1MZPA

Structure of the l1 protuberance in the ribosome
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
217
structure length
217
Chain Sequence
MLADKESLIEALKLALSTEYNVKRNFTQSVEIILTFKGIDMKKGDLKLREIVPLPKQPSKAKRVLVVPSSEQLEYAKKASPKVVITREELQKLQGQKRPVKKLARQNEWFLINQESMALAGRILGPALGPRGKFPTPLPNTADISEYINRFKRSVLVKTKDQPQVQVFIGTEDMKPEDLAENAIAVLNAIENKAKVETNLRNIYVKTTMGKAVKVKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the L1 protuberance in the ribosome.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Ribosome
molecule keywords fragment of 23S rRNA
total genus 59
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2002-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 1mzpA01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mzpA02
4QG3A 4F9TA 3TG8A 3ZQJA 4QGBA 3QOYA 4LQ4A 5DM60 4REOA 1I2AA 5DM70 1U63A 1ZHOA 3FPNA 3U4MA 4QVIA 3U56A 4DFCB 1DWUA 3UMYA 1MZPA 1CJSA 1AD2A 2HW8A
chains in the Genus database with same CATH superfamily
3WR5A 4KU4A 3KSRA 3RT1A 1TIKA 3QE4A 4HMOA 1DFIA 2FWBA 4G25A 4BKRA 1K3FA 4OMFG 1G18A 1LLDA 4GBED 1JLKA 1JMYA 4HJXA 4QWMA 1USKA 4D26A 1K92A 4KDFA 2IYWA 2HDHA 2B7BA 4P5DA 4JQOA 2ZSUA 4HGQA 1RI3A 2CCJA 2N75A 2YN0A 5A4DA 4ZHQF 1NM5C 3OFKA 1VMKA 5TQ2B 1I7LA 4BPRA 1T5OA 2H2DA 4BHTA 4MLZA 5C18A 2Q5CA 2QVYX 3EZ6A 2DBQA 4YCDA 5LDHA 2EFYA 5LQAA 1PV1A 1UF9A 1GWNA 3NKLA 4AG6A 1Z4LA 2ORYA 2CWWA 3LDFA 4FSHA 3O5AA 3VOSA 4WPGA 2KQUA 3CWZA 2XDAA 2YZ2A 3HUDA 3R9KA 2PTGA 2RH5A 3AP2A 3LXUX 1EUDB 5BYKA 2KBEA 3FGZA 3PGLA 4GRDA 3A6GA 4RW0A 4AJ1A 4LN1A 3U40A 4CM1A 4URXR 1NVTA 1PE0A 4BP1A 1XDBA 3FW1A 1E3DA 3EE6A 1PWEA 4DABA 3QELA 5ALHA 3KWJA 1GDDA 1W35A 3KDSE 3BILA 5MN5A 2H5EA 1KVRA 3FDXA 4HEA6 4JJ8A 3IUYA 4IIJF 1HM5A 1Z2DA 2WJGA 1CNEA 5LQDA 5HTOA 4O1HA 2Y2VA 1ORTA 4XUEA 3R3JA 5C34B 3UJAA 2AOTB 4XB2A 1JHAA 1VHQA 2AN5A 2L17A 1VJRA 2RGYA 3VAYA 4BMOB 1ZCJA 4DC9A 3H1AA 2XCRB 1X70A 4E21A 4QPDA 1GNPA 3VR5H 1XJ5A 2X15A 2A94A 3BWDD 5EY5B 2E18A 1ORRA 2DT5A 3TQRA 3L6CA 1QYCA 3WYAA 1TGVA 2F1HA 2ZDHA 3DVQX 1B3RA 3VVLA 3HABA 3BULA 3RBVA 1L8OA 3INGA 3CLHA 3U7IA 4QLAA 5G1OA 4KWEA 5HFJA 1JXOA 1V1RA 2VHWA 2X8BA 2FR0A 1YB1A 1VP9A 1ZZEA 3REFA 1VKJA 2GPYA 2PT7A 2GBPA 4JROA 3CLSD 1H5UA 3N6XA 5DM0A 3I76A 1G60A 1ULAA 4YTEA 3WIVA 3QVGB 3CEJA 4H1VA 4Q1AA 4OLFA 3K5HA 3C7CB 3CLRC 3EXHB 3AF2A 3PV0A 4DMRA 1RRGA 5F78A 2MU1A 3BXZA 3EBPA 4FLFA 2CUNA 3IP5A 5EWJA 1QDEA 4ZFNA 1CCWA 3UUFA 2Y27A 3SLRA 5CFPA 1B3BA 1YR9A 2AS0A 1RJ9B 4NZPA 3RFVA 1FOEB 2PZBA 1Q22A 5BMOA 3JZIA 4B3GA 1EM8B 3JYNA 4EARA 3G2OA 4WLNA 5HUQA 3PFFA 1VLHA 4ND7A 1TT5A 4AICA 2CEKA 1I3CA 3JWHA 3KM0A 4B8YA 4AKIA 2AN3A 4RNCA 1UZMA 4G5HA 3HB0A 3ZHYA 2WHQA 1NN0A 5L7YA 2QTFA 3LA6A 4NP6A 3G8DA 4FYWA 1JEQB 1Z0SA 4Z3OA 2IH5A 1PL0A 3LRPA 2REBA 4C0WA 4PRLA 4EKNB 1MJGA 4H59A 1RWVA 1KAEA 3HUFA 2ZRPA 1ZSNA 5C1BA 5F1OA 1A96A 1I2CA 2HW8A 4HTFB 1IJKA 3NQ41 2X1HA 4GOMD 4M46A 3TLGB 1TKBA 2NVOA 3A1EA 4HDQB 4MVJA 3VSDA 1P5HA 3CH4B 1Q0QA 2WFLA 1ENZA 1QP0A 1L7VC 1XTVA 1J2UA 2G4LA 1EGHA 4CQJA 2IS1A 2IK8A 4F45A 3HA7A 2IIQA 1XK7A 1J42A 2QW1A 4XX1A 4DV5B 4EX7A 4PYJA 3PT9A 4MB2A 4QO8A 3BSFA 3GRKA 1P1RA 5J40A 4UMVA 4D92A 2OCAA 2BFAA 1P5JA 2R2AA 2W83A 3K5PA 4YBZA 5B4VA 4W82A 2NZWA 4KPEC 3KAPA 5FF9A 3VGPA 5C81A 3DM9B 2PSHA 1WW3A 4M0LA 3TLEA 3WAKA 2P78A 2JA2A 4G4SO 3B20A 4B71A 2VYCA 1ZQ1A 2ZRBA 4XDYA 3GLIB 1WOYA 1EMDA 1ZD1A 1SOAA 4IHJB 1MA3A 2AXQA 2Q1TA 4NBNA 1HEYA 4UM9D 2PUVA 2JLWA 1YJ5A 4PSKA 4XSHA 2FQXA 2BHTA 2GA8A 2VP0A 2P69A 2DVMA 2LIVA 2EW2A 3HZHA 3MUNA 3W9BA 2IYTA 1V5WA 1UW9C 7REQA 5AI4A 1GGKA 2B4TO 4AX8A 4B8ZA 2Q4OA 4CEIB 3F3SA 1LPAB 3N8IA 2LV8A 3QI7A 3BAZA 4FIZA 1FYFA 4YV1A 4NHOA 4ZCMA 3EH2A 2HNKA 1JR4A 1KU0A 4QATA 5DHPA 1RYEA 3REQB 3RBXA 1TQ8A 3RU7A 4CFZA 5CCXA 1WIWA 4FOPA 4DJAA 4MUNA 1OAAA 3CWCA 4HEHA 2B4YA 1RQRA 4GMFA 4MTCA 4JJ4A 1OZ0A 1EINA 5IAJA 4DZTA 4CIAA 1A8HA 5CBKA 3OQPA 3G88A 3RYIA 1Z0KA 5K0TA 1QH1A 2R86A 5KMGB 3C16C 3G2KA 5D1NA 3SKVA 3ZQ6A 3FHCB 5AQ1A 3T1QA 5LQJA 3TRFA 5CBPB 1SB8A 1T1IA 4E22A 3Q5DA 2CJYA 3F5FA 4B0OA 1ZIOA 2DBZA 2Y92A 3D64A 3I04A 3I6MA 2Q62A 4KN6A 1DAMA 1E5QA 1QIDA 4K8OA 2IX9A 4V0KA 1LFDB 5LQMA 3NVKI 2WTNA 4KLZA 1NMZA 2RAFA 3K9LA 2REXB 4NL4H 3ZNOA 5CA1F 1UMCB 3LPDA 5UKDA 5K8CA 1K3UB 2CV0A 1P2GA 4OHRA 4B32A 3PPIA 4D56A 4MZDA 4G1BA 5CB6A 4IBOA 2C95A 2I7TA 3AP3A 5EJ8A 1P44A 1ZVQA 3QKSA 1IIBA 3I0ZA 5AKJA 3EDQA 2B2NA 1BOFA 2R8EA 3AVPA 3PQEA 4NYIR 5LP6A 2ZDQA 3SHOA 4EVRA 1APBA 3E22B 4HDRA 4MS4B 2CLFB 4EHIA 2QMYA 4Y30A 5FI1B 1XWWA 3BMQA 1CUVA 2BEWA 1GKIA 3RBAA 3JWPA 2F55A 1DTWB 1CIVA 1NUSA 3NT5A 3ZE2B 4NCBA 2YIMA 3CJRA 2K87A 3EC1A 3O95A 4WK6A 2ZKIA 4DRXB 2G1AA 3EWNA 2OECA 1KDOA 4I36A 3CT6A 3EXEB 4YMSA 1BFDA 2BOVA 1TCUA 1HFJA 4PXYA 5LP6B 4UNQA 5HE8A 3RIYA 4MZXA 5D3ZA 4DCPA 3A1VA 4NH0A 1FSFA 3I09A 4WXEA 4YB8A 3ZV4A 3G0HA 4Q9JA 5LFAA 1XD2A 2R8RA 4OL0A 4WCFA 3T4XA 4LHXA 4AT1A 1J8DA 2O50A 1BIFA 2XCTB 4G0WA 4BATA 1TA4A 2GPNA 2CLKB 4Y0AA 4EI8A 2J4FA 3OC0A 4A15A 1S2NA 2V65A 1XA4A 2JGIA 1ISRA 4Q5IA 5IN4A 4DSZA 3MINB 3EPKA 2X41A 4Q3KA 2R9VA 5I9TA 4X44A 4J3NA 4MKFA 3E8MA 4RENA 2XRYA 5BR7A 1B26A 2V6FA 4BMPB 4ZMSA 