5GPRA 3SCSA 4QITA 2QCNA 3NL5A 3KOFA 3NPVA 3IK4A 3WDHA 2YFOA 4M82A 4BFAA 1W31A 4PTWA 5DX7A 4O17A 1J0ZA 4B3LA 1NH6A 3NZGA 3GFYA 1TA3B 2J9XA 1HTIA 1W37A 1BTCA 2X1IA 1PKNA 4LANA 1DTUA 1SO6A 3NAVA 3IJ6A 1A0EA 3OGRA 3UYCA 1JCXA 4D71A 2VDIA 3APYA 5G2WA 3TYUA 1MEWA 3SBFA 3DBPA 3B03A 1XLBA 1QJWA 3NSMA 1K7XA 4H6QA 1BD0A 4JIQA 1CEOA 3O6CA 5BROA 3N2TA 4RE4A 3GVRA 1ZJAA 1KM0A 4J4KA 5D4YA 3RDKA 1V3KA 3H4WA 3EWZA 5FEZA 4EANA 4OWGA 2EEXA 4D8AA 2WNZA 2DSVA 2A3LA 1Q6EA 4AZ7A 5I3FA 1FHLA 5CAHA 3OVGA 3XINA 1WP6A 3KZSA 1LBFA 7ENLA 1UWIA 1C90A 2XGZA 3E49A 1U1JA 3C2EA 1WPCA 3LX9A 4L61A 4JTGA 2YPIA 4XZBA 4XV0A 1JAEA 4I7VA 1AQHA 4TX8A 4GZEA 3E0FA 2O9OA 3WDRA 2C18A 2XUCA 3ARSA 3FXYA 5E0KA 3VU2A 2IMRA 3IUHA 3WQDA 2QYGA 4IISA 3IACA 4L56A 3EA3A 3BPWA 4R34A 3B8WA 2QCLA 4MKNA 1U30A 4UR8A 1PHQA 3MUZ1 1EDGA 1J0IA 3OQEA 4TTGA 3RCNA 5D03A 4FXSA 1V3HA 3MP5A 2QJNA 2VENA 3G1XA 3C2FA 5I7GA 4QX4A 3NQVA 1UZ4A 3VC5A 3ARRA 1GW9A 4DJDD 4IIHA 4UQBA 2FVLA 4HA0A 2QULA 3GY1A 3UXIA 1P6WA 1NOFA 1P7TA 1H50A 4S38A 1YDYA 3VNDA 2O7QA 3RXZA 3GW3A 2X16A 1GJPA 3GG7A 4HK7A 5I24A 2Q09A 4MADA 4EF9A 3WD1A 2DJLA 1MZHA 1TV3A 5IHRA 2CW6A 5G1MA 2E5BA 4AX7A 2GJRA 4NYYA 3CV2A 3HZ3A 3BANA 4WEVX 2QJMA 1WDQA 4KKXA 1QNRA 4W89A 3FGCA 2Y5SA 4DHGA 1KXHA 2DSKA 5ABFA 1EOMA 2E1DA 3GXFA 1IXPA 1RVKA 1W9PA 2FGLA 2G5WA 3NQMA 2CFFA 4IMDA 3CLMA 2I7GA 3LTSA 1PYFA 1QNSA 3VMPA 5ABGA 4V1XA 1VBRA 2CU0A 2D23A 2XM1A 1JZ7A 4MJ2A 5E6YA 1TWZA 2HSAA 3EPOA 3I6EA 4DM1A 3NCOA 5C54A 4JYEA 4XUGA 1B0IA 4L4OA 3P2VA 4BI6A 5T9BG 3H53A 1EXPA 1YKWA 3RPMA 3NVTA 4MHBA 3F5KA 3R1ZA 3CIXA 2CEQA 3I7RA 3HB9A 3W7JA 4BS0A 1DJIA 1TG7A 1F5ZA 2Q3RA 1TIWA 4MPQA 3V0UA 3G1SA 4JHZA 1E9ZB 3TTOA 3PM6A 1SU5A 1CGTA 1A0CA 4FR6A 4W8AA 1NWTA 3WUBA 4O19A 1KGUA 2W67A 3AQUA 5B7ZA 3DC0A 3U7VA 2C8NA 2XWEA 4UUIA 4DEFA 5M5DA 2I17A 3E6EA 4LCQA 3WK0A 2BOEX 2ONEA 3KBVA 1XH0A 3W2NA 2PDJA 4GQGA 4WK9A 1W9UA 3IGSA 5A6KA 2WC7A 3CWOX 3KBJA 3G3DA 2D20A 3HIJA 3KLKA 2C1IA 2D24A 4HSHA 1VIWA 3FVDA 1QBBA 2R1MA 3ZT6A 1PB0A 2PWEA 4U28A 1XLDA 4WKAA 1UB3A 3GZ3A 3LG3A 3ZVHB 2QDHA 1JCYA 1KQZA 1UKOA 5D04C 1K8XA 3T0BA 3VZXA 2AMXA 2WSQA 4WSKA 1BG4A 2A85A 4Q7BA 1VBGA 3AHYA 2FDSA 1H60A 2W61A 2PA6A 3PPHA 4Z2LA 5C8BB 1HKVA 1Y7VA 3A3HA 