1MZPA

Structure of the l1 protuberance in the ribosome
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
217
structure length
217
Chain Sequence
MLADKESLIEALKLALSTEYNVKRNFTQSVEIILTFKGIDMKKGDLKLREIVPLPKQPSKAKRVLVVPSSEQLEYAKKASPKVVITREELQKLQGQKRPVKKLARQNEWFLINQESMALAGRILGPALGPRGKFPTPLPNTADISEYINRFKRSVLVKTKDQPQVQVFIGTEDMKPEDLAENAIAVLNAIENKAKVETNLRNIYVKTTMGKAVKVKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the L1 protuberance in the ribosome.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Ribosome
molecule keywords fragment of 23S rRNA
total genus 59
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2002-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 1mzpA01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mzpA02
3TG8A 3ZQJA 5DM70 4QG3A 3U4MA 1ZHOA 1MZPA 5DM60 4QGBA 3QOYA 4F9TA 2HW8A 3U56A 3FPNA 1AD2A 1DWUA 1I2AA 4DFCB 4QVIA 1U63A 1CJSA 3UMYA 4LQ4A 4REOA
chains in the Genus database with same CATH superfamily
4Q5IA 1I1QB 1K68A 3L9WA 4QEKA 3V8MA 4E12A 3BD8A 5J9FA 3T3DA 3KHUA 4ZO9A 2YHBA 4Z7NB 1MOPA 4DBLE 1W44A 3DR3A 3CO5A 5BSKA 1V3TA 1ECJA 4UNQA 3SHTA 3QX9A 3GP3A 3M4YA 1YL6A 4C0AC 1GZUA 2KSQA 2W2KA 3H4TA 4YO8A 3CWZA 5DW0A 4ZAVA 2G8LA 2R7NA 2Y1GA 1RWPA 2OXFA 1H85A 4UZFA 1P4HA 1JSLA 3K31A 4TM8A 1C81A 5BT9A 1MH1A 2PLRA 4H6XA 4BFLA 3K1ZA 4DMGA 4ZPJA 4GX5A 5C8YA 1Q1GA 4GLOA 5TQVA 1XXLA 4DQ0A 4LY0A 5EFOA 1UBMS 1R8YA 4MHSA 1UQUA 1IRXA 2B37A 2B5VA 2P41A 2XUIA 3IDFA 4KK4A 4ZVKA 5BVHA 1U7PA 5L4NA 2W6ID 2E82A 3SJ7A 1VGQA 1ZNZA 3T3MB 3U60B 2GNAA 1IPEA 1IBRA 4AXXA 4CR6A 3B2NA 2QUIA 3MAJA 3KZOA 1B0UA 1M72A 3ICWA 1GCOA 3AESB 2CE2X 2PZ8A 4HQNA 1J56A 2RH5A 2G4LA 2Q3DA 5T4EA 4Q9HA 5D1HA 1EAMA 3P9PA 4PR0A 5KKAA 3A1VA 1G9XA 1DPGA 4JXXA 1G3RA 1ZUNB 4CQLB 1E96A 1TK2A 3B1YA 4YT2A 4KDFA 1OLXA 1XZDA 2WTEA 2XLCA 3QWBA 1PQUA 1LTHR 4KRXA 4BTVA 5DF1A 3ME5A 4P4LA 4LJRA 4KX5A 4XIYA 1RC1A 3OU7A 2QKYA 2V9ZA 3IIEA 1UIMA 4MYCA 4P4SA 3VKFA 5AVQA 1TECE 1F3LA 1JHAA 4FQ8A 2MSLA 5EESA 4B73A 5JFGA 1SCBA 4XWAA 2GI4A 2V3WA 3WYDA 4N9WA 2W48A 2JLWA 2HXSA 1U04A 3A06A 3CVVA 2AI1A 3QXCA 3E9RA 2G9NA 2Q41A 4K26A 2IYTA 1NSTA 4G0PA 4LE2A 2PSEA 1F48A 1PX2A 1QFSA 2BUCA 3MHPA 3ROPA 9LDTA 4BWFB 4E46A 2Q1XA 1MFZA 3KLPX 4ZARA 3BDVA 3EMVA 4M7OA 5J2UF 3WIBA 3GVHA 3PQFA 4FSXA 1JDBB 2AN3A 3IPAA 2QQEA 3V80A 2YQ4A 4YP6A 4Z7OB 4JCCA 1N7IA 3U5ZB 3Q7QA 1CZUA 1KSGA 2RG7A 4CF5A 2A30A 1XEXB 3QWAA 3CZ9A 1GU7A 5FX2A 2JARA 4X44A 4BLRA 4EA9A 4KO8A 4MA0A 1V6CA 2UZ4A 4KZKA 4IS3A 3EDMA 1W4RA 3REGA 3I09A 3NAGA 3UHOA 3DTTA 3K4PA 4QWMA 4ZPXA 5J2UB 4DBVO 4YX9A 4J6FA 4XJSA 4B82A 1NNLA 1JPUA 1JSZA 3KHKA 1P2DA 3FYSA 4GSKA 4PHGA 2IU0A 3QH4A 4BWVA 3KL4A 3IT1A 4JHLA 5CT5A 2OV6A 3EFBA 1VJ5A 3D8BA 1YVRA 1XU9A 5LQMA 4MRSA 5DTMA 2VYVD 3IQZA 2YDXA 3OE7A 1RXWA 3IA7A 4A2PA 4RHYA 4EY3A 3VHLB 2CSUA 3PHJA 1KIFA 3A2NA 3MTEA 4G1BA 5FPTA 4ETNA 2WJZB 1XDSA 5AD1A 1E0AA 5L9AA 3DULA 1HK7A 4TMKA 1IOWA 3F5MA 1MJ5A 2CDNA 3M33A 5FBZA 3FSEA 1JX6A 5ES3A 4XI9A 4U6NA 4J90A 1NU8A 1QIHA 3MWDA 2GD6A 4RF3A 4UUNA 4H3HB 1P0IA 2VK4A 4KU4A 4EHAA 3RUCA 3D4PA 1OSNA 2ACWA 3WLHA 1GR1A 3LY5A 4C03A 4RHEA 3NHAA 1P1CA 2VN8A 1YQEA 4FI3F 821PA 4QFMA 5HPYB 2D6FA 2Q5LA 3ONEA 2JD2A 1PG2A 2ZJ0A 3ZY3A 4P36A 3RSQA 5K01A 1F2DA 1R2QA 1Q2XA 4PZ9A 2NQTA 4EATA 3CFYA 2GERA 1D6JA 1T2NA 3P52A 4BUCA 4TS9A 4D0LB 5IYZF 3TLMA 1OCEA 1YS4A 4ZCTA 4P5PA 1KEUA 3LY9A 3BRWA 1U2GA 2VEDA 3FSGD 3TM4A 1G8AA 3ZJUA 1UXKA 2IYWA 1MQ8B 2Z57A 4MK4A 1UDRA 2AMYA 1JIUA 1O95D 4OJNA 4DCOA 1KY3A 1H6CA 1S3GA 2XKJE 3NOQA 4Z3DA 2OBFA 1NPDA 3M5WA 4HDKB 2G5GX 1DWOA 1G6OA 1DHRA 3CWQA 3Q5DA 5GM1A 1VXOA 4BP9A 1J06A 1T3ZA 2V1UA 1XLTA 4TQGA 3NIGB 3SPXA 2B98A 5DWQA 4BVJA 1ECLA 5HGJA 1OC2A 4LJYA 4D98A 1IG0A 1ZM4A 4Y9UA 4OGGA 3GGJA 4GUAA 4IOJA 2NU9B 1QTIA 5IMBA 3S3TA 5DX1A 3W2FA 2FN3A 3UCEA 1OWNA 1DAIA 1HBJA 1OGJA 1Z62A 1TI7A 3DDHA 1KAOA 1GA1A 1P81A 2P6PA 4MQ5A 5ELLA 4ER6A 3ETJA 2EU8A 2Q5CA 5EMNA 1GDHA 2WB4A 4PZUA 5GP1A 3S28A 1ZCJA 2GRAA 3AR3A 2ZSIA 5IVHA 1N1GA 4ZK2A 3F49S 4UQOA 4D9HA 4EUKA 3SHVA 2P5UA 4RZHA 4RQTA 5LP6C 1P33A 4CG2A 4CTMA 3KC2A 3L0CA 3EXFB 1HE3A 2IPAB 1R8SA 4ESEA 2R6AA 3PTZA 2ZYSA 3QE4A 4LYYA 3HN7A 4HH1A 4XFDA 2QNIA 1KKUA 3HL4A 4UBMA 5HBGA 3UJAA 3UUEA 4F5EA 5LJLA 3S2GA 2IS4A 1FNSA 1G5QA 3QOXA 4R54A 3WLNA 1GYQA 1B6GA 1G2IA 1JEQB 5C0OE 1PX0A 3E3LA 4YT8A 4L6AA 1EX9A 1T91A 2BGLA 2I87A 1OLXB 4D92A 2V03A 2X6TA 3G59A 4X3OA 2W11A 2NQ2C 2JLZA 1HOXA 3BJMA 2QTVA 1D2AA 2YZMA 4J0EA 2ZI6A 5TGTA 1TU3A 4LRWA 1E59A 1PGJA 1HX7A 4NQZA 4DMHA 1Z07A 2FFHA 2IYUA 3R2JA 5HX7A 3JQ8B 5ALEA 4ZEXA 1DAHA 1XAGA 2RBGA 3RM3A 1V9LA 5K3BA 4PF1A 4N3BA 3TCKA 4AN1A 1IB0A 3QQ5A 1JVSA 2Q4DA 3OT4A 1SEPA 2B8WA 3IP3A 3KO8A 4LTNA 1SFRA 2E6UX 3LVRE 1DWPA 1UFQA 2PZMA 3DPSA 4OB6A 5BMVB 1JIKA 2YH2A 2O06A 5CG2A 1XN4A 1RSCI 4YRTA 1FP4B 3W6UA 5A3QA 3PXDA 2ZUEA 4IG4A 4UZEA 1JSRA 2Y2VA 4GSLA 4QHSA 1C9NA 4YV1A 1W75A 3J80A 1A2QA 1U0HC 1WF3A 5GVRA 4IICA 5BY2A 1ZMOA 2XUJA 2ZS8A 2WG1A 3D3KA 3IUBA 5K2MA 2OGZA 3C3PA 3ENKA 2D3TA 3ZHSA 1E66A 4P0PB 1Y42X 4WZ6A 1W36D 2VI5A 1GPMA 4KI0A 1K5HA 5HJEA 1AJEA 3IQIX 3CH4B 4AZ3B 2E5WA 3G9QA 5DGTA 4N0DA 1SCQA 4P93A 