1MZHA

Qr15, an aldolase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
225
structure length
225
Chain Sequence
MIDVRKYIDNAALKPHLSEKEIEEFVLKSEELGIYAVCVNPYHVKLASSIAKKVKVCCVIGFPLGLNKTSVKVKEAVEAVRDGAQELDIVWNLSAFKSEKYDFVVEELKEIFRETPSAVHKVIVETPYLNEEEIKKAVEICIEAGADFIKTSTGFAPRGTTLEEVRLIKSSAKGRIKVKASGGIRDLETAISMIEAGADRIGTSSGISIAEEFLKRHLILEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Aquifex Aeolicus Aldolase, Northeast Structural Genomics Consortium Target QR15
rcsb
molecule keywords Deoxyribose-phosphate aldolase
molecule tags Structural genomics, aldolase
source organism Aquifex aeolicus
total genus 86
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1mzhA00
3LRMA 2VFEA 1LROA 4AAJA 4JTJA 1SO4A 2TSYA 3G0XA 1JVNA 3NPXA 3NQ2A 1K8ZA 5BRBA 3EWZA 3W7EA 1VC4A 1TTIA 3LX9A 2B4GA 3ZWTA 5CZSA 4I7UA 1V7YA 5FESA 3GKAA 4ZQNA 1X1OA 1ZCOA 2FB2A 2ZQ0A 3PY2A 4IPIA 4PFMA 3NL5A 4ADTA 5EMUA 4LRSA 2G95A 4DXVA 3LB0A 3QSRA 5BMXA 4C1LA 2JKPA 4HIBA 3TIMA 1ALDA 1K7XA 1SFLA 1Z48A 3IGXA 3MHFA 1KW1A 1VHCA 4OT7A 2VFHA 2Y62A 3P82A 3KXQA 3MJYA 2OJPA 1JCJA 4NJHA 4FHAA 5DCEA 3LCIA 1YLVA 3GDRA 3INPA 1XC4A 2BTMA 1KBJA 1X6UA 4Y90A 3E9AA 1TJRA 5D33A 4HPJA 5I3KA 3N14A 2ISVA 1O4UA 2EGZA 3KX6A 3TC7A 3G0UA 4I7WA 4K39A 2QJHA 4M6QA 2RHGA 4NJGA 1KM0A 2E68A 4M19A 4FNSA 2ZZ5A 3GDMA 3LXAA 2ABAA 4JR5A 1LOSA 2CLKA 5G2WA 3GX9A 2C14A 5D03A 2BZNA 1YDVA 3M16A 2HS6A 2C1HA 4IX0A 2ATMA 2X1RA 3WK3A 5I3JA 2ZZ2A 1T8XA 3I65A 4N9DA 3JR2A 2YDAA 1C29A 2V2CA 3QM3A 3P84A 3R89A 1JCLA 3NQ7A 1S5VA 1UB3A 5CPOA 2WKJA 4NNCA 2ZFAA 1WOAA 3DBPA 1EUAA 3BV4A 3NVTA 3N2XA 4DO4A 4DF2A 4NXKA 3M7WA 1Y0EA 3A22A 3C2OA 1NAL1 1W56A 3IRDA 3NYZA 1OYAA 4ORIA 1GVRA 3Q94A 4S1FA 3VCRA 2EKCA 1XM3A 4J9JA 3MI2A 4UTIA 1QO5A 4IXHA 1W0MA 5TQLA 3W73A 2E09A 1O5XA 1UBSA 3R8RA 3NNTA 1A5AA 5IM51 2H3BA 5I3FA 3I7QA 1L9WA 4X2RA 1W5PA 3FLUA 4QSHA 1WV2A 2QCNA 5LNRA 3CEPA 1RD5A 1VPXA 4OHQA 2AGKA 3W7DA 3K30A 3LHTA 3W1LA 3BPWA 2FFCA 1GG1A 5CGQA 5AC7A 2BXVA 2V30A 4KFPA 3AJXA 5DLCA 1TQXA 5DELA 2C16A 3FKKA 3SI9A 2NX1A 4UFKA 4DO6A 3G1FA 4K38A 2CW6A 3PAJA 3LTSA 2FTPA 3JS3A 1OFQA 3DXIA 3NQEA 3TH6A 3UZJA 3C2EA 4JGDA 4ORMA 1YDNA 3W6YA 3BW4A 1K3UA 3TV8A 3W86A 3HBLA 3G1XA 4UTUA 5AHMA 3A5VA 3EXSA 2IQTA 4X9SA 5GVJA 1I2PA 4LNYA 3KVMA 3MHGA 4MYXA 4RK8A 3BVJA 4HN4A 2P0OA 1KLZA 4MFEA 4LS2A 2Y61A 3TXZA 4JY9A 4QISA 4O13A 2VFGA 5I3IA 4GFSA 1TTPA 1SZEA 3PULA 4AVFA 5AC6A 3LLDA 4NQ1A 4MJMA 4BR1A 4X3ZA 4NJKA 2ZRZA 1EEPA 4LW7A 3NQAA 5LSMA 1UCWA 2NXHA 2PRLA 4GBUA 2A85A 2X2GA 3A24A 3LCXA 4B5NA 5FEPA 3IV3A 4DEFA 2AAMA 3OIXA 3G8RA 3SGZA 1TMHA 4LUIA 4O15A 3W2MA 3FS2A 1PV8A 1FDZA 2VENA 3U8GA 3GR8A 2ABBA 5K9CA 1LRQA 3EEGA 3W23A 5FF0A 3MBFA 4YWIA 2Q8LA 3LHZA 4HNVA 3LV5A 5AFDA 5BNKA 3N9RA 2B7NA 3M9YA 1ZAHA 1O5KA 1TRDA 2OT1A 2FPTA 1L6YA 2ALDA 1G6CA 4WQ6A 2ZRWA 4S2CA 4WXYA 2NX9A 3FFSA 4DPPA 1OHLA 2YW4A 1J4EA 3W1AA 2NXIA 1JUKA 4NZFA 3DGRA 3G1YA 1GTHA 3NQGA 4AHPA 4CQ8A 1OFOA 2Z1BA 4DQWA 1LLWA 2R8WA 1SUXA 1DJQA 4OE7A 3O15A 4O28A 3C2RA 1JJKA 1VHNA 2QCGA 3N9SA 5DXXA 3BARA 5H2ZA 1RQHA 3NPUA 2GPTA 1C9DA 3HOJA 3W7PA 2PRMA 3MO7A 1TPEA 4C1KA 1P4CA 2VEIA 4K36A 3TFXA 1VYSX 1ZJIA 2NUWA 3CM4A 3O6DA 4WY0A 4A29A 3KVKA 1GYNA 3LCFA 5G2HA 2G96A 1GG0A 1JRBA 4IXXA 2RDUA 4UTTC 1H7PA 5CSSA 3S42A 3QJAA 2QJGA 3PB0A 2C15A 2ZYFA 1A5BA 3W07A 2RFGA 4UR8A 2J9ZA 4ICNA 3W1MA 3W2JA 2W0UA 1EIXA 1OX4B 3LHVA 1R2RA 1VCFA 1NEYA 2QCMA 1YXDA 3QC3A 3L9CA 5KZDA 2EPHA 3OHIA 2A6LA 2A7NA 1OF8A 2QCFA 1VJIA 3CPRA 3LHWA 2WNZA 3AO0A 1KM3A 5F4WA 1XI3A 1H5YA 2QCCA 3WJSA 1RR2A 4JN6A 3VKJA 2F84A 1M5WA 4W9TA 5F1VA 1XFBA 4QAIA 6TIMA 3GIYA 4N4PA 5U4NA 1QPNA 4MLRA 3V1PA 5D2XA 3PG9A 4UMBA 2QKFA 3NPVA 4R34A 2J24A 4RZ4A 3W1NA 5EL1A 2VKZG 1BKSA 1TV7A 1TPH1 4EVZA 1H7WA 4Y6GA 5I3HA 5AHLA 4DBDA 4OBTA 3SJ3A 2YX0A 5J5RA 1K02A 3GNNA 3O6CA 3M6YA 1F74A 2V9DA 4X22A 1PS9A 4O4VA 2X1UA 1D3HA 3C52A 3MI6A 3G24A 3W7OA 4M5PA 3QMSA 1Q3NA 4N9EA 1DV7A 2GJNA 2H8ZA 4GNJA 4LVBA 1D9EA 1IIGA 5K2ZA 4UUIA 4N4QA 5CZ0A 4HHPA 1ZALA 4O4WA 2Q8ZA 2NLIA 3GLCA 3NAVA 4UTKA 1MEHA 1SPQA 4O8RA 1VCGA 1YADA 2RH9A 4ADUA 5CZTA 3GZ3A 3WK0A 3NQ6A 1PVNA 2QR6A 3G18A 3W2LA 3QMTA 3NQ8A 5D38A 4EOUA 2Z6JA 5C5YA 3S9YA 4OQVA 4IX2A 4GJ1A 4O53A 4OGZA 3SZ8A 2P10A 4E2DA 1KFCA 1R2TA 4O54A 2QF7A 4LTSA 4UTTA 3IVUA 4GUJA 3G8EA 3BLEA 3L2IA 5K7JA 3BW2A 2Y88A 3FIGA 2A21A 3N73A 4O1DA 1CX9A 2ATSA 5C55A 4DBEA 4Z1CA 1FCUA 2FLIA 4YLWA 4GE8A 3W1PA 1HG3A 3P81A 3VE7A 4BF9A 3IGSA 3M1ZA 1SW0A 4NVTA 4WY0F 2E5CA 3R5EA 4JTUA 4Y9AA 5AN7A 1L2UA 1FCQA 1TTQA 3PUDA 3HO8A 3C61A 5FEZA 2H6RA 2X1SA 2NX3A 2WNQA 3NL6A 5EPDA 3QFEA 3ZFHA 2ZA1A 3W2UA 1DOSA 1H1YA 2UV8G 4EF8A 3C56A 3MBDA 3S5OA 1F2JA 3DHDA 1OFEA 1B57A 1P5BA 2OMAA 4LC8A 1LBMA 3MUXA 3KHJA 4LY8A 4L4MA 4UFJA 3LBCA 5HUOA 1SZFA 1EUNA 2FIQA 3ZWSA 1T99A 3TFCA 1XDMA 3MMTA 3EWBX 4NXSA 3CHVA 4LOCA 3HG5A 1NVMA 1WX0A 1XUZA 2EHHA 5C2XA 1LOQA 1J2WA 5F1UA 3H53A 3TMQA 5E1QA 5A8GA 3FA5A 3EX2A 4BI5A 4O52A 2VOMA 4D2JA 1KM1A 1B4EA 5HWNA 1F7BA 3W1XA 3S5ZA 2G97A 4AMAA 4AF0B 5HR6A 1W5NA 3W7QA 2ZZ6A 4K7YA 3T55A 3P7YA 1EWEA 2TMDA 1LRTA 1KM2A 2GQ9A 2O7QA 3PB2A 2GUUA 4TO8A 4AHOA 3TUUA 3I6RA 