4WZBA 3KAQA 3HJBA 4ZDWA 2ERYA 1LSJA 2UVQA 3DVSX 3U4IA 3ZDAA 1XXHA 4M8NE 4OH7A 4CMEA 2XBMA 1VJ1A 2D1YA 3VR6A 4GEGA 4GLBA 2AOUB 5KNBD 5E6UB 1O77A 2FJ0A 2G9RA 1LS1A 2X42A 4FEAA 4TXHA 4D4JA 3D2AA 2BSAA 2WIKA 3D6UA 4Q3CA 2F3SA 3V00A 3IEVA 3QXSA 3QYFA 3A1TA 2RH4A 3EF0A 1U0LA 4PPFA 5IS2A 4OHMA 1DKNA 1W87A 3C3DA 4FGJA 2FEWB 1J9EA 3RVDA 4K6MA 3ZIDA 3ZWNA 3ROTA 3GHHA 3U7FB 2P3QA 1VGQA 1XPJA 2H4XA 3C6YA 3GNQA 4YNBA 3TIGA 1JLHA 4WBNF 4BVJA 3DHYA 3ZDQA 5EWLA 1ZA1A 3I1YA 1NL3A 3AC0A 2ZROA 1QX4A 2FI1A 1B16A 3Q6NA 3K9GA 4B3MB 4D8VA 4X20B 1DCKA 8ATCA 2PWBA 5JH7F 1ZAKA 1Q7GA 4Q7LA 5E4FA 4I1OA 2C0QA 2C57A 1G1MA 4Y1RA 3DYVA 3BCRA 4PO1A 1GM5A 3IAEA 2BEWB 2ABWA 1XVVA 5JJLA 4Y9DA 4UUOA 1W2HA 2XE7A 3JASB 1IZZA 2FQQA 2FPRA 2YIJA 2ZTLA 2H0AA 1IQUA 2WYHA 3PX3A 1R10A 4IX9A 2A4MA 3MIZA 2GJ9A 3WGQA 5I01A 2OUKA 2L19A 3TYXA 3B36A 4D81A 2J3IA 3RHTA 1NJ6A 4XKJA 4Z8YA 1U4SA 2Q6OA 2YY7A 3KFXA 2HEGA 3SFTA 3LPNA 3OD5A 4M1KA 1N2SA 2V6BA 3IKJA 3OH8A 2H48A 5B7PA 5GJBA 3NVDA 3OICA 1XRQA 1EK2A 1WA5A 2FR1A 2QM7A 2ZWVA 2OBNA 5H16A 5J5VA 4EYSA 1BSVA 3IKTA 3MHTA 5FTNA 3DKPA 4Q3LA 1RLUA 1Y1RA 3A7EA 1ZVVA 3LNCA 4CDMA 2UU9B 5AP9A 2P90A 3PZRA 5FOQA 5FOXA 2C5BA 4CZ2A 1L8XA 4M60A 3IP1A 4PNPA 4QRHA 5BVGB 4R0VA 1T9AA 5EERA 2H3HA 4K5QA 5JJ5A 2CLEB 5E9AA 2JFGA 2PRZA 3M6WA 1PJ2A 4OGWA 1GL9B 1XVUA 3DPUA 1SG9A 3ED5A 4V0QA 5I3CA 1ZD3A 1E9FA 5DTIA 3RVBA 1YR8A 1LDNA 4PX9A 3MRVA 3W79A 3MBIA 4G8BA 4UEOA 1ZCZA 4BO3A 3L8ZA 1BWSA 4Q82A 1IHXA 2Q29A 2UUCB 1BE1A 1EJ2A 2PFKA 3ZLTA 3AB8A 1VJ5A 3CPJB 4Y2VA 1M5TA 1K5HA 1V25A 2CD9A 2ZS8A 3K70B 1SCIA 3RGGA 3W2FA 3UNXA 4BFUA 2REQB 5AKHA 3AM1A 3CG0A 1C8BA 1ZONA 1LF5A 5KTOA 4TZKA 3IUMA 3BVPA 1CUAA 1BRMA 2JKYA 1RVDA 4M1WA 5B5SA 2AFHE 1KFJB 4M0PA 5AVYA 2DR2A 4LTNA 2Z1NA 3KEGA 4L73A 4IGKA 1A72A 2FRXA 2CL0X 1E1KA 1V1RB 2BHLA 1LI7A 3ZWPA 3ICQB 4DCJA 3KBBA 4OMCA 3O8QA 2I2DA 1MDFA 3MQ2A 2REQA 2O0LA 1RAGA 2DBVO 3G89A 2OY0A 3DMHA 4UNNA 5E9WA 3WDKA 5CB4B 2RGRA 5AOAA 1OZHA 5K3AA 1JDPA 5KHLB 1KEUA 4RTQA 1CW2B 1JDNA 2UUBB 3TIFA 4JI1B 4ED9A 2W8BA 1P2SA 1VPDA 4OLBA 4MH0R 3LVRE 1LJUA 3ZIAA 5JZVA 3DZGA 4Y6GB 3CNEA 3U26A 1P0PA 1SHUX 1H6AA 5TQ2A 2IHJA 1WCIA 1MVNA 1BJTA 3FNIA 2ZS7A 2X58A 4KLNA 4NYJQ 2NZ2A 1RBZA 1YCFA 2XUPA 4DFDA 5K7SA 5AT1A 4K05A 2GKSA 2P30A 2QJFA 3FTFA 4OX9Y 3DG9A 1UM8A 1SK9A 4HAIA 5IBRA 4F5EA 3I2FA 2GM4A 4L5JA 2XOKA 3JQRA 4MCAA 3HHEA 3I53A 4HY3A 1UDRA 3T4UA 2WTXA 2PKXA 4S35A 4QU8A 4IIJA 1WEHA 3WL7A 1F4LA 3HSKA 4A0GA 2XB4A 3DFIA 2PR7A 2BE7A 1ORHA 4WKNA 4Y6QA 5DLQC 1YC5A 5J9FA 5ULLA 4NS1A 4TKVA 2WHPB 3TX6A 1YFZA 4FDVA 5ECWA 5GJVC 2RCYA 1NG9A 5KWJA 4QPZA 1FSPA 2OC4A 1WE2A 2QTNA 3Q5GA 1R6XA 2Q3MA 1PG2A 1W30A 4LBZA 1OUMA 5JROA 1YVUA 4TV8A 1RKVA 3OC6A 3ZWDA 5IEJA 2WSLA 1TDJA 4WCVA 3DJYA 4MQUA 4BJ3A 3RQIA 1JQJC 3B3FA 3ZNQA 1RAIA 2CLCX 5IARA 3TAXA 3L5OA 4TV9B 1OYOA 2PM8A 4HPJB 2WJVA 4U2KA 4XJVA 5BN5B 1KOJA 3RWOA 2QMOA 3K9WA 1A2KC 3OE1A 4RV9A 1MO4A 5E3HA 5LB2A 1WUHS 1G38A 1RRFA 2ZTUA 1B0AA 1I4LD 3HKCB 4IDPA 3VU9A 1O6BA 1T4CB 4HS4A 1G7CA 1B6TA 2WKRA 3K0BA 2DXIA 2RK3A 1MO2A 2Q4DA 1H3EA 4J2OA 3SJCA 1CNMA 1TQDA 1U9JA 3GCXA 3UATA 2EAUA 5PNTA 1E5LA 2Q4EA 1QQBA 2G04A 5BY2A 2C2HA 4Z1OA 5F4ZA 2ZGVA 3AL3A 1STOA 4MB6A 2O06A 2VAWA 2MINA 3P26A 1RPAA 2WYIA 2ZUUA 3NBAA 2FX3A 2HTEA 2Z8XA 5JTUA 4C3VA 3AJ8A 4XLTA 5JCXA 4PX2A 1X2EA 3L0SA 1I7PA 3IILA 3Q85A 1EE9A 4WA7A 1ACJA 2BSXA 1K7XB 2P1DA 1E7MA 3FFTA 3B48A 1YDHA 2C2MA 3MAAC 3WGMA 4EPWA 1FJXA 1WCXA 1CJVC 1UAGA 3GEEA 4MK4A 4TROA 3NFYA 4YMLA 1A7KA 3LM8A 3FUVA 2L82A 4B17A 1NXPA 4BLVA 3JQFA 2F9FA 4TYPA 4Y67A 3R76A 1XDZA 2HTFA 1WUYA 2J4DA 1G5PA 4RYLA 4JI2B 2W11A 1G8FA 2CMKA 2R44A 2ZYGA 3NAMA 4JT8A 3DWIA 2I4NA 3OLYA 2HWKA 3THRA 1V7PC 2V1XA 4LWOA 6REQA 2WP8J 2EG9A 2NPIA 1SKAA 2BGKA 2WAXA 4OLJA 4Y0NA 4ZO7A 1H2FA 4DIMA 4HWGA 2Y66A 1ZNXA 3M33A 3C5VA 4L5YA 3GGPA 3TUZC 3KB6A 3LTEA 4EJSA 1OASA 5CGZA 4KTVE 3V6MA 1L4YA 1TKAA 2NO6A 2YY5A 4UNIA 3SSAA 4PN7A 2KM1A 2FEPA 2JI6A 4GI5A 2RHBA 2VNHA 1H0KA 3GLVA 4XB1A 2P67A 3NIGB 2P9EA 1U3FA 3IDSA 3IP9A 1P91A 2OP1A 2FB9A 2G0AA 2BIFA 3O7MA 3ANNA 2TECE 4HDSA 3A1FA 5CNJA 3FA2A 3K5IA 3D8UA 5ED4A 4MIOA 5D86A 4Z0HO 3FRJA 4AO6A 2QN8A 1XVIA 2IE0A 4LOLA 4RJKA 5E6RA 3K0FB 4J0KA 2C2WA 2OCXA 2J8ZA 4YP6A 1QQ7A 1HE5A 2FRDA 1IZ9A 4JXJA 3ZWCA 4EHNA 2EEPA 3DGEC 4OYRA 3JZMA 3RC8A 1QGYA 3AIOA 4BNDA 2VDWA 2PSDA 1G8HA 2AGVA 2C58A 2I6FA 3UA3A 3JQAA 3JZFA 3WB2A 4MRSA 1J5PA 2BP7B 3FCCA 3KJZA 4ZEOA 4OJNA 3V4LA 4Y9SA 5CCEA 3A1NA 1TM2A 4S3MA 2HF2A 2DPGA 2OBBA 3ICOA 2ZM5A 4LQDA 2E4AA 1N6IA 3RIGA 4A8JA 4CU5A 4F3NA 3JD0A 5J5AA 3HKEA 1OX4B 4BRSA 4JUDX 4QXAA 4P5PA 3RFTA 3D0KA 3RYHB 4M53A 1X7XB 1DBSA 3SR4A 4BNJA 4ACBA 4TWRA 3A6PC 2WU4A 1H2YA 2PFGA 3RVOA 1Z0FA 2NUPA 4JB0A 4ZOBA 3I62A 2C7QA 4CM4B 4QNMA 4CMBA 3NWEA 3STVA 3VTKA 1WB4A 4LZLA 3B5JA 3WYCA 4LF4B 2IVFA 2VR1A 2O54A 4C2TA 3O94A 4HNQA 2J0EA 1FFBA 1TZKA 3GY0A 3GMIA 4RPJA 4EYQA 3KQHA 3LPCA 1XZQA 1DE0A 1KJNA 3KQWA 1GTZA 2GYVA 2C4MA 1I32A 1OTXA 2W6ID 2FQYA 1OA1A 2ONKA 2ZCJA 1C7QA 2CXTA 4BNHA 1ZHOA 3FFAA 3RSSA 1JAXA 3FFBA 1VSTA 4K87A 2DGDA 1PTJA 2Z4RA 2G3YA 4RDCA 4B2IA 3HBAA 4BECA 1WLYA 4WQMA 2RI6A 