1UBGA 2C61A 5KJFA 3KR0A 3AY7A 2GA8A 1J2EA 2HB6A 4CMCA 4F9EA 4GSYA 4LMBA 3B1WA 3A70A 4R83A 2P65A 2FH5B 3G2LA 5F1KA 1ZR2A 1N57A 2PL1A 2FK8A 1U6KA 4LV5B 4E13A 3E8MA 1F0PA 4RQUA 2YNMA 4LX0A 2C5SA 1QE5A 3F1KA 3LYLA 1TF2A 2WWIA 2JIZA 1F17A 3M3PA 2IZ1A 2P2CA 2VQ3A 3N7UA 5SY6A 3SHQA 3ONVA 3B7GA 5F21A 3NHWA 3SNHA 2PUAA 4YMTA 2HMWA 3P9YA 4JLSA 4GBED 2OD9A 3TDKA 3B1KA 4WBSA 4BB6A 3I92A 5L45A 1LBTA 2ZRHA 1M8PA 4AVYA 1M7BA 3IDZA 2FRDC 3RT1A 4YMVA 4C0KA 4I08A 3IESA 2ZB8A 3C3DA 1QPBA 2DPHA 4BV3A 4R7ZA 4H4DA 4KZPA 5HSGA 2AFHA 5FWYA 3A28A 1JHVA 4G86A 1EXDA 5FYQA 4R1SA 3U3OA 1U11A 2A94A 2ATEA 5EWMB 3RRJA 1J4AA 3HSSA 4HMPA 4YJ3A 4E5PA 2YWGA 4BQFA 4IZHA 4PPFA 2O0LA 1DG3A 1I2CA 4Q9DA 2I1LA 3A11A 4H1UA 3ZGOA 5AJHA 2ZM6B 5K6TA 4EX6A 2C3YA 5HWSA 2BR3A 1CDZA 5FT9A 4A92A 1E7YA 1VI5A 3U4IA 1JAYA 4DGSA 3W3AH 4E5MA 1ZS9A 3AG5A 1L5HB 1ATIA 2VSOA 3DHWC 1LFDB 1X1AA 4WXRA 1N0HA 2DPLA 4BMOB 1A9XA 1N9ZA 4KSYA 2B2CA 3IAM6 2YRFA 4F0JA 1WULS 1EWQA 3Q88A 1QF9A 4FFBA 4M0PA 1I4OA 2YRWA 3W5HA 1QGUA 3OHPA 4DV4B 4WERA 1FBTA 4AKTA 2XYRA 3KQVA 5EIBC 3CSUA 1HORA 2XCQA 3MNFA 3DL0A 1VL8A 5KHAA 1N75A 4X1IA 2BW0A 3DBHA 3LNCA 4JY7A 3TLAA 4HH3C 1EGHA 4NU8X 2Z30A 1TO6A 3PFNA 4CI0B 2VH2A 1Y8ZA 3UH0A 4URYR 3ETEA 3HDVA 2JI8A 4MICA 1A2OA 1VHLA 2DFDA 4G41A 5B1IA 1NE2A 3Q9LA 3DWIA 4AXBA 3RRMA 2O2EA 2IQIA 5E4YA 2J0UA 5KTOA 1XDWA 1XQVA 1XZGA 1ARZA 2FUG6 2WSSD 4XA8A 1PAUA 4N5MA 1BDIA 4NEGA 2Q0SA 3D43A 3MWFA 1O54A 2HO5A 4MVJA 5MHTA 5SYMA 1JHOA 5J4VA 1U3FA 1T10A 4N3AA 4MPTA 1OJLA 3WAGA 3GLKA 5DFAA 5IJ0B 2MYUA 4OI2A 5CYFA 3GP5A 4GKBA 2WSMA 2FW0A 4P38A 1SBIA 3RYHA 1AT1A 2GMWA 4Q01A 2YJTD 1PYDA 3D0RA 4K28A 4PIPA 4WTOA 4RDXA 1UZMA 4H27A 2HPAA 3K5IA 1GG8A 4K9SA 3OJFA 1P29A 4AS2A 1JKIA 4YAOA 2C4MA 1V95A 1JLRA 1V7CA 1TRHA 1A27A 1KOJA 1NW8A 2AS0A 4C4AA 2QP3A 4I1YA 2EX0A 4E6EA 1R0RE 2PBLA 1QUFA 4R8RA 5EG5A 3HZZA 3KWFA 1TNDA 2JFGA 5I8ZA 1XD2A 2QE7D 1W76A 2IHVA 2MSKA 3R8CA 3A6GA 1DS6A 3CPHA 3R3WA 4J75A 4LQDA 4PONA 4AZVA 2XAAA 2FG7C 1UC8A 3EXHC 4LF9B 5IARA 4NBNA 1Y3BE 3ORHA 1SD2A 1VSTA 2OV8A 4K6MA 2PKYX 1DB3A 1POWA 3EFOB 3OZAA 1WXEA 2H65A 4TV8F 2B69A 5AHRA 1D5WA 2XDAA 1DCFA 4BJ6A 4EG7A 5CYGA 3FPEA 1R5JA 3G5AA 4UTOA 1U1EA 1E1KA 1V7ZA 3K4HA 3NFRA 4FOPA 4Y2SA 1JTFA 2GPBA 4HQOA 1IM5A 2WVHA 4X1KA 5GADl 2ZQYA 5KX5F 1E2DA 2EYQA 4G0MA 1I2MA 3T15A 5C1DA 1KJZA 2C8LA 2ZCUA 4BMDA 2IOQA 1NJ6A 3RAFC 3UVEA 2VHJA 3SQMA 5E7QA 1MTZA 2DLDA 4WLVA 1TYDE 4BNUA 3O4GA 2Q21A 2CBZA 4MWEA 3FZGA 4KXYA 1B41A 3W34A 1SD5A 1P72A 2XBUA 4KFRA 4E6PA 1VIAA 2W8BA 4MB0A 2VXOA 2XZPA 3C7AA 3C7DB 3K3PA 2QJTA 4M6WB 1ZBDA 2PS3A 3EQ8A 3O2SB 1HLPA 2CLFB 2QTCA 3AKDA 4NH0A 1SIOA 5D5PA 4U8HA 5TJHA 1YONA 3EXEA 1OFUA 4P98A 3A3OA 5FI0B 3EPHA 2WJVA 5CLQA 2C7GA 1L4KA 1WXFA 4HYEA 1E4EB 2X0JA 1EFTA 4M8LA 1OYOA 2GN0A 1SU8A 1LCIA 1Q50A 4MV6A 1O8BA 4ZYTA 4XR9A 2QBYB 3O8OB 1DNPA 1KMQA 3E18A 3NR2A 2P9GA 4JQCA 4CR7A 5KVQA 2IY7A 1ULTA 3PSAA 1YZKA 3B6EA 1QCCA 3EGWA 1B6TA 4KTTE 1B16A 4QBIA 4QU8A 1OI7A 4DARA 4HAIA 3MMXA 3HRHA 4CR8A 4RELA 5KSZA 3L0OA 2WTNA 3ND8A 4B3XA 5FWXA 1F6DA 1DHTA 2ZUVA 4LXQA 2VSYA 2D1YA 1T9AA 2WD7A 4L5JA 1XA0A 4ER5A 1MJHA 1X7ZB 4OKSA 1Q44A 3K09A 1RPJA 2RHCA 4JL5A 4GL2A 4PLHA 1XTUA 2Z0MA 2JPDA 5A3JA 4OYRA 4HNQA 3HXTA 4G63A 5LSAA 1D1PA 3BH7A 3UENA 1NNI1 3DAFA 3GEHA 1N6PA 1XMSA 2JAOA 4R7TA 4OQEA 3TXAA 4NYJR 3BICA 3BUSA 1K2WA 1N5MA 3FNRA 5I5GA 3S4YA 2VP9A 4H6WA 2C7QA 4F84A 5B1HA 2NUAB 4QUIA 5JY6A 1ZA1A 1C8BA 2UYYA 4A8JC 4C43A 3IAS6 4CL2A 5MN4A 1RYHA 2ODBA 2F3TA 1DSSG 2ZBFA 4KQXA 4L8FA 1C0EA 1BDJA 1OPRA 4REQA 4LN1A 2XAUA 4XIFA 1PKEA 3I64A 2O2CA 4TN5A 3C6XA 1THZA 3KBBA 4GI2A 1C4OA 1CYDA 3F67A 4RORA 3WMWA 3DKPA 1AHHA 4P32A 4D46A 2AI2A 1M5UA 2EGUA 1IULA 3H8WA 1MQSA 1Q92A 5B3LA 4IV8A 1XELA 4R1MA 5TVGA 3ORRA 4EKEA 1ZH6A 2UYQA 2P9TA 4Q9NA 1Q74A 4DR7B 4F4JA 4JZYA 2AG1A 5KMGA 2DPGA 3RKRA 3VPSA 1IHXA 1NT2A 1M1YE 3DVQX 2H63A 3TLZA 2IHYA 4UTXA 5BUZA 3V55A 2FW8A 1KK3A 1QLJA 4KUHA 3MTQA 4F2WA 3WZMA 4YONB 2OOKA 3PNBA 2VNAA 4MW5A 2GPAA 3UC5A 4B3HA 2PV7A 2W70A 621PA 2JGNA 1TU0A 3A9UA 1XHLA 3FETA 3FYUA 3D6AA 2Z58A 3A1UA 2OPHA 5IDXA 1LY1A 3KJIA 2GAFA 5HTKA 1DC4A 2V8BA 3GWZA 4N3GA 2FZ4A 3OMXA 5FFMA 1QYVA 3KB1A 5KNBA 2CXHA 4XLZA 1MZVA 2OECA 2JLAA 3UV7A 2NPOA 5FDFA 1JMKC 5FUWA 3KFVA 2W2TA 4BO8A 2FMIA 1CR4A 2RIRA 3G9XA 3A3PA 4I4TF 3OA2A 2E4YA 3AKYA 1OROA 2A5DA 2C3MA 3I6ZA 1T43A 1V6SA 4HAUA 4WLOA 3G2MA 3OCUA 3GPBA 4D0GA 3CLSC 3T38A 1IBLB 3HI6A 2O50A 4J16C 4BE7B 1YTLA 2BSXA 5AJTA 1ADJA 4DJ5X 4DJAA 1JEDA 5IULC 1NW5A 3L07A 4CM1A 2BKEA 1S2LA 3LBIA 4I4TB 1FUEA 1HT1E 1SGWA 4WBXC 1M2FA 1A8HA 3ZNQA 4CLDA 3MB5A 1LDGA 4WA7A 2CLHB 7ABPA 4V2UA 5DTJA 3RFUA 3OOEA 3MWGA 4LZWA 5E3JA 3U5TA 1LPAB 1QHGA 2P4EA 2VKTA 1R1DA 2FUKA 2VP3A 2OZPA 3FLEA 7MHTA 1XK7A 4G4SO 3ESQA 4XD2A 2UZIR 4YJGB 3MBOA 1G18A 4RA6A 3BJRA 2A0KA 3K1AB 1BGWA 3K0FB 4DV2B 4P84A 1BD4A 1E2NA 4OFXA 4OQYA 5K3FB 3A7EA 1QCDA 1QLHA 2PHZA 2PUWA 1F2VA 4HRVA 4KQGA 3I9KA 1SZJG 1WZNA 3ZXUB 4CLOB 4AIRA 2E4WA 4CETA 4IJWA 3O03A 2VAWA 4H3VA 3AZPA 4KV7A 5DJ5A 1Q20A 1A97A 3LA8A 4Y67A 5JANA 3Q3HA 4ALNA 1TA4A 3A4LA 1PR3A 1XBTA 3KKKA 1SC3A 2FJUA 3BCRA 3DZHA 3TZCA 2RBEA 