1XICA 4MWAD 5LIWX 1U1HA 1YTKA 3VIGA 3GS6A 3B97A 1P7TB 3L4XA 5CQ1A 1FCBA 4ATDA 2DH2A 2NQLA 2DZVA 1CGYA 1R6WA 3QM3A 4HSNA 3W26A 3ZFHA 3IUDA 3W01A 3IV8A 1EH9A 1UD3A 1NEYA 3NXLA 4B5TA 2PZNA 4NASA 5LNRA 2GLKA 4GNKB 2IPWA 4Q8VA 3DG3A 3TOPA 1L8PA 3CH0A 4WUIA 1E6XM 1V03A 4J9JA 4QG9A 4W9TA 3VKCA 1JPHA 1J2WA 3VOHA 4BF5A 3MVIA 3R79A 3LM7A 1XISA 4Y8FA 2GSEA 4UFHA 2W6RA 4GGBA 4UOZA 2CBVA 1ONRA 4DUWA 4LV9A 1NOWA 3M1ZA 1M65A 1R47A 3BAXA 3N2BA 2OX4A 3M0YA 2VX6A 4RNHA 1SFTA 4PBEA 3TTYA 1LM1A 1HZYA 1W3KA 2HRWA 3M6YA 3TC3A 4RPPA 3D6NA 3ICJA 3K8LA 1M1BA 3WQOA 2XIOA 2Y7FA 3OTRA 1A5NC 1KFEA 2ZC1A 1T96A 3C61A 3BURA 5CPMA 1NWRA 2VVSA 4Y2WA 4I5XA 2ZKMX 4L9ZA 3L4ZA 2WC3A 4PR4A 2HDJA 4MZ1A 2QCDA 4WSJA 3LY0A 2D0HA 4UTWC 2XVNA 2PRMA 3PTQA 1TCMA 1OGSA 1DIDA 4EACA 5I03A 4XD4A 3PS7A 2I9UA 2Z4GA 4GVIA 4CQBA 2V67A 4I5UA 1XLMA 2J79A 5DXYA 1F61A 4YVVA 1XUZA 1UIOA 2PC4A 4N7QA 3W25A 3AROA 4KBXA 3POHA 4HK6A 1I2QA 4U2YA 3ZS4A 4E3VA 1YX1A 2Z2UA 4GISA 1ZS2A 4F0RA 2WPBA 1ZB5A 2DQWA 4IPJA 2XN0A 3CAVA 3WJXA 1TJRA 4GG9A 9XIAA 4JQ3A 1RQBA 4JKLA 3RK8A 1V0MA 3VPLA 3STGA 5CBBA 5F4XA 3SN4A 4MUPA 2PDWA 2NQZA 2TSYA 3PBUA 3NO1A 3UCQA 4GNJA 4QCEA 3RJYA 3MW7A 4M7TA 2D2HA 3AMLA 3H70A 1NDZA 3R8HA 4O4WA 1RD6A 1O6IA 1TQJA 1WDWA 1XFBA 4UCGA 1PIFA 3QVQA 3GTFA 6TIMA 1GOXA 4DYKA 1VRDA 3WDJA 1DPMA 1CLXA 4IX2A 4DJEC 3C0LA 4KGLA 5JH2A 1J2BA 3AICA 5LGZA 4WLCA 1HJSA 4C5YA 3C0JA 3SY8A 1F74A 1AJ0A 1A3WA 3ES8A 1ZRQA 3VD9A 1PWLA 2O4QA 4UWMA 4GJJA 2VMFA 1XRTA 1DJYA 5EFDA 1RBAA 2DW6A 2E1WA 4B5XA 2ZUVA 1EC8A 4JKMA 4EF8A 5BCAA 3QKZA 4ACYA 3MT1A 1PV8A 3M5ZA 2E67A 4ZQOA 3MUXA 4LUIA 4D6GA 1HFBA 1BF2A 3NUKA 1XRSA 3EX3A 1ZBWA 5CPOA 1E6RA 2CLKA 2E6DA 1YDNA 3VOCA 5CPQA 4JD4A 1FH7A 3QZ6A 2DEPA 1E1EA 4GYJA 4W8LA 2PTYA 3EXSA 2BOGX 4KGJA 3U2OA 1DOSA 3MUIA 2NVCA 5CZKA 3SSZA 5K2ZA 3LOTA 4PMJA 2YDQA 4ZQPA 3N6HA 4BEQA 4N6EA 2HV5A 1G4SA 1H1NA 5F4WA 1S2UA 5BWAA 3S1XA 2EAWA 2A4AA 4LF1A 4MIMA 1V02E 3UWVA 1JDEA 2QCDB 5I06A 2VDHA 4GQQA 4A3YA 4GBDA 3KL5A 4GIYA 2QR6A 3K4WA 3AHZA 3CZLA 4XISA 4GD0A 4Q4MA 1MW2A 1HO1A 2E28A 3VIIA 4AX6A 4LUSA 4E2OA 1BYDA 1S5MA 3ABRA 4KS0A 4RNIA 1EJRC 3B9OA 2HBVA 3WEOA 5K4XA 1OADA 1IZKA 3RM8A 4H9YA 1F05A 1JZ5A 1W32A 4O50A 4ATWA 5C0QA 3IEBA 2WSPA 