1LCOA 4CNNA 5HQEA 4AXKA 4OU1A 3RMJA 3W7LA 4GRSA 1TSIA 3QPZA 4M7SA 2E5DA 5EKYA 2XN1A 4M7TA 2H8XA 1OK4A 3E0IA 3M5XA 3W7RA 3FJLA 4NX5A 1VRDA 3U6WA 2BLEA 3ZR4A 4QQ3A 4UIOA 5D04C 4FXRA 3BG9A 3OVQA 3PBYA 2X1TA 3W84A 2ZRUA 4QIUA 2NV2A 3L66A 4UTMA 1QNVA 5D02A 3QW4B 2PCQA 2QDHA 4UFHA 3M47A 3NPWA 2CZEA 4LUJA 3LCWA 3BG3A 1WBHA 3ABOA 3S1UA 1W3TA 5AYZA 2GVLA 1OK6A 2Y7DA 3NZ1A 1OFPA 1KV5A 4ZZ9A 1O60A 3EB2A 3H54A 4MJZA 3TE9A 4RXFA 4JYEA 3BG5A 4MKNA 4AB4A 1GQNA 2FPYA 1D3GA 3G3MA 2BSLA 1M7PA 5HWJA 2CLEA 1W31A 1KV8A 3UPWA 2H90A 3C2VA 3GYEA 4IMDA 3C6CA 4KKXA 2WQPA 1H63A 4UTWC 3QH2A 2J9YA 1U5JA 2O7SA 3BO9A 1LTDA 3W70A 2CLOA 3NM1A 3TA6A 2V5BA 3B05A 4K37A 1GWJA 3DFPA 5DBTA 4XBSA 5CPLA 4JX6A 3M43A 1SR9A 1VGAA 1DBTA 1Q6RA 5L6UA 4UFMA 1I45A 1OF6A 3CTLA 5LGXA 4WXZA 4XKYB 4NT0A 3S5NA 3QQ1A 3NL3A 1KFEA 5DXYA 1E51A 2V8ZA 4WJEA 3Q58A 4JEQA 5CG7A 3VI2A 1QOPA 3SSJA 2ZTJA 4NZJA 3CC1A 4UNKA 4HNTA 2DZPA 1C8VA 1EB3A 3CU2A 4LU0A 1XBZA 4A2SA 3UZ5A 3HB9A 1AK5A 3NQDA 5AOUA 3TAOA 3JRKA 4TU1A 4JTSA 3C8FA 4KWWA 2DZSA 1UJPA 2GQAA 1LYXA 1JCYA 1THFD 4IQLA 1SO6A 3FYPA 4ZMGA 3QQ0A 1TPC1 2QCHA 1F6KA 4JTEA 3TKFA 3LHYA 3PBUA 5BMWA 5FF3A 1I2RA 1RPXA 2QUUA 3LI1A 3M5ZA 3NQCA 4JS3A 3WJXA 5G1TA 2FB3A 2Z6IA 5AHNA 1LP6A 3GDLA 1GTEA 3P67A 1JCNA 3YPIA 2QCDA 1OX4A 2YW3A 3RLUA 3W71A 1OJXA 3TK7A 1K8XA 3ATZA 5LHFA 3BLFA 5LNWA 2ISSA 4PCFA 1P0KA 5G1YA 1BWKA 3O63A 3MYPA 2B7OA 2EAWA 4FNUA 3FOKA 4HSOA 3G22A 3PG8A 3GR7A 2CU0A 2C19A 5SWUA 3OA3A 1RZMA 1WOBA 1FWNA 4E0CA 4U28A 3W7IA 1PCWA 4LV4A 5AB3A 1IIHA 1YDOA 2TPSA 4JD4A 1DQXA 1B4KA 3PWAA 3VFLA 3EX3A 3HG4A 3DFOA 1I2NA 3LERA 3N2MA 3IEBA 3S8HA 2V0TA 4FNQA 2ZRXA 3W74A 4BWLC 1BTMA 3M41A 4UTHA 4O10A 1H7RA 4O11A 3D0CA 4N6EA 2TYSA 4KFOA 4QNEA 1F73A 1TPVA 2QJIA 3L65A 2AQWA 3TMLA 3FYOA 5EBUA 1XCFA 3T40A 5LNVA 4TMCA 1MEIA 4JTFA 3HGSA 4FIQA 4MY9A 5LZLA 1Z41A 1PCKA 4YCOA 1DQWA 1WAUA 3CB8A 5K3VA 1KTCA 4NX0A 5AHIA 1TYGA 2CLMA 1FWWA 1T96A 3W7CA 3W7JA 3GAKA 3DAQA 1QDSA 3R13A 2RDTA 4JTGA 3F4WA 3WK1A 1WYIA 3B0VC 1H7XA 2W6RA 3B04A 4Z0SA 4LS1A 4I9AA 1HUVA 3SECA 2DP3A 4Z1DA 5HINA 4XWUA 2J88A 3KOFA 4LRTA 3LXCA 4P61A 2HMCA 4O50A 1BWLA 3KRUA 3HJZA 1XUUA 4MLJA 4WD0A 3B03A 4ML9A 5DBUA 1SW7A 5KITA 2C0AA 4PH6A 4RLIA 3BLIA 3NDOA 1W54A 4MOZA 1SO3A 3HGJA 4HKPA 1TIMA 2V2HA 4RV8A 5D2VA 1QFEA 1F6PA 3CQ0A 4JTTA 3PM6A 1OYBA 1U83A 1CI1A 4MPQA 4R33A 2Q3RA 2QEZA 1TCDA 2Y7FA 1XL9A 3WFAA 1EA0A 5H91A 3LDVA 3W1QA 4M6PA 3P80A 1FQ0A 1HO4A 1JQXA 2DJXA 1ICQA 1ZFJA 3KAOA 4NJJA 3EWYA 1ZY9A 4GXMA 4ZL1A 4GUGA 3UQNA 4MZYA 4U4MA 2B7PA 2RDWA 3GB6A 1AL8A 2PRHA 1G4EA 3C3NA 1M7OA 1R30A 3O16A 4NNBA 4CQAA 4JDYA 4QJ1A 1DVJA 5D09A 5E93A 1GEQA 4XQ6A 4BWLA 5G2IA 3HF3A 3KRSA 5D2YA 3LV6A 4TX9A 1H51A 2ZRVA 3NEVA 3Q2DA 3VNDA 1W3IA 4IOTA 4GUFA 3DKLA 5LNSA 4UTJA 4K8EA 5F2IA 2C3ZA 2QCDB 5ABTA 2E6YA 5EA9A 1TV8A 2GVGA 2YYTA 3P74A 4JTIA 5G4WA 4R53A 4AF0A 1N55A 1ME9A 3HG3A 2V81A 4H6KA 4YL2A 3SW6A 3GKFA 2A1YA 1H61A 4FNRA 1H7NA 4ZQMA 3EXRA 4CCCA 3WK2A 2WOQA 4M6VA 2ZA3A 1WQ5A 1LDCA 4JIPA 4TR9A 3MP5A 4E38A 5F2GA 4CNPA 4PL1A 2YSWA 4JIQA 1XXXA 1RV8A 3M0ZA 2QCLA 3W7GA 2PURA 4PA8A 1OFAA 2Y89A 1VR6A 2DJLA 2F7FA 3LXBA 5KZMA 5K4ZA 1QAPA 3TSDA 4ZQOA 3TNOA 5IBXC 4FNTA 3S1WA 1TPFA 5DCBA 5AC8A 4Z0JA 1PL9A 4H3DA 3A5FA 4JYDA 2A6NA 2I1OA 4JTLA 5K9DA 4O1AA 1FX6A 2QDGA 3IIOA 5LKYA 1EP1A 3EWUA 3TW6A 4Y96A 3TXVA 3UXDA 2OZ0A 4AWUA 1AW2A 2FQIA 2P1FA 5F2MA 4S2BA 2JGYA 4H4IA 4UNLA 1JCMP 4MIMA 2VFFA 3H55A 5D30A 3VE9A 3QEZA 3GXPA 3C2FA 1L6WA 2WV8A 5HWMA 4R7JA 1FDYA 1LRNA 4AH7A 3I7SA 4OV9A 4XTIA 3EX6A 3CIXA 2YPIA 8TIMA 3B0UX 1AW5A 3EWWA 3IVSA 4Q4KA 1GOXA 1SQ7A 2CLFA 1KBIA 4ZVJA 3UPBA 1VZWA 2VELA 5J5DA 2V2DA 2YR1A 1LZOA 4XKYA 1KA9F 3DH7A 3W9ZA 4YXGA 2JBMA 3NXFA 1IXPA 1F05A 1YTKA 3W7NA 2HSAA 4EWND 3FKRA 4PODA 1FCBA 4CNOA 3W87A 5TIMA 4JY8A 1FCVA 3O6YX 1S5WA 3A23A 4PC8A 1ZNNA 3CWNA 3ABSA 2E6FA 4HPXA 3IGUA 5G4EA 5F4SA 3TAKA 5HJLA 3DFQA 3HG2A 1B3OA 3L0KA 4WZHA 1W8SA 1OFBA 3L5AA 2CZ5A 2NWSA 2XN0A 4MFDA 3IIZA 2YFOA 3CLMA 1PHWA 2W79A 1TTJA 5TBOA 3B4UA 3KVLA 5HNRA 3UD6A 4QM1A 1WDWA 5AHEA 1DJNA 3GAYA 1R47A 2QAPA 3MP4A 1OFDA 2A0NA 4QNWA 4NJIA 1K8YA 3M5YA 3LTYA 4CCEA 4Z1AA 1GVOA 1YYAA 4FNPA 3MHUA 1MSSA 4O1BA 2NV1A 1M6JA 2R94A 5HUPA 2C18A 4JDBA 4WUIA 2ZCGA 2EF9A 2DZTA 3ELFA 4MYAA 2Y7EA 4AEOA 3G1HA 5CZJA 3PSVA 3G1SA 2PC4A 2E1DA 5CPNA 1LBLA 2NUXA 2WJZA 1DL3A 1MXSA 2FPVA 4N9BA 3G0SA 3I7RA 3NM3A 1A53A 1QPQA 2DZXA 2VC6A 3BGJA 3LHUA 3W75A 1GVSA 1JRCA 1ADOA 3A9IA 1QCWA 2FDSA 5KTLA 3L21A 4IMCA 4GUHA 1A50A 3FJ6A 3TW7A 3QF0A 3P8IA 4TMBA 4UR7A 1GVFA 3G1DA 1VS1A 2YCEA 3PF3A 3PC0A 2KZHA 1G7VA 1VH7A 3RLVA 4RXGA 3GDKA 1H50A 3UWUA 3BK0A 1LOLA 5T26A 4BI7A 4MZ1A 4CLMA 4FF7A 4PTNA 2WNNA 4A2RA 5F4XA 2C13A 3W7HA 2R91A 1JQVA 2CLIA 2OCZA 4RKAA 2NUYA 4GWEA 4IGHA 2J6XA 5I3GA 1GJPA 3UNDA 3WJWA 2X16A 4EF9A 2Z0IA 2Y7GA 3L0NA 3W3OA 3NL2A 3NQMA 3BGGA 3TJLA 3HPXA 3MWAA 4I7VA 3TR2A 3S1XA 3F4NA 3LCGA 5HR7A 1XBYA 4HT3A 1KLYA 1H60A 4XZ9A 1XKYA 3PS7A 2E6DA 3MI3A 3FEMA 3EX4A 3QRHA 4QITA 3P5YA 4PL2A 1GVQA 5HMSA 2ZZ1A 3DFSA 2RKXA 4K6AA 3R12A 3S5YA 5HULA 1P1XA 4IUOA 1AMKA 3O1NA 4FIRA 1QPOA 2OX1A 3B06A 3THAA 3W1RA 1TJPA 