3C87A 3DAHA 5JD4A 2R7AA 2I03A 2VF8A 1SAYA 2R8BA 1IE3A 2PS9A 3TFQA 5HKKA 5KUTA 1E2UA 3WHLA 4IMPA 3KSMA 4YTEA 5C5EA 4KXUA 4XM0A 3LYAA 3HJBA 1L7MA 3KETA 2PANA 1OAAA 1R74A 2GTPA 5HK9A 1TQ6A 2OZKA 5HVNA 1XR3A 1BCRB 5E6RB 4N5LA 4ZREA 3ZDRA 4EG8A 1OXBB 4TRMA 4BYMA 2QSUA 2RJOA 1FTGA 4E1BA 4FC7A 1U31A 2G1JA 3W2GA 2WU8A 1FF9A 2BF4A 1KJWA 5KYTA 4IIXA 1SVUA 4TZKA 3AM3A 4E4RA 1GNSA 4QVGA 2HGSA 1EUCA 4P35A 4C78A 4H3KB 1OGIA 2HIAA 4I55F 4KIUA 3NBUA 5EJEA 2V97A 2D0OB 3UYLA 5CHEA 3UQYS 1ZAKA 3TQQA 1DARA 4MQFB 1UAAA 1WDLA 2PBZA 3CZQA 2P2ZA 4IX9A 1L7NA 5HQJA 4X5OA 1SY7A 4BTEA 2IPOA 1WXDA 1WBDA 3V8RA 5PNTA 3ZWMA 2Q5FA 3VYWA 2OD7A 2CDRA 2COUA 4P82A 3FOBA 4RTQA 4HDMA 4TN1A 4G0QA 2MINB 1FTYA 5DOVA 3RASA 2ARKA 3H0EA 1AKTA 3VPDA 4CQJA 3KQLA 3Q41A 4DLNA 5BVGA 4CKEA 3ZNOA 3W7AA 4A1FA 5DYWA 3V46A 2QJFA 4UDNA 1IWPB 2VNKA 4JQYA 4QATA 3RGGA 4LJ5A 3W3ZB 5BSHA 3K20A 3FVTA 3MCVA 3N0WA 4AY3A 1ZCFA 3ZCXA 1N6KA 4Z0TA 2CEAA 2UXCB 1RXUA 2FQYA 3T34A 2HYDA 1D6NA 1YCDA 3UWKA 4EPWA 2DWOA 4CG0A 5EVCA 2OT3B 1CY2A 3JWJA 3KXIA 3ZUGA 4RTKA 5HIJA 4KR0A 1QQTA 5ITZB 3LT4A 3NETA 3V1NA 4ZI5A 5DWDA 5I7HA 3O47A 4KRGA 1XP8A 2AVDA 3FW1A 1RMYA 5A2GA 3CEJA 3N3BC 1YE3A 2C8JA 4JYAB 4NCAA 1I5OA 3PGA1 3X43A 4BX3A 2WFLA 4UVEA 1Z17A 4OXYA 1YS2X 1Z08A 2DBQA 2OL4A 3KV3O 1QPZA 3E7DA 2ZKLA 4B43A 2KMLA 3MS7A 2PYZA 1QCZA 2B7BA 1ZNQO 4PGGA 5JC8A 3VHRA 1TC1A 3FWPA 2JJYA 4JP1A 3THWA 2F8SA 1ZFNA 2R62A 1HZZA 3W1VA 1M6VB 2YXNA 3AEYA 4LF5B 3LSTA 2HR1A 4CF3A 5LUAA 3LX5A 4Z4EA 2DWPA 3HWSA 5H16A 3O0DA 3OQ1A 5ESXA 5TPZA 3JTMA 3SDSA 3EVFA 4Z54A 3FWHA 4HWPA 4JJ6A 5EMMA 2Z09A 1TVEA 3PHGA 1QHFA 3AB8A 3GDGA 3GJZA 4GM4A 4UCFA 3U40A 2VNHA 2Z83A 3IPCA 3AJEA 4MR7B 5BSVA 2RAFA 2VP2A 3BJEA 3PX7A 1D2CA 4C4TA 4BLTA 4Q9JA 3WGHA 2BMVA 4XPIA 5FULA 2APJA 2OOSA 1KO5A 5DXFA 3D5QA 1YOVA 2J41A 5KVVA 1D4OA 4YASA 1E79D 1L1RA 4KWTA 4M22A 2ZSBA 4LCEA 1UPPI 3P96A 3U19A 1ECPA 1E5TA 3F5QA 1U0LA 1R6AA 4U3JB 4XWGA 3LUKA 5G53C 2X9GA 4C0BA 4MUHA 1PW7A 2HLPA 3LQFA 3FCYA 5CB8A 4XM1A 5K0FA 1G6HA 3CUUA 1Z7EA 3BKWA 3MWKA 4TYMA 4W5QA 3SFZA 1ZOIA 3DZDA 3O2JA 3VYTB 3IMGA 1XU7A 2XIJA 2Z98A 3HUEA 4DFCB 3D4NA 1OH7A 1Q57A 4XJXA 1UZHC 1XPRA 1MH9A 5F2KA 2CNNA 1V8BA 3K0FA 1UM8A 2PO7A 4NU0A 1VL1A 3Q6NA 1QANA 4QL3A 5AXCA 4LSMA 5U9CA 2WUEA 2I7DA 2VHVA 1YMQA 3GUUA 2GJ8A 4JBWA 2WG0A 4QPDA 1XRRA 4TL6A 3F3KA 1KI4A 1GARA 3FLBA 4GE0A 3TQHA 3KQSA 4U0KA 4IIHA 3EXHA 3STWA 1OTYA 3L8ZA 1FFXB 5A6SB 4JEHA 4OB8A 2E0IA 4KSBA 1R27A 4BMZA 3QU5A 1I2ZA 2FUNB 2Q4EA 1NRWA 3OLWA 4BO2A 3L1VA 3E61A 1Q0UA 3KPYA 4ABTA 4ZVNA 1BGVA 1IDN1 1DRWA 2QMYA 3U7HB 5AJVB 4FMPA 2P9HA 3K7EA 1Q1ZA 1B8NA 1BCRA 3FJYA 3PKIA 5E6RA 4DIUA 1UR5A 2R6FA 2GM4A 3EODA 3HYRA 3AV3A 3QKRA 4HS4A 5FXMA 4F7DA 4EG1A 1M0TA 2A78A 2I2FA 3GJ3A 3QVVA 4NU5A 3PD0A 2O7QA 3UO8B 3ZTWA 4Q24A 4Y6LA 2X0DA 3KJQA 4Q0MA 4D44A 1A76A 3BFPA 1DDIA 2M2IA 5D3QA 1L4UA 1YUMA 3CNLA 1DG1G 3ONWA 4EO4A 2VP4A 3HB1A 2A0YA 5LU8A 1CSEE 1USUA 4A1OA 2VDII 2R9VA 2J9ZB 2Q27A 1E2MA 4PLYA 1UPUA 2PWZA 2XVYA 3A6JA 4IAOA 1OE0A 4P4SB 1PDWA 5ESRA 3IVXA 3G0GA 1RI3A 2AR9A 1I3KA 2O3RA 1HKUA 1ISHA 1EWTA 2QZ9A 1YDEA 5A4MS 1NYTA 5IKEA 1NY6A 1U5CA 1X9IA 2YQ5A 5E9WA 1JQ3A 5JMPA 2JJ2A 2GCPA 3S70A 4LXYA 1PT9A 4WZBB 3V2GA 4EEXA 4EI8A 4RL4A 3IVRA 3R5JA 4QPCA 2A33A 2K5UA 2VUUA 3K4QA 4BV2A 4WCFA 1M2EA 4ZOQI 1NLMA 1NC3A 3AILA 3LV8A 3PIDA 4LVOA 3WBBA 1P2FA 2QTWB 3R0QA 2XNKA 3T54A 4AROA 2Q4TA 4IL5A 1ZOSA 4WJKB 2CT8A 3MA0A 2AI3A 4S1OA 4C0HA 3HHPA 1JP7A 2QUJA 1L3BA 2V98A 1HYBA 2YJNA 4QUKA 4XUEA 4IILA 2R6GA 1FTSA 3PDHA 4N6OA 5JATA 3N2EA 5EIHA 1E63A 1PR5A 1HQKA 2Q3BA 3OIVA 3T3EA 5MN5A 3HDTA 2YIDA 3N8DA 5DGHA 5FRDA 5JSUA 4B4OA 1PP4A 1V2GA 2G9RA 2CXOA 4WK2B 1CNFA 5EE9A 4GC5A 4ZJZA 3I2IA 4Z7QB 4LGVA 4K9PA 3TOXA 4XWWA 1WE2A 1KAGA 2ON6A 3NRCA 4BVEA 3MUFA 5G1NA 1T0HB 2YTZA 4B7ZA 4BP3A 1WSWA 3M4JA 3E5HA 3G5LA 4JB0A 5IABA 4H08A 4PLFA 4C3VA 1ZO8A 1LSJA 1NE7A 4LDNA 1CQPA 2AWNA 1VHWA 2QM7A 1I6KA 2VDJA 2WNSA 1WBBA 5JALA 4TVOA 2DUUA 1Q2UA 3ZX4A 5FH9A 4Y2TA 4MR9A 4LC1A 1NNSA 3OM1A 2CUZA 1ZW6A 4AD8A 4LBYA 3IP1A 2EW1A 4JI3B 1CG6A 1QAOA 1VKJA 3OZSA 3QMMA 5KVAA 4TUYA 1U63A 2JVJA 1L4HA 4ZVLA 3JALB 4OFBA 2ISCA 5BN4A 3FLMA 3HCRA 3MCAA 3PXXA 2JCGA 3AXMS 3SR0A 5JAOA 5FUYA 1M3SA 1JH9A 1FQWA 1XVUA 4C4ZA 2VTBA 1CF4A 2AOVA 2IYYA 5PGMA 3T1TA 3EA4A 4E4TA 3L0SA 4ZWNA 4XRGA 5CLJA 3GLGB 3C45A 2ZRFA 2Q46A 2Z1DA 5EJ9A 2PT5A 2XVMA 3CB2A 4F46A 4HVCA 2W4IA 3ZDFA 3ZHOA 2XF2A 1N7GA 1OX4A 1DO2A 1HC7A 2ZYDA 4RFLA 3SJAA 4NBUA 1R3UA 1HDEA 3GFSA 5IBQA 3V00A 4CM3A 4DM3A 2FN9A 1KI6A 3EIQA 2M98A 2FMKA 2I6FA 4D42A 4C7MA 4FYYA 4PG5A 1PJ8A 2DUJA 1Y34E 3CC8A 3WICA 3WL7A 2JATA 3JPYA 1JPNA 2AJDA 2VHTA 3BH6A 3PNYA 4PO3X 3ZDYB 4DABA 4EW1A 1AKMA 4R2MA 1LD3A 3GGDA 4R1PA 1FYEA 2J46A 3WQSB 4I81A 2QBYA 2AN9A 2EP8A 5CPBA 4EMSA 4OD0A 2VYQA 1V45E 3FROA 5IHPA 5JFTA 1OQAA 2VPWA 4KR9A 1KPIA 4O2AA 2QUHA 2FW7A 2GDJA 4MYDA 4V0QA 3FPBA 4JGGA 3AU8A 4EUNA 2AFIE 2IPMA 2Z1NA 3QXHA 1R5NA 4EF5A 1D7AA 1YZUA 1U8CB 3OHSX 4O3FA 3DAYA 4FR0A 3S99A 3VOBA 1KNXA 2A9JA 5DBIA 3OEHA 3S27A 3UG7A 3WG9A 4D3ZA 3LFHA 1J0XO 1NJ2A 3PITA 3TG2A 1A8PA 2VZEA 2AV6A 7REQB 5B6PA 1G8MA 1L7OA 2QIPA 1B1CA 