5XIMA 1TV8A 2FZDA 4D6EA 4Z0SA 3G3MA 4GCAA 3DAQA 3DIPA 4FOUA 3M7WA 3MCNA 4C5ZA 3KBMA 1IQ8A 1UPPA 5E5CA 3U3HA 3QEZA 1GNXA 1XL9A 4KWUA 1S46A 2C79A 2IQDA 4GYPC 4J3UA 4JN8A 3ITTA 1SW7A 4LSBA 5C9ZA 2J77A 4AYSA 4DF1A 4Z1CA 3SCOA 4GXWA 2A3BA 3JVAA 4RL3A 1RBLA 1X96A 1RUSA 2HWGA 4QBXA 1HXJA 3TWAA 3ONCA 2Z1VA 4M1BA 3CYVA 2PWHA 1CI1A 1ENUA 2FGBA 1UR8A 3VGGA 4JY9A 1I45A 2E25A 2C6QA 1GWJA 1R0MA 2JIWA 2NQ9A 1F4HA 3W86A 2Q6ZA 2ZZ1A 4R85A 4AY1A 5E0FA 3W84A 1EJTC 2QCFA 3MHGA 1TV7A 3G1YA 2GOKA 3IAPA 4ONVA 1KGXA 2HEJA 3CWNA 4PMUA 4JGDA 3RLGA 1VBJA 2C15A 3TMQA 5DCDA 1AVAA 2WCGA 4L9YA 3MBFA 3EA2A 3OZPA 3CTTA 2Y8VA 2FHBA 4Q8WA 4M80A 3R89A 3N4FA 3QJAA 1W1PA 3SURA 4FNTA 3O1NA 3URBA 2REQB 2YL6A 3TKFA 2CZFA 2R24A 1H1YA 5LIYX 4RPQA 4LVGA 4WGXA 4FX6M 4DX3A 2W63A 3W82A 2R8WA 3CMGA 4MSSA 2F2KA 3NZ1A 4DWSA 1W2VA 3B06A 3EWDA 4O8AA 2J74A 3ZZ1A 3LN3A 1E5JA 5BRPA 3H7RA 4W5ZA 3SUSA 3FK4A 4G6CA 1VEOA 3UYIA 4NX0A 3S4TA 4Q33A 2OJPA 4F3HA 1E0XA 4XB3A 4IIEA 2R6OA 3GB6A 3GC2A 5FF7A 3LHVA 3GG0A 5E9AA 1GPFA 1JDCA 4X2RA 5FL1A 4C6BA 2ZFAA 4B3KA 1UWTA 2WJDA 3W22A 4RE0A 3BSMA 4NNCA 3WF3A 2PD5A 1Q4WA 2VT0A 4X61A 1L2UA 4AH7A 5LNSA 4LUSB 3U4FA 3KRBA 4JOMA 5FJJA 3A4XA 3CQIA 1ONXA 3N19B 5CSUA 3W6MA 2YDSA 1RLDA 4JIRA 2HNEA 3BCDA 1O60A 1GZ1A 1TPVA 4ZTXA 4LGXA 3PPGA 1A5KC 5I3KA 4AZIA 1THFD 2WMFA 3W29A 2HPIA 1TQXA 5JQ9A 4YTRA 1IIGA 4W7WA 1XLAA 2X40A 1OYCA 4QNEA 1GW1A 1Q63A 3QW4B 4DO7A 4GFIA 2G95A 1V93A 4UNLA 2BY3A 4LW7A 5CZTA 1E6NA 4IPNB 5JIWA 1H61A 1QI3A 3CJPA 5A3HA 3GBEA 3FIGA 2UV8G 1JZ3A 3IK2A 2ZUUA 3SRKA 3LSCA 3ANVA 2MUCA 1M7XA 3AALA 4FHAA 1ITXA 2IKHA 1RCXB 2QZRA 3UP8A 1UKQA 4IHCA 4NRSA 5DBTA 4I6KA 2OU4A 1F2JA 3RLUA 3U9IA 1ELSA 1E4NA 1HJQA 2LLEA 2O55A 1R8LA 1TPWA 2F2HA 1FCVA 1GVSA 3FCPA 2OO6A 2Y61A 3MHFA 3AXXA 4GJ1A 4JTTA 2YA2A 4PTNA 1XHGA 5FSDC 3BG5A 1SZRA 2DZPA 3BGAA 1FDZA 4C6NA 1WXYA 4BF9A 4PYSA 3S0CA 4H00A 3WMCA 1XYAA 4HBKA 2FPVA 3H26A 2J8FA 3SRDA 3TN5A 4F9DA 2V38A 4QHRA 4LNYA 1N82A 2QDGA 5G2HA 4RK8A 2V3DA 3TROA 4ERAA 2ICSA 3ZOAA 1KFJA 4FI4A 1XG4A 3KE0A 1KW1A 1NFPA 3O6YX 3P61A 1S2TA 2DVUA 4ZL1A 2Q3OA 3AXHA 4FALA 3EZ4A 2RH9A 3K13A 4YL2A 5A5WA 3OODA 4DWSB 4C7GA 4JTAA 3WUGA 5I6SA 3FDKA 1MDRA 2VDGA 2WWCA 4A35A 1RPXA 3L12A 3S2LA 1UUMA 