5L9FA 1OG0A 3NO5A 2XFWA 3HQ1A 4Z08A 1QPRA 4JICA 4JTHA 3SGUA 3KFTA 1W1ZA 3STFA 4RX0A 1Z44A 5BOOA 1SZNA 1ML1A 3QPYA 2WO5A 1R46A 1RQBA 3OG3A 1KM5A 3KRZA 3IIVA 4XUGA 2BX7A 5D37A 5FI8A 1OVDA 3ABRA 1NFBA 5U7SA 3OVPA 1X1ZA 1FXPA 1A5SA 3E49A 3NZRA 1GZGA 4JNMA 5DN1A 1KFJA 3G3DA 3DFNA 3LLFA 1LBFA 1XBXA 3ATYA 5KINA 1G69A 5DCDA 1FDJA 4RJEA 3LRLA 4LVGA 1GPWA 1B9BA 4ONVA 3W85A 3ANYA 4OWGA 4BI6A 3A21A 4A3UA 4UMAA 4MVAA 3P62A 4RZ6A 1G7UA 2C6QA 4YMZA 5AYXA 3SR7A 1DHPA 1KTBA 1MO0A 1W3NA 3TX9A 3T7VA 1MEWA 3I68A 1QOQA 4DO5A 3NQFA 3STCA 2QUVA 5D2WA 2LLEA 3CT7A 5DY2A 1O94A 2QUTA 4ZQCA 2JKAA 4MY8A 1BEUA 2A5HA 2HTMA 3M5VA 1LORA 5KZEA 3CEUA 1JUBA 2GJLA 4XTDA 4LS0A 3LCLA 4NU7A 4N6FA 3E12A 1OX6A 3BW3A 3O8AA 3L5LA 4DF1A 3HIJA 3EX1A 4JYFA 4UTWA 2CLHA 3DFTA 2ZDRA 1ONRA 1K7FA 1IXOA 2YXGA 1TRIA 1DKWA 1W37A 5BW6A 3TSMA 4AHQA 1X8FA 4IPJA 1Q6LA 4O57A 3RU6A 2ZTKA 1VYPX 4RR4A 4UCGA 3PUOA 4LC6A 1KTNA 3PSWA 1FWSA 2CFFA 4LV9A 3C0JA 1H62A 1CW2A 4IMFA 2V82A 2VFIA 3EKZA 3MYOA 3C4UA 2V5LA 3S6DA 1AG1O 3PVFA 4K7VA 1JR1A 3RK8A 2A2IA 3L5MA 4JXCA 2DZUA 1OABA 3E96A 3UWVA 2VEPA 3DI1A 5G5IA 4ZQPA 1O95A 1PE1A 2A4AA 5FEWA 2OT0A 3N34A 2E77A 4FO4A 3GNDA 3KVJA 4IMGA 3ABQA 1MZHA 1YXCA 2NXGA 3DU0A 1EX5A 2JKEA 2YFNA 3W83A 3PUEA 1G4SA 1I2QA 4WOZA 1VYRA 3N19B 2GVJA 1H7OA 5D05A 3QMRA 4JX5A 3W7KA 4N2YA 4HNUA 3W1UA 4KFNA 1EP3A 3UWWA 3LOTA 2CLLA 4YCPA 4ALDA 1TPWA 1YTDA 1W5OA 3TU9A 3WJZA 4MUZA 3W1TA 3HGRA 4CCDA 3UWQA 3NR0A 3EXTA 1QWGA 3NGJA 3LTPA 1ME8A 4GC4A 1WBJA 1KM4A 4N9CA 1ME7A 3LCHA 3S1VA 3GK0A 3PBVA 1JUEA 4UXDA 5K9XA 3STGA 3ZS4A 2DU2A 1KFKA 1GYLA 4LVAA 3W22A 1TPUA 1FWRA 2VEKA 4O19A 2VFDA 3O05A 4UTLA 3IIPA 3M44A 3P8JA 1TB3A 2Y63A 3QSTA 1TQJA 3F03K 4UC5A 1R2SA 3HPSA 5KMYA 4NUWA 3LM7A 1P0NA 4IMEA 1W5MA 5F2LA 1T0OA 4FEZA 3W76A 3TJXA 2DZVA 3IVTA 2FJKA 1VCVA 4JX4A 1KM6A 1ZAJA 1FY6A 2WSRA 3O06A 2NZLA 1K03A 4TIMA 4DELA 4O12A 1AL7A 2JGQA 1KFBA 4KWVA 3NOEA 4LVDA 2GOUA 1X7FA 1WA3A 5A5WA 2ZZ7A 3B8DA 4Q32A 1S5TA 3U2OA 3F1QA 4O17A 3IIXA 4FX8A 4FXSA 3PR2A 2D73A 3DHFA 3B0PA 4OV4A 4UFIA 3O07A 1JULA 4G1KA 1PIIA 1SO5A 3LGEA 1L6SA 1LM1A 3W2NA 3GVGA 3L68A 2H3DA 1KFLA 4AWTA 1H1ZA 1SFJA 1Q45A 1V5XA 4MY1A 2E5BA 1ICPA 3E02A 2BWGA 2ZZ3A 1N7KA 1DORA 2ISWA 1HFBA 3GDTA 3HPZA 4LWWA 2CZDA 1QR7A 2Y85A 3QZEA 4RZ5A 1S3HA 3LI0A 1Q6OA 3EKLA 1SZGA 3RFAA 1ZENA 1NF0A 3N3MA 3RF9A 4JTKA 1IGSA 2VXNA 3OEXA 3OVRA 3DKJA 4Y8FA 3T78A 2B0MA 3SFKA 1Z42A 3R2GA 4O0KA 2WSQA 3MP3A 5AYYA 4BK9A 2NWRA 3TQ0A 4K8HA 4ADSA 4PEKA 5CPMA 4N02A 3W2KA 5D2TA 3THQA 3Q37A 2A7PA 4XBKA 1FWTA 4O18A 2CWNA 3DZ1A 1ZAIA 3STEA 3TC6A 1EWDA 4FX6M 3UWZA 1ZHAA 3UY8A 3WJYA 3CWOX 1IXNA 2ZZ4A 1LLZA 4Z1BA 3CIWA 3L67A 5MHBA 5AHFA 1OX5A 4LT9A 3TSBA 3P61A 2Y70A 4A22A 5EY5A 5EYWA 5CKSA 1UUMA 2WPBA 5FF2A 4UMCA 5FF7A 4O14A 2I14A 4DF0A 5KSWA 2JK2A 4L4LA 3RNDA 2ZRYA 1XBVA 2Q3OA 1TPB1 3EWXA 3NQVA 1RQEA 2WSYA 1SSGA 2QCEA 1ICSA 1YPFA 1YXYA 1EP2A 1IXQA 3UWYA 1F5ZA 1OFRA 3LBMA 1A5CA 4HNNA 1EPXA 5C54A 2YZRA 1OYCA 2X30A 1TPDA 1G67A 3T44A 3HMJG 4AWSA 3G1VA 3NA8A 2DORA 1FUYA 1PHQA 2QAFA 3TQKA 4UFLA 1Q6QA 1JCXA 3S0CA 4WX2A 5CSRA 4RCXA 4FX7A 3P5ZA 3GXTA 5LGZA 3TQVA 2VEMA 4FB7A 3TCEA 1I2OA 1AW1A 1HTIA 4ZQRA 3QW3A 2ZBTA 1VLIA 2YGYA 5IBXA 2J9XA 5D32A 4IWWA 6ALDA 2CZFA 1VQTA 4Q33A 3GXNA 1XDLA 3LRKA 1GT8A 5LHEA 2J27A 2TRSA 3G1AA 2GQ8A 1G4PA 3DENA 4CQ9A 5C6MA 1YTEA 1TREA 1TV5A 4E2BA 3W7MA 1SW3A 1W5QA 3TROA 2PE4A 4WY0B 1K7EA 3MW7A 4BFAA 1F76A 1FXQA 5FEXA 1WXJA 3V75A 2XN2A 4DPQA 3TDFA 1TO3A 1I8JA 3L0GA 1NSJA 5E0KA 3PBWA 5DY3A 5K4XA 1YPIA 4LVFA 3QYQA 3SY5A 3W72A 3T4CA 4IJBA 1UASA 1N8FA 4O1CA 1G4TA 1RVGA 2G5WA 2B7QA 1QMLA 4O0ZA 7TIMA 4O16A 2R14A 4P2VA 1IF2A 4EIVA 1HO1A 2Y6ZA 2A7RA 4GUIA 3UXAA 4A21A 3USBA 3W88A 3P60A 2E6AA 1FBAA 3UYCA 5FF4A 2ZA2A 4WOQA 1SU5A 3OBKA 3SIZA 3HGOA 1I4NA 2DZWA 2HS8A 2YYUA 1J5TA 1UUOA 1VLWA 4POCA 4NNAA 2Z2UA 1QO2A 1SSDA 4MZ8A 5LNUA 2I9EA 1NF7A 4HSNA 3DI0A 3NG3A 3UY7A 1HL2A
chains in the Genus database with same CATH superfamily
3LRMA 3WQ8A 1LROA 1SO4A 5DMLA 1JVNA 1K8ZA 2OOFA 3EWZA 3W7EA 1VC4A 1TTIA 3EMCA 1JDFA 4YTUA 2A3LA 3B8UA 1W3JA 1E15A 3L4ZA 2VHLA 4P7RA 3WQDA 2G0WA 5IDZA 4ADTA 3NL5A 4E8DA 3GH7A 1BYBA 4F79A 3QSRA 3T2OA 1TMQA 3H7RA 4HIBA 5I0DA 3IGXA 3KL0A 1S2WA 1KW1A 2GGEA 4LB4A 4YTQA 3P82A 3KXQA 5DCEA 3LCIA 4TTGA 5HMEA 3INPA 4Z42C 1IR2A 4YYCA 3KP1A 3E9AA 1UR0A 4LUSB 1EX1A 5H8MA 2IPFA 1RVKA 2QPXA 1XV8A 1X1NA 3QN3A 1LUCA 1O6IA 1ZGDA 2QJHA 4BJHA 4QJ5B 2UZ9A 2CC0A 3LXAA 3GX9A 2BZNA 1M65A 2VQTA 2HS6A 3QHNA 5I3JA 3I65A 2V2CA 1Q63A 3VIMA 3HTWA 3ARWA 1D8CA 3NQ7A 2W61A 1S5VA 4L9XA 3MB9A 1F6YA 4DJDD 2ZFAA 1WOAA 2VUNA 1EUAA 4U5KA 4DO4A 3A22A 2GDQA 3C2OA 1EBGA 3IRDA 4IT1A 1IZCA 4LQ1A 2EKCA 1XM3A 3MI2A 4HMDA 2CXGA 4IXHA 1TG7A 5TQLA 3W73A 2E09A 1DYSA 3PZQA 1O5XA 3R8RA 3H7VA 5I3FA 4X2RA 1DIKA 3FLUA 4QAWA 4H7ZA 1CEOA 1N2VA 3R10A 1VFFA 1UOKA 4OHQA 1LL6A 2AGKA 1TZ9A 3K30A 3ZLGA 3JZEA 3W00A 5KEZA 3CUGA 5AC7A 4XVDA 3AJXA 1A5LC 3AHVA 1KFWA 1VRXA 5DELA 2C16A 1ECEA 4KRUA 4L9ZA 1P6WA 3LU2A 2GSEA 4ICCX 3PAJA 5BYWA 3TONA 1MXDA 1S39A 2OELA 2B81A 3TH6A 4XK2A 4KQNA 3WBEA 3W6YA 1V77A 3TV8A 3W86A 3HBLA 3G1XA 3ZO9A 