2ZRNA 1EGAA 1E3LA 1O87A 2IYEA 4LXHA 2C8JA 1DS6A 1YRBA 2JHAA 4I6JA 2FSVC 2WOOA 4Y9TA 3E4CA 1TYEB 2PH5A 2E4VA 4DLRA 2NTNA 2Q2OA 2Q2QA 3D3QA 4GC9A 4LYJA 1DRWA 1RJEA 1DAPA 1KVSA 3X2FA 1BN7A 2ZVDA 4YGYA 1T1SA 2CGEA 2R97A 5EN4A 1M8JA 1YHYA 1ZMBA 2VPQA 3P2MA 2VAMA 1E5VA 1UPXA 3CUWA 4F2DA 4ZQGA 5AK0A 5FYQA 3QKRB 5HW0A 1PGPA 1C30B 4YO8A 1NMEA 1X14A 3U7JA 1AY0A 2EFDB 1D5WA 3FYCA 4HEJA 4A36A 1KVTA 3OWHA 3CNQS 5NULA 1FRNA 4OYYA 4D02A 3JAMA 1NW6A 1UJBA 1GFIA 3DH0A 1Q91A 1D0VA 1F2UA 1RHMA 3LHDA 4MO2A 4ON9A 3NHBA 1O5OA 3KAKA 3TI9A 1AQNA 1WF6A 1O9BA 3G7SA 3LF1A 4R84A 4LYHA 1MNQA 2PZFA 4LWQA 4RIEA 3AEUA 4PG4A 2AFIB 1AKVA 1MO6A 1TJ4A 2GPSA 2YBEA 5EE9A 3R7BA 2FSSA 4Q1VA 1LQUA 4XM0A 4ZAZA 1MT3A 1U2RA 3D4PA 1YUNA 3LU1A 3CZCA 1J6UA 2H17A 4NR0A 1C9DB 1XAHA 3FTCA 3T7RA 2QI9F 3TDMA 4JYZA 1MR3F 4U2FA 4NEQA 5CYPA 3DNFA 3TM4A 1MFPA 2V7TA 3HTXA 2A3RA 1P7WA 3IMGA 1V8FA 4DNQA 4TMKA 5JAPA 1KYXA 1M2JA 5JADA 3C8MA 2IUFA 4DWWA 5A4AA 5TY0A 1JZTA 1N0UA 3FJ1A 2PMKA 2XIJA 3QPCA 4H3VA 4K6OA 4RU1A 1H2RS 2CBXA 1EJ6A 5DWQA 3IJ5A 4EZEA 2N3ZA 3ZTYA 2LTAA 1SC9A 1F12A 2RHWA 3KKNA 2F8LA 1GU1A 3ME5A 4IXNA 4NATA 1S02A 1E61A 4X97A 4I66A 2IBMA 2IV2X 1DDGA 2W37A 3I1IA 4UVGA 1DAGA 4MTLA 3QLJA 2FN9A 2ZVPX 1P9OA 1W2WB 3PDWA 1MOZA 1QCCA 3M70A 1WQ4A 3FWKA 1QJ4A 2QNIA 4L0MA 4QFDA 4UTOA 2OCBA 5F4BA 5H02A 3VPDA 4F46A 3C48A 1FLVA 4HGOA 2LW7A 2D5LA 2G88A 3LQYA 4ZQHA 3DUFA 2L0XA 4EABA 2D2IA 1KOFA 2ZVJA 4KVGA 1CNFA 3BSWA 4GM0A 3FSGA 2FK7A 3FHLA 3L0PA 4DLZA 3S2FA 4HLUC 5BWCA 4D0GA 3DT8A 3TG2A 4H1TA 2RBKA 4AS2A 3JYHA 2CCKA 4RC9A 2XVAA 2GO7A 2W22A 1VC2A 3CZ9A 4NU0A 3KVRA 3GJSA 1TJPB 4MI1A 1WULS 1U7ZA 1H2ZA 2QX8A 2YV1A 1ODTC 4YP1A 1CIJA 3P32A 5EHNA 1C14A 1RC1A 1QCYA 1J97A 2LDBA 3COZA 4BDSA 4M1SA 5JY1A 1W4RA 2VVTA 4NAUA 4FLMA 1ZRNA 3O1IC 2XV1A 3IVAA 3QUTA 1LPBB 1UMBB 1HFWA 1P29A 3DFFA 2F17A 3GJXC 4ZV9A 1DEOA 2QMQA 1JLMA 1U0HC 2A0WA 2G9VA 2JH9A 2LKDA 1E2IA 1XDSA 2NTEA 3MMXA 3PFCA 3Q8XB 2PFSA 4O2BA 4D9CA 2IXTA 1FX0B 1TM7E 2FWIA 3HJUA 3OCUA 1H1TA 4PRZA 5B2FA 1UAYA 3EC2A 5ELXA 4ZGBA 1ULBA 2GESA 1D3AA 3BYZA 2VYVA 3KQUA 2AB0A 2L2QA 2C0CA 4MEJA 2OSBA 1EXMA 3EULA 3MUFA 5FWYA 1WZIA 4HLCA 1I4WA 1CRQA 1Z2PX 4HAWA 3ECCA 4YHHB 3NC4A 4F5WA 4N3BA 1P0CA 1WO8A 3T35A 1AA6A 3WLTA 4CKZA 2IKSA 4J4BA 3WLRA 3VO2A 5AO9A 4LOIA 4ETMA 4YAEA 3UAWA 4QSHA 5ALZA 2WHPA 3NHUA 5HBRA 1VE5A 1IHYA 4ZO8A 4V3BA 3T7KA 3RABA 1L3BA 5HKLA 3GVCA 2EWVA 2CEAA 3FNQA 2AZXA 3QVMA 3GQBA 1UBKS 1LVUA 1N3BA 1PF7E 4C7OB 1E2HA 3A2LA 3GPIA 4PSUA 4V0OA 1WXFA 4RDHA 3GLHE 3NDPA 3G2QA 3O8NA 4H31A 4P2GA 3B9RA 2R5NA 3QMMA 4QVGA 3EXG2 3S68A 4AIRA 4DCTA 2JFBA 2WYOA 1BJKA 5M7EA 2X8WA 3NTOA 2IYAA 1AHHA 3AY6A 3BWBA 1U1CA 3LBNA 3AG6A 1IZYA 4EFDA 1OLSA 4DKJA 1XTJA 1WU8A 1U5BB 3PUVA 3M6MD 4O6VA 5EC8A 4JLSA 3EHEA 1M7BA 2Y1DA 4KFCA 1ONBA 1G20A 1QO7A 1QIKA 1KJQA 3H04A 4N65A 2ZBVA 4X8OA 4XI9A 1FYXA 4RULA 3ROFA 5FHQA 4NDAA 4OHPA 4LW8A 3PHJA 4QDUA 3F6RA 4DQLA 1ID8A 1OC2A 1J4AA 2W48A 4DQKA 4PQFA 4F12A 3E9DA 1JT9A 3L0CA 3O8OB 4FUQA 4GHWA 2NG1A 3FCSB 3ZCRA 1GZ6A 3BIJA 3THWB 1YR6A 3DYBA 3O2QB 3MCAA 4I5FA 3B9PA 4F38A 4JDPA 2IXGA 1FCJA 4B8WA 2A2ZA 3LRTA 1HQDA 4L8VA 4NBLA 1PWYE 4MV7A 2W2LD 5ECDA 4ZGWA 2CUTA 5K4HA 2CNLA 3FI9A 4BNDB 4F1KA 3AO0B 4KLCA 1M33A 4G4JA 4HWTA 4ND3A 2NUAB 4F1JA 5BV1A 4ARBA 5L8VA 3NIDB 3BKWA 1KAMA 4EB8A 1WBDA 1NY5A 5HS4A 2GARA 3EA0A 4QUKA 4O2LA 3QIVA 5FL3A 5K0FA 4W5TA 1Z0UA 2BFEB 3I32A 1NP3A 2PEYA 2Q3FA 3HZZA 3VPCA 2OOSA 3RV3A 4EKEA 1GGJA 3U56A 1R5JA 2R6GA 4DMFA 1COZA 1C3LA 3TD9A 3VPSA 2OHFA 3CF2A 4HGYA 4RK1A 2YWBA 2BPOA 1KI3A 4KXXA 4MXDA 2FPSA 3ROMA 2IEZA 1Z7YA 1RXEA 4P53A 2JIPA 4RHEA 1GIAA 1H8HA 3ZHCA 2JFFA 4U0JA 4KN9S 2X9GA 4DNXA 2NU9A 4DGQA 1D2CA 4LC9A 3GWZA 3OM0A 3KRTA 1K8RA 4X95A 3WK9A 3A9VA 2B1GA 2H7YA 3IOBA 1XC7A 2UYQA 2L69A 3GD7A 3GJ8A 4PSDA 5F35A 1T2FA 5JCOC 1QS0A 2ZIFA 1Z33A 5KWIA 1AMOA 3PTAA 3B7GA 2A9QA 2IYPA 2P62A 1VIYA 1Y9ZA 2WIFA 1XTRA 2YHAA 5D00A 1X1RA 5DI3A 3WNDA 2R1UA 1SAYA 5AKYA 3SZGA 1XLTA 3TSOA 4CYMA 5LQCA 2NLOA 3FB4A 2Q2NA 3G2NA 3NBKA 3KX2A 4HQLA 4QU5A 4V02A 1VG1A 2WUWE 4WINA 3FBGA 4XYMA 5DBEX 5I9BA 1JFSA 1RZRD 3E3NA 3T1OA 1W29A 3D6JA 1DQSA 3N2YA 4O4JF 3OKPA 1PJ8A 4WZBB 4XYLA 3L07A 5L51A 1I3MA 3PHHA 2ACVA 3BZBA 4G0YA 4K3VA 5GTDA 1XQ9A 2J07A 2I8AA 2VQSA 3P9PA 3MTQA 3A25A 2ZSFA 4LIPD 1SZJG 4XM1A 4ETWA 3EF3A 2BMWA 3ZD7A 2CNDA 5L3VA 2VDNB 1TCAA 4ANFA 3PPXA 4UM5A 3AHFA 2FPGA 3NKFA 3AJAA 2Z5LA 4J90A 3EAGA 4TWZA 5KTSA 1MAUA 2Z08A 1YNOA 2ZYIA 1MHPA 1TLLA 4H35A 4R1MA 3BJRA 5ADHA 4BGVA 3WZMA 1XQXA 4WESB 4WZZA 3E2PA 3IKLA 4BLSA 1SKYE 3QEKA 4U3JB 1TJ5A 3C3BA 2P4EA 4QU9A 1E9EA 2GZ2A 4C5AA 1N2XA 4BQFA 4NNPA 1E0KA 2VYND 1HC7A 5FB3A 3TLBA 3CNNA 1CY4A 2QJWA 1IRIA 3O3NB 4OJTA 3H9UA 4PZ9A 3UW1A 3PX2A 2GHQA 3I6IA 2RHGB 4M9UA 2XF8A 4R6XA 4JYAB 3BWCA 3CONA 5T6BA 3FOEC 1XNHA 2RKOA 1KS9A 4A3SA 2Z58A 3WK6A 3I6BA 3MN1A 2RKWA 3G13A 3AR3A 4E2XA 4EJ6A 5KB3A 2XB9A 4HZUB 4LVCA 4PBSA 4JJZA 5FORA 5GQSA 3CCBA 3IQEA 4P2BA 3ZW8A 5BT8A 3K70C 2A7QA 1P3JA 2YBDA 3EA4A 2ZI4A 4GG1A 4CMCA 1TC2A 2AR0A 2ZM6B 1YBFA 4TKUB 4DWVA 1L5HB 4IJQA 1VYUA 2AUMA 1GN9A 1XXHB 2QQFA 4P4NA 1H42A 3M6XA 