3VIJA 3UJSA 4N9BA 4N9EA 1V0KA 1BRLB 3UCCA 4I8DA 3ITVA 1AUSL 1UUQA 1JGMA 1WDPA 2C0AA 4UC5A 3CQKA 3GVQA 1CXFA 3W76A 5BOFA 3VINA 3EEGA 5AYBA 5U7SA 2BLEA 3B40A 3CLWA 3B9EA 1EC9A 3C2YA 3FXGA 2BX7A 2Z7GA 3THCA 2W27A 1OABA 1NDYA 3VIPA 1Y0EA 1KO0A 1X1OA 4NXKA 4YTTA 2H8XA 1ONEA 1ITCA 4HOXA 3O0KA 4CD8A 2XINA 4X2PA 1L6SA 4CCCA 4Q4OA 2D1ZA 2D69A 2PDPA 3H21A 4G1KA 3UZYA 1YXYA 4UTKA 3TC6A 4G7EA 1HJVA 3WBAA 3FV9A 4GY0A 3NJ3A 4YWSA 2OXNA 3CUFA 3N18A 2PDHA 4S3GA 5I09A 4JCLA 2HQAA 2OZ8A 2VFGA 4IX0A 3VE9A 2YCEA 1MMFA 4JDBA 4NAFA 1H7RA 4NG3A 4XZ9A 3BV4A 1W17A 3SCPA 1TCDA 3KDOA 4HU8A 2J7CA 4GPNA 1C8XA 1I0BA 4O1FA 3LCFA 4KEUA 3L5MA 2Y85A 3SCWA 4KMQA 2XFWA 2FPTA 3G8EA 3QQWA 2QT3A 2V68A 2P0OA 1YBQB 4AVOA 2WHKA 1US2A 3H2MA 1TZZA 4JTKA 3A21A 1B31A 2VWSA 5J8LA 3HG4A 4K68A 1LT8A 2PTXA 4HPNA 2NXGA 1F07A 3P0WA 3LPFA 3GXNA 3HG3A 3UA4A 3MSRA 4UMBA 5D8ZA 2ON3A 3WMSA 4NZ5A 3CC1A 4HJFA 1UKSA 3DFQA 3IVSA 1XKJA 4A2SA 1LP6A 4NJGA 3NWRA 1E3XA 2YJQA 2KAUC 1M04A 1L6GA 3A9BA 1G7VA 3I10A 3QC3A 4BZYA 4MVAA 3KHDA 4JTLA 1XDJA 4GGHA 4KQNA 4IUGA 3GIYA 5DO8A 4CQ9A 3BICA 2EHHA 5CZJA 3NFUA 1I4NA 1B3OA 1W5QA 1NDWA 3CV7A 5HMFA 1CT5A 2ZE3A 4QDPA 2CZ5A 1VB9A 3WNNA 5FCZA 2ISFA 4FXFA 3EOUA 3UBPC 1XCWA 1GOIA 4KRZA 3CAWA 2QS8A 2DZTA 4PSPA 3THQA 2AOSA 3OP2A 3HMJG 1R86A 3TSDA 3SUTA 2INZA 3EDEA 2IPGA 4WKHA 2WBGA 4GRSA 4GLEA 4QG6A 5A6LA 4B2DA 4KRUA 4F66A 3EDFA 4GQBA 1JZ2A 4PCTA 1Q6CA 3GTHA 5M2FX 3AI0A 2DSUA 3R11A 3TX9A 1J9YA 2O56A 2PP1A 4TVCA 1FHVA 4HK5A 3DECA 1F6YA 1HJWA 3FS2A 1ADDA 2JKAA 5M03A 4O18A 5CSYA 3LZ3A 4GVFA 3MYOA 3S6TA 1OG6A 3PC0A 2VX5A 4NP7A 3A9IA 1UUOA 3AWNA 5D2WA 5LNUA 5KETA 2BZNA 2ZUWA 3WK2A 1KR0A 2UY4A 2I56A 2XGIA 1P6CA 4M6PA 3B3DA 4ICMA 3HOJA 2OCZA 4U3CA 4DWSD 3FA5A 2HISA 1XH1A 3MKCA 4MKVA 1A0DA 4PCFA 3V36A 2A6NA 3QR1A 2C1HA 3B8DA 3V5FA 4QE5A 3W7IA 2VEPA 4EXAA 2DDXA 2V63A 3UWZA 1S5WA 1KFCA 4K8EA 4Z1DA 2GQAA 4G7EB 3NVDA 4HNTA 1XLHA 1XPYA 1KBLA 1E56A 2CHOA 1LOQA 3IIXA 4AWTA 4L6DA 2P76A 4W4QA 4IIDA 3SCUA 4PZVA 3TK7A 4UZSA 3UWEA 3O6AA 1W9VA 3ZJ8A 5I3DA 4ATLA 4GY1A 4R53A 4LEQA 4NAFB 4A3QA 4EKJA 1WXZA 4PMNA 3GUWA 5BOOA 2G4JA 3EWCA 3D3AA 2OPJA 2OT1A 3SCTA 3LPOA 1RA0A 5HQMA 1X39A 3F4WA 4MJ4A 1QNQA 2WZMA 4X22A 3PSWA 1ZQ5A 3ZJKA 