2IXUA 3U5UA 1OC5A 3VDAA 2XWDA 1W3HA 4MYXA 2DZAA 3EOSA 3W28A 3FSTA 4XD6A 3GIPA 2DY3A 3N4AA 5I3IA 3VPLA 4MKVA 1VBRA 4NG3A 3LLDA 4DLFA 3VXGA 2J66A 4NJKA 1XH2A 4J35A 1HL8A 4MB5A 3LY0A 3H4WA 3NQAA 4IPNB 3UVAA 1W6TA 2NXHA 2PRLA 3IUDA 3LCXA 5FEPA 3IV3A 5C9WA 4JKLA 2XIQA 1FWCC 3C8NA 5CPTA 1TMHA 4WVXA 1EGVA 2XWEA 1FDZA 5CH9A 3DFYA 1WXZA 4B90A 4YWIA 4R27A 2A3EA 4MG4A 2AL2A 2YBVA 3G1RA 2YIHA 3NSMA 4H8VA 4LCSA 3IJ9A 3IAQA 5BNKA 3N13A 4OVXA 3M9YA 3LZ3A 1TRDA 3AXXA 1QI4A 2OT1A 3EDEA 2PWDA 3T81A 2QUMA 2NX9A 3SURA 1OHLA 1OINA 4KWUA 2P8BA 4TOQA 3NGFA 3E0LA 1K9DA 1GTHA 3HU7A 1LLWA 2R8WA 1SFTA 1SUXA 1XISA 1SJBA 1FWDC 3O15A 3C2RA 2BV9A 1EXPA 5HQMA 3A13A 1MVYA 4H9YA 5XIAA 4CEUC 2Z4GA 4C1KA 3PNUA 4K36A 1TVLA 3A3XA 3QZ6A 3NURA 5EFFA 4IFRA 4HA4A 3MPGA 5G2HA 4PN2A 1CWYA 1TWIA 1GQLA 1K6WA 3QJAA 4BF5A 4C65A 3PB0A 3W07A 1YBQA 1O1HA 4ICNA 3U3HA 3W2JA 1PWMA 3LHVA 1R2RA 1CGXA 2VGGA 3I3EA 1AJ0A 1E5NA 1O5RA 4GISA 3L9CA 3VGDA 1KR1A 2X7VA 3OHIA 4B4HA 3WENA 5CPSA 3GG0A 2VVSA 2PWHA 4TV6A 1VJIA 2VD8A 1H5YA 4QS5A 1RR2A 4JN6A 4PMNA 2F84A 1M5WA 3OYXA 3WNPA 1NOFA 1XFBA 5D9OA 2HRWA 4QAIA 3GIYA 4F3HA 4WSHA 4MLRA 3V1PA 3PG9A 2QKFA 1IT7A 3NCOA 1GQJA 4R34A 3BOFA 3WUGA 3UR7A 1TV7A 2DW6A 5G1MA 1CGWA 3PZTA 1S2AA 5J5RA 3GNNA 3LYEA 4L80A 3QKZA 2V9DA 1IEVA 1YHTA 3AYVA 4H9MA 3G24A 4WLCA 3QMSA 1Q3NA 4LYKA 1MYRA 3WLHA 4RE0A 3L4XA 1HQTA 4B5XA 3SRHA 1IIGA 5G4HC 3NIYA 5CZ0A 2WNWA 4O4WA 3ITLA 1MRQA 1PX3A 2Q8ZA 2NLIA 2G37A 3NAVA 2G41A 1SPQA 1YADA 2ASHA 1TIWA 5CZTA 4EPEC 3P14A 4HA0A 1V02A 1ZUAX 2GWGA 4LUSA 3EKGA 1RUSA 3VD3A 4C6CA 4KRZA 4GJ1A 1OT2A 3GU2A 2Z2BA 4JL1A 4O54A 2MANA 2OYKA 3ANUA 4TV5A 6A3HA 2OSYA 4Q8WA 1I75A 4MAZA 4EXAA 1GUVA 4QEEA 1UH3A 4P5UA 5C55A 4DBEA 3CBWA 2OSXA 4Z1CA 1XLMA 4YYFA 1PEZA 3W1PA 1XS2A 3VE7A 4BF9A 3IGSA 3PZMA 1BRLB 1W8GA 2QPUA 3M1ZA 1B5TA 2CHRA 3EOLA 2Z1XA 4JTUA 1W9BM 4IIHA 2P0IA 2D2GA 4Y9AA 5AN7A 1FCQA 1Q8AA 1TTQA 1XR2A 1T5AA 5FEZA 5IDIA 2WNQA 1IR1A 4AG0A 2XSBA 3CYJA 1DOSA 2UV8G 3PWIA 4EF8A 4XD4A 4OKDA 1QW7A 2OMAA 2CLPA 4LC8A 4AIUA 1LBMA 4LY8A 5C9ZA 4W8BA 4UFJA 3R8HA 4RDWA 1ZQ5A 3LMYA 3ZWSA 3TFCA 3MMTA 4LOCA 1WX0A 2Y8UA 2HBXA 1F9CA 3H53A 1KM1A 1O66A 3W7QA 3A64A 1ITCA 3P7YA 4V33A 2TMDA 1KM2A 3MTWA 1GYMA 3TUUA 3I6RA 4CD4A 3WX7A 1EYEA 1SM9A 4GMEA 4AMCA 3NSNA 3W7RA 1NOWA 1XJBA 3AIQA 2BLEA 4OBRA 2D3NA 4UIOA 5D04C 5KETA 4D8AA 3F4CA 4QXIA 1H11A 1XIFA 4W7UA 4KBXA 4H8HA 3W01A 2C1GA 1Q2RA 2J7GA 2QDHA 3M47A 2JFEX 3UF9A 3BXWA 3NPWA 4HGXA 4LUJA 1KCZA 4HA3A 4PMZA 2GOKA 2GVLA 3HN3A 3NJ3A 3KBMA 1KV5A 3OPSA 3U2CA 1W1PA 4JYEA 1BYCA 3WBAA 2GDUA 3ARRA 1M7PA 1WO2A 3OZMA 1KV8A 1W9UA 1P6BA 3C6CA 4KKXA 4UTWC 1U5JA 2DH2A 4LF1A 5FCZA 3B05A 4PMVA 3SCPA 1GWJA 4E3VA 3DFPA 2DSVA 3QXBA 3IRSA 4GYKA 4GQQA 1YE6A 4UFMA 3WD2A 1OF6A 2ODOA 9RUBA 4XKYB 3WQVA 3GHRA 4IIBA 2R82A 2V8ZA 4JEQA 1M7XA 2ZTJA 3R6IA 3CC1A 4NZJA 4UNKA 1O12A 4LU0A 4WDTA 1BVZA 4BS0A 5IFTA 3TAOA 2V6AA 4JTSA 3C8FA 4PCTA 1JNEA 1UJPA 3FNDA 1THFD 2AOSA 3KM8A 4HHMA 3TKFA 3TYEA 1AH4A 1E43A 3IWPA 2XH7A 3LI1A 2VT0A 1VJSA 2DQWA 4JS3A 3ZSSA 3UCCA 1V3JA 4R3UA 5AHNA 2PGWA 4ECLA 1PKYA 3RLUA 3UR5A 3TK7A 1P0KA 5G1YA 3FOKA 4HSOA 4LSBA 5C70A 4DZIA 3BE7A 3OA3A 1IGWA 4PEEA 1ONXA 1S2VA 1FWNA 3WDJA 1A5UA 2BG5A 2HXTA 4D6FA 4B9YA 1OSEA 3V35A 2TPSA 2PTDA 4GBDA 1I2NA 4XZLX 2V0TA 3OLEA 4FNQA 1EJRC 3W27A 3W74A 2RGMA 3M41A 1KRAC 2BODX 3P3BA 1XCFA 3T40A 4C60A 1S38A 1GCYA 1Z41A 1PCKA 3K13A 1ONEA 4K68A 4UTFA 1T96A 3AYRA 1Y5WA 3W7JA 3GAKA 3DAQA 1QDSA 1WPCA 4G6CA 1AJ2A 4US5A 2FMNA 3BAXA 2W6RA 1VEPA 4Z0SA 3SUSA 4LS1A 3I3DA 4LAUA 4I9AA 2ZX8A 2DP3A 3TYDA 2JE8A 4K2SA 3KOFA 2GGJA 3UJEA 4HMNA 2DT3A 3VD4A 4WD0A 3DEQA 3B03A 1QXLA 3C0QA 3ZSTA 4RLIA 3T08A 3KP0A 2YDSA 4FPSA 4MOZA 1SO3A 3HGJA 1BSIA 4HKPA 1PXGA 3D3FA 5D2VA 5J8LA 3TYBA 3UZZA 5JBEA 1UPPA 3K8KA 1KGXA 2RUSA 2ZX6A 2NQJA 2OR2A 3E1F1 4PB5A 2Z25A 3PZNA 2AMGA 4E6MA 3KOXA 4KT2A 3ARTA 4IISA 4M6PA 3P80A 2XVLA 1BRLA 5C9UA 2I5GA 3OA5A 3E0WA 4TUFA 1JQXA 2DJXA 1ZFJA 4UBPC 4BCEA 2ALRA 2WW5A 1PAMA 4ZL1A 4GUGA 3UQNA 4WCJA 5A1AA 4KESA 3IACA 4U4MA 4EKJA 2FVMA 4B5UA 2PRHA 1KR0A 3M6DA 3FHQA 4NNBA 3CZ8A 2EBNA 1TX2A 3UWEA 2HVMA 4R9OA 3V0TA 1CZ1A 2HXUA 3VO0A 4TX9A 4ZR8A 2ZRVA 3RPMA 1RCXB 1W3IA 4IOTA 5LNSA 4JPGA 7TAAA 1XYCA 1RJRA 1R9ZA 1VFMA 1TV8A 1GKQA 3D46A 3P74A 4JTIA 5G4WA 4KMQA 4R53A 2WM1A 1US0A 2V81A 3SW6A 3GKFA 3KRBA 3TTYA 3K4WA 1H61A 1H7NA 1A5OC 5JBFA 3WK2A 2WOQA 4M6VA 4JIPA 4TR9A 3LUTA 3ZQ9A 3GXDA 4CNPA 1XQKA 4LUTB 1XXXA 1RV8A 4AZ6A 1Q5MA 4V15A 2VNCA 3W7GA 3VMOA 2TAAA 4PA8A 3BOLA 4ZODA 2DJLA 5K4ZA 3GTFA 4JN7A 2F2KA 3BCFA 5AC8A 3KW3A 6PTDA 3AMKA 2PDQA 1DQUA 3KDOA 3WCZA 2XTKA 3PNZA 1W9PA 2A6NA 3A4WA 2I1OA 1JZ4A 5A6AA 1FX6A 1YDYA 1QHPA 2UY3A 2GK1B 2YCLB 4QROA 3M0VA 1EP1A 1M9HA 4Y96A 4AWUA 2P1FA 5F2MA 3BURA 3VYLA 2VFFA 3H55A 1JPHA 5D30A 1VFLA 2PGFA 1FWJC 5A8OA 3C2FA 1L6WA 4C7DA 3XISA 1JDEA 4R7JA 1FDYA 1LRNA 1GOKA 1F8MA 1W9DM 3H23A 3EX6A 2NQZA 4R85A 3T4WA 1LWJA 2PWFA 2YPIA 3B0UX 3H2CA 3QHOA 3EWWA 1Z89A 3HQNA 3IVSA 1DXEA 5D9MA 1PTAA 3DBNA 4XKYA 4AFYA 3DH7A 3Q67A 3I3BA 4C7FA 3FK4A 4HJFA 1CGYA 3NXFA 3N15A 1IXPA 1YTKA 2YZ5A 1AD1A 1RP8A 3FKRA 3QY8A 2C71A 