2G70A 3DBOB 1NXXA 3X1DA 2AFIE 3BIFA 3MAGA 3AMVA 3DZJA 3E5MA 3FNFA 1Z5GA 2NM0A 4MRRA 5KVQA 3EY4A 3BDIA 2P41A 4JC4A 1B0UA 5KSZA 3QGMA 4ZTZB 2JEYA 2O5EA 1SPBS 5IP5A 4FM9A 1QOPB 2F6RA 3OZGA 4FFOA 5H4HA 1HLPA 1NVVR 1Q0UA 3CLRD 3IOMA 4FKMA 2YZNA 3SEQA 2HT6A 1ATZA 1KERA 2Y8EA 4FI3C 1Z7EA 2JVJA 3E7PA 3I9MA 3TINA 5IDXA 4IRXA 2JJ1A 4K03A 3RI3A 1N5IA 2XF2A 1GUFA 2AMJA 1ESNA 2VI5A 3AEXA 1Z13A 4AG5A 3T4PA 2XBUA 3IPAA 2C9OA 3FROA 4K9MA 3GYGA 3F0TA 4C4YA 4KRFA 4AKSA 3SCZA 4INPA 3SI7A 1BE0A 3KLMX 5AI6A 1G8KA 1KEPA 2B98A 3P9IA 5I5EA 1IULA 5KAMA 3QUCA 4A8JB 2WK1A 1W2GA 4GUDA 1GQQA 2CBZA 5FBWB 2JJ2A 5GVRA 4YX9A 2XIQA 3I4LA 4ZK2A 1JLLB 3Q0IA 3W34A 3DVRX 3GNLA 5KTPA 2F00A 4EAQA 3MTAA 4RJLA 5HK9A 4PHFA 2G77B 1KJJA 2OBFA 1P62B 1E6MA 2ENUA 3GAZA 3INRA 4FFNA 4FIDA 1T0BA 1U0EA 1JSXA 4BYGA 4IF6A 3H4IA 3NGLA 1CERA 1KE1A 2VK2A 4X00A 3KXIA 2C42A 3G23A 1E1CA 3BL6A 4H27A 4UMFA 4Y2RA 5AMXA 4FMCF 3PWTA 5EINA 2PZEA 4DCNA 2NQTA 1BTOA 1CUDA 3A4MA 2PNJA 3RTCA 3WLNA 2FLVA 2OOKA 1PZFA 5DNEA 1OXTA 4I1VA 4EFLA 4RVNA 5B1HA 1U9ZA 1R4NA 2OD9A 2BFOA 4OO3A 4PM4A 3F2VA 3NLLA 3EDRA 1WXGA 3CXRA 1ISMA 1M5UA 5I8PA 2PMBA 1F20A 1NW8A 2H63A 3DQZA 1HT3A 3RC3A 4EJMA 4YRMA 3D6AA 2F43B 3ADOA 5BWLA 1NVFA 5KYUB 5P21A 2C61A 2QAGA 1IK4A 4TTVA 1FYWA 2NX2A 1VKRA 1J2EA 2X2FA 3IMKA 3I5YA 4GLFA 1YAJA 3LUCA 3W2GA 2E4WA 1G59A 3VR6H 3N8KA 3DHVA 1Y7PA 2K4MA 1P4RA 3CB2A 4F3RA 4AKGA 2ADFA 2BY4A 4B6QA 1G4UR 1YHNA 3IS3A 4Y2GA 1DAKA 4AJJA 2B99A 1GP2A 2W6JD 3QXXA 4MARA 3D3WA 1IJFA 3TZKA 1WKBA 4JC5A 4QJ5A 1IUPA 1CZLA 2FZEA 4UZEA 2VFAA 4Q93A 4B80A 1A88A 1V39A 3OZTA 3GC6A 3FKQA 2PKQO 3HR4A 3LQFA 3JYPA 3LY5A 3BFVA 3RRJA 1QQ5A 1U4NA 4HGNA 3R44A 2DQZA 3VSEA 1UMKA 4M8KA 3HGMA 2YWHA 4RANA 5FBRB 4BNMA 1Z8HA 2V7WA 4DC0A 2MSLA 4K9LA 3E27A 1ISGA 1PLLA 2CY0A 2VH1A 5EIBD 3L4BC 4BLWA 1YDEA 2FPOA 5B3JC 4YCCA 4IHJA 3WGVA 2PT5A 1T6YA 4RKQA 2VPYA 2WKWA 1X19A 3OWXA 4JAVC 1ESEA 1FYDA 4TTPA 4DSAA 1TTQB 4ZOLF 1R5OA 1J06A 2GNAA 3EGEA 3T7AA 3VDXA 4F7DA 2W2VA 2A0KA 1ZOIA 1R3DA 4KXFB 4O4LA 2PKRA 3SE7A 3VR0A 3WZ2A 4N0PA 1ZMXA 2HGSA 4JT9A 3UWOA 4BDTA 1KU6A 4P7GA 2WWVD 1KY4A 3RK4A 4DQ0A 3M5CA 4PC2A 1KH1A 3DZ8A 4FKBA 5FTWA 1W4BA 5BYJA 4WKBA 1W9MA 3CUYA 1BJRE 1JDTA 1LW6E 1R5BA 3SFVA 4DUPA 5CA1B 4L50A 4IXTA 1GA1A 1T15A 3G1TA 2O20A 2I2CA 1PIWA 3L0YA 5DX8A 1A77A 4JL6A 1DB3A 3WA7A 1O4WA 3O47A 1DT3A 3N2NA 4YCAA 4TV8B 2H57A 1XZIA 1C2YA 2Z1DA 3HBNA 4WNAA 3SQWA 1ISSA 1QYWA 4RMJA 2UYHA 4BFLA 4Z4CA 2EZ8A 3A1WA 1W1IA 2WT9A 2Z5VA 2JFPA 2QWXA 3NPMA 4AO7A 4O4HA 3HPRA 1C7IA 5TF0A 3H5NA 1YVPA 2XSZA 4EA8A 1RMTA 1H0SA 1SXJC 2P9JA 4BLOA 3RG2A 2JFNA 1HT2E 2WZCA 2UXCB 2X2OA 4I1UA 3DONA 4L6CA 2CK3D 1M0EA 3L1JA 3NIBA 3AFOA 1FMTA 4LSMA 1XZFA 1YI0A 1HDIA 2I6GA 2W8ZA 4FNAA 2GYWA 4GOLD 1FMFA 1N5KA 1Q20A 3K53A 4IY1A 4DPMA 4G0NA 2FHSA 1JAIA 1HZZC 1O94C 1ZN8A 5AHWA 3OIDA 5JPCA 5EIAA 1YRWA 1KAHA 3VHLB 3RC7A 1NVMB 4NFSA 5CLHA 3ROXA 1MW8X 4IPTA 1YB4A 4M87A 4EEXA 1W1WA 4TRJA 4HGRA 4OSEA 4A8TA 1ZITA 4IUYA 3IQDB 4DCUA 4ILKA 1VCIA 2AOXA 5IYZF 1K0UA 1X7YB 2Q6VA 2XYHA 4HDSB 4KBYA 1MORA 1AG9A 1IN6A 2ZSHA 4M3NA 1U8YA 2ZCUA 3O93A 1CPYA 4UFOA 2FFBA 2FEMA 2HHAA 2PX6A 3GCZA 4TM7A 2PBRA 5CB4A 2FSPA 2DKOA 2ZRMA 4R2IA 3RQSA 1DEKA 3HXKA 2ROQA 3WNQA 3X44A 4RY2A 2OPBA 5EZYB 5HSGA 4IDFA 5CH3A 4PIMA 2P6MA 4B40A 1UJNA 2JHCA 2W2NA 4K1XA 4FNMA 1CUXA 3GXBA 5FI0B 1N0VC 1WY5A 2OAP1 2YHSA 4MS3B 3V4RA 3FB1A 4OGKA 5K45A 3H17A 4PLZA 3OPQA 3A4LA 4F9TA 1QYIA 4D8TA 2VXYA 2JHGA 1IY8A 5E7IA 4PPNA 1ZY2A 5REQA 2IYLD 1E3QA 1M8PA 2EYUA 2ZT8A 2C99A 1D2MA 3OBIA 5LCXA 3WISA 5CNKA 2AMVA 4I3GA 4TLLB 1RHKA 2WVHA 3ABZA 1W5FA 4FK8A 1QAMA 2O1XA 4H15A 4UARA 5ALXA 2B1QA 1R8SA 1XMJA 4MMYB 2OCIA 1XNRB 2LPMA 4B4DA 4IM7A 1UJMA 4WXRA 1Y8RB 2NXWA 3SZOA 3NIFB 1C3XA 4B3TB 2BCGY 2P9BA 1YDMA 3Q6IA 3IPXA 1L1RA 1QCZA 2PS9A 3JARB 3ZVMA 4PYMA 3L7IA 1PS0A 1PFGA 1PT6A 4Q34A 3OIGA 1RM0A 1NR1A 1J1UA 1L5FA 4WVFA 1UDXA 4QTYA 3H65A 4PLPA 1HO3A 2G83A 3BZUA 3FPJA 3IR6A 2BH9A 2ZIXB 3LBFA 1JWBB 1E8MA 4QGAA 5DXFA 1KC3A 3CE9A 4EUFA 1XTKA 3VAAA 2VF2A 3CH6A 2A0YA 1U99A 4QUEA 1RYBA 1JAZA 1M2HA 1E8NA 3I58A 3WXMA 5AKLA 4EGJA 3TIIA 1QHXA 2GKOA 3D2LA 1KQGA 2XXAA 5TDHA 3W2TA 1ULHA 1QYRA 2A1TS 2EP8A 3HKDA 4JJIA 4EK9A 1HBJA 4WBNB 5EJ7A 2BDEA 1KETA 3R5JA 5IHXA 1AXGA 1V7ZA 1Z0AA 1B74A 4E4YA 2QLNA 1I13A 5DHFA 5BN5A 3HI4A 2IS6A 4KQMA 1GPLA 1SCKA 3IB6A 3WLEA 5C8XA 4Q4AA 3VU3A 4EDFA 3NPAA 1QAOA 4XCVA 3R9XB 3DFUA 4M9ZA 5LVAA 1DAEA 1D4FA 1Y34E 3CX8A 3TX2A 3VH1A 3M34A 3KTFA 3KZCA 1RIIA 2GN0A 4LZPA 5AVZA 3ZCPA 2XXAB 1YQGA 5KYTA 2QL5A 4WESA 2I76A 3S8EA 1MJGM 1CS4C 3LDHA 4LJ4A 4AZ3A 3FTNA 1V95A 3PRKE 3GFPA 1XYYA 1N8KA 2O1SA 4FTWA 3K6KA 2IU4A 4H7DA 1NWHA 1VI2A 1XCGB 2JJMA 1ZESA 2RK6A 3SEAA 4YLYA 3LO8A 3UXHA 3SDZA 3SOPA 2HWWA 2Q9CA 1Y5RA 1OFVA 2R1ZA 3TRJA 3ADDA 1DXQA 4C06A 1PK9A 4GKBA 4GL2A 3OPYA 3B3GA 2EKZA 4H6WA 3AR4A 3FPAA 2XOKD 4DMMA 4Q9DA 3VR4H 5L3QA 4FCTA 1ZRHA 1D6JA 3EEOA 1KDVA 1EFPB 1JYEA 3V7FA 3UUEA 3UN1A 4YECA 1SM4A 2IOFK 4I50F 2LZ0A 5B53A 2ZUTA 3T9CA 2ZRAA 3X1KA 4C0AC 4EL0A 2EYQA 2E9SA 4RETA 5KX5F 4IZIA 1KY2A 1VIDA 1ZMRA 3HE3A 4BNWA 3EBLA 4CEHA 4JJAA 3WV4A 2Q5LA 1JE1A 