1IXNA 3KVJA 3PWGA 2Y7DA 1KFLA 1OGGA 3CHVA 1GPWA 1B3WA 1EHAA 4GOAA 4FLSA 1QW8A 3N4AA 4XVEA 3M7SA 4PB3A 1ZU8A 1YPFA 2IUZA 2YYUA 2ACQA 5FJRA 3VIFA 3F5LA 4DAIA 2YLLA 3MMWA 2X8RA 1RY0A 2VOMA 3EKGA 3VCNA 1DWHM 1OB0A 3GRIA 1OD0A 3SQSA 5L6UA 1QU4A 4OV4A 4YCPA 4AD3A 1OFRA 1LWHA 4YCOA 1VR6A 2WHJA 4IGSA 4F0LA 5I3IA 3C52A 1FBAA 2PTWA 1EOKA 1ZP4A 4AD2A 1EIBA 3CT2A 1GZJA 4YVPA 1CW2A 1V3IA 1MQPA 4UNIA 2PPGA 4PMXA 5JU6A 4XSMA 3VD4A 5HQLA 1XYBA 1JPIA 1OZQA 1S2CA 3E5PA 1PZ2A 5DXXA 2JGQA 1MNZA 3VM5A 1NOUA 3ABOA 3HTWA 4PEKA 3VNIA 4J3TA 1RD5A 3GU9A 5ABEA 1MSSA 1Z3NA 1XGEA 1IV8A 9XIMA 4YTSA 3N6JA 1JYXA 2YW4A 2X1RA 2VJXA 3GQYA 3TTQA 3W70A 1GHRA 4N6FA 3Q2DA 4WDTA 2ACUA 5FESA 4A8NA 3O8AA 1FUYA 1T0OA 2BWGA 2NW0A 3FEMA 1TR1A 3V5CA 4Y6GA 4CNNA 1HJXA 1LBLA 4QS6A 3K4AA 4O12A 1PTDA 2E6YA 3GXIA 1SYTA 1JL8A 2WAGA 4FF7A 3ATYA 4V2XA 4IPPA 3QV9A 1FFQA 4EIVA 4Q7NA 3FHAA 1A5OC 1DWFM 5FF0A 2AKMA 5A95A 1M7PA 5LIUX 4JTFA 5KEZA 2ZX5A 2CLOA 1LUCB 3ZLHA 5K9CA 2H6RA 1H62A 1QNVA 3R5EA 3BW4A 2HCVA 4AIOA 5CPTA 2NWSA 3FJNA 4FAMA 7A3HA 5AHNA 4DYEA 3GO2A 5TF0A 1XSKA 2RFGA 2DY3A 3UA3A 2WSKA 1Q7MA 3WLPA 1V7YA 2Y1HA 1MQRA 4E4UA 4Y9OA 1UWSA 1BXBA 1LQ0A 1WKFA 4M6UA 5BZAA 4G7FA 3PJXA 4L4MA 1I75A 4E4FA 2GYIA 4QNWA 2VYOA 4AWEA 2G3NA 3DHDA 3RIKA 3VUSA 4HT3A 1QVBA 1IR1A 3R0UA 4Q8TA 5DCBA 1Q2SA 2EF9A 3K8KA 4CKQA 3C6CA 2GVYA 1XC4A 1GVYA 3H4XA 2WMKA 4G5DA 3TE9A 1OX5A 4RKAA 3G5EA 2GGEA 1VBHA 1WA3A 3LGGA 4HCDA 5C55A 1QW9A 3B9NA 3L21A 4Z2GA 4K1GA 3IVTA 4NZ1A 3O15A 4GX9A 1I60A 3UR5A 2X2GA 2FJKA 1Y8BA 4IQDA 5E0CA 3RM9A 4M7SA 3HPSA 4KESA 1UD4A 5AKQA 4R27A 3Q94A 1VRXA 3ALFA 5D2TA 1B1YA 1KM5A 3N9RA 5AYYA 1R3RA 3FN9A 2SFPA 1C7TA 3DFPA 4WQ6A 5AHLA 5LNWA 6REQA 3LHUA 3JZUA 4LF2A 2VRKA 3ARQA 3M0IA 2Y6ZA 2VFHA 1GVQA 2AQWA 5FAGA 2C91A 1E1FA 2Y0FA 4K8GA 2PF8A 8CGTA 4O11A 4C6LA 3D3FA 4Y90A 1Q7QA 1CENA 3NZQA 4AXKA 1R2RA 3U6WA 1OG0A 2B0MA 1W3JA 2VO5A 1LQ2A 1RJPA 2QUMA 4UFIA 4LCRA 3UQNA 5I3GA 4HIBA 3WEMA 1Q45A 2VI0A 3ITLA 2ALDA 2EPMX 1VP5A 3RMJA 1UD5A 5CH9A 5F2GA 3U5UA 3WQ4A 2Y4SA 3KX6A 1D8WA 1X98A 3DOPA 3EWXA 2PDGA 3SO7A 1MWOA 1X6NA 2YZRA 1EDTA 4B4FA 3AXKA 2EJAA 1VFSA 1V7AA 1F8MA 2CBIA 3N2CA 3N34A 5IFTA 1OC7A 5DELA 5IHSA 3ABXA 1ALDA 4ALDA 1JQXA 3MO7A 4N2YA 