4RPPA 3GTNA 2B31A 2CKRA 2NSOA 5TIMA 1CENA 3CLWA 1DJHA 3D6NA 3LENA 3A23A 3CWNA 1AZ1A 4HPXA 4F9JA 1VAHA 2XIJA 5ABHA 1A3WA 1GVEA 2HVOA 3WQEA 3K1GA 3LZ5A 3KWXA 4D72A 5C8BB 5I00A 4DWSB 2QV4A 1UC5A 2OLHA 3CLMA 3WQWA 3AYTA 3ORWA 1RH9A 1NH6A 1CXEA 3MP4A 2J8FA 4IMAA 3WNMA 4F2TA 1GVOA 4KCWA 1S3TC 4FA3A 4MB3A 3AXHA 4WUIA 2ZCGA 4BQ5A 4U33A 4MYAA 3FDKA 1Q66A 2Y7EA 3DHUA 1J10A 3AYSA 3PSVA 2IUZA 3G1SA 4DJDA 5ABEA 5CPNA 2WJZA 1DL3A 4Z2JA 4Y8EA 2QHAA 2ZUUA 1GVSA 3CO4A 3C86A 3Q65A 3ZMRA 5AC5A 2FDSA 3CK5A 3WF0A 3TW7A 3FGCB 3QF0A 2OQHA 3G1DA 1BYDA 4DUOA 3WQ6A 3ZT5A 1UZDA 3RLVA 2GYIA 4QR6A 3RCYA 1E1CB 1HJQA 1DJGA 2WC3A 3B9NA 1QI2A 1NQ6A 4GIRA 4BI7A 2DV0A 2C7FA 2C13A 1LT7A 4GXPA 2BVTA 4W4QA 1P6CA 3BUVA 2R91A 2CLIA 2OCZA 4RKAA 4G7EB 2DSWA 4JZ5A 1GJPA 3CUFA 3GFXA 3UNDA 3RO6A 5HXMA 2X16A 2Z0IA 3L0NA 3CHCA 1WKYA 4UOQA 3HPXA 4L61A 1R7OA 5IXEA 3S1XA 2P50A 4JTCA 1E0TA 4AX7A 4B3KA 4B3ZA 3PS7A 4AEFA 3MI3A 4KCTA 3PTQA 1DEDA 2E1WA 1JYVA 1BXBA 3EX4A 4LAOA 2Q8XA 3UZXA 4PL2A 3VDGA 2V5JA 3S5YA 4H9TA 4PRWA 3WQFA 1P48A 3WF4A 1AMKA 3UW6A 4FIRA 3MVIA 1OQFA 3FEQA 1C8XA 3M07A 1OG0A 6ENLA 1GEHA 1ZBKA 4U10A 3HQ1A 4JICA 4JTHA 1PZ2A 3SGUA 1B3ZA 1VKFA 1W1ZA 3STFA 3TP4A 3FYYA 4RX0A 1GJUA 4EAMA 1UZ1A 1L8PA 4W7VA 1ML1A 2QGHA 3SCUA 2Z7KA 2ZUWA 5EB8A 1J12A 5HNUA 1V6VA 3ARVA 5D37A 4B9ZA 3TTSA 4H8NA 5U7SA 1FXPA 4PTDA 4Q8QA 3WMCA 3NZRA 3CUHA 3T07A 3CHFA 3GVVA 5CC7A 3DFNA 4D71A 3HV9A 3LLFA 4Q7NA 1LBFA 4WGHA 2DQXA 1XBXA 2FZ9A 3ATYA 5DCDA 3QV9A 3RG6A 2PUZA 3MO4A 3W85A 4TX8A 4LAKA 3CQIA 1XIMA 2DEPA 1H4PA 3P62A 1JD7A 4J40A 3LQLA 4AZBA 1MO0A 3TX9A 5FSDC 2WMHA 1ISZA 1QOQA 4DO5A 3STCA 1R9XA 5D2WA 2LLEA 4PUMA 4LUTA 2Z24A 2OKOA 2QUTA 2A5HA 3H2FA 4EK7A 2VYOA 3GXIA 5D8WA 4FXFA 1HKKA 3BW3A 4HNLA 3O8AA 5EMKA 4WK9A 2GK1A 2YCLA 1AA1B 4DF1A 3DFTA 1ONRA 3EDFA 4EX4A 1J0KA 2C1IA 1DKWA 2UWFA 3TSMA 1V93A 4AY8A 2F61A 3CQJA 1EZWA 4H00A 3G2GA 3E3HA 2VEGA 2ACQA 4RR4A 2HWGA 3LGGA 4GIYA 4LC6A 1MRAA 4LV9A 3APYA 1H62A 4X61A 2BXYA 2V82A 3PFRA 4LB3A 1PDZA 2QS8A 3TZFA 1OCQA 1AG1O 3PVFA 3N17A 1ZJAA 1Y7VA 4KEZA 4PUNA 3H8AA 1Z6KA 2A2IA 3L5MA 3UJ2A 3RYSA 4JXCA 3J7HA 3MSGA 5BRQA 3CQKA 3E96A 3ITGA 4MHBA 3KL5A 2VEPA 3DI1A 3NDZA 4ZQPA 1XLGA 1Y5XA 5FEWA 1UKSA 2PMQA 1X7IA 3KVJA 5I09A 4S3BA 2FZBA 2EKGA 1YXCA 4L1GA 2YFNA 1RXOB 4Z17A 1I2QA 4DYJA 4DWSA 4B5VA 4MDOA 1SFSA 5JH1A 2PS2A 4GQBA 1KB3A 2J7HA 3IV8A 3UWWA 3TYCA 3LOTA 2TODA 2WBGA 1EJUC 1YTDA 3L4WA 1W5OA 3NO3A 3W1TA 4Y2WA 3AROA 1HJWA 1Q6EA 2CERA 3LTPA 1FHLA 5F7UA 3IK4A 3PAOA 4ZOCA 3LCHA 3MDUA 1JZ7A 2OO6A 3GZAA 3QQWA 1ISWA 3VFCA 4IGMA 3AISA 3H26A 3ZS4A 1GYLA 3W22A 2VEKA 1FWRA 5A6KA 4O19A 4L56A 3EGJA 3LNMA 4IIDA 3VU2A 4UTLA 3IJIA 3BAYA 5I79A 5CLTA 3MKCA 1E71M 1TQJA 5AZ0A 4UC5A 4IIGA 1R2SA 3LSCA 3LM7A 2X0YA 4MWAD 4XZWA 5TAOA 2J8TA 3IVTA 2P53A 5JUVA 2PDKA 1UKTA 5A94A 2VX7A 2ZC8A 4DELA 2JGQA 1V3LA 1E4IA 4M3PA 1E1CA 2WSKA 3GWQA 2J7BA 3DN5A 4OV4A 3JUGA 2CXEA 5DMMA 4G1KA 4M1RA 4DJFD 4JCLA 1DWIM 5FJUA 2H3DA 4ERAA 1KFLA 3VOGA 3TLQA 4G7EA 1Q45A 1AQFA 4OOZA 4DLMA 1V5XA 4MY1A 5LA0A 4QS6A 1QW9A 2UY4A 4E2OA 2BS9A 2ISWA 3MKKA 3VUSA 2PD5A 4RZ5A 3EKLA 1SZGA 2PDUA 2OSWA 4UQBA 3AZTA 4PBFA 4LCRA 1D7FA 2W62A 2BFGA 2JQXA 1W1A1 3DKJA 4RPQA 2B0MA 3BZGA 3SFKA 4F0HA 3A3WA 3MMUA 4BK9A 5DANA 2PBOA 1J11A 3SRDA 2BHYA 3WL0A 4U5IA 1TJ2A 1YW1A 4XIMA 3W2KA 3THQA 3VGFA 1VFHA 2A7PA 1FWTA 3B3DA 3ECQA 2FDMA 1E73M 4W84A 3CWOX 4ACYA 2ZZ4A 3E5PA 1LLZA 4Z1BA 3L67A 3E5BA 4EANA 1GOWA 1J79A 1OX5A 4ZOEA 4ZOAA 1XLIA 2O56A 3I6TA 3ZLHA 4UNIA 4HK5A 4DF0A 4S3DA 4DN1A 1DHKA 4GOAA 3RNDA 2ZRYA 3FJ4A 4JCMA 5BXTA 1QT1A 2NVDA 4A8NA 3B8VA 2Z00A 1GQKA 4QGCA 3VIIA 4K1WA 2YLLA 1BVNP 3GHUA 1IXQA 4CD6A 4HNNA 5C54A 2YZRA 1EJVC 2PLKA 1OYCA 1G67A 3HMJG 3G1VA 3M0HA 4MF4A 4X0VA 1FUYA 1PHQA 4HCDA 2QAFA 3KCOA 1Q6QA 5CSRA 3CJPA 3P5ZA 3GXTA 4FB7A 1XPYA 1OCJA 1U1HA 1FWHC 1VLIA 5CC6A 5IBXA 1E6SM 5E70A 3GXNA 2AQVA 1GT8A 5LHEA 2J27A 5C0QA 4XAPA 4W86A 4CQ9A 1HL9A 5C6MA 1YTEA 2BY0A 3MW7A 4BFAA 1F76A 3MCNA 2PFHA 4XVEA 5I02A 2BHUA 4B91A 1TO3A 2VGFA 2QVNA 4D6EA 1J01A 5DY3A 3ITYA 1K6AA 4JFWA 1UASA 3KBNA 1G4TA 4UZUA 2B7QA 1QMLA 2YL6A 3D3AA 4P2VA 2R14A 2WK2A 4J4KA 3WNKA 2IQDA 3HURA 2A7RA 4HVXA 3UXAA 3W88A 4H8UA 1FBAA 4GYFA 3BAJA 4RV3A 4WKAA 2E8YA 1OD8A 5M3WA 2E9LA 2HS8A 3ONCA 2J75A 2F8QA 4LUYA 3QLDA 4DUVA 1RAKA 3WUBA 7REQB 4AQLA 1M1BA 1ZBVA 3NG3A 1A3HA 4ICMA 4OECA 3UY7A 3G0XA 4GZJA 3WD3A 3R58A 2B4GA 1UMYA 1RK5A 5CZSA 4I7UA 3SQSA 2ISFA 2O55A 3NO1A 2D2OA 2ZQ0A 3PY2A 1IT0A 4C1LA 1K7XA 1SFLA 3ITCA 1VHCA 2WZEA 3VVGA 2Y62A 1MW1A 1R3YA 1IQ8A 3MJYA 5GNYA 1NFPA 4URIA 3B8TA 3CV7A 1JZ3A 2ZXBA 3GDRA 1JFHA 2BTMA 1KBJA 2XH2A 4JFVA 4GKTA 4GY7A 1TJRA 5I3KA 2AKZA 4B2DD 2ISVA 1A80A 2KAUC 3TC7A 3RUBL 3AALA 3VOCA 4GIAA 4I7WA 1ITUA 1HP4A 3AZSA 4M6QA 1DJIA 5D4YA 4H1ZA 4M19A 1XLLA 1VBJA 2E7FA 3GDMA 2CLKA 4CCZA 3MUY1 1ZSXA 4GVFA 2Y1HA 1V4YA 4GH1A 1IV8A 3M16A 2ATMA 3WK3A 1QNQA 4QG8A 2YDAA 1C29A 3QM3A 1BG9A 1E1EA 2IQ0A 2PGEA 3PPHA 3BJTA 5CPOA 4MPKA 1Q2SA 3MT1A 4LGXA 1AD4A 5E9AA 1G1YA 4DB7A 4DF2A 3M7WA 1Y0EA 1EOMA 1NAL1 1XLEA 3BCDA 4S3FA 1OYAA 4ORIA 4QJ3B 1V8EA 4D6DA 4U3AA 5M5DA 4OJYA 4L1WA 4WEVX 4GJIA 