3U7RA 1ZYUA 2OHHA 4JGBA 4IILA 3V8NA 3FSRA 1H94A 4Z4HA 4ZARA 3KZ1E 1DHRA 5ALQA 4HXFB 5B3JA 1XYVA 4QXQA 3MD9A 2QI9C 3L4BA 3H9CA 4DWOA 1OX6A 4DMGA 1L2TA 1WVMA 1R0WA 1ZD9A 1ZMTA 2FR8A 2HK7A 2R6ZA 3CSSA 3NTRA 2M6KA 1II8B 3OEED 3TL6A 4GE3A 3AR9A 2C9MA 2ZAGA 5DNUA 4ZCRA 1C8VB 2ZSDA 3L4SO 2CUZA 4N3GA 4NICA 2W2LA 3OJFA 3I2IA 3UK6A 1ZVMA 4HYEA 1P0MA 3HU2A 3NT4A 5JWOA 2GFIA 4KN8A 5A6SA 1DXYA 3AILA 1AC5A 3K2EA 2ZB3A 5KWSA 2TYSB 5HCNA 3AOEA 3IDAA 1KQNA 4XQ9A 2EL9A 5IDYA 3RU9A 3ADBA 3QVLA 2OGUA 3TBKA 2OE2A 2BEUA 3TNDA 5ALUA 4PTYA 1XP5A 4PZUA 3V3KA 3VZSA 3WRWA 5KINB 5LNK1 8MHTA 2W6QA 2CXRA 3FN4A 1UJ4A 2WQZA 3C8DA 5LSAA 1HF3A 2Z6AA 1L4BA 1RAAA 1ZD2P 3IFSA 4KK4A 4RBNA 5DCLA 4B3SB 1L7BA 1IXZA 2RHDA 4TTSA 3IHLA 1U0BB 2BMFA 1RE0A 2OMKA 4A91A 5KIAA 2G5PA 4HDKB 3WNBA 4DN6A 3RDPA 4CLOA 2TMKA 1SELA 1FYEA 1VE1A 4I2NA 2ISSD 3IURA 5EZ5A 5BVGA 5HILA 1O5IA 1KYIA 1UP6A 1XCJA 1QFZA 5DNAA 3VJKA 4BP9A 4TVSA 1E60A 3T1YB 1SWVA 4UAGA 1Y3AA 2IVZA 4LRQA 4IEFB 3GG9A 4KQHA 4B7ZA 4XPIA 3O8RA 1JEDA 1SY7A 1YB2A 2K7FA 1GZ7A 2YNMD 4U5QA 1A5ZA 1CLEA 3UWKA 2QU7A 3QVGA 4YJHA 2QPTA 5J47A 2J4CA 4DHEA 3WGUA 1GAXA 2Q7OE 4EG4A 1RZRA 3GDOA 3CRNA 2QE6A 3ZCUA 5F12A 2Q1XA 2NTJA 3L4JA 2FPMA 4IICA 3IL2A 1WZ2A 2C4NA 2QNBA 5HF6A 2PSJA 2XW6A 5FADA 3TTVA 5K3OA 2FPPB 1JDUA 3CISA 1ZGHA 1HURA 1Y42X 4FHZA 5FBVB 2PQ0A 3HMQA 4YJ3B 4TQUS 5DP2A 1N5DA 2XOXA 3VPXA 4ZICA 5EHXA 5LNK6 3SVLA 3TCNA 1JP7A 2CD7A 2VDPB 4PGGA 3GUVA 3A6HA 4G63A 5KTNA 1CKEA 1W4CA 3NIWA 3NS7A 4KR7A 1K7FB 4ZT5A 3RH0A 3S27A 3HFJA 3WHPA 4AQ7A 1PP4A 4LFCB 2JD0A 4BBZA 1E63A 3CG4A 2AW3A 3QSYA 3AXSA 4B6OA 2GOYA 4HAUA 5JUWA 1CQXA 1KEZA 1K68A 2IZOA 3KQTA 4QDTA 4RD3A 5EWMA 1NV9A 2DERA 3F6EX 3JRNA 2OUIA 5TXGA 2V6JA 4Y2JA 1LV8A 1ODSA 3NFRA 2FZGA 2R7LA 1SXGA 2A0UA 3LUKA 1D03A 4ZPJA 3HCPA 2PRJA 4R8MA 4MI9A 4XW2A 3TKAA 3ZTTA 3ZDBA 1R0RE 3NJ4A 3QBDA 2UYYA 1U2DA 3NTXA 4MCIA 3S55A 4BNUA 4C6SA 4BB0A 2VEOA 4Q16A 5C3MA 3I61A 3DTVA 1QZUA 3IJPA 3HA2A 4YY3B 1PK7A 3G8AA 2SBTA 3K2IA 4IIUA 4Q9IA 5BRAA 5A0TA 4MV0A 5JJCA 1H0HA 2I71A 1SIBE 2RGCA 2VRBA 4BKOA 4Q4CA 5LZ5A 3SF8B 3EDCA 2HFJA 1UZHC 3OJCA 5HYVA 1SUEA 3H5AA 1JU3A 2GM9A 2SHKA 3LQKA 5DIZA 5B2EA 2Q5OA 1FTQA 3B1JA 2CV1A 3A3NA 3IQWA 2QTWB 2XUKA 5A5VA 4BAZA 3KOMA 1DL5A 1WZCA 1X0VA 4EG6A 1EM8A 1NUAA 5E9QA 3UHJA 4Q05A 2WNIA 1SCAA 2XNHA 1EA7A 3IGFA 3WV5A 4R69A 4AQDA 1PSDA 3EG5A 3N2ZB 3MFQA 1B8NA 4F9GA 4R3NA 4L6IA 1CR4A 1NRXA 3KPYA 4LY3A 3DAFA 3QRWA 1YFLA 1G0OA 1BX0A 3B85A 3ZHQA 5IABA 3OZBA 3A2KA 3BXGA 1T26A 2EF0A 2AE2A 1JRLA 1CVIA 5AVJA 2WJWA 2X14A 4NPHA 4QWWA 3UUGA 1SOMA 1X38A 1TLFA 2M2IA 4D9FA 4NHEA 4WKOA 5TEVA 4YCBA 2I29A 1AZWA 4PVCA 1JIKA 1UUFA 4XWGA 3RFCA 3TZEA 4RA6B 1S2GA 4Q6BA 1JQDA 4YC7A 2J0SA 5AXDA 2R4QA 4KNYA 3SYNA 1GITA 4U8GA 2R8BA 1IN4A 1NOIA 4KKXB 5F23A 2Y93A 3S99A 4MB0A 2PMEA 3SLKA 4IDNA 2R6FA 3DB2A 3UJ7A 1P9RA 1PD1A 2GCOB 1CSEE 2GSDA 4NOLA 4EUEA 1EK0A 1J0CA 4Q1DA 3BA1A 1K08A 1U6IA 4AWXA 4IV5A 5KQRA 1E4OA 4M9XA 1ZM3A 1GG2A 1ZEMA 3FPSA 3CURA 4MWDA 1NVGA 2HSGA 3SBDA 2PGLA 1XVAA 3L7YA 4XA8A 2RGDA 4WW0A 4LCBA 2D1SA 2VOJA 3A06A 4EI2A 2VKQA 2INGX 4N9WA 5D51S 3ESQA 3WGLA 5FJIA 4QBGB 1QFYA 3ICCA 4C43A 2DUNA 2CLMB 4X6YA 1BHJA 3ZWAA 4K40A 3R3XA 3QJ5A 4BVKA 1PTKA 3CZ4A 3COJA 5AESA 5KOIA 2JLXA 3MK31 2R5WA 4PHGA 4H7JA 5IAAA 1ZJ4A 3OTGA 3HCFA 5K03A 3AONB 1SZDA 1WTCA 1H1DA 5F52A 4NCAA 3ZXXA 5KSYA 1E2LA 5AUPB 3WQBA 4PFKA 3PBKA 2CL6X 1FK8A 2NO4A 4DA0A 2YW2A 1WMBA 3DMGA 3CF0A 5TPZD 4KB5A 3N53A 4MICA 3G02A 3O73A 4O0LA 2ZIGA 2HCRA 4LDAA 1UM9A 1G4HA 4OJKA 4OUDA 2NU6B 4D9NA 1IONA 3NNDA 1A2QA 4X1IA 2FNAA 4W1PA 4XUCA 4ZN6A 5JPDA 2WBLC 2I78A 2I66A 2WWTA 3UFBA 6ADHA 2XUHA 3X1YA 5A9RA 4Z2AA 3WO0A 1X86B 3W8DA 2OL4A 2AJTA 5CLGA 1XTIA 5IFKA 3VHXA 1ECPA 1CY8A 3E9MA 5E9JA 2FSUA 1FZQA 3EEIA 1TPZA 1U3VA 2R68A 3I9KA 4FEYA 5BSRA 1KYVA 3UK0A 1QR2A 1Y3BE 4ND8B 3ONVA 7ADHA 1Q7TA 1GL6A 1AZSC 4B2YA 4L16A 2IEBA 1I3KA 2FSIA 2O8EB 2XODA 5KC9A 1U0FA 2JPDA 1OSNA 3HVHA 4M4SA 2GMWA 4C21A 1M1NA 1S4QA 2ATVA 4HCJA 1FDOA 1QG4A 5D3MB 4HVTA 4L3VA 1ZGJA 5FBLB 2IDKA 3F2IA 3UEOA 1OV6A 4ETIA 4IQFA 2PBZA 1EZZA 1V7QA 2J5KA 2YFHA 1G5TA 1UOPA 1ACLA 3U4AA 3EVCA 3HMKA 3QY9A 4QOGA 1KFCB 5AVQA 3G2LA 1K1EA 3EZXA 3FMGA 3O9ZA 4UXHA 1P6UA 4RH3A 1XUOA 4LJ5A 1OBFO 3R9IA 4DJJA 4EB6B 1O5TA 2IHBA 3QNWA 5EMLA 1LRJA 2BW0A 1I6KA 2AC4A 5F51A 1XMQB 1KGSA 4X3OA 1CP2A 4M0MA 5DK6A 2PBLA 4KJXA 1UC9A 4D4HA 1WVIA 5C5EA 4KQ9A 1X8XA 5J59A 1PWZA 1QUEA 3KIPA 3U80A 1V26A 4OD0A 5ICGA 2BUAA 4JLKA 4CM7A 5CDYA 5C5CA 4GQAA 3B7WA 2HQSA 2ZJFA 1FUYB 1WZUA 4ZVVA 5C35A 1UBRS 5JVDB 1J56A 4NJOA 2FSFA 2RHJA 2W8BB 2XAAA 4XYGA 5HIMA 3Q3JB 2BEKA 3V8VA 4D4IA 4EGQA 5K8IA 2A9VA 2YQ4A 3B12A 1TPYA 2J48A 3EDMA 3FLAA 2XAUA 4TL8A 3KXLA 1KMIY 1XN1A 1FXSA 3HCEA 4H7KA 3PXBA 4NZZA 2HUPA 2P2NA 3MF4A 2Q0HA 2QEQA 1YE5A 1Q1AA 1SMKA 1HSZA 5JJIA 3TJZA 2FGJA 5KTTA 3VO9A 1E9AA 5HMMA 2ACKA 3KD2A 4PQRA 4YUWA 4D7AA 2O9JA 2P9CA 3H2KA 1L9XA 3C7TA 3AVVA 3U7QB 3QX8A 3FD8A 5CVUA 2QLLA 2BI4A 5DGHA 1C80A 3Q7EA 5F9FA 3VZCA 4G9GA 2VHEA 4DV4B 1CJUC 2YRFA 3CSUA 1AO3A 3TUJC 1GZDA 1YB6A 4MQFA 5DBFA 2YYAA 2B0JA 2WF7A 4JUIA 5DJ5A 3F9IA 2ZBUA 