4OIFA 2CLPA 2J27A 4IMGA 4IQLA 3FDGA 4LS2A 4ML4A 1WZMA 4RDVA 1D3CA 2DSZA 1QTWA 3LK6A 4BWLA 3AYRA 4I7WA 2X41A 2A1YA 4IJBA 4L4LA 3DYOA 2EG6A 3USZA 1SMDA 1A4MA 3O6DA 4C91A 3WO8A 4XIMA 1QNPA 4R7WA 5LA2A 1FWCC 1SZGA 2J9ZA 2DGAA 4KEZA 4LX4A 4S1FA 3NGJA 4TV6A 5C71A 2XN2A 2P0IA 3BCFA 1RK5A 4AHOA 2QGYA 1CCWB 1JI2A 1WZKA 1JXKA 3LHZA 3HG5A 4C6JA 1L9WA 3H6OA 3OLEA 3U2EA 1FP8A 4NJJA 5A8MA 1TELA 4OKDA 3STEA 1XFCA 1L8NA 5C2GA 3S6OA 5E70A 3NOEA 1VKFA 3NXFA 2PRHA 2DIEA 3B8IA 3W7KA 5REQA 1B3YA 1BHGA 1TVLA 5FF2A 4ACZA 2IXVA 4HN8A 2WZTA 3BZGA 1DWGM 3G1DA 3VD5A 3RR1A 3TYZA 4Q6JA 1J11A 2H9AA 2DT0A 1MUCA 1QASA 2F8QA 4J2PA 5I07A 3BMWA 1L6WA 5GNZA 3B8VA 3FA3A 3FEQA 3E2VA 5A2BA 1BYBA 1UPMB 2XH4A 1UR1A 1NU5A 3W7QA 2JEQA 4V28A 4XD6A 3BSGA 4BQ5A 2WVVA 1VJZA 3N2XA 3CQ0A 3ARTA 1OWQA 1VAHA 4C1NB 6REQB 4DIAA 4HYVA 2CITA 4IFRA 4MB5A 5A1AA 4MM1A 4NHVA 2JKEA 4NT0A 3ID7A 2A0NA 1W3NA 1VBUA 1KD0A 3GKAA 5JUVA 2DP3A 2F84A 5LKYA 3W1AA 4MLJA 2PDLA 1S2WA 4ENLA 2J24A 3QKEA 3ONBA 3B8TA 5DQPA 3SIMA 1UOKA 3CHFA 2DH3A 3F1QA 3CQJA 4X0NA 4MAVA 4AYGA 5E9XA 3DBNA 5I2UA 1R9XA 2DW7A 2NQJA 2OSYA 4HHPA 3W1LA 4J28A 1PTAA 2GPTA 4IXHA 4NU7A 5LXEA 1DJXA 5TBOA 2J78A 4ADUA 2E8ZA 4OFCA 4QJ4B 1KWKA 2J7BA 4CN1A 3CV1A 3BG9A 3LXBA 1LCOA 3UY7A 3LB0A 2X42A 3EOLA 4O8RA 3P3BA 3BZJA 3KZPA 4F8XA 4KFPA 3S3GA 4HU3A 1AD4A 1Z8AA 5HR7A 4GQ0A 2WMIA 4LALA 2CKRA 2BVWA 3F4VA 4JTHA 1TE6A 2PI6A 2PF0A 1PYMA 3PNZA 4F40A 4HP5A 4GIRA 1QPNA 2AL1A 3QRHA 2CCRA 4K39A 3DG7A 1DYSA 2ZTKA 1BQGA 2VGBA 1AZ1A 3KL0A 3LTPA 1E73M 5CJNA 2JBMA 3CS2A 4I9TA 4GVGA 3CTLA 4QSFA 4GYFA 1PVNA 1YLVA 1P0KA 3UG8A 3SSJA 2XWDA 2Y5EA 3QZEA 2PD9A 3A12A 2VCBA 3S5NA 3W00A 1BYCA 3GG8A 4IQJA 2EO7A 4IL0A 1H11A 2W9MA 1BSIA 1TPUA 1J93A 2VEKA 1R3SA 1SFSA 3DGBA 5AVHA 2HXUA 4HOZA 5A6AA 2NUYA 4Y9NA 1UG6A 1FX6A 1ZL1A 1DV7A 4RDZA 2BVYA 1LG1A 3LPPA 1HVXA 3TFCA 2MNRA 1JD9A 4XVDA 5REQB 1QDSA 4GIAA 1WO2A 2FPYA 4ML9A 4N9CA 3VOGA 3NQ7A 3WLOA 1UP3A 3DYMA 2H9AB 3TDFA 1IWBA 3IWPA 5U4NA 5CC5A 4H2CA 3TIMA 3H2EA 1MRQA 1CLKA 3IGXA 4GFSA 3HGSA 1BVZA 4NZ4A 1E51A 2J7FA 5EBUA 1K03A 1OHLA 2E09A 1GEHA 4UZUA 3PAOA 1US0A 3V35A 4NQ1A 3TH6A 4PUUA 3QHMA 1J0YA 2GUBA 4HNNA 5IDZA 4NJHA 1Y5VA 3TW7A 1W54A 1OVDA 1OFQA 3WDIA 5T91A 2R91A 