1LLUA 1TA0A 4JJ7A 2O14A 2PM8A 4OHWA 3OSUA 5LM3A 3D7SA 1XAHA 5J59A 5KOHB 3D0KA 2G17A 2HA7A 2G0TA 4LKOA 2IHJA 1T4MA 2Q7XA 3ET4A 5EZYF 4DDHA 2EP5A 4BO0A 3V3KA 1RVDA 3F6YA 4IS2A 1E2IA 5T6BA 3ZJ5A 2IYAA 3HU3A 3GLIA 2YXPX 1P0FA 3GCDA 4LA4A 4XX0B 2IZ5A 2OORC 4FSHA 2BGJA 4UM7A 2HKIA 4J94A 1W85A 1ILWA 4B4DA 3BERA 3P1JA 1KBZA 2CVHA 4KQCA 4YAIA 1UBOS 4RY8A 2Y05A 3BH0A 4FR5A 3P26A 1SVNA 3ROZA 1GA6A 1T2FA 2VRCA 2WRZA 4TQAA 1KFKB 5IX8A 1W94A 1NKSA 2VOEA 3H16A 1DAMA 3ITEA 2I91A 3PVCA 3NBXX 1E3EA 3WQHA 5J1SB 3FB4A 4RH0A 3KEOA 4X63A 2PH3A 3O9VA 4H2DA 3K0KA 4YNBA 3FDZB 1XRPA 1T34A 4ZTUB 1EUZA 3HADA 3MYRA 3FRIA 2YY7A 3UOGA 2V4UA 4JXJA 4E03A 1WW2A 2XE8A 1G8GA 3TAXA 2FX2A 3GLRA 5LQUA 2ZUUA 4IRUB 2Q5JA 1N5KA 1U2SA 2Z2YA 4ON9A 1FFWA 3FYUB 3TEJA 5AUNB 2VTBB 5BSWA 3MHTA 4PGAA 4L16A 1NX6A 1SQFA 4M2LA 5CFLA 2XGJA 4ESOA 2P9EA 1QO0D 4JI0B 5FORA 4BZQA 3DFIA 4PYRA 1IBCA 1M1YB 5LXTF 2WB2A 4GMGA 2GYUA 3WL6A 4LOLA 3CX4A 4CIVA 4F86A 2JHAA 1RKXA 4IXDA 1GQRA 2B2XA 1RZ3A 1V4VA 1E9AA 1E7QA 2WC1A 3QPUA 4ZVUA 3FDJA 2Q1TA 2XYQA 4HPWA 1NFQA 4M9SA 5DLEA 1L5NA 4ND2A 3TZBA 3R3JA 5ELXA 4OX9Y 1D2HA 3O31A 4PX9A 3QMWA 3RBZA 4CEJB 4F2PA 1E1NA 2ZUCA 1YRHA 1ODJA 3GB9A 4QHYA 1RP7A 2ODTX 4MI3A 4AO7A 1YK0A 4C87A 3ODPA 4BQNA 5JI2E 1AZWA 3R4CA 5AM2A 2XT9A 1ZMTA 1G3MA 2XQIA 5TX7A 1BNCA 2RAUA 2YWEA 4L85A 4ND5A 3J7TA 1Z6QA 1XPOA 1XMOB 1P5ZB 2GN4A 1FJXA 2UYGA 3QFSA 1RZRA 2BFCB 2L17A 4QQKA 4LI0A 1XALA 2BFWA 2JCYA 4O2AB 4AIIA 2B9VA 4ECEA 1IXYA 3I1JA 2A9VA 2FRDA 4MGHA 1BE0A 3IUSA 4HUTA 2ZWIA 4DREA 1FMTA 4N8DA 3UJ6A 5ED4A 4CTJA 2I6QA 3GR6A 1MENA 3THXB 3FG9A 3KELA 2XSZD 4HS9A 4TV8A 1OV6A 5HYVA 3ZVNA 1U2QA 3MRVA 1XQ6A 4NY1A 3L84A 8AT1A 4M83A 1NY5A 4IRXA 4K5QA 1A9XB 1RVV1 3OZXA 1C9DB 4Z4FA 2I2XB 4DIFA 4X00A 1Z4PX 4PCLA 4UREA 4V0LA 2JAPA 2FF5A 3PUHA 4H7IA 2VTVA 4NZMA 2HEIA 5EKDA 4UCXA 3TTVA 1ETHA 1JR4A 3LOPA 4J91A 4D79A 4E2YA 5BRJA 4AS1A 2FG6C 1IN6A 1VPLA 1WIWA 2C9ZA 4R8MA 3UKOA 6REQA 1CY0A 4JC5A 1UT8A 1PJ4A 2IYVA 1W52X 3EZ6A 1NULA 3JQFC 4IKEA 3HNPA 4HNGA 1XD9A 3TTYA 3U7EB 3P2YA 1A5ZA 2I2CA 4YP7A 1QV9A 1Q21A 1XLWA 5DX8A 3KQWA 4EHKA 4HNAA 4FFLA 3KP1A 4QO7A 1F0NA 4GI5A 2WW8A 2XMZA 4OJYA 1QAQA 5EXEA 1TJNA 2PKXA 5EMLA 3DC7A 3ES9A 4X92A 2O8EA 5A3SA 4P8RA 2XB8A 3CCCA 4F4CA 1Y33E 1TXGA 1SUWA 3KD2A 3LOQA 3PTLA 2GJ9A 4UC0A 4XH9B 5DYNA 3ZE7A 4AJ9A 4F4DA 3MUNA 1KC1A 5GVSA 4HXFB 5DSXA 1NVEA 1BYUA 2ZYHA 2HBYA 4N76A 4DBLC 1JQBA 3D81A 1EUCB 2J31A 1DUIA 4KK3A 4NJMA 4XVHA 3KVOA 5JR3A 1KJ8A 1XRJA 4YRBA 4PAMA 5AHKA 4RFSA 4W8HA 1ITZA 3AEZA 1EK5A 1ES9A 1OFIA 1X1EA 1YS1X 4KMSA 2ZEJA 2EWMA 2Y77A 2HDOA 4L4RA 5JNVA 2OV2A 4COOA 1ZGBA 5DHUA 1R6XA 3H9UA 3ND7A 4JP3A 1QO0A 5DSTA 4BX8A 5CEEA 4D26A 5IFKA 2QY6A 3D2AA 3KKPA 3QBDA 4P3KA 3PQ3A 1U2PA 4AJKA 5JSHA 3VJRA 1KYXA 3H3FA 1XUOA 4MQLA 2WT9A 1PFWA 4NCKA 3T9CA 2UUBB 2NTVA 4Q4JA 4R3UC 1JEYB 3OICA 2H1RA 2P1DA 3N5KA 1XD2B 4EX7A 3K70B 2CNBA 4YFVA 4CLOA 1TC2A 2FWPA 2O57A 2P4QA 5HF9A 1JG4A 4B3IA 3RG2A 2P9QA 3UANA 4CG1A 1O94C 3DEIA 1KQFA 3NEPX 5J2TB 2Y2UA 1PGPA 2C2XA 4FEGA 4QTYA 1TVMA 3VM6A 2JJ1A 3E9NA 3I04M 1E1RA 3EEQA 3MMPA 4ZAWA 2QVYX 2V54A 2XSZA 3B3JA 3PRYA 2OHJA 2RI6A 1W96A 3QEJA 3GJYA 4HO1X 1O4WA 1NQOA 3WNZA 4BB0A 3FDZA 3ZXXA 3UG6A 1Z8HA 1WKVA 2V69I 2NU7A 2ZYGA 3PQ6A 3G0IA 4NYIR 4TMYA 3AJ8A 1E3JA 1A4IA 1DTWB 2Z2JA 1TKBA 4EUSA 1MC5A 1DQZA 1SKMA 2VJYA 3LPLA 5BPFA 1YQXA 3TEMA 2N42A 2IEIA 3AX6A 1KO7A 1N8TA 1IBMB 1JHZA 1Y9JA 3ZI0A 3AJRA 2XW6A 5C7LO 2UXDB 3O0TA 3VC2A 5H3CA 3CMMA 4XYBA 3JAWB 5AESA 1APBA 3P2EA 2FYTA 2HMYB 3ELBA 3HWWA 3GRYA 1M1YA 3CH6A 2IBSA 1MJFA 1T9GR 1KBQA 4PLGA 4C5BA 2AJLI 5EZ6B 3TB4A 1NLUA 4GXTA 4HUQA 3IILA 1VBFA 3AH8A 3TUZC 4I1SA 4O4LF 2Q2WA 3NVAA 4W8GA 3CO0S 4ZDIA 2YV2A 4AZ0B 3HQ4O 1GVHA 2X9NA 1WQ3A 2PVSA 4DG9A 1CUSA 1G2QA 3EDCA 4J0JA 1ZJWA 1RQLA 2O48X 1VJ0A 2QAJA 2HC9A 2W2XA 2C20A 2XYVA 3HA2A 2GXUA 3DXZA 2BFPA 3T0IA 2YWXA 4MS4A 5E1MA 1AUXA 3FPKA 3K8ZA 4FYHA 3RF7A 3RVNA 2QAGC 5REQB 2BH2A 4E15A 2ADMA 4ZOAA 2OG1A 2WOOA 2EL9A 1ZUHA 4B76A 1OZ0A 3BX1A 5L7TA 4FNGA 3IAUA 1QBGA 1P0PA 3VNQA 3AOEA 4O1IA 2OBXA 3B3GA 2XB9A 4L78A 1QFJA 1JS1X 1QYDA 2YC4C 4FS3A 3NRJA 1PT8A 2FP4B 1WU7A 4G9GA 1OXKB 1CUCA 3HV0A 4MS1A 4K81B 3GW8A 1RLTA 2X0NA 4JT4A 3LD9A 2GCGA 5EI5A 2VXYA 1BCSB 1R15A 5LL6P 5DDIP 1IQ0A 2R79A 3BE5A 4IWYA 1CQXA 2C3PA 4NCBA 3DKVA 3PLAE 1C4KA 2W83A 2I2BA 5BNFA 4DQKA 4EGQA 3V7FA 2EVWX 1IR21 2Z04A 1HFWA 1UC5B 3DGFC 3FRJA 4BLSA 1U0SY 5C53B 2IBTA 4RPGA 4GI7A 2XZDA 3VYUB 3WTBA 4HDSA 1FUIA 5EWLB 1MXHA 2A7XA 3P0RA 3DBLA 2O8DB 4F6RB 5AVVA 1DXQA 3RFTA 4DG8A 3I23A 1AN0A 4WXPA 2ECPA 3E70C 3L43A 2ILVA 4GLLA 4Y2QA 2Z6UA 2JLBA 3WGIA 2AFRA 3LJKA 3VMMA 1J2UA 4G5OA 5K99A 3O4HA 3ZDDA 3M6LA 5CDFA 4CKCA 1NF2A 1T0PA 3CR7A 3DPUA 2X7XA 1GTZA 4Q4JB 3I1FA 2VDQB 4EWLA 4EHBA 1QSGA 2E4AA 1U28C 2GZMA 4TVSA 2X19A 4Z51A 2FF7A 1ACMA 4F1KA 2AEMA 4CMEA 2FNAA 4TTQA 1XZPA 1KQPA 3GH1A 5DTEA 1J2YA 1JR3A 1N2GA 2Q0QA 4EY8A 1LTQA 4HQLA 2MR6A 3VO1A 3DCIA 1L8QA 3GL9A 3CZ4A 1FTWA 3BTVA 4C0LA 4BN5A 2PXCA 3RB8A 1SKYE 3LWBA 2PY6A 1M2HA 3W5BA 8MHTA 1IY2A 1SIBE 2ZXEA 1TAGA 1BH2A 5JECA 2JJMA 1DTWA 2VSFA 2ZQZA 1E92A 3I30X 3LT0A 5FUMA 1FYDA 4FOTA 1YRLA 