5ALMA 5AYVA 2EX1A 2GD0A 1KNXA 1MB3A 5EXDA 3SC2B 4J1TC 2PZAA 4F93B 5IG2A 2C3MA 3CWQA 3COSA 3SZMA 3VNBA 4DDHA 2AZDA 5IM4F 1NN3A 4GWLA 1P73A 4MQ4A 4OBBA 4MW6A 3TLZA 1A98A 3CN7A 2BFCA 4AJNA 2AOTA 1ML4A 3EWAA 3MHPA 2J41A 5I4CA 3H8SA 2HSZA 1I4TD 5C2JB 2HYIC 4HB4A 3DAPA 1P7VA 1HXHA 1NVXQ 1XTQA 3RHFA 3ZNPA 5BV7A 1E20A 3PDHA 4KQFA 4DCGA 1YKFA 4QT0A 1KEKA 1J8VA 3LHIA 4OM8A 3R7WB 4QULA 3F71A 4HYTA 2ZZMA 1B8OA 3E9EA 3ACBA 4QO7A 4QHTA 4TSRA 1Y8AA 4U2DA 5ALFA 1N77A 3BGIA 1NVKA 2XUIA 5FR1A 3RRFA 4CEJB 3R3UA 1DXOA 2XEXA 3AUKA 3AR2A 3E70C 1PFWA 3GT4A 1MVLA 1ZH8A 1MB9A 4MP8A 3KVNA 1DVRA 3F7NA 3II6X 2QTBA 5CDFA 2A0FA 3FJOA 4M1MA 3ZUPA 4F56A 3VKUA 1CG6A 3LDAA 3M6LA 1EK5A 1Q95A 1ZNWA 2FFQA 2RG1A 2Z2YA 3P2IA 3Q11A 5JDCC 4EZBA 1P2BA 5LU9A 4MYCA 4W5OA 1WMDA 3U4GA 2YDXA 3DJFA 1DZ3A 1R15A 2HIMA 3F6YA 4GFDA 4N7RA 4ZZ1A 1Y3FE 1JI3A 2ODAA 4GBMA 3ZLUA 1VSBA 1A9RA 2J33A 3AM3A 3M1YA 4BU1A 2EC5A 3RHSA 1MOPA 2H2FA 1QFXA 3LGXA 3V7YA 3L05A 4FMCB 3JAWA 3UB2A 3O4VA 4H3HB 4E15A 3Q1KA 1SCUB 1PL6A 4DBVO 1IN5A 3NAGA 2OZPA 2H9IA 2A0XA 3HZRA 3OP4A 3I8OA 3QVOA 3S1SA 4Q9NA 1J1IA 2BVNA 3B3JA 2W2OA 1UBHS 1A1VA 2BHSA 5AQEA 3H5TA 1K2VN 3AUXA 5I48A 3F1KA 1IC6A 3WFJA 1SPXA 1BMFD 5FUQA 2C5LA 4NESA 2O2JA 4CODB 3H16A 2P3SA 1NJFA 1UC4B 1CUCA 4JOBA 2QRMA 4TGLA 4L3OA 4OF4A 1P61B 4IGFA 3RBZA 4NAHA 2CSUA 1SZPA 3LKZA 2HM7A 4M1QA 4PS0A 3TO5A 3MGCA 3ROQA 1EHYA 1PVDA 1R6TA 3PRJA 4QPJC 2DE0X 5F21A 1RYNA 2IIBA 5HQ3B 5LZ2A 4RZSA 4JL5A 2O2DA 1E9DA 2WIJA 3ORSA 2RDMA 5AI0A 4MJLA 4EKDA 2VP2A 1IWBB 2JBWA 3ESDA 4FWTA 5DHSA 1T2NA 3AIMA 3WLFA 2VSXA 1S9DA 3FMOB 1VJTA 3W2HA 4ES6A 2PL3A 1PTJC 4QRDA 3K9HA 4FGZA 1H8ED 1KMNA 2QLFA 3GVIA 2XWJI 3OUUA 2BT4A 3TXXA 1GZ5A 3V2GA 1ILEA 3ISJA 3HKCA 3WSTA 4ZMBA 4F84A 1KQFA 3NJ8A 1NDUA 1D9ZA 5E2BA 4BVAA 3PFWO 2G1JA 3CT4A 2GBGA 3IR7A 1FTSA 1N8TA 3CUVA 3E84A 3ROPA 2XPCA 2AXPA 1PT5A 3T5MA 1IZ0A 2CHGA 2VT2A 3ZHZA 4DEYA 4ZYYA 3NP9A 4NFLA 2HWXA 4ER5A 5LXTA 4BC1A 2FETA 3VMMA 3AUJB 5KVSA 1UK9A 4PQEA 2YXPX 2F1RA 1FFXB 1CLUA 4FZ3A 4LJ9A 3FVRA 3WWEA 1BAPA 4ZDIA 5KVVA 2J0QA 2AA3A 4MJ3A 4GOXA 3S6JA 4I9HA 4N12A 4DLUA 2ZE6A 3GT0A 1P74A 4X6XA 1ZUHA 4Z7QB 2FCRA 2FMHA 1SHTX 1T24A 1SCUA 2NYUA 1NBIA 3Q6MA 4XIJA 3GA7A 5DPMA 4ZTBA 3K0HA 4A8JC 1OLSB 4NDZA 3PSHA 4BKQA 3Q87B 1KFEB 1L6IA 3RFFA 4AAYA 5BVHB 2PJRA 3KVYA 5AW0A 1NULA 1SKUA 4R9SA 2P5SA 1LJLA 1Z5PA 1VLLA 1JIQA 1RXOC 1A9PA 3L93A 1TZ2A 2AFVA 3CZAA 5U4QA 3ZDDA 4UC0A 4F4FA 2MSCB 1D1QA 4LQLA 4A9AA 3E7FA 3LW8A 5AVRA 3KLOA 5L3RA 5IVHA 1N4DA 1PX0A 2AN1A 2Z57A 4XB6B 2BF4A 4EB0A 4N7MA 1ZVKA 4C08A 1SURA 2CLOB 2HRZA 1BGVA 3W9UA 3DO5A 1N36B 2CHEA 3HO1A 3EOAI 3A1UA 2XDWA 3B2EA 5DN6A 3HRIA 2YVKA 4YDHB 4X94A 2ZYUX 3ZKWB 3PU6A 3K1AB 5AW9A 2P8JA 3NM5A 4ZCTA 3A04A 2V69I 1QV9A 1T36B 4EHHA 2IPNA 2EF1A 3KKQA 3FCAA 4MUEA 4UFPA 1KZ9A 4FDUA 1Z6ZA 4AP5A 3OLQA 4JY7A 2VBCA 1AHIA 2QQ5A 3HG7A 4KE8A 1OPRA 1Z5OA 2IPLA 3NONA 4XFKA 5DDIP 5H7XA 3T3HA 3W05A 4W9NA 1GTRA 1NQTA 5CYOA 1DKLA 1ONPA 3WMXA 2C2XA 1PR9A 1ZK1A 5HTKA 3DE3X 3MOIA 1GCUA 4OYHA 1ZHFA 4PYIA 1A69A 1PR1A 2GD1O 4RPLA 1F5SA 4L5AA 2VQ6A 5CA0F 5BPFA 1QDUA 3I9NA 1KTIA 5CK4A 2JJ8A 5A71A 2I4MA 3HUTA 1B23P 3G2MA 4QSMA 5ALKA 4UVIA 1VBKA 2OHIA 1OFUX 3B1WA 5ELMA 3OBBA 1Y3CE 2IKQA 4HYQA 3SDSA 1L5VA 1KI2A 3QOWA 2V5UA 5AKIA 3QF4A 2I03A 4WE3A 5IKEA 5EI5A 2X9LA 3TVYA 5C8YA 1K8QA 1PBNA 2QZ4A 2V55B 3JQEA 2XLCA 4TXMA 3KSMA 5U1PA 1VI5A 4ID3A 4QGHA 5EIHA 2AZMA 3GV0A 4AY6A 1M6VA 2E2WA 2YQZA 1ZC4A 5ANRB 2AR7A 4DA7A 4Q02A 4DIOA 2JDID 2RK4A 5AK4A 2ZITA 3KALA 2NZXA 1TK2A 4JA0A 3CR8A 4EB3A 1VJGA 1GHTA 2NUPB 3ICPA 1RU3A 4HGPA 4RGVA 2NV0A 1TXGA 4YJFB 3FZEA 4RA6A 4Y3UA 3UM9A 2IYRA 1YQDA 1EH5A 4QARA 3VTFA 3QKWA 5C8YB 5J2TF 4RQTA 2A35A 2K7ZA 3CRZA 2G71A 5I4IA 1JEYA 3GN1A 5DM60 3WNZA 2O1EA 1NVEA 3O75A 4UUPA 3OVMA 3PUHA 4NEGA 2B36A 1OZGA 4MWZA 2J32A 3K8OE 5C7LO 3F4KA 1PZGA 3NUZA 4J7CA 1L7EA 4MV1A 2JH3A 2B9VA 1O95C 1L4NA 4DSNA 3BHMA 4CI9A 4Z49A 1K8XB 5IYZB 3KDPA 1P0IA 3VYWA 3FWHA 3U4MA 3EOBI 1W0JA 4MYRA 4X1YA 3H6GA 3KQYA 2PL9A 1T9GS 2OYCA 8AT1A 4EY5A 3BMCB 3WK8A 4Z1MA 3ROEA 5JI2E 1EVLA 1OFGA 2R25B 2RGBA 4F21A 4C87A 1EK1A 2YVLA 2OO3A 2IYOA 3PE4A 3QX9A 4IUDS 5A3SA 4BXOB 4XR4A 1U7XA 4KQ2A 2ZP1A 3KTAA 3ZS8A 2J6IA 1Z4MA 4GD3Q 2QMZA 3O92A 4HOYA 4O4IB 3W1WA 1N2CE 5B1SA 3IX7A 4PC3A 2B1RA 2FW9A 2Z56A 1GQOA 1QX3A 1OI2A 1JMKC 1GAEO 1FFYA 1NXOA 2XGJA 4CLXA 3PLRA 3RUBS 1MLDA 2YJTD 4LJSA 1PJ3A 4WJZA 5HBGA 2DWCA 3TPFA 4HNAB 3QFFA 3IBSA 4IFBA 4CEJA 1P33A 2IOYA 3AVOA 3H5IA 2DPHA 3WL8A 2BC9A 4YJKA 4X7MA 3DBLA 1BWQA 4KZPA 3WYDA 4RZUA 1R2QA 4AW9A 5JSKA 1NW9B 3GMDA 2DQ4A 3U13A 5TVGA 4UDOA 5CXQA 1RLOA 4N7BA 3LXXA 4ISCA 1KQOA 4JBLA 1JPNA 1Z62A 2PZJA 3ND8A 1Y4UA 3CS3A 2IXAA 5JCJD 1HDEA 1B1CA 1QYDA 1XL0A 2P9ZA 1T25A 4LYYA 5EHIA 3RJ5A 1RP1A 1N5MA 2W5UA 3QXJA 3JQ8A 1II8A 1CY0A 1ZKDA 3MG9A 5D7NA 5I7FA 4D8UA 1P1HA 4YQZA 2JFYA 3OIFA 4TKVB 2VJMB 2ZFUA 3KEQA 3WP0A 1QK5A 4W4TA 3DWEX 2WTUA 4NCHA 4W1QA 2V6GA 1M73E 1ZZGA 2PCLA 5A6SB 4DG5A 5HKKA 1I3LA 1U02A 4OBWA 4U8HA 3DD5A 1XU7A 3K6JA 2NO1A 5TX7A 5EFZA 1D2EA 4JFRA 1LDGA 4WN9A 2RCNA 4UKDA 1VOTA 3RASA 4F6LA 5IDQA 4RTSA 4YI5A 2JAPA 