5IM51 2BGQA 4QSHA 4BQ2A 4NIRA 2REQB 3AIEA 3W1LA 4W5UA 3BPWA 4Q8UA 3ABZA 4LANA 4WDXA 5CGQA 4KFPA 3E2RA 5LIXX 3VKCA 2FTWA 2HV5A 3TW9A 3WO8A 3SI9A 2OWCA 2Z1SA 3IAPA 2CW6A 3LTSA 1OFQA 2WMJA 2OZTA 3NQEA 3WLRA 5JVLA 3VNKA 4JGDA 4ML4A 4YWSA 5PTDA 3BW4A 1P7TB 1K3UA 3CT2A 5AHMA 2ISDA 4ZFCA 3A5VA 3EXSA 2IQTA 4X9SA 3KVMA 1XYBA 4HN4A 2P0OA 1KLZA 4MFEA 3VIOA 2Y61A 3GYCA 4QISA 5JBDA 1TTPA 1SZEA 4AVFA 4NQ1A 4MJMA 3R8GA 1EEPA 3SUTA 4GK8A 4MB1A 2HVNA 7XIMA 4GBUA 1H1NA 1JYNA 3AU6A 2X2GA 3A24A 4B5NA 5C7VA 1B3YA 1VBUA 2AAMA 3OIXA 3G8RA 3SGZA 3W2MA 3BV7A 8XIMA 5DMYA 2P76A 3B0YA 4AY7A 3EEGA 5GPRA 3U7BA 3P0XA 2Q8LA 3LHZA 1RBLA 3LV5A 2Z1KA 5EBAA 3OGSA 1DJYA 3N9RA 4LFYA 3PJWA 4WQ6A 4WXYA 4B5TA 3RXZA 2ZXQA 3K5XA 2XGZA 3W1AA 5FJOA 2CHNA 1PJ9A 3G1YA 2VL4A 4AHPA 2AL1A 2PDPA 3KTCA 1JYWA 1DJQA 3GVRA 3CTTA 3W26A 1JJKA 3N9SA 5DXXA 1IWBA 3NPUA 4C6MA 3HOJA 3R25A 2PRMA 3RDKA 5CLWA 4ZGYA 2PDCA 3WMSA 1P4CA 2VEIA 3GW3A 3TFXA 4HPGA 1ZJIA 5CC5A 3HV8A 2G96A 4LNCA 3VKAA 3QKEA 5HNNA 3UBPC 2VI0A 4XX6A 4I9TA 1XYLA 3BJSA 2ZYFA 4KWSA 1EJWC 2DDXA 2PU1A 2J9ZA 3HMCA 3W1MA 2W0UA 3BANA 1VBGA 1NEYA 2QCMA 2CIPA 4B92A 1GJWA 2F38A 4XD5A 5KZDA 3AUJA 3GXMA 2A6LA 4UR9A 5LA1A 3CPRA 3AO0A 2HK1A 2WCAA 3FAXA 2WHKA 2QCCA 1XSKA 2G3IA 4YS1A 5C9XA 3AUOA 3U48A 3K46A 1EBHA 5F1VA 4AZ7A 5U4NA 4N4PA 1DJXA 4MWAB 2AMXA 4UMBA 2J24A 4RZ4A 3W1NA 3R11A 1UD6A 1U2YA 2ZUTA 1J18A 1BKSA 2DVTA 1TPH1 4PB3A 4BHYA 1H7WA 7REQA 1QI0A 3BMVA 5AHLA 4OBTA 3SJ3A 4DJDC 4YNGA 3M4HA 1KCXA 1F74A 1RBAA 4LH8A 3JU2A 4C1NB 1D3HA 2FGZA 5I7GA 4Q22A 5A95A 2PDBA 6REQB 3W7OA 4N9EA 4JNZA 4F0KA 1PZ3A 4ZFMA 2YL8A 1RK6A 4GVHA 4N4QA 4JTQA 1C8QA 3ZR5A 1MEHA 1EXBA 4O8RA 3GD6A 3SADA 1Z69A 1CTNA 1PVNA 3W2LA 2RDXA 4L4PA 3QMTA 4G5DA 4EOUA 2QQ6A 3S9YA 4IX2A 4LYQA 1PUDA 5EFDA 1OBAA 1DIOA 3B8WA 3SZ8A 3ZJ7A 1E72M 4E2DA 1KFCA 4HTBA 3IVUA 4LYPA 5BU6A 3UG4A 3G8EA 3BLEA 2CZVA 4F2BA 1IE7C 4WF7A 5I24A 2A21A 3SM0A 2ATSA 4YLWA 1K70A 3ZZ1A 3CXOA 3VMPA 4H9VA 3IUHA 4WY0F 2E5CA 3A4AA 2QZRA 2D23A 1A47A 2P8CA 4DUXA 2OXNA 2X1SA 1WKDA 4V28A 1DTUA 7PTDA 2QJMA 4PMRA 2NX3A 2YA2A 2ZA1A 4AWEA 3W2UA 4AC1X 4ERIA 4HTYA 3VKKA 4NAEB 1B2YA 2HNEA 3S5OA 3DHDA 1P5BA 4AX6A 5BXRA 1KO0A 4HQVA 2GVEA 3I10A 5HUOA 4FR6A 4MJ2A 6CGTA 2FIQA 1I1XA 3LLXA 3EWBX 4NXSA 3CHVA 3CZJA 4F8XA 3ARPA 1XUZA 3OU8A 2D2JA 2EHHA 4INFA 1HP5A 2ZADA 4IHCA 3TMQA 3ZT6A 5E1QA 4O52A 2UY5A 3BCJA 1VFSA 1F7BA 4UZSA 4AD5A 2G97A 3POCA 1W5NA 4L6OA 4K7YA 4QJ4B 4S3JA 3PHAA 1P7TA 1MQRA 2EXOA 2GUUA 1VFUA 2VM8A 1JPDX 1Q6CA 3AIUA 5HQEA 4CNNA 4OU1A 2NW0A 3RMJA 4AD0A 3QPZA 5B7YA 2E5DA 4PBEA 5EKYA 2XN1A 2NVAA 1EKOA 2H8XA 2POTA 3AFBA 3FJLA 1JDCA 2VGBA 3BMXA 2ZX9A 2FTYA 2DIJA 1E4MM 1GZJA 2C0HA 4FXRA 2X1TA 3UA3A 3IGHX 4X2PA 4S39A 3K2GA 2V5CA 2NV2A 1QNVA 3GNOA 1PYFA 2AQOA 1EA9C 4UFHA 3LCWA 3BG3A 1WBHA 3S1UA 4IL0A 4ZSTA 5AYZA 3SSZA 4LF2A 1FKXA 2Y7DA 3WDPP 1OFPA 3WEMA 3H54A 4MJZA 3KEHA 2XH4A 2G50A 3WLOA 3SBFA 4MKNA 1GQNA 1XFCA 1YX1A 1BFNA 2FPYA 3GH4A 2ONEA 3GC5A 3L4TA 4WJ8A 3FX4A 3C2VA 4A8RA 3KCJA 4AZHA 2FZMA 5CSUA 2J9YA 1EPVA 5FJIA 3R7MA 5GQBA 2V5BA 4FI4A 5CPLA 4XAGA 1P1MA 1P43A 4H41A 5T91A 1G5AA 2XGIA 1K9TA 4WXZA 1VENA 4L5ZA 3L23A 3CPUA 1GPFA 1I6NA 4WJEA 1OADA 3VI2A 1PX4A 1QOPA 5ENLA 2W5FA 4QRNA 3TYZA 3UT0A 3VOIA 2DZPA 4UQ9A 1XBZA 3UZ5A 1LT8A 4Z2LA 3HJEA 1MFUA 4LBSA 1CGTA 4ZB0A 4IP7A 4IQLA 1JCYA 4ZMGA 3FYPA 2FZDA 3KOYA 1P0BA 3KDNA 3LHYA 3FVMA 8A3HA 1JPKA 5FF3A 3M5ZA 5G1TA 3P67A 1JCNA 3MJMA 3S5SA 1Q6FA 4LJ3A 3CZGA 4DVOA 2EG6A 1OG6A 2VR5A 3HQOA 2EAWA 3G22A 2CU0A 5M1TA 2PDGA 3V0UA 1RZMA 1WOBA 2Q6ZA 4ZEPA 1JZ8A 2PPGA 3HZ3A 3W7IA 4LV4A 5AB3A 3EPMA 2WC4A 5I5RA 4MWAA 3AQUA 3W38A 3F2DA 1YDOA 4EPKA 5HMFA 5BRPA 4JD4A 1DQXA 2J8GA 2WPGA 2WBKA 3PWAA 3VFLA 5JIPA 3HG4A 3LERA 3N2MA 2A3HA 4KIRA 1BKHA 4PTXA 4TVUA 4XAYA 4CGTA 1BTMA 4FLOA 3KBJA 2PDMA 1CGUA 3VK5A 2TYSA 3LPPA 1F73A 1PKMA 3L65A 1GW9A 5EBUA 3CAVA 4DJFA 4C1NA 2PB1A 1KRCC 4MY9A 2VRJA 1B3VA 1DQWA 3CB8A 6REQA 2BY3A 3MS8A 4NX0A 3GSMA 3HA1A 3UJRA 1TYGA 2HROA 3SCVA 3WLIA 1FWWA 4A3HA 1XIHA 2WXDM 2FJUB 3W7CA 3NOYA 4LBUA 2DVXA 3R13A 2J7CA 2WCSA 3GHSA 1WYIA 1CXHA 1HJXA 3QTGA 1JYXA 5KZ6A 2J88A 1RBOB 1D8WA 1HF6A 4B5SA 3KRUA 3OVGA 3HJZA 1E0XA 3VC5A 4MLJA 5JH2A 2GFTA 2PP1A 5KITA 2GQ3A 2C0AA 4PH6A 2XJ7A 3KS6A 1UP0A 1W54A 3TEVA 1MZRA 3B40A 3HFYA 3PBMA 4O1FA 3WDIA 3IUIA 3XIMA 1U83A 3SJNA 1S1PA 2Q3RA 2A3CA 3VX1A 4IZGA 3AMCA 3VOHA 5H91A 1JGIA 2PSNA 3M0XA 1KNWA 2WHJA 2EPKX 1FQ0A 4HMEA 4Y9MA 1B3WA 5HOSA 1ICQA 2YCJA 3KAOA 4NJJA 4HHLA 3EWYA 4GIEA 1ZY9A 3IJQA 4MZYA 4M8UA 3IS4A 3GB6A 1AL8A 4NAEA 3C3NA 3OB8A 1N8WA 4AD1A 1HKIA 4JDYA 4CQAA 1DVJA 3U4FA 1DJZA 2JALA 5D09A 5E93A 3CAWA 4G56A 4FZIA 5G2IA 3HF3A 3KRSA 5D2YA 3BL3A 1EJXC 3LV6A 3QYSA 2WHMA 2WM0A 3T8QA 4CVUA 1TVPA 2OGJA 2PWEA 4L64A 1YNQA 2QCDB 1CECA 2E6YA 5EA9A 2YYTA 4V1YA 4L4OA 1OWQA 1XLDA 4I9MA 2NQHA 4H6KA 3GM8A 4ACZB 3CWHA 4I5XA 1DTNA 2DUXA 1NWTA 4KETA 2YCIX 3EXRA 4R5EA 3W24A 3VC6A 1KBLA 2PDFA 5F2GA 3QOMA 4XB3A 4AISA 2KX9A 1VFOA 4PL1A 4FMVA 4FOJA 2QCLA 2D3LA 4DI9A 1OFAA 4PMDA 2G3FA 2F7FA 3LXBA 5KZMA 1S2CA 2WLYA 3SCOA 3OHMB 5IBXC 4FNTA 1V3MA 3F7JA 1PL9A 1QNRA 4H9ZA 4C5YA 4IQEA 