3RN6A 3NYZA 4C6DA 5IXEA 2FQIA 2V0TA 2Y62A 1JYVA 1YE6A 4LYKA 4MJMA 1YQ2A 4ORMA 2DPEA 2FH6A 1TJ1A 3RCYA 4E4PA 3P81A 3ZR5A 5I02A 4I8YA 2BB0A 3BJFA 3R43A 3OLIA 1TZ9A 5AC5A 4D6HA 1QHOA 4BY3A 4KW2A 3H12A 4J1OA 1UH4A 3H24A 1QUMA 4C1KA 3FJ6A 2YDAA 2J88A 4XIAA 3VD3A 4CNSA 4HNUA 2B7OA 2X1TA 3LLFA 2HS8A 4LXFA 2FDMA 4JXCA 3QMSA 3QQ1A 4R9XA 2J7DA 3PBWA 4AB4A 4XAZA 4XBKA 2ZX8A 4NNBA 4D6FA 3WUEA 2WMIB 3MCOA 4MY1A 3TP4A 3DERA 4GO8A 1R3YA 4EAMA 1KRBC 2V3GA 4UFLA 5F2IA 1NF7A 3N12A 3VGDA 1LWJA 5B80A 2J62A 3A64A 2GDQA 3W24A 3S8HA 3WJZA 1FWFC 2DUAA 3O07A 3LCIA 3UY8A 1A5BA 2XSXA 3WNOA 2CZEA 1QPKA 1FWSA 3DX5A 4UFMA 3HFYA 1HQTA 1S38A 3IVUA 2YBVA 4CNOA 1EX5A 3RPDA 1EHNA 3ARXA 3UERA 4RDYA 4PTMA 4DYJA 4Y7EA 1DHKA 4JIIX 4IGHA 1W5OA 4LAKA 1YPIA 4WY0F 2QCGA 4QJ1A 1YXCA 3FKKA 5HR6A 2QV4A 3ORWA 3U2CA 3UG4A 1KCXA 1GTEA 2XVGA 3AFBA 4QJ5B 4L1GA 2XIMA 1JULA 3THAA 1CLVA 3WY1A 5K9DA 4Z1AA 1F73A 3N4EA 5F2MA 2PUZA 5C7VA 3MSGA 3A22A 1VQTA 1YE4A 3F5JA 4CU7A 1VJSA 3SUWA 3NSNA 3C86A 2RDXA 2WC4A 2Z1KA 1FKXA 2P1FA 2O9PA 1RZMA 1UD2A 3POCA 3KFTA 3LHWA 2D3LA 3BCJA 3GHSA 2C16A 3VM7A 3O3RA 5ABHA 1KTNA 1BWLA 2UWFA 4GX8A 5AYIA 4P5UA 3MQTA 1JVNA 3VDAA 4TX6A 4B92A 4H9TA 1K8ZA 3CZ8A 2ZQ0A 1XUUA 4RDWA 4CQCA 3AC0A 3A5FA 4Q8UA 4DVOA 4RV3A 3VMNA 1BEUA 3PZIA 2VCCA 4R5EA 4S3JA 5BOEA 1E6ZA 3M43A 1IXOA 5D33A 1TVNA 2OLSA 4GUIA 1IT8A 1KLZA 1GTHA 4KIRA 1O68A 3OZYA 3IARA 1ZALA 2VGFA 1HN1A 3ITXA 1KB3A 1UZ1A 4W85A 4K6AA 5CG7A 4FIQA 4B91A 1UWUA 2VHLA 1NTHA 1EX1A 2YA0A 1DORA 3ZWTA 3AJXA 4U5IA 3GSMA 2NT1A 3OG2A 3H2AA 4JYFA 2YYTA 4W5UA 1Z6KA 1TPDA 4P7LA 4HA3A 4WJXA 3SW6A 4OBTA 1A80A 4G1NA 1E0UA 3WL0A 4TVUA 1OEPA 4IF2A 2HBXA 2E6AA 4IUOA 4LJ3A 3URQA 3SCRA 4JEJA 5HNRA 4L64A 2TMDA 5LYRA 4M3PA 2EPLX 4LH8A 4P7NA 2V3FA 3M64A 4BQ4A 2BY2A 2VL4A 1X6UA 3T78A 2QW5A 4QRNA 2BXZA 4ECLA 2C3ZA 2VGGA 4PMVA 1DJGA 3TSBA 2ZUNA 2PDIA 3TJXA 1U83A 3BGGA 5HNUA 1E43A 4ZXLA 5J04A 2RHGA 4DBDA 5CG0A 3VX0A 2GDVA 1OCQA 3W2LA 3DCPA 4RW3A 2Y88A 1U22A 4HTYA 3AYSA 1GQLA 4M56A 1XM3A 3VNYA 5DFAA 1BGAA 2NSXA 1J96A 3Q45A 4QGCA 4DPQA 1DJHA 3KTXA 1B4EA 1XRVA 3Q65A 1VFMA 4YPJA 1JRBA 4UB9A 1WE5A 1PL9A 2YL9A 3OGSA 2WSYA 1FWRA 2PTDA 3KAOA 2WJZA 4BWLC 1Z42A 3BOLA 5D2VA 1J6OA 1U1UA 1W3IA 3K8MA 1RXOB 