2A4KA 3EIEA 1XL1A 4UNSA 4MO9A 2V8BA 3VC3A 5A3JA 1E2PA 4JCOA 3CKMA 4C78A 4RIIA 1QKJA 1OTHA 4XEUA 2DCUA 4DVJA 4OY3A 3JWJA 4HNGA 1KDYA 1SBYA 1PW5A 4LBWA 3CKYA 3ONWA 1BS1A 1RR6A 3AUTA 2HZBA 2I62A 2IITA 2WD7B 3G9UA 5BW4A 2YVAA 4RMGA 1NN1A 5TNXA 1N6OA 1ABFA 3ETLA 4HDMB 3RVMA 3NC1C 3WP1B 4EYGA 1R66A 1JG2A 4Y6RA 3ILVA 2G07A 2C03A 4H18A 4WOPA 1T9ZA 1VL5A 2JLZA 3DKVA 1VL1A 1XRNA 1XMVA 1IM8A 3ASZA 1LLFA 5KDOA 3CVJA 4P34A 1DQRA 3FMVA 3VOBA 2J6HA 2Q4TA 5FEMA 3DE0X 5IC5A 2Y67A 1UBMS 2XMDA 2OEPA 1JLSA 4MYHA 1G0NA 3U37A 1XLVA 1A27A 3SHVA 2PRKA 3AF6A 4PC1A 4RFSA 5EWMB 2F7SA 2AK3A 2BV3A 3A3PA 3CRRA 4HG2A 4U39A 1W85A 1UPFA 2ILVA 2IZ7A 1AB6A 3ISTA 3OJWA 3PXCX 4Z5XA 4FLEA 4NJMA 5ITZB 5CT6A 2J9YB 4NMHA 1VL8A 1C9KA 1WLSA 2IPAB 3S1AB 1IPHA 3JS5A 3T3IA 3T3OA 2OHVA 3RUDA 3ZZMA 5CLQA 4EG5A 4JC8A 1P9LA 2PA0A 3CX4A 3AHCA 1FP1D 3PE6A 3V34A 3DZCA 1HE3A 2WSSD 3ESCA 4EDHA 5BWNA 1UBLS 1SRQA 3OY7A 3WWOA 1BOOA 5ESWA 1QP4A 1OPXA 4S2EA 4GGPA 2DJ5A 1Y6GA 4PICA 1UXJA 2CXHA 2BJHA 1VGRA 5LPNA 1NVWQ 2K5UA 2VP6A 3U09A 1A7JA 4V1CB 1BMFA 1QRTA 4GE0A 2ZRFA 3ACCA 2Y0CA 4B76A 2NPOA 4RCYA 1TVCA 5HXAA 1M6YA 3C3WA 4BMZA 1TAHA 1E6LA 2HSJA 2YJ4A 4HTFA 1R64A 3QHAA 5JY6A 1KYTA 3E35A 3EUFA 4IGAA 4M37A 3TW8A 1TNDA 1M2OB 2WB4A 1UMCA 2XXBA 4FINA 3RS4A 3VH4A 4UBLA 4YUYA 1YU9A 3I92A 1NLYA 2UYCA 1M7HA 1SUFA 2FZ4A 4OXKA 4XCXA 1PV4A 3OF2A 5JDIA 1JFFA 3DQPA 1UQRA 1T1RA 3FNEA 4PLWA 3JD4A 2VHJA 4OLAA 3LW7A 1OGJA 1XIVA 3AFGA 3FSGD 5EJ4A 2ASVA 4Q9HA 5AHKA 1PJCA 4EITA 1JDVA 1Z6PA 1ULZA 4M8SA 1Q21A 3Q2OA 4HDCA 4PAQA 1AK1A 2JIMA 4GLJA 5FRDA 3DP7A 1AB5A 2PUHA 3MSCA 1NR7A 4P7BA 4Y2XA 1SXJE 4LC1A 2JFHA 2MJLA 5CVDA 1TAGA 4L8WB 5TB5A 3RS2A 1WDMA 3G2JA 5B7NA 3CVXA 3VYVA 2ZJBA 1JQAA 2ZXEA 4CMEC 5ILGA 1WXIA 2MSEB 2RGWA 4AF7A 4HNHA 4MWBA 4BN0A 4DCMA 1FP7A 1M6HA 5HM8A 3HADA 1PGNA 3U1TA 4PHHA 1K6EA 3VHRA 3MWEA 4J1SA 1PJTA 2QRNA 1R0SA 3MXOA 3BGWA 1X80A 4J0EA 4KJZA 4O4JA 4L4UA 3FKSA 4WERA 5DM2A 4RESA 4CFYA 1O9HA 1IXYA 4OG2A 1MP0A 1NNLA 4NXNB 4G1MB 2I0FA 4KQKA 4E0BA 1ZJZA 2QRLA 2R8YA 3IDFA 1UDAA 3LZ6A 1OMOA 2BKEA 3SQOA 4GZ6A 1H85A 1HUQA 3QVVA 3UIEA 4BJ5A 3IV9A 3EW9A 3ENKA 2H7XA 3H3FA 1EM6A 3RD5A 5HCUA 4BJHB 4N5HX 2HIAA 2JCSA 2WMDA 3CUSA 1Y1TA 1U65A 3NXSA 3JAKA 1PLKA 3ACDA 3C3MA 1I01A 1EJ0A 1N2HA 3INTA 2VH2A 3L0DA 4B48A 3U44A 2C97A 1P19A 4OXXA 1IQRA 2BFDB 2ZTVA 4IL5A 1DGQA 1NIPA 3IQGX 5HKAA 3RYFB 4AUMA 4PN3A 3F7MA 1NVVQ 1G8JA 2VDKB 4JI3B 2UXBB 2PL5A 3RWMB 2QRVA 4NZNA 1P4AA 4QUJA 4D8WA 4MHSA 4R05A 3S4YA 1K97A 5CVVA 1WHTB 3AF0A 3REOA 4B33A 2JJQA 2RC5A 1NI4B 4PINA 5DWDA 3HJGA 3JWIA 3O4HA 2NZ8A 3RRYA 4DLNA 2JK0A 4ZYLA 3GL9A 5DNWA 5ARDA 3UT5B 4ZV4A 5BWOA 5LP6C 1IBCA 1A5TA 5CK5A 1AKRA 3HUUA 1GQRA 3E9NA 3AGPA 2GCEA 4I46A 4PEVA 3G1UA 1YFKA 1Y33E 3M5WA 1SQ5A 4MP3A 4S1OA 3ZS9A 1F2TB 4MVJP 2OA0A 3N58A 3PQ2A 1YR2A 3OG9A 1JAYA 2Z2XA 3QZUA 4LSZA 4RA9A 3LFTA 4LF6B 3G85A 2RI1A 4KP7A 2IP4A 1G2OA 1RRVA 4DY4A 2QTCA 1H23A 3ZXYA 2LGJA 2BKXA 3RGWS 3VVCA 5A6VA 3KPWA 2W7TA 4NEHB 4TS1A 4P80A 4REOA 1T6NA 4HQRA 4B4WA 1CJTC 1UKEA 4B46A 4KI0A 2P6UA 3FLEA 2OM2A 4G8JA 3ZWKA 4N4AA 4DXAA 1O6ZA 3WRXA 5A7FA 4YJGA 5K05A 4NG4A 2ZAOA 4PNHA 5ALNA 3CF4G 4ZTUB 3PWSA 4ZHQB 4EG7A 5KU7A 4YLEA 1ZK2A 5DTMA 4URFA 4CCWA 5A06A 3GRCA 3B60A 2H0QA 4QFCA 2IEIA 2QSJA 2XA9A 5HJ5A 4JT2A 5JQWA 4BRWA 5DLPA 2P0EA 2Q5QA 2BZ0A 3HCRA 1L1QA 5BUSA 4R1NA 4D3SA 2O0MA 1HG1A 4OJQA 4ILEA 2DULA 4AF8A 3PZBA 4WA8A 3IHTA 2R11A 4F92B 4G5RA 3MJ4A 1HQCA 3IOEA 1ECJA 2CW5A 2XTZA 3EMKA 3VOTA 5EJFA 1UOQA 3W6PA 4FB5A 4ESVA 4QYMA 5E4TA 4Q7KA 2CJFA 3S2YA 1SRRA 2BR3A 1YDWA 3N1UA 1JDBB 1QG2A 3QA3E 3WK7A 1J23A 5CURA 3COYA 3LK7A 3WWCA 4US0R 2D8MA 2PTHA 1A9XA 2WJJA 2IF0A 2XVYA 4JK3A 1DQPA 2M9MA 1N9KA 5FFMA 2J0VA 3PFNA 3ANMA 4MR7A 4S1TA 5JISA 1Y98A 1B8UA 2BISA 2OV4A 2VZLA 3AERB 3GJQA 3I37X 3MWJA 4QTUB 1TA0A 2IUYA 3F5SA 3LOUA 3PFHA 5EHZA 2G0TA 4JQSA 4UPVA 3WX0A 1AXRA 1ZOSA 1RMQA 1QF7A 2IYFA 2P2ZA 3MPOA 1CVLA 2YRXA 4J4TA 4MUBA 5ENVA 2J3EA 2QHXA 3T5BA 2PUFA 5FNZA 3KJIA 3LQ1A 1OHHD 1GPUA 3X1XA 4F9FA 2OG2A 10MHA 2JASA 2VUHB 1TJNA 2CF6A 4DB2A 3RIMA 1FXWA 1V16A 4LXYA 4NJEB 5T4EA 5IK2D 3RRZA 1V8PA 3IBYA 1WVGA 3MBOA 3FZYA 4PRYA 2V4MA 4ZODA 3OAAA 3OOJA 5KBYA 4RAOA 1HOXA 2CFSA 2YW9A 1YU6A 2CB0A 2QZSA 2IY9A 4CG1A 4MCJA 2FW7A 1ETUA 3L8DA 4B7CA 4UHCA 2XB2A 4NDNE 1G3UA 2DKFA 2FUKA 3S81A 3L18A 2X13A 1NT4A 4MPJA 4HADA 2QZ9A 4LJYA 4QUGA 5HFAA 4BV3A 2NO5A 2GPTA 1R9MA 5JAIA 1OYVA 1V1JA 3SE0A 1P4HA 2VDMB 1A9QA 1PU2A 4JGIA 3OTOB 1JHDA 1USGA 3QTBA 2IOFA 3HO8A 3RLFA 3LBYA 1U8EA 3TAHA 3PTLA 3EK2A 4JI8B 4QUDA 4X6UA 3N0TA 1YZTA 4QOHA 4YEDA 2XMBA 1HSOA 1J5EB 5I7OA 5HZHA 2FP3A 3M6VA 3DBHA 2C2YA 3FX2A 2EERA 4JIMA 4M7WA 4F6RB 1YRAA 2N0SA 1OGYA 3O21A 4UEJA 5LJIA 4UQPA 3J81A 3JQGB 2WFZA 1WUJS 2X22A 5AI9A 3WLIA 2JC3A 1G6OA 4MYUA 2VF7A 3V55A 1RQ7A 4WXPA 3LP6A 1NF3A 1E3TA 2IEGA 2RB4A 4J29A 2CXPA 2EBHX 4PZYA 5AKKA 3BJMA 4INZA 4U6QA 1LC3A 5JO9A 5T4BA 3T9AA 3DZKA 1KPHA 1VLVA 2FPLA 2GEJA 3VVMA 5C37A 1BGXT 4PF1A 1UPPI 1T3SA 5H8WA 1B6GA 2R751 3RU3A 3OOWA 3EFBA 4JCCA 4MRVA 5KREA 3OD1A 4LJ6A 4CN8A 4ZCLA 5KUTA 2H1IA 4RZHA 4X1YB 4FN5A 3ZCQA 3JW8A 4MRPA 