1E3ZA 3UZYA 3TLLA 3RRAA 4H3DA 4JYDA 5GJPA 1W3LA 1BQGA 4UOZA 3T09A 4ATDA 1PYMA 1XG3A 1C9WA 3EWUA 3TW6A 3OODA 3UXDA 3ICJA 4S3AA 3SAZA 3BSMA 5BROA 3BZJA 2JGYA 4H4IA 4UNLA 4MIMA 4HU3A 5HMDA 4PR4A 3SIMA 5C2GA 3GXPA 2PF8A 2O4MA 4I6VA 4A3YA 5FAGA 2WV8A 5HWMA 4MNJA 3AS1A 3THCA 1JEZA 5EMMA 3CIXA 3QY6A 1AW5A 1ISXA 2NSXA 4MMWA 3CS2A 2CLFA 1VZWA 5J5DA 2YR1A 4L1XA 1UROA 2JBMA 4DYKA 4JFUA 2WZHA 3TNBA 1F05A 2Q71A 3WELA 3CZLA 4EWND 2WAGA 4J28A 3IK2A 5FAJA 2BOGX 1V79A 4QFUA 3O6YX 4PC8A 2E6FA 3IGUA 4LALA 2DSZA 1T6MA 1JXJA 3SCSA 2VDIA 3HG2A 1B3OA 1FTXA 3TN5A 2YA0A 1MNSA 1AH0A 4WZHA 4HYRA 1W8SA 1OFBA 3L5AA 2XN0A 3IIZA 1GONA 1WUFA 2PP0A 1WDWA 4QDMA 5AHEA 3W81A 1VIWA 2FVLA 1DWAM 3P93A 1EFZA 1OFDA 4NJIA 1K8YA 3GTIA 4HBKA 2QMJA 1XLHA 3URNA 4JTRA 3LTYA 3IJ6A 4GD0A 4GZIA 2ACRA 4CCEA 2WZIA 1YYAA 4FNPA 3MHUA 4O1BA 3ZVHB 4JFSA 2R94A 5AYBA 5HUPA 2E0PA 4JDBA 5CXPA 3DESA 1N8IA 1PO9A 4AEOA 3G1HA 1Q8JA 4PUJA 1FWIC 2IKGA 4KRTA 4C5ZA 1LBLA 1C8YA 5A2AA 1MXSA 1PB0A 4C6KA 3VZZA 3I7RA 3NM3A 4CN4A 1A53A 3AC0A 1QPQA 2VC6A 4ZO8A 4C6BA 2QIWA 3H70A 1ADOA 2OO0A 2XVNA 3WSUA 1FP8A 1SYTA 2G3NA 5KTLA 3L21A 4IMCA 1A50A 1IEWA 3FJ6A 3MMDA 2ACUA 1FFQA 1GVFA 1VS1A 2OOGA 3PF3A 2KZHA 1G7VA 1S46A 3GNRA 3EWDA 1VH7A 2UBPC 3UWUA 2O92A 2Z29A 4Q7BA 5B7ZA 4CD5A 1LOLA 4HU8A 5T26A 2QDEA 5BOFA 3VKBA 4BA0A 4CLMA 3TQPA 2CWXA 3TTOA 4C91A 4GGHA 3T8LA 4PYSA 5I77A 2NUYA 2AKMA 4GWEA 5LA2A 4IGHA 1M01A 1D3CA 5I3GA 1Q7MA 4W8LA 2CCRA 2Y4SA 3VGEA 4JFTA 1LQ0A 3GH5A 5A3HA 4D6CA 1POKA 1XRSA 3MWAA 4I7VA 5EMYA 4HYVA 1E55A 2I5IA 3CGTA 4XZ9A 4JQ4A 3CIVA 1EYWA 1GVQA 3OYZA 3O0FA 2RKXA 4K6AA 3R12A 8RUCA 3WD4A 4WKHA 1HKMA 3O1NA 1QPOA 2OX1A 3MV11 3B06A 2FZNA 3IJ7A 1TJPA 1YQ2A 3A4XA 3NO5A 2WQDA 4Z08A 2AGTA 3KFTA 2PTWA 1H0GA 3LG3A 5BOOA 1SZNA 1UOZA 1R38A 1UH2A 3OJGA 3QPYA 2WVVB 1OGGA 1R46A 1RQBA 3OG3A 1KM5A 4XUGA 3SCRA 5FI8A 1TZ7A 1OVDA 4DJED 1NFBA 1R0MA 2WKGA 2J78A 3MSDA 2OX4A 3E49A 3CAKA 3RX4A 2OZ8A 5FJJA 4IF2A 2W27A 1X6LA 5REQB 1JZ6A 2VOTA 4Q8MA 3RJYA 1E70M 1GPWA 1TV4A 3OZPA 4ONVA 4ASTA 1FVPA 3LEPA 3NTYA 3ZJ8A 3ANYA 4OWGA 2PCEA 4EXQA 1DPMA 3A21A 5JU6A 1WUEA 5AYXA 3SR7A 2GDVA 1DHPA 4HPNA 4RDYA 4JQAA 1QBAA 3UETA 3T7VA 1MEWA 4EE9A 2ADAA 3NQFA 4I5UA 3T0TA 2D20A 3QC0A 3A3HA 4Q8VA 2JKAA 3PZIA 1PIFA 2J4GA 3SO7A 2DSUA 1LORA 4JBRA 4ZTXA 1JUBA 1H2JA 2GJLA 1K4GA 1XG4A 2V5KA 3LCLA 4NU7A 1J0JA 3TC3A 3E12A 1OX6A 2BGSA 4GI8A 3BAKA 4HZMA 2CYGA 3HIJA 1IHIA 2CLHA 3BLDA 1K7FA 4HOZA 2YXGA 3LNPA 1W37A 3GC2A 1X8FA 1Q6LA 2J13A 4O57A 3PTKA 3E0FA 3PUOA 1A0EA 1KTNA 2CFFA 4DZHA 5E0FA 3OGRA 3H7UA 4J3TA 1CW2A 1P0DA 1ZL1A 2QV5A 3IJDA 3S6DA 3RRXA 3BDKA 5T8GA 2VJXA 1F3WA 4UQEA 4I9JA 1XIBA 1JR1A 3FV9A 2E8ZA 4GCXA 3AMDA 1ZRQA 3MQTA 3SCTA 4Y7EA 2D0HA 3B97A 4GI4A 1O95A 1UC4A 4PSRA 2ICSA 3CMGA 3RHGA 4FO4A 3VTRA 4PE8A 2BVWA 4IQJA 1H3GA 3DU0A 4KCVA 2INZA 1C93A 2G4JA 3URQA 1DE5A 1G4SA 3PUEA 4D8LA 4GQRA 1I1WA 5D05A 3QMRA 1E6PA 1TWWA 2GJXB 4F2UA 3CV1A 3WQPA 2QLYA 4AIEA 2BOFX 2CLLA 4YCPA 1TPWA 2Y8KA 3QV7A 1QNSA 1QBBA 2OB3A 2IS7A 3WH5A 3TZNA 3AS3A 4CCDA 4M6UA 2JF7A 1PTDA 2IKJA 5FJTA 3ZVHA 1CLVA 3VGBA 4DWDA 3DHPA 3UR8A 3Q4DA 1KM4A 2VRQA 4N9CA 1OIFA 2V63A 3APGA 4NILA 4ZO6A 4UXDA 2X09A 5K9XA 4FS9A 3L4UA 1TPUA 4HZ8A 1RA5A 2FHFA 1ZP3A 3N6HA 3O05A 4GVGA 3I4EA 3IIPA 4DM2A 1BG4A 9XIAA 3ZJ6A 1XIJA 2W66A 1EHAA 1GW1A 2HCVA 5F2LA 1T0OA 4YTRA 3TJXA 1AUSL 1VCVA 3UCQA 1HKVA 1ZAJA 1JD9A 3ARZA 3B9OA 4Q8TA 5M2FX 1JDAA 1N82A 4KWVA 1X7FA 5A5WA 3IIXA 1TE6A 3GIQA 4FXSA 3B0PA 2VX5A 3QFWA 1JULA 1PIIA 1SO5A 3LGEA 5AZ1A 1L6SA 3C5QA 3IARA 3W2NA 3L68A 1HKJA 3SCQA 1L6FA 1WP6A 1EC7A 1SFJA 3ZXWA 1E56A 1V6YA 4YTTA 4J3WA 2BWGA 4Y9NA 5FJPA 3V3WA 3QGKC 1FWGC 2CZDA 1L6GA 1MFVA 4N7QA 2FFIA 1QR7A 4PULA 3LI0A 3RITA 4G2DA 3N3MA 3NDYA 4IJCA 1IGSA 1LJYA 2VXNA 1QK0A 3C3UA 3VA8A 1KGWA 1RP9A 3NZPA 4IFKB 3SN1A 2XVKA 1M68A 1Z42A 4O0KA 1MUWA 5AYYA 4K8HA 3A12A 3VGHA 4AVOA 4ZO9A 4UWMA 4ADSA 4PEKA 2VD9A 4N02A 1VEOA 2YLAA 2WZMA 5D2TA 3UYIA 4CNTA 3ZYZA 4JN8A 3Q37A 4IGSA 2XYLA 3DZ1A 1ZAIA 1B3XA 3STEA 4Y9PA 3LPFA 1EWDA 4GCAA 3UY8A 4XZNX 2X1IA 2FYMA 2X8RA 3TSBA 2V3DA 4XO7A 4MKSA 5EYWA 3K8MA 2FHBA 3T0BA 1XSJA 2WPBA 4ROPA 4W7WA 2BGNE 3M0IA 2I14A 4NZCA 2NT0A 1XBVA 1R7AA 3SRFA 3CV2A 3NQVA 1RQEA 2WSYA 3WEOA 1YPFA 1EP2A 1NJJA 3UWYA 1F5ZA 4WIWA 5REQA 1A5CA 3KS5A 2JEPA 1EPXA 2X30A 4ZE4A 4NZ4A 3T44A 3LPGA 1GOMA 4HHHA 5HA7A 5IHSA 4C90A 1KQZA 3PANA 4GACA 4UFLA 1JCXA 3KE0A 2PEVA 1AW1A 3AS0A 2J9XA 5D32A 6ALDA 2CZFA 1WZMA 1D2KA 3LRKA 3U57A 2YB4A 1OZMA 2V3GA 3MCOA 3OIHA 2PE4A 3PZOA 4WY0B 1OT1A 3G6LA 3MC5A 2Q02A 2C8NA 4AYGA 4DPQA 2NT1A 1R3VA 3T05A 1NSJA 3NZGA 4EPBC 1EHNA 1XCXA 4QDWA 5K4XA 4PCNA 5XIMA 3SY5A 1OGSA 3W29A 4M51A 4IJBA 2WMFA 4U2YA 1RVGA 3GW0A 4A3RA 3PPGA 4O0ZA 3CNYA 1E6ZA 2Y5JA 4MGGA 1V6UA 3CH9A 2WC7A 5CCZA 4DAFA 3EMZA 3H2MA 5E0CA 1E6RA 2WVUA 3AIVA 3UYCA 1WE5A 2PD9A 1V6WA 5FF4A 2ZA2A 4WOQA 1SU5A 5GNXA 3OBKA 1KXTA 2DZWA 1UUOA 1KXHA 5LXXA 4POCA 1LLOA 3WDRA 1EEXA 3FHAA 2PWVA 4MWAC 2WANA 1Q85A 3POHA 1B90A 3ZJKA 5I6SA 1VPYA 4AAJA 4JTJA 2TSYA 4MNMA 1UWQA 3NQ2A 1FHVA 5BRBA 2E9MA 3LX9A 1EQPA 1ITQA 3DYMA 3ZWTA 4W87A 1X1OA 2FB2A 1U30A 2OG9A 4IPIA 