2XM2A 2DFAA 3KTCA 3WD4A 3AUJA 2X09A 3BJSA 3ANUA 5FD0A 5JVLA 4DJDA 3LBMA 3K1GA 3ZR4A 3L9CA 2D22A 3ARWA 2XU2A 3QR3A 5DF0A 4OOZA 3WD2A 1C29A 3W53A 1I8JA 2PWUA 3R25A 2FGZA 2GL5A 2ACRA 4N0RA 1BPLB 5IBXA 4O15A 2ZRUA 2YDRA 2P50A 4AD0A 4NYUA 4MB1A 3THUA 3QPEA 5HXMA 3MI2A 2V5LA 5HDRA 4DF0A 4HA1A 4BJHA 1E55A 2WO5A 4DO5A 2PTZA 2V2CA 4HQVA 3LDVA 3THDA 4JFVA 1SO3A 4KFNA 4LRTA 1UW9A 4HPGA 1WDRA 3P74A 3B0XA 4OOUA 4HHLA 1XLJA 1MO0A 3N2MA 4O53A 2E6FA 3UZ5A 2YX0A 2ZZ2A 2JALA 1TV2A 4IL2A 4IGNA 1K9TA 3LV5A 3SGUA 3NG3A 4GZJA 4GK8A 2E8YA 2EKGA 1A47A 4XUYA 4C90A 4AXNA 1BAGA 4TU1A 5H8UA 1DJZA 4MYAA 2E3ZA 4P8WA 4IP4A 2HJPA 4A2RA 5D02A 4D2JA 3OZMA 4HNLA 4TX9A 3W3OA 1MDLA 3L67A 1NFGA 3TAOA 4A8RA 3PWIA 3RR4A 5AB3A 1CYGA 1EPVA 3TZFA 1OFOA 3B4UA 1AK5A 5A6JA 5H6HA 1QOPA 1VGAA 1TX2A 3CAQA 3NYDA 2VR4A 4XSLA 2FZ8A 4NL1A 1T41A 3A13A 1N8FA 3AIBA 4AZBA 4IFKA 3E2SA 5CC3A 2H3DA 4O1DA 4PGLA 3WNLA 2DZAA 3GW0A 1FWAC 4Z2KA 5MKGA 4KPLA 3TUUA 3M4HA 4YMZA 3R94A 1X7FA 4DJFC 4AEEA 2AKZA 2OEJA 3O16A 1E6QM 4FOKA 3DHPA 2F6UA 3OG3A 5FJTA 1MEHA 1FWNA 3BLKA 3MANA 4ES4A 2B81A 2DV0A 1S1RA 3FNDA 3M41A 4ZXOA 1W1ZA 1HKKA 1I2RA 4ICCX 4GWEA 2OG9A 5EBAA 3MJYA 1E9LA 3SCVA 2XPKA 3S2CA 2PMQA 2WVUA 1O1HA 1V4YA 2J8GA 2XVPA 3LCGA 2AAAA 1YHTA 3WEZA 2BMBA 3F4DA 3LS9A 3VNMA 4EOUA 3O06A 5JMUA 3O05A 3EDKA 1GJUA 3IUIA 3WQ5A 1W8GA 1ICQA 1Q3NA 3B9DA 2V5DA 4MB3A 3WBEA 1LRTA 4AW7A 3OVRA 4Z1YA 1GYLA 2ZBTA 2A2IA 1X7IA 3V4BA 4WJ8A 4AD1A 4AC1X 2VR5A 1EC7A 1Z32X 4E8GA 3UT0A 4GKTA 1ISYA 3F2DA 1KXTA 3CHCA 4QXIA 1LLWA 2Y7GA 4MWAA 3N15A 3B4YA 3HJZA 3NDYA 1JF6A 1W91A 1W5PA 5AYZA 3CUZA 3MS8A 1A5CA 4Z1BA 4KWOA 1BG9A 2EPNA 2YR1A 5I00A 4QAIA 1CWYA 1IEIA 1MXGA 1NWUA 2HK1A 2JFEX 3OO2A 4M81A 6TAAA 3GK0A 3O0FA 2YSWA 2ALRA 1WDDA 2TAAA 2VVNA 3C2OA 1AL7A 3GR7A 3EMZA 3WLJA 4H9XA 5I77A 4IQEA 4YIWA 3LGDA 3G1RA 1TRDA 4US6A 1SSDA 3VOFA 3KP0A 3IJ7A 1PAMA 2QJJA 1H49A 3LM3A 4JX6A 4CNTA 4GCXA 3WMBA 3SCNA 1ITQA 2X7WA 3EKLA 3NQCA 2WANA 5EPDA 5LIKX 3EGJA 4W7VA 4OVXA 1U5HA 1DP0A 1KWGA 1DJQA 3TVAA 3BLEA 3VIOA 3S5SA 3GR8A 2WOQA 1GORA 4IM4A 3EB3A 1GK8A 4YTUA 2Y89A 1OX6A 3GNPA 2HNHA 3AO0A 3GIPA 2XYLA 4W87A 3DYPA 1IEXA 2VFDA 5C9WA 2Q8XA 3WF0A 2OR2A 3WYZA 4N4PA 2INEA 3RPTA 3U8GA 4GC4A 2G3IA