1UWCA 3ANNA 1QIEA 4HQFA 1OFHA 1XCMA 3KKQA 3PPVA 3WGMA 4GDMA 1WNTA 3BTUA 3VKHA 3AV0B 2K7ZA 2Q8QA 4I5IA 4G37A 2JCXA 5JDCA 4UOZA 4ZOLA 2X1HA 2Z1MA 2ISQA 3AM5A 4PSKA 5SY9A 4YP5A 1E1CA 1JNYA 3W1EA 2CMGA 2X76A 4YCBA 5FNVB 3PEEA 4RPKA 3WJ7A 4WCFB 2P11A 1O89A 2GUGA 3A9RA 1SKAA 4GMKA 1GLGA 3AUSA 3H05A 2PX5A 4PV7A 1XQ9A 2CYBA 2ZRMA 2J6IA 3IE2A 3RIMA 3L6DA 1XTIA 1U9CA 3CW9A 2B6HA 3OOWA 3R4VA 4BVBA 5LQNA 5M34A 4DXAA 2E1RA 1EE1A 5CDUA 1YWGO 2JIBA 3PWZA 1AUSS 5FL7D 5KTRA 2X9LA 6GPBA 2H1CA 1D1QA 4CEHB 1Y1TA 1E61A 2ZZKA 3H8VA 2AVNA 1OX6A 4YHHB 1TEXA 3L7BA 1DOAA 4KYIB 1WHTB 4J7AA 2OHVA 2R44A 2XY4A 4D99A 3BD7A 4O5OA 5HFJA 3PUWA 2FP4A 1N1MA 3KYIB 3L04A 4G24A 2NAPA 3UB3A 4EJ6A 4EHIA 4FGJA 5HMMA 1W35A 2ZT5A 1K6XA 1MTOA 3UV6A 2H06A 4W9MC 4DM4A 2Q5EA 2XUOA 3CR8A 4NEHB 4XFJA 1ZJ5A 1VSBA 4MIOA 3EPJA 4AWBA 3KJHA 3O8DA 2FGKA 4X84A 3M83A 3Q15C 3VH3A 1G5PA 2RKOA 3DKIA 3NXKA 1FSGA 4LJ7A 4AJEA 1XP5A 5B57C 2C3OA 2YVAA 1O5TA 1VE5A 1WXHA 3R0XA 5LIPA 1L2TA 3OU6A 4CCWA 4EB6A 3V4ZA 5I6DA 4R9RA 1MDFA 1Z45A 4R40A 2LTAA 2NWQA 5CIQA 3RRFA 4EARA 1VBMA 4YO7A 1TB4A 2N1MA 4MV0A 4HWOA 4ZAFA 3JQRA 3WDKA 5DM4A 4NNOA 3ZCTA 4WH0A 3IA2A 4EF6A 5A7FA 1YB7A 2VRWA 2FPIA 5T8KC 5ICEA 3NZEA 2AHOA 2GHTA 1K6IA 4WOJA 1QOQB 5GV8A 1BA2A 3ABSB 1BFUA 3L01A 4G1FA 1EI9A 3RQSA 5ALTA 5J5CA 1CUVA 2COKA 4JFAA 1KZHA 4WFIA 5H9WA 1Y7IA 4W5RA 4QUHA 3HC7A 1M66A 4RLSA 2GPNA 2GUWA 1PJTA 3EGEA 5C81A 3KVRA 1HDCA 1CS4C 1W29A 2IXEA 2NZWA 1A1SA 2BEUA 4QQ8A 4JJKA 1ORIA 3HEMA 3R76A 5HJ2A 2DGDA 4I50B 3HXKA 1P6QA 4D97A 1O9GA 3TQIA 3D3WA 1MGOA 5AKHA 1X39A 3FVVA 3FOZA 1K7YA 4DFDA 4E14A 3M6FA 4U2FA 3U3ZA 2JW5A 5FO0A 3ICCA 1P7PA 2RK3A 3JQ7B 5F5XA 3LYHA 4XOUA 3OZBA 2W6CX 3AZQA 2BWJA 2PV0A 3N87A 4XJTA 5DLYA 5IEJA 4P58A 2AE2A 1YQQA 1JFRA 4IYJA 4EJ0A 4D9MA 3PNSA 1XGKA 1XZKA 4RLQA 3H4VA 1ZXXA 5FPQA 4BXOB 3LDGA 2NVWA 1VOTA 5JVDB 1YKSA 4MV4A 3G68A 3CVJA 5EJ5A 1SG6A 2G83A 3H6HA 3LC1O 4L5BA 3VNRA 2PR7A 1U8XX 3FBGA 3NHUA 1EIWA 1ZN8A 2Y9PB 3E22B 1PSWA 2IDMA 4HDNA 2H1FA 3R7SA 5BP7A 2WTBA 3C97A 4ZCSA 3SR3A 1C1HA 4PNEA 2DR0A 1Y4DE 2OZVA 1ONBA 3ADKA 2RD2A 3OQOA 3TGWA 2BUAA 3TW0A 3GEPA 2L82A 3BEOA 4BQQA 3JSAA 1UJMA 3EUWA 1ECCA 4PZPA 1B7GO 1PEAA 2TSYB 2W6MA 3G5UA 2IWHA 2PUVA 5K8LA 4R9UC 2D5AA 5HNKA 4EG3A 5K3EA 6CHYA 1P3JA 1E1QD 3RUBS 3IO3A 2HQBA 2QUAA 1FP7A 2JFQA 1D4ZA 3M89A 1LPOA 3BGDA 3OX3A 1T1RA 3UXHA 1AKQA 4FNOA 4N01A 3D6VA 5J47A 1QB8A 3NTOA 1CUEA 4DDVA 1V5FA 4B3JA 1RPTA 1XXHB 2PIAA 2H7VA 4C76A 2WIKA 4CN9A 3BMCB 4O8ZA 2PUDA 1JFVA 4OUDB 3RARA 4RBNA 2D0DA 2EARA 2C9CA 4HQ0A 4Z49A 2OGUA 4ZK6A 1C1XB 2BLNA 4LVNA 4QGSA 5I4BA 3FM9A 2XWQA 1L7VC 1GCUA 3LHDA 1XL1A 4O08A 2NZXA 3OTHA 4DXHA 4HF7A 1P1FA 4XVQA 3WFIA 4S3MA 1J49A 3JQ9C 4DLZA 3DNMA 1KJNA 2WT4A 1AY0A 1GPNA 1XCJA 1W0JD 1XFDA 4FK8A 5FUXA 3TLKA 1VRVA 3I6IA 2GX6A 2FHPA 4MUJA 3FNHA 1M2JA 1DEHA 1T4BA 1TKRA 1UXGA 1MO2A 4X6XA 4DWWA 5BYKA 1CT9A 1Y5MA 4FQ7A 4NZNA 3ZQKA 4J2OA 2RK4A 1T2UA 1OVMA 2WYVA 2WG2A 5FD8A 3LWZA 5TV2A 2E49A 1T0JB 3U44A 1NRXA 1A9SA 1RBYA 3M5CA 4Q4AA 3QLUC 4DY4A 4HXEB 1YVPA 2QK4A 2P8JA 1RR6A 1X7GA 4FYVA 3ZDXB 3AVTA 1XI2A 5KTYA 5CD1A 1Q1NA 2Y4OA 1GM5A 2XRFA 1Y7HA 3B1ZA 4ENTA 1U6IA 2EV9A 1NBOA 2G5TA 3PQDA 4F21A 2R2AA 1DAPA 1B26A 1MGPA 2XUGA 2YMQA 1K7EB 3K9NA 3KVYA 3O2NA 4RDHA 3RBXA 3TR6A 5L6MB 1J1ZA 3O90A 3PYMA 5CB4B 3ZGNA 1PR1A 3UGTA 5L3VA 4YIHA 4MW6A 3F4KA 4HAOA 1TM2A 2RHHA 1SVDM 3VDQA 1AH2A 5KTNA 1Q0HA 3BZUA 1N5JA 2Q5HA 1UMBA 4X3CA 5TMDA 4GR5A 4KQHA 1KEKA 1O4VA 1WB4A 4DHEA 1Q6ZA 3HZOA 3IOBA 1U3UA 4C3OB 4PU0A 3GBPA 4S2UA 1K5GA 3J81A 4B0PA 2O4CA 1WMBA 5EIWA 3MMNA 1JG2A 4MQ6A 4IIBA 2ZPAA 3QK7A 4YQEA 2HJSA 1FFXA 2ZROA 1PJ2A 1CJCA 3I9LA 4RV4A 5A6SA 4M1TA 1ZK0A 4H77A 3ZQUA 3E6AA 2A0WA 4L5AA 5HCNA 2DFTA 4UHHA 2CV0A 4Z1OA 5FPPA 4KBYA 5D7NA 4ZV9A 2BEVB 3KKLA 1C14A 1MU0A 1TEHA 2VYND 3L7OA 4MYUA 3HR8A 1I32A 4NNJA 2Y4NA 3T3OA 3N0TA 2YV4A 4B1FA 5HRUA 4E1VA 4TVBA 4RPJA 4BATA 3QX8A 4DW8A 3RUHA 3L92A 1UEIA 3VX4A 2JHGA 4QWWA 3G2IA 5F7JA 4ZGWA 5JYBA 5LFAA 5E3HA 4DLUA 5FOVA 3REFA 4QRHA 1RYDA 4C4PA 1NZJA 1EDZA 3COYA 1R6UA 4MLCA 3DE4X 5TARA 3HXOA 4BO7A 4KQKA 1UMDB 3AVYA 2GESA 4L02A 4PC3A 4E7PA 4P2BA 2CVZA 5CXSA 1PJLA 1XT6A 2ODQA 3PQ8A 3ZDEA 1KTVA 4ER3A 1YRQA 2XQKA 2LWIA 2HWWA 4GL4A 4MKIA 1RMTA 4OA5A 5JOQA 4KLZA 1ISGA 1EFPA 2J59A 2PGNA 3H97A 4S24A 1YXMA 2BGTA 2P7HA 4Y6RA 4FJ0A 3HRIA 1JEQA 1IEXA 4PFJA 2WIAA 4IKPA 1K5PA 2UVPB 2VHUA 5CT6A 3NP9A 2QU8A 4ZP1A 4DF3A 4MIYA 2D2VA 2QTZA 2QMHA 5TMBA 2QRGA 1UAGA 3W5CA 4N40A 4QGHA 4ZAXA 2PX6A 4BP1A 2AYYA 2V5VA 3PCXA 5CA1F 3B38A 2YIJA 3AOGA 3NDRA 3WA6A 1F06A 1JJFA 3ABRB 4OU4A 3A2MA 4HMQA 3M1YA 4R2IA 4GS5A 1OKKA 3WNQA 4CLRA 1GL6A 4YIKA 2XMSA 3W78A 1CBUA 3WNBA 4WN9A 3NXSA 4JVSB 1NF9A 3R0JA 4LPKA 2NYUA 3F7TA 4E09A 5HKKD 3OA0A 3RGWS 1FP4A 2ALJA 4OHBA 4KQMA 3F73A 2Q07A 4GZ6A 1Y48E 2I4IA 1JG3A 3GC6A 4D5EA 3G0DA 5K8CA 3BTOA 2L42A 1E3MA 3N2ZB 1WCIB 4LPSA 4MW7A 1LC3A 4RVOA 3T0FA 1G21E 1R4ZA 4U0JA 2WWTA 3PG5A 1G5TA 4A15A 2RGRA 1FNNA 1ZEJA 2E4ZA 4LXXA 2ZRPA 1VE1A 1WKCA 4GZMA 1JQKA 1P77A 4L8LA 4UFNA 1OVGA 2FSVA 4ZCRA 3FTCA 5GTDA 3PPWA 5KQPA 1CRWG 4DA8A 4ROTA 1LSOA 2V7XA 3V6MA 3L2OB 2BMFA 2WWYA 