4PFMA 4CQDA 3GFYA 4LRSA 2G95A 3AHYA 5EMUA 3N29A 4DXVA 3RM9A 3O6AA 4B15A 3AMLA 4DJFC 2GJXA 3A9BA 5BMXA 2JKPA 1ALDA 4BF7A 1Z48A 3KBVA 4OT7A 2VFHA 2MNRA 2OJPA 4F4RA 1JCJA 4NJHA 4J2MA 2R1NA 1XC4A 1XDJA 3O3RA 2X05A 2QYGA 1X6UA 2OEKA 5CJNA 3N14A 2EGZA 2VX6A 3KX6A 3G0UA 1E3XA 4DM1A 4XIAA 4CNUA 2RHGA 1Z7AA 3UERA 4FNSA 2ZZ5A 2ABAA 4XD3A 4JR5A 5JIWA 1Q6GA 2QW5A 4I8DA 3QLLA 1AQHA 2C1HA 2X1RA 2IPWA 3HM7A 2ZZ2A 1T8XA 3TWAA 3JR2A 4ATLA 3UNTA 3WH6A 4YU1A 3F5JA 1JCLA 2PI6A 3BJFA 1BQCA 3VNMA 2YXOA 1QWKA 1I60A 3NVTA 3N6JA 4NXKA 2VZOA 2P3EA 1W56A 1OC7A 3NYZA 1F8IA 1EJ7L 4TVDA 4YVPA 5A6LA 4NF7A 4UTIA 1QO5A 2IW0A 4Q4MA 3NNTA 4B3LA 2H3BA 5E6YA 1WV2A 1CCWB 3UGVA 2WKLA 1IWPA 2QCNA 3CEPA 1RD5A 3W7DA 1R8LA 1RD6A 2D0FA 4V1XA 4ZO7A 2QPSA 1UQYA 1GG1A 2BXVA 2V30A 1RJQA 3CHDA 1TQXA 1XHGA 2NV9A 3FKKA 4IFKA 2NX1A 1CXFA 4UFKA 4DO6A 4E8CA 1ISVA 3G1FA 2FTPA 3UZJA 3OQ8A 2GLKA 4UTUA 5HNTA 5GVJA 4XAZA 3BVJA 3VIHA 5I07A 1V0KA 4GNKB 3TXZA 4LS2A 3BSGA 2Z26A 4JY9A 2HDJA 4O13A 2VFGA 1W2PA 4GFSA 3PULA 2GGGA 2XGBA 1LG2A 4BR1A 3EB4A 4LW7A 5LSMA 1UWUA 3TN6A 2A85A 4NZ3A 3AHXA 2XFFA 2YL5A 4M0XA 1XYAA 4LUIA 4O15A 2PDJA 4IPLA 3WL1A 5I03A 1PV8A 2HISA 3GR8A 1UR3M 3VNLA 3ENLA 4HNVA 1JF5A 3L7RA 3VOJA 2PF0A 2CITA 3GG7A 2B7NA 1ZAHA 3II1A 1O5KA 4AD2A 2D22A 2ALDA 4J3VA 4PZVA 1G6CA 1PKNA 4S2CA 4CEXC 2CPUA 1R87A 3FFSA 1LF1A 2WLZA 4DPPA 2BOEX 2NXIA 1JUKA 4NZFA 2EQDA 3M0MA 4ROQA 5BWAA 1OFOA 3E2SA 3T9PA 3L2MA 3DYOA 4RE2A 4AIBA 1UMLA 4O28A 1J0IA 1W17A 3PBGA 3LMZA 2RGLA 3JZUA 5H2ZA 4XSLA 2VCBA 1QHOA 3PJUA 1C9DA 4F0SA 4Q6JA 3MO7A 2QJJA 1TELA 1QNOA 3OP2A 1VYSX 4KIEA 2Z27A 4GQ0A 3R4IA 3SY1A 3N1AA 2NUWA 3CM4A 5B80A 4WY0A 3UXKA 1GYNA 3B4YA 4PTVA 3V5OA 1JRBA 1WAWA 4IXXA 2RDUA 5LYRA 4UTTC 1H7PA 5CSSA 4O0QA 2C15A 4OFCA 2PDHA 3QY7A 4GH3A 2INEA 4TX6A 1EIXA 3SUUA 1VCFA 5FL0A 1TWZA 2WMIB 4G9PA 4PRTA 3QC3A 1WDQA 3LA4A 2EPHA 2A7NA 2PLMA 3AIWA 1OF8A 2QCFA 3LHWA 2WNZA 2BNJA 1KM3A 5F4WA 1XI3A 1UR4A 2FH8A 3ARXA 9CGTA 3WJSA 4D8ZA 3EA3A 3UFYA 4W9TA 3N11A 4JQ1A 4O1EA 1YRRA 2PDLA 3EDKA 1PZ0A 6TIMA 1X38A 1FFRA 3B9DA 4XZMX 3STPA 1KGUA 5M17A 3NEHA 3V1HA 1EO7A 4RNIA 2FVKA 1UIOA 2IMRA 3LS9A 3F2BA 3LSBA 3BICA 1W1B1 3GU9A 4CQCA 4EVZA 3MY9A 7ODCA 5I3HA 4DBDA 4KS0A 3KLKA 1K02A 3SUVA 3O6CA 4X22A 1PS9A 4O4VA 5AYIA 3MI6A 4R7OA 4FLQA 4M5PA 3IANA 2FH6A 2GJNA 1WXYA 2H8ZA 3U2EA 4LVBA 4RW5A 1JL8A 5K2ZA 3TTEA 3DUGA 5HPCA 1FP9A 1ZALA 2ZWZA 4KEMA 5BCAA 4PSPA 4J1OA 2EEXA 4WSKA 1TKKA 3WLMA 1VCGA 5I23A 3PZUA 2RH9A 1XYFA 3G18A 4YPJA 3SGGA 1F3TA 3CUZA 5D38A 3MKVA 2J7FA 2BY2A 1O5QA 1YEYA 1B30A 3H22A 4YTSA 4O53A 1OY0A 3QGAC 4OGZA 2P10A 1B1YA 2AAAA 1JF6A 1KRBC 4LTSA 4GUJA 3R1ZA 5C7HA 3GDBA 3M46A 5K7JA 4Q7IA 3FIGA 2OYLA 1B9ZA 5CJ5A 3N73A 4D6IA 1NFGA 4KW2A 5TD4A 4JAWA 1FCUA 2FLIA 4A8LA 4GE8A 3P81A 3KBWA 4DJEA 1RALA 1SW0A 3GUWA 4KCUA 5D9NA 1HW6A 2XZ9A 1L2UA 1JI2A 4G8TA 2HPIA 3CUXA 3TYUA 3PUDA 3HO8A 4P8XA 3C61A 3WLQA 1IYXA 3AWOA 5BXSA 4CUCA 5EPDA 4UCFA 5A69A 2OU4A 1H1YA 2Q01A 3VDHA 3MBDA 2EG8A 1OFEA 3OGVA 4CVWA 3IJLA 3A6OA 3TJIA 3KHJA 4L4MA 3LBCA 1K8CA 1SZFA 1A49A 1EUNA 2J7EA 1XDMA 1C91A 1S5NA 3HG5A 1HJSA 4NKCA 1ZCCA 1LOQA 1XX1A 1UZHA 3VMNA 1J2WA 2C79A 5A8GA 4TXEA 4BI5A 4RNJA 3GNPA 3BLLA 5A8PA 1B4EA 5HWNA 2XPKA 3S5ZA 4AF0B 4LY4A 2ZZ6A 2XIOA 2XM2A 4PCPA 4HNCA 2VZUA 4GABA 4JKMA 2GQ9A 2O7QA 3PB2A 4GA8A 1LCOA 1U33A 2WMGA 5DF0A 2PWGA 4E4UA 1BGGA 4C6IA 1Q4NX 5HANA 4NX5A 3U6WA 3ZR4A 4QQ3A 1GK8A 1FKWA 3DFHA 2WJDA 3BG9A 1RCQA 3PBYA 1V6TA 2NQLA 4UTMA 1QOXA 4M24A 5D02A 1ZJHA 4XISA 2DIEA 2CZEA 1X97A 2ZX7A 5J04A 4WHBA 4EXBA 1OK6A 4ZZ9A 2J74A 1OEPA 4HZ7A 4RXFA 2E9BA 4AB4A 4B16A 4DNMA 3H2EA 5H8PA 3G3MA 1PIGA 2CLEA 3UPWA 2H90A 4IMDA 2YDQA 2O0TA 6TAAA 1H63A 2O7SA 4ILSA 3H4XA 3V5FA 1LTDA 3CUJA 4DZAA 3NM1A 3TA6A 4A4AA 3F5KA 1UR2A 4NAFB 2DUAA 3M43A 1DBTA 5A6BD 1Q6RA 5L6UA 1I45A 3CTLA 1M03A 3CMFA 4NT0A 1K77A 3S5NA 3QQ1A 3NL3A 4DBUA 4D6GA 3SY8A 3DC8A 1KKRA 5CG7A 3PPCA 3S83A 3K1DA 4J3UA 3LN3A 3VIPA 1X8CA 1QHZA 1EB3A 3OW1A 5FL1A 1AK5A 3NQDA 5AOUA 3JRKA 4GX9A 4KWWA 4D1JA 1J9YA 2GQAA 1LYXA 2XM1A 1SO6A 2E67A 3QQ0A 2G3MA 1UR8A 2QCHA 3N6QA 4JTEA 1F6KA 1HN1A 1KD0A 3PBUA 5BMWA 1CDGA 1I2RA 4AVNA 5CQ1A 2WVSA 4OUIA 1KRMA 2QUUA 4G1NA 3WJXA 3WD0A 1VF8A 4CU7A 3W71A 3KLLA 2WMIA 5LNWA 2ISSA 1JI1A 3MYPA 2B7OA 2GUBA 4FNUA 4DO7A 3R94A 2QT3A 3NYDA 5SWUA 5E9XA 4DAIA 5CG0A 1UD4A 2RAGA 2XINA 4H7VA 4U28A 3EPNA 1SVDA 1IIHA 1UPMB 3E38A 2VZVA 2PTYA 3GG1A 3CMJA 3W6LA 4GNVA 2L5HA 3DFOA 4RW3A 1Q4WA 1AVAA 1UW9A 3UG5A 1LG1A 3GE7A 4HYWA 1K9EA 3IEBA 4BWLC 2DFAA 4Z2KA 1SJCA 4UTHA 4O10A 1H7RA 3D0CA 4N6EA 2R1KA 4ZTYA 1TPVA 4CU8A 1RSCA 3TMLA 3WY1A 1UHVA 4MUPA 3SB0A 5LNVA 3RU8X 4FIQA 1B31A 1W1VA 3QBUA 5K3VA 1HNYA 1R6WA 3CB3A 4DXXA 3EOUA 2CLMA 4IL2A 2I9UA 5DMNA 2YB1A 3E2VA 3F4WA 2R9RA 4JIRA 3WDHA 1NY1A 1H7XA 1C3FA 3RX2A 1XIEA 2VQUA 3SECA 4X9YA 4GX8A 1FOBA 4XWUA 2JIEA 4LRTA 4FAMA 2HMCA 4O50A 4W85A 1M41A 5DT7A 4XZBA 1EO5A 1E5JA 5HBFA 4A35A 3NUKA 3NDOA 4PGLA 2YBUA 1UA3A 2NLYA 1TIMA 2V2HA 5H1WA 4RV8A 4Q8OA 1QFEA 4JKKA 5GNZA 2F6UA 4OTKA 3PM6A 2A3BA 3RJXA 1CI1A 5DX7A 4MPQA 2XZ7A 4JL2A 4Z1YA 2QEZA 3PP7A 5MKGB 2Y7FA 1OCNA 3WLKX 3PZVA