1F51E 1Z4LA 3AM1A 3EIWA 2VBIA 5THQA 2HX1A 5AJWA 2C1ZA 5I7VA 1N33B 1BDBA 1CDOA 2ZBGA 4XQ9A 3WYGA 2O2DA 2NPFA 1CB0A 1VIYA 3PNPA 1M1NB 3DDZX 5AKYA 1EXWA 3D7MA 1BWRA 3PNOA 4KDCA 4FZJA 4AUMA 5DNDA 4CMEC 2VVTA 4COKA 4YMHA 3O7MA 3V4RA 1VXRA 1X87A 3LDHA 4C05A 2J48A 4O4HB 1F4PA 4O8CA 5EQTA 2XQFA 3EGIA 3MTGA 4M1MA 1R5OA 2CXSA 3ZU3A 4AF7A 1RZUA 3TLXA 1A2BA 3HXQA 3QYJA 3STYA 4B48A 4M8KA 1RMQA 1QU3A 1S2GA 2VSQA 3MINA 1V1RA 1VCNA 1RTTA 2PKQP 4K3UA 3AEKB 2JIOA 3BSYA 3N2KA 3A10A 2AHRA 1KARA 1RKVA 3PHCA 1OXVA 1E0DA 2XX3A 3CZ5A 1JFSA 2YUTA 4B17A 2DCUA 5KQGA 1AOXA 2GJSA 4OHCA 2ZIGA 4NBSA 1ZUD1 1NVXQ 4J0GA 3MGAA 4CRWB 1M1ZA 1WCWA 4KN8A 1HGXA 2CZGA 2WJPA 4WY8A 4CIBA 4HZGA 5ADVA 3ZY5A 5A9RA 3T1HB 1MQAA 1DJMA 1KYVA 1QE0A 3JZAA 3AZOA 3PFFA 5ALGA 3IDQA 5TMEA 3VNBA 3V9AA 1Z29A 3HB7A 3IB6A 3K1TA 4B40A 3JX9A 2R60A 1EXVA 2R25B 1JR3E 1P2VA 5AQ1A 3UK0A 2NSJA 4J4HA 1RACA 2KPOA 3I3OA 4GD3Q 1GAEO 4IH9A 4BQRA 3RFCA 3I6BA 1NKVA 1AA1C 3K70C 3BQ9A 4W5JA 1P7YA 1PV2A 2QD2A 5AR1A 3WK6A 5K20A 1H6DA 3JVIA 3GJ7A 3OCYA 1I7PA 4OIFA 4KLAA 4F8JA 4EB0A 2GK4A 2GQ0A 3F4LA 1G9TA 1L6IA 4AYTA 5F78A 3CUVA 3EN0A 5KC9A 3DUFB 5KS2A 3HLYA 3OZIA 4N5IX 3GLIE 4BZPA 3QMVA 1YZQA 2QRKA 1FX0A 3TQCA 2WE7A 1M2GA 3FBWA 3CB4A 4KLCA 2PK3A 2V65A 1R88A 3ANSA 1KEZA 3T4XA 5FWYB 1GUYA 2GXAA 4MB6A 1KZGB 1N4AA 1IK6A 5FA6A 4I46A 5DIZA 1ZD4A 5JJCA 3EVDA 4I6JA 5SZHB 3DEJA 2WZDA 3A1TA 1Z7YA 4GGMX 1CYEA 4BKQA 5KOIA 2UZ1A 1R64A 2VDMB 4EY4A 1UKEA 3QVGB 2R5WA 1DUSA 4OL9A 4OOEA 3ROEA 3QYAA 2Q6OA 2CJPA 3L8CA 3LDFA 4K6CA 2KJQA 3S1LA 2ZJ1A 2WAAA 2BGWA 1XQYA 4AKSA 4AC9A 2MSDB 2IYZA 3IODA 4NATA 3JVUA 2HUPA 3QXXA 3AONB 4PC7A 4R84A 4DXDA 1IWAB 1T2EA 3C3KA 4D4GA 3HVJA 2IV7A 1SJ9A 1BG6A 2QN8A 2DETA 1HV8A 5A7GA 1QWOA 2IVFA 1L5MA 2IEDA 5KVCA 4J76A 1ZUWA 3ZNNA 1TUIA 3ON5A 2RAVA 3F6BX 3R5KA 1IZ7A 3H9JA 4XGIA 2PGLA 2O0JA 1DGQA 1JDTA 1GTL1 4LBVA 3WGKA 1IQUA 3DJYA 1BFDA 1U2DC 3BHIA 1T8PA 3Q1LA 2YJ5A 3H7IA 4ZHQA 4P22A 4UVDA 5JAQA 4CDMA 1KJ9A 2HWXA 3W5SA 5BW8A 4C4YA 3R5HA 2J07A 2OUKA 5KTMA 2FHZA 2FSUA 1MC4A 1SOAA 2XNJA 4X97A 1I1OA 5CLFA 2PWAA 4C2AA 1H2WA 1W88A 4A5OA 1O8CA 1V1RB 1YE5A 4DLSA 5I7SA 1D5CA 2FMHA 2AF3C 3W1WA 1EK0A 1MPXA 5J2TF 1ICIA 4CCAA 4YCDA 5EP4A 1DBVO 2B1GA 2PPLA 1NVVQ 4KQ2A 1ESNA 1EVJA 3WIVA 1J7JA 1GJRA 4PFKA 1XJ0A 1BWVS 4CG3A 5HS4A 3CT4A 1U2GC 5LOVB 4QGFA 1EQ2A 3WB0A 1QG6A 2QS9A 1F4LA 2MMGA 3CLTC 2CXRA 3OU2A 2CJWA 4MWZA 3VJLA 5LR6A 2V74B 2OB2A 3FPSA 1PYOA 2F1JA 5ALFA 1Z6XA 1L5WA 3MERA 5AKIA 3TCNA 3UC9A 2JI7A 5J2UA 4MI6A 1X2BA 1H9AA 5CYOA 3PI7A 2PEZA 3KPJA 3HBAA 2MSCB 3CU5A 3I34X 5TEWA 3ANLA 1R10A 1KWKA 4DR5B 5ED0A 2ONJA 5BW4A 3DF9A 3HGTA 1TCCA 1ZITA 3IUPA 4OAOA 2DU8A 2EC5A 2YNMC 4L4YA 4WXHA 3SC3A 2V7EA 4UDXX 1GIAA 3NDBB 4OI4A 1T25A 1VPEA 3AYXB 4HGOA 1ZEMA 1DBPA 3I0ZA 1WM1A 4YPFA 1ZWLA 3UFBA 4F97A 5K4GA 5DCWA 1KTIA 1DKUA 2YJ6A 2PJUA 2R1VA 4JNKA 3CW8X 3EAQA 2V67I 3DVLA 3ROKA 4WBNB 3M2PA 4F93B 1JAZA 4CMAA 4JQZA 1KEVA 1SOMA 1Y8QB 4PNPA 1QGAA 1T5BA 4ETIA 4UVIA 2DR2A 1UZLA 2V0NA 3TLBA 2BFCA 5AP9A 3L4EA 3LW7A 3DMYA 2WMYA 3KCQA 3F0TA 4X1KB 4E33A 3N75A 4ZVVA 4ZCQA 3JVVA 3R8FA 3LQYA 2VT2A 1O1YA 2BGRA 1TZKA 2OQRA 2AMFA 3N39C 3KAQA 1FDRA 2J3LA 5JAZA 3L4JA 2BF7A 1AKNA 3E3AA 4K40A 5TB5A 5KNDH 2AXPA 4FMCB 3KT0A 1FSPA 3Q8WA 3ZEAA 1G5HA 1EP2B 1XRNA 1PQYA 4AMUA 2AUNA 2DT8A 1TUEA 2Y76A 4IQ4A 4DCUA 1B14A 3H9EO 2F1HA 4ZQFA 1QZXA 1BRMA 5EUQB 1HF3A 3R6WA 3OAAD 1IR1S 4J29A 2VJOA 2ZJ5A 4RFVA 4REQB 5ITZA 3C98A 5FNVF 4RABA 5AW1A 1QUEA 1OI3A 2BTQA 4A0SA 1E3LA 5ARBA 3D3JA 1TO2E 2CLLB 3AF4A 4DY6A 5KIAA 2NU8A 3N53A 3DZJA 4R41A 4EG5A 5K8IA 3W5DA 3VXKA 1MVLA 3W2IA 1D6MA 3NLLA 5IDYA 1SVMA 2RJ3A 1NNUA 1RYZA 2JD1A 1U9JA 3O9MA 2IEGA 4E5YA 3LBNA 3DBRA 1KOFA 5KYVA 3JQGA 1TA9A 3PR1A 5JAMA 1Z12A 2FN7A 3D8TA 3VPAA 2BFEB 3T7RA 1VG0B 3OX4A 4K03A 1FYFA 1SCAA 2G1PA 1X7XB 2XQJA 1RAEA 5H3LA 1TTQB 3QEAZ 4AKIA 5DBHX 4EMBA 1XZIA 1GNLA 2GK3A 1X74A 4HNSA 4E2ZA 3E22A 1ZHFA 1A8SA 1N2CB 4YR7A 1QRTA 1EK1A 1WU8A 2SKDA 1QK5A 1XZBA 3K5WA 3L06A 4FKBA 3FTFA 1K63A 1Y6QA 1TVCA 2PD4A 3C5WP 3S2FA 2OXTA 4YROA 2C1EA 2P4UA 2ICAA 3AF0A 3D3QA 5EHQA 2ZT8A 1K2VN 2CFCA 3VR0A 2IZ7A 3L0BA 1EFCA 1ORWA 3KJEA 4IIJA 5KJ6A 2QX7A 4WK4B 4ZHQB 1JEYA 1W6RA 4LFAB 2C7BA 3P7MA 1FYVA 2FQWA 5EHNA 3LY8A 2O3SA 1KQOA 2HIMA 4U7DA 2OO5A 1ZW1A 3TTXA 2O59A 5KSWB 2HSGA 3BFXA 1NVTA 3HUTA 2F3PA 4FP9A 4F71A 5IVPA 1JYSA 1KVTA 1N4DA 2QRPA 2ZYRA 4I66A 3CXUA 4QNNA 2Y1LA 1QV6A 1Y1RA 2WV7A 1VSUA 1IUOA 2YYZA 3DDNA 3EUAA 3FCSB 3WMGA 5BSEA 3D0QA 4EVRA 3VH2A 1OREA 2NO1A 3NTVA 4DDWA 2IZ6A 3MIIA 2FDRA 3SVLA 5JXHA 4UBNA 1QP7A 2BZSA 3PYXA 3K15A 2X3YA 1MA0A 5DBOA 5HE8A 3VV2A 2CJWB 2W6ZA 2PCLA 1Q0QA 4I14A 3H3JA 1II9A 1ESCA 3AVPA 1QVRA 5SZKB 4F85A 2CXTA 5E2IA 3VPHA 3VKGA 3P19A 3TIVA 5F64A 3BE8A 3OT1B 1ABEA 3QVMA 2ESRA 5DHPA 1GY8A 3PNKA 4MARA 3OCJA 1DC8A 3L6OO 1GT91 5HIIA 4C5AA 4D8YA 5K0ZA 4CM8B 4MDYA 3DT6A 3NFYA 3E5NA 3LGSA 2UUOA 4ZGBA 2DWUA 1SR8A 3NANA 4GWLA 2ACKA 4S05A 1KH1A 3IEPA 5CVVA 3OJCA 3C8HA 3RC2A 1HFEL 5EP2A 2JH8A 1BVHA 4BMNA 3A04A 4QDZA 2VJBA 1J07A 5TXGA 1OLSA 4RAQA 4E32A 1BCSA 1C4XA 4JHXA 5H02A 2X14A 4H0NA 1N2JA 2I29A 3DE3X 4KMOA 1C41A 5FQOA 2ZANA 1E6UA 3QKTA 3KPUA 2HN9A 5FTWA 5LYJF 2Z56A 1H2FA 1EDEA 1K3TA 3R3ZA 4M46A 3GRUA 1NOJA 1J8DA 1EFUA 2K2QB 3H2GA 5IBPA 4HT3B 1T1SA 5BMVF 1GN9A 3ANXA 3PUKA 4C3UA 1AMOA 1E9EA 1JALA 2DUMA 1ZGHA 3DGEC 1V41E 3DA8A 4PYMA 4YJ3B 4AJNA 1CX9B 3HVKA 3F96A 4I5EA 1K86A 5U1PA 3NHBA 3FHLA 4H0CA 4YC7A 3UTDA 1U7DA 3SQOA 3MAAC 1G20E 4JLJA 4UBKA 3WGJA 1DQPA 2E85A 4E1AA 3HXMA 5C1IA 3SQNA 2EKQA 1T3HA 3OMWA 5JSZA 1KEEB 1DRJA 2I7VA 3JASB 4IHJA 4IUBS 2VPPA 3QKUA 5ARCA 4B83A 4DYDA 3FPHA 2JAHA 1QYRA 4DQLA 3ILYA 4HSGA 5JNUA 3FWZA 2B36A 3G13A 4BNZA 4EMTA 1LKZA 5C35A 3WDMA 3FMFA 5DASA 1UBSB 3VUFA 4TTPA 4EA8A 3FF1A 4Q7MB 4X62B 1NV9A 1B00A 3KUXA 2H7XA 1JHQA 4RADA 3OFVA 3RHZA 2YRXA 1PD0A 1AQUA 2NIPA 4NWIA 5C32A 9LDBA 1P1JA 4DNFA 4LHWA 1QOPB 2EIXA 3Q3EA 3WYCA 1RZRD 1GZDA 3B2EA 1NZDA 1O6GA 3WV4A 5BYBA 3DQZA 4R1NA 1PJRA 1VL0A 1B0PA 4AS3A 3WMRA 1VMEA 2FGJA 1ZJZA 1K0UA 2ZVJA 3CF4A 3OFSA 3FVWA 1WVGA 1X38A 1B4DA 1XCPA 3H18A 4KQ9A 3UFXB 4ASUD 4EM6A 2Z4TA 1TQ4A 3PJRA 1EUDB 1W73A 3DBRB 3HEBA 3AEXA 4H16A 3MD0A 2RI1A 1T9CA 1ZHOA 1NVFA 1V47A 1KU6A 4R1TA 1G1AA 2J0UB 2QN1A 4CN8A 2Y68A 1FP6A 2XUKA 3OWXA 4Z2YA 5A4DA 1MORA 1UDWA 1F9AA 2I2WA 1ISFA 1Z0DA 1KR5A 1QH8B 2R68A 2JI9A 3GQBB 3LDUA 3LLUA 4DLTA 2BBWA 1N3IA 3EBOA 3WAKA 1UBUS 1VFNA 4TWAA 1T8TA 5JARA 1U7OA 1KZ6A 2M6RA 4IJUA 4LV6A 1KORA 3ILHA 4BRUA 2BFDB 3DDOA 2RHBA 3KB6A 1CZHA 5CVEA 1GU0A 5HJ7A 3CZCA 4F3CA 3LCCA 4ID3A 4IQGA 1FSZA 1EPUA 4PHTA 2G80A 1US8B 3I8SA 4OQXA 5I7EA 1V8FA 2GEJA 4NENB 3NALA 2Z2ZA 3ZV5A 3VR4A 3KTDA 3LC0A 2IJGX 2UZ3A 4KGVA 1YUBA 2PJDA 1E8MA 3BRQA 1UPCA 2JAXA 2WTAA 3QVWA 4L75A 5IYZB 3EVNA 4J2TA 4R71A 2JFXA 2PGAA 4LV8B 1DKMA 4C6TA 2Q2VA 3PU6A 1SRQA 1BHSA 3WGTA 3OZTA 4X64B 3OLXA 1I2DA 4TT3D 2QWXA 3OPYB 4KR7A 5B3JC 3IURA 4BNIA 2QVBA 3LUFA 2WWWA 1K9SA 3DMPA 3FI9A 1YGYA 5CM8B 1W49A 3UPUA 3DZCA 1IY1A 5HIMA 2VCEA 2XXAB 5LBUA 3IR6A 1BQ3A 2UZ0A 1YIAA 5KU7A 4UTZA 2XKBA 2O54A 2AOUB 2QZJA 3PEUA 4BNXA 3T61A 1GITA 2AXQA 2C4KA 3A31A 4MCJA 1OY1A 2I7TA 3H6KA 3C8UA 4J4BA 3AUJB 1T36B 2R96A 4O4HA 3C1AA 4ILEA 5NLLA 5LYYA 2OORA 3DL4A 3F7NA 4TL9A 4D4KA 5DHRA 1AXGA 5FBKA 1QP0A 4LYGA 2QI9C 2GXSA 3MXOA 1Q11A 3LPCA 2YBEA 1IM2A 2P6UA 3BRSA 3ENZA 4KFTA 4MUAA 5EPOA 3ZKWB 2VO1A 1J23A 2QW1A 2R8XA 4LJ8A 3JRWA 4KOEC 3SWWA 2QI9F 3B70A 3HDGA 4P0TA 4BMYA 3ASVA 2XB2A 1D0SA 2BEUB 4ZCMA 1RHUA 1TM7E 4CMIB 1P5FA 3C3AA 2R6HA 3V4SA 1ZIDA 2FPIB 4HFRA 1IN8A 2OWDA 3A6KA 1FLDA 1TCVA 3B1JA 5CEJA 3HKEA 4MMYB 1NX9A 1CUUA 3E7XA 1WMEA 2N75A 3OWOA 4ALJA 3HN2A 3STXA 3HA3A 5KNDA 4ISCA 3CJRA 2HPVA 4NBRA 3E5MA 2YYYA 3OBIA 3H19A 4YALA 3RSGA 3SEQA 3CLTD 3B3FA 4MWCA 2XCOA 4UXHA 5CAEB 4BFVA 5EJ8A 1N2CE 1R9GA 4GVLA 3ND5A 1ADYA 3OIUA 4RY9A 1A04A 2QB5A 4H1WA 3FYUC 1OWOA 3IUQA 4Z9AA 1BOOA 1EEXB 3MFYA 4INAA 1QH8A 4QNRA 3W7BA 1RWKA 2E9SA 3ENWA 5ALHA 1EK6A 1I6WA 4L4XA 5HMLA 1SK9A 5KHOC 4US0R 5AKEA 1UM9B 3NI2A 1ENYA 4FUQA 1P4RA 4L0CA 4G5RA 3TB6A 2ZUTA 1FX0B 2B8TA 2D5CA 1AKYA 4G8BA 1MO6A 5JY1A 1FW6A 2DQKA 2P77A 2HYIC 5EJMA 2RGDA 1E2FA 2Y71A 3MMZA 1C4WA 6Q21A 1PWHA 1VHQA 1EH5A 3PC4A 1N0VC 1JXQA 1T8RA 2LBPA 1KI1A 2FSHA 3I2JA 1WB9A 2KYRA 4K1XA 4KL8S 1OPXA 1RJGA 1EGQA 4PICA 5AIAA 2WF8A 4B4WA 3LPDA 4H60A 4ZAZA 2FFRA 4Z86A 4PWYA 3DAOA 3DL7A 2BFMA 1S1MA 4IY1A 1IPHA 4YN3A 4JI4B 2DKOA 5JU6A 5BOVA 4HX2A 1QXSA 4G0XA 4E31A 1HYEA 2IVZA 5FOTA 4C07A 4HAYA 3V1UA 1DIOB 3MTAA 3A27A 1GPAA 2IP2A 3IBCA 5FTJA 2WM3A 2P9BA 2C00A 2BDEA 3OQBA 4ZVPA 3L1UA 4G67A 2RIPA 2VDUE 3BPSA 2XRYA 4CIAA 3LBYA 1A9TA 3QENA 3WK9A 4QUJA 3OJLA 2XNDA 3ZGLA 4ZC1A 5KYGA 4BFZA 2FPOA 4D56A 2I4NA 3FZYA 1NBME 4U2GA 5B7QA 1Y89A 1T4CB 1R37A 3RR2A 4IDQA 4K6KA 1SCNE 1VB5A 2DH5A 2DYKA 3MSCA 2FZGA 1E9DA 3NBKA 4FX5A 5T4BA 1VGVA 4NC9A 4G0OA 5LYJA 2ORVA 3C3WA 3HUFA 4F3RA 5KTPA 2QR2A 1CY6A 2V0GA 2X2EA 4UU1A 2LNDA 2Q3FA 3NKVA 4I50F 1T1IA 1YHNA 2FVXA 2P6MA 2ZIEA 4PNHA 4QHTA 4TKUB 1E9VA 4YJ2F 2R8ZA 5C4IA 1B6SA 2OA0A 1RTKA 1MG5A 3NONA 2FETA 5J5VA 2CXNA 1H9CA 4LVUA 2AWOA 3HCEA 4GZLA 4M0LA 2I34A 2J4DA 2V7QA 4OBBA 2P1RA 4HEA1 1X19A 3N59A 1Y1QA 3H5OA 3LF2A 4Q03A 3RSOA 3SBOA 5LDDC 3T7AA 1TKCA 4TKVA 4DV7B 3AEUB 2Q6TA 3VKUA 1TKAA 1T15A 3CTPA 5D51S 5LNK1 3LT1A 3P0HA 4Q4AB 3SYLA 4ZZ1A 5B4VA 3PNLA 4C3ZA 4WSOA 1I7SB 2A1UB 2FPGA 1ZC4A 1RLJA 1C7ZA 1FS6A 1P2GA 2XQVA 2CL5A 4GQAA 4AMZA 1DINA 3GOHA 4GYKA 4LBWA 5DLQC 3VTKA 2CVFA 1YIDA 3UT5A 4CLXA 2CV2A 1UPAA 4BNYA 4O6VA 1SVWA 3WP0A 5IC4A 2AFVA 4NXNB 1HDIA 1LFAA 1SMKA 3PFCA 5MF6A 3GEEA 2VXCA 2PMCA 2R8RA 4B7CA 2ZVDA 3ORFA 2QLTA 1CS0B 1PGQA 3B6ZA 2JHCA 1IHPA 3BIFA 4PAWA 1QHYA 2P69A 3GD5A 3GPCA 5AXAA 3DHNA 4E21A 4OJQA 1ZH2A 1KJIA 4OFZA 2DRIA 3HV2A 1N2XA 2ORYA 4J07A 1OH6A 4EYQA 2B5WA 4JP2A 3VR3A 2XWBF 3RKUA 5U4XA 4LHSA 4GI3A 4K9QA 4D0RA 4CM9D 1H0SA 1N0WA 5EZSA 4NSNA 1PHRA 4RZIA 1PR0A 2D5BA 3RSHA 4CMIA 4V24A 4LOAA 2DSTA 2QQ0A 5A04A 4IUDS 1S4MA 2QPAA 1BMDA 2W2OA 3C74A 3U9LA 3VTAA 4ARIA 4C4XA 2RGNA 1GRQA 3ASYA 3G0CA 5D7BA 1Y4SA 5JZBA 3BXZA 4RH1A 4QFDA 4URZR 2YZ2A 2HV8A 1G3UA 2C97A 2GASA 3GLHA 4JJGA 3W5UA 5F51A 3Q8XB 5LMZA 2W2LD 3WJAA 3NORA 3LTEA 4JR1A 1SULA 3QEMB 3U48A 4DMUB 4YMLA 2XJ9A 5LQJA 2IEAA 1JWBB 1VLHA 1TM3E 2DMRA 2ZE8A 3GCWA 3L6CA 2PWPA 4D6XA 1UZAA 4G97A 1TO1E 3HKDB 4NE9A 3SBDA 2REBA 3EFEA 4HFMA 3OQVA 3O1IC 1WZCA 2H1OA 1VRWA 3D8SA 2ISSD 4W99A 2WJYA 2IYPA 5B4TA 3DVRX 1SA0B 2GZDA 3GLIB 4Y2GA 3PDUA 1ZMRA 1SELA 5IANA 1S9HA 1QBKC 1HZZC 4RAOA 2JGKA 4L6IA 4TTIA 3VA7A 3QFHA 3RHFA 1P9WA 4CFSA 4IDPA 2OYCA 5KYYA 5E4JA 2KW5A 3ZD6A 2ZUSA 2A9QA 2RFLA 2VUHB 4DIDA 1D7OA 1JJAA 3H6GA 1UWKA 2JNWA 2H2DA 5EJFA 2OB1A 1Z7WA 4D8VA 3K0AB 1E6WA 2C4NA 2UVDA 1ECBA 2Y0DA 2PXHA 2XJ4A 1HL3A 3DE6X 3URKA 4ETMA 2GAOA 1VBNA 4BNNA 1TW2A 4R6WA 3USES 1P1IA 4DLKA 5B1DA 3EB9A 3WZLA 2VTKA 2H9AA 1Q84A 1RLIA 3U6BA 4WGFA 1CQJB 2NX2A 3AEUA 3WQBA 5AFSA 3NQ41 4UM9D 4ENSA 3G8DA 5FBWB 4Y2HA 3RODA 5AI4A 4MO2A 1RCOC 4HDQB 3WLPA 1NQAO 1E2PA 5AJXA 4YRLA 1NLZA 2FSVC 4IBOA 2JCSA 1U3CA 4J0HA 2F43A 3MUEA 2WQ7A 4D3SA 2YQZA 2H4WA 4I4CA 3VO2A 4YUXA 3HR7A 1HDGO 1LSSA 2Y1DA 3IYLW 3NGLA 4LJLA 1MJGA 1KY5A 1EMDA 3BMOA 2O6LA 3U62A 1GP2A 4ZV4A 1S8AA 2X8LA 1ADCA 2MSNA 1JU4A 4P4GA 3THSA 1XOIA 2C0CA 4JBXA 4Q1CA 4YK7A 2C2ZA 1C0IA 1QTQA 4JLMA 1ZY2A 1ONSA 3KQOA 1W25A 3KYBA 3NIDB 4QICA 4UM8B 1RAIA 4K7JA 4NCHA 4Q6BA 1FA9A 1YQDA 4YY3B 3A1CA 4L9AA 4BFYA 4DA6A 5LDGA 4OYHA 4WUVA 1SEVA 1KQ3A 1JAXA 5A9TA 3S40A 4FMBB 2JJ8A 1DTEA 1M6NA 2PBRA 1GNQA 3OZWA 4QDJA 2I80A 4RKFA 3DLAA 2JK0A 3I3SR 1VPTA 2ZJYA 3HKCA 3PA6A 4JASB 4B71A 3IOMA 5BPHA 1CULC 1TYZA 1T6XA 4CEIB 1XTQA 5EZYA 1K8ZB 1K7FB 1NBEA 2XODA 4LNUA 1XNJA 4KO1S 4W5HA 2ZCVA 3T5GA 1RT9A 5FFFA 1NW3A 1EDOA 3GH3A 1O5IA 3MT9A 3WO1A 2ZWAA 4A8PA 2R00C 5CU7A 3TSCA 2QSJA 3AUUA 2ZUDA 2RG1A 2A8YA 1AKWA 1Z68A 3KSZO 2AEFA 1L7RA 1FW8A 2CVOA 3ETDA 2VCHA 1A9ZA 2JRCA 3IQWA 4J6EA 4JQSA 2B1QA 3DW1X 4ZVOA 4ZFNA 2VQ6A 1VCHA 2VCYA 1F0KA 1T5SA 2W58A 3W2TA 1KDZA 521PA 3F3YA 2Q9AA 1OBHA 1T8UA 4RXMA 5AK6A 5IF3A 5LU9A 3MJSA 3Q0IA 1HT3A 1XDBA 3DLCA 1CNMA 2G6TA 3KAKA 1Q0SA 3TOZA 3NMUF 3DLTA 4AKHA 1E9CA 3QLVA 1ULSA 2C9YA 4HNTA 2J8ZA 1A4RA 2PGJA 1EM8A 3DQPA 2BMAA 2FA9A 2KLHA 4PVCA 2D4AA 4B4UA 1SUEA 3EEOA 2NNLD 2VATA 4YWJA 2EL7A 1CJMA 1JFLA 4G89A 3KQKA 3EIFA 2AUTA 3SQLA 3T9FA 1GUFA 3T8YA 4MUMA 2X42A 3AY0A 2XF8A 2GZAA 1MEJA 2HMUA 3H5NA 2EJTA 3BAFA 4MUIA 1NMYA 1UPMC 3Q7SA 2Q6LA 5AK0A 1D2EA 1DC5A 1NBAA 4OIMA 3T3PB 4GOND 5DNWA 2OZLA 1X9GA 5HFAA 2E6KA 3NC4A 2VHCA 4K9OA 5ECYA 3ZQJA 3CLRC 3LQQA 4DNXA 1YVEI 3QEMA 1KE1A 2HU5A 2PX3A 3G2PA 5FA8A 2QRQA 1RWMA 1T5OA 4RCYA 4XX1A 5FYDA 1WL8A 4F5ZA 4ENWA 4DKJA 1KMNA 4DPLA 2O2XA 3NH6A 3Q85A 4JEIA 3K96A 2FPRA 5DT2A 5GMOA 3DYIA 2AXNA 1TDJA 3QWHA 1NZFA 4RK5A 3IP7A 1MG0A 1FQOA 1JILA 3OFNA 2PU5A 6REQB 1L8XA 8ADHA 3PHBE 1L5QA 4GU5A 5FV4A 5KDOA 1GSOA 4M36A 2FSPA 3H9CA 4MA4A 2HDNB 4RCVA 4UEKA 3RVRA 3SKYA 4CCSA 5LIRA 2PIDA 1PT5A 3ZHYA 4B74A 1AS3A 2C78A 3D2LA 2ZWOA 4ZOEA 3A9CA 4F5DA 2OSVA 3I9NA 1CY8A 3ZZ1A 3ICVA 4WLFA 2CHQA 1VLQA 5DK4A 4BO5A 2CHVA 4WDQA 3WY9A 5JG7A 1XJ5A 4O4LA 4TWBA 1WY7A 1EEHA 3ZZNA 4LYDA 2AEJA 3SSOA 1XO1A 1J8FA 4WHMA 5CGZA 2C94A 3WRWA 3CVUA 3PCTA 3VZBA 2QYSA 1DOHA 1GAWA 1GZ6A 2FR8A 2WF9A 3CCBA 3FR7A 4LC9A 1NUHA 3ZZTA 5D2CA 1ZRSA 1G16A 2AA3A 4BQEA 4KR3A 4Q9LA 5FTNA 3DFKA 3DZBA 4MVWA 2A84A 3G02A 2W22A 4MEBA 3TF5A 4DE5A 2FOLA 3JY6A 4HX5A 3JAKA 4XYMA 5AW9A 1FVXA 2H1HA 5P21A 1DBIA 4TTAA 4KHPB 1AQNA 3PQ5A 3RJMA 1SHLA 1M1XB 3PFKA 4FHDA 3W3AD 2DC1A 2BCGY 3WRXC 4YBRA 3T95A 4DR2B 5JMOA 4V0SA 1QMGA 1TIBA 1N9GB 4HYTA 5A03A 1DKPA 1EX6A 2PX0A 3NTRA 4J0IA 1BE6A 3ULKA 2XA9A 1Z2CA 2G1KA 3VH1A 3A05A 1WO8A 3IMEA 1UPFA 3AR4A 3CY6A 4LY9A 3NHZA 3OKFA 4WZBE 5J2TA 2R5FA 5JAUA 3P2IA 3UJHA 4RETA 3PF9A 3OPYA 3X1DA 3ZE8A 3I52A 4LGMA 4DPKA 5C3MA 5ISMA 1FFAA 1G42A 3JCZA 4TTRA 4PG8A 1J22A 1SRRA 4NVRA 5TIIA 2O8FB 1S2IA 3L8YA 1NP7A 1FB5A 3S0JA 4JB3A 2VH5R 1M8FA 2AOUA 3LPAA 3OKAA 4JFRA 1DQSA 5E6SB 1R0BA 2ZS7A 4IVRA 2H7YA 1E77A 4C9BA 4U39A 3BM5A 2F17A 3JALA 3M9LA 3H1GA 1TK9A 2NO5A 1P7VA 5LA6F 4GM1A 2FEWB 1YVDA 2JCVA 1RYNA 3FE2A 5EHGA 3DKRA 4G0NA 4FYKA 5LP6A 5JC1A 3R6LA 2VDRB 1S2MA 3T4PA 4DDUA 1GKYA 1U81A 2X4GA 3U6KA 3C6MA 1N1DA 2CLIB 1COZA 1U8UA 5ALIA 2JJ1D 4H0FA 1HT2E 3RABA 2XMQA 1DFHA 4Q1AA 3ICQB 3A0RB 2JGRA 4BNTA 2R7KA 1SB8A 1FXSA 2QX4A 4A8TA 2IEBA 1UEJA 1SUCA 2R751 4GXQA 1QHSA 1YR2A 2X3UA 4W9NC 5IVIA 3TQFA 4CL8A 3WYNA 5CBKA 2BHLA 4PG4A 4D0NA 4PG6A 4RPIA 2OFWA 2X0RA 1E3QA 1RQNA 2M1ZA 1S1CA 2EJVA 4NFLA 2XVZA 5EJIA 1R50A 2OHGA 4EY7A 1FUKA 3H0CA 2IX3A 3C6KA 2OBNA 4LJ6A 4INPA 4X1IB 1XCOA 3PIIA 3UH1A 4O4IF 1MEEA 4LRSB 1HNZB 3I9OA 5DSZA 2LV8A 1PZXA 3FPJA 3BGVA 1OBCA 3L4SO 5EXPA 3CN9A 4OSOA 5BN3B 3CKLA 4BMXA 1XB2A 1CUYA 3N5CA 2ZAGA 1E9SA 4FW9A 2X4DA 1RW4A 2ZAYA 3ED1A 3N3AC 3CRNA 5B37A 4WGGA 4X6YA 5A0FA 3RTEA 3ITKA 1RXVA 3IDOA 1KO8A 3WMXA 4Z4CA 3H1TA 1W4ZA 3WL4A 5EEHA 2RGXA 4WIAA 3BGWA 4NCNA 3OIDA 4DDTA 2HO4A 3CIFA 4Q82A 9ABPA 3ZGZA 4HTFB 1YFLA 1T9GS 1Z5VA 1YR8A 3AW8A 4EYOA 2F55A 1RRFA 1G5RA 2E2WA 1O96B 2D2XA 2UUAB 1QH1A 5JRDS 4TXNA 1W0KD 4GOXA 2YZ7A 5TY0A 2P3LA 2ZTMA 3DJFA 3ZEIA 2BZ0A 4IH4A 3ZXYA 3HA7A 5B6IA 5JAPA 3ESBA 4E2XA 3A1SA 1H3FA 1NURA 4ND7A 1OT5A 3DH0A 1SVIA 4FPXA 1R4AA 4KC0A 4DA9A 1IG3A 1U7XA 1X8KA 3SF0A 3MWLA 3QKWA 5NULA 1YJ8A 4M89A 4M49A 5K0EA 2IOFA 3DZ8A 1FDUA 3HGQA 4KKXB 3EULA 2QMUA 5J4KA 5JYCA 3T94A 1DIAA 1TFRA 1PBNA 4KAFA 5HQ3A