3P5BA 3TNLA 4CN9A 3EARA 1Z17A 4J0IA 3K4PA 5GWXA 4BLRA 4ZJZA 2BMJA 2FPIA 3GOQA 1C8KA 1USUA 2V68I 4NENB 4Z7JA 3TNJA 2VOEA 2QN3A 4TZ0A 4DC1A 4D41A 3DA8A 4ZI3A 3CHYA 5T64A 1K86A 3EQ6A 5JR3A 3GPCA 1L5YA 1MEOA 2AJBA 1MV5A 3H2IA 3KQSA 2ETVA 3HCDA 4LXGA 1YA6A 3GJTA 4B3FX 2I4OA 4YMUA 5JAHA 1AJEA 5EJ9A 4OHYA 4GICA 4YASA 1YWGO 2A33A 2ODPA 2NV2B 3OHSX 4AG3A 3E3OA 1IR1S 4CDRA 4XM2A 1K6MA 2D5BA 1F2DA 1VPEA 2EKLA 1BCSA 1SZCA 1TECE 4JOCA 3D8TA 1KEEA 5FQNA 4WKPA 5J2TB 2CNNA 3GXOA 4FILA 2FZCA 3BE8A 2V7EA 2RAVA 1IB6A 2ESRA 5EIOA 4GOJA 1W4LA 1PUXA 2CVZA 2GZRA 4FHCA 5FTJA 1B76A 5IFLA 4J43A 5DI9A 1YK0A 2UAGA 3SNKA 3O91A 1KXZA 1DKMA 3P9NA 4JR0A 5EPOA 1AQIA 1NZFA 2CXSA 3RT9A 3DF9A 4LHEA 5BSVA 3FLMA 4DV2B 1AUQA 4REQA 1OF1A 5LA6F 1E2KA 4OP3A 3OQIB 1T5SA 1RLDS 4FYIA 2A5JA 2P2DA 2Q9AA 1DSSG 2VP3A 3LECA 1WY7A 3ON5A 4II2A 5KJEA 3EG9A 4YCJA 3VV2A 5HZMA 5BV2P 1ANKA 4IWXA 2PN1A 1G5RA 4BV8A 5KQMA 1JQ5A 3ROKA 1POXA 2BONA 3CZPA 3MJTA 1TU3A 3UJDA 1SCQA 3X1ZA 4BKPA 3Q12A 5A04A 3INYA 2CBGA 1H2HA 1M2VA 5JSUA 4R31A 3C1OA 2G76A 2X1MA 3DV9A 3UWMA 2HDNB 4QYXA 2GZDA 2AKYA 4W8GA 4XVQA 5BQFA 2FZLA 5F2NA 2IYXA 5FOTA 7MDHA 1M1XB 2FLWA 1XXHE 4OI4A 2W4MA 3T12A 5A4JA 1UOEA 2X19A 4EAAA 2E7ZA 3HCOA 1L4UA 4PG5A 4RLSA 3MJCA 5EXSA 5B30A 1SC3A 1YO6A 3EXG1 3MCUA 7AT1A 2YNMA 1BRTA 3LL4A 5L4NA 3NBYC 2B92A 2OD7A 2PH1A 3CH7A 5L6MB 4HXYA 4YT8A 1H2XA 4ZAVA 2PT6A 3TQQA 4OXIA 4CKEB 2OT3B 1SVOA 1US8A 3C5CA 4EHAA 3BZWA 3JQBA 2CVFA 4J2TA 2QE7A 4DG8A 4JGGA 1QCDA 2PKQP 4O4HF 2YMMA 1BA3A 4LRYA 2HRBA 4P93A 5K4AA 2ES4A 5DRTA 4XASA 2J9XB 4G97A 4RKFA 4XAQA 3ZDEA 5TQJA 3WVNA 2F8SA 3HGQA 2RJOA 1SNYA 3AR5A 3EVNA 3F6CA 2RHRA 3RS9A 3NC0C 3TSWA 1W34A 1Y7LA 2PZKA 1G5IA 4RVHA 1KAOA 1ZBQA 5CVEA 4ER6A 1B42A 2QW0X 3O82A 3PFKA 3QBJA 2GSWA 4JB3A 4BNNA 4BWGA 2EQ5A 3QV2A 3OCYA 2VF5X 3EXIB 4E46A 4PANA 4XRGA 4UEKA 2HJSA 2I2FA 1MQSA 2E55A 2KLHA 2W90A 2R87A 3MS4A 4ER7A 7REQB 2CZQA 4MR8A 2FE4A 3CR3C 1DC8A 2FVYA 2XD9A 5DTQA 1RLJA 1NJ1A 5I7VA 5AW7A 1XQYA 2IPOA 3QE0A 4KX3A 2EJWA 1LK5A 1QM5A 1E5DA 3IAS6 4LE2A 4Q7MB 1F06A 1T2UA 1V9CA 4F3TA 5G2OA 2WWRA 4KAXA 5IAEA 5KNDA 1ZI8A 2QXYA 2VZ0A 1Z38A 2Q99A 3DDOA 4H7PA 1ZLYA 3SK0A 4CM8B 1HL7A 4EIWA 1Y9AA 3JVDA 1VIAA 3PUJA 3V1LA 4Y98A 3O7WA 3PEYA 4MAMA 5FFNA 1Q7CA 1Y6RA 2BMEA 2QRVB 3FFWA 3QFCA 2CNBA 3R1IA 3ROGA 5JZOA 1QFMA 4BUJA 1KI7A 1RADA 3EUAA 1ADYA 3GFFA 3ONEA 4DF3A 1Z36A 2BGNA 4QOIA 4EWLA 1F6DA 2HT1A 1DADA 1P31A 1H5QA 3DQQA 4EHFA 4RJIA 1NHWA 4WOJA 1AKUA 1RSCI 1FNMA 2EWMA 2VUIB 4D1YA 4F8YA 2XLBA 2VKTA 2IHNA 3BFJA 1KR5A 3EZLA 1LBSA 3PPWA 2CHQA 3DULA 3PC3A 4KCGA 2UUAB 1UINA 3BK2A 3O3OB 3R9WA 2C4TA 3DEAA 1M2FA 5B3AA 1EHCA 1LK7A 3G17A 3FPBA 4WHMA 1KO1A 5P8WA 3R24A 3VZDA 5D3MA 2ZJ1A 3EYWA 1MG5A 5I51A 5MFPA 2VZ9A 2C9ZA 4CF5A 5EEGA 4HYYA 1KI1A 2C88A 3G49A 4MDYA 1BG6A 2XMRA 1KAQA 1SJ9A 3OAAD 1RQ2A 2V7XA 4LE1A 4UHJA 3SHWA 5BN3A 1I3NA 1P1JA 3BSSA 3ZHTA 1C4WA 1UEIA 2R48A 1AUVA 4K9SA 4LJRA 2PNFA 1VLQA 3HXTA 2IZZA 4ISBA 4KH0A 3H2HA 1O95A 4XFJA 5C3UA 2I99A 2KWIA 1EXVA 1DT5A 1JG4A 1ZDMA 3JRWA 3KSUA 5IAGA 5IN5A 2FEKA 3LPMA 3A9SA 4EUSA 3WOVA 1XLWA 2JIDA 1S7GA 2NT3A 6GPBA 2Q45A 4O08A 4NY1A 5B4TA 3HC7A 1XNJA 4J0GA 3GJ3A 2ZR9A 1Z12A 3P9RA 1T5DX 1KPIA 3K70D 2EIXA 2LVBA 1HYEA 1VIMA 5DHUA 3H1EA 1MTZA 2Q1SA 2VAVA 4RD0A 1Y5MA 3EIHA 3RT7A 4EBBA 3ZEAA 3AEUB 2NAFA 4YK7A 3BCUA 1NU6A 3BXEA 2XUQA 1NQOA 1UZNA 4M88A 2AYYA 4FZJA 4PPGA 1UQUA 1DKOA 2JIRA 1LWOA 3HKBA 4HNUA 1JE0A 4AS3A 3FWNA 3V4FA 2XA2A 3AY3A 3NR2A 3U48A 3CF4A 3GR6A 3CLTC 3NTLA 4ZANA 3WICA 2DHEA 4HWRA 1GNLA 2JAUA 2Y1KA 1QQTA 4MMXB 1E8DA 1G6HA 4JUCA 1MUUA 2HA3A 3GYBA 1GCOA 1DJQA 1NAIA 3LNTA 5DBIA 3UWPA 3FUXA 3RU2A 1A5SB 3KPUA 2GK3A 4IP0A 1EX7A 3VO8A 3VPHA 2ZQYA 1L5NA 5L3QB 1ENOA 2GAIA 1TU0A 1NBHA 2YASA 5C8ZA 1QB8A 1TYAE 5TQ0B 1YR1A 2RSLA 5LOVB 4K9QA 1CX9B 2D54A 4AB1A 2HZ7A 1GUYA 3AI7A 4A73A 3E1GA 1BHO1 3ZCVA 5CFRA 3BHJA 3JX9A 4OHWA 5C1DA 4EMBA 1F14A 3BWMA 3TKYA 4Z9AA 5EJEA 5K3SA 1VSVA 4W9NC 2ZUDA 3MRSA 3NYRA 4IIEA 4AYWA 1IXSB 2GZHA 4RNDB 4UZFA 5JATA 1EWVA 1FVXA 1RWQA 1JHYA 4QUHA 2P0YA 1LBHA 4JX9A 4JH0A 4QYIA 4CETA 2JFWA 4P36A 1SBQA 2P6PA 1Z8NA 1LDEA 4YAUA 1QG6A 4LX8A 3WLMA 2OWEA 5T4HA 1U11A 3CKKA 3Q7SA 3E03A 1YS1X 1Y1SA 1N92A 4JYCA 1W4AA 3RAGA 1O08A 4I9UA 3THSA 7MHTA 5LN1A 1ISFA 3FCYA 4P0QB 1WV0A 4FHEA 2JKVA 2GA9A 4YP0A 3WL6A 2GGSA 3RVNA 3ENWA 3G7NA 1EQ2A 2WABA 1BFUA 3NHLA 1KBOA 2ECQA 3FGPA 4FOLA 4FBLA 1QGAA 2AEEA 2QYTA 3QUQA 3UICA 3K72B 1UWVA 5AXBA 2FW6A 4U7WA 3C97A 3OQIA 3RSHA 5JMWA 4OIMA 1J24A 1L1EA 2DAPA 3VISA 4YAKA 2QW8A 5HZKA 4POOA 1CUWA 1B00A 721PA 3HU1A 1Y3DE 2H8KA 1S8FA 1U8FO 1JPJA 3CZMA 4PR0A 4S04A 1G20B 4GVLA 2W2XA 1A04A 2A1IA 3ZXUB 1B2RA 2XE8A 1P2VA 2JBHA 2PQ2A 1WXHA 3FR8A 4FVTA 1ZL2A 4G5FA 2NQ8A 3ST7A 4BQIA 2EKPA 1OXSC 1PG5A 3ND9A 1RRCA 4KW7A 3ANLA 1II0A 4HFNA 4A82A 1Q0PA 3PHIA 3R0JA 2QJTA 4FYYA 1IK6A 2I34A 2PRIA 5GM2A 1JEYB 1DO0A 4BY9E 2V58A 3WNCA 3HWWA 3TRKA 4DDKA 3GQBB 4HN2A 3A2MA 1I2AA 1N1GA 3LOPA 1CQJB 1HE4A 3EC7A 4JBGA 4JZYA 5HGJA 4R2MA 4UU1A 1GNRA 1LGYA 2C2KA 2C7BA 2ECKA 2J3HA 3KJGA 3O4JA 5JU6A 1FYVA 3GNTA 4YHBA 5TEWA 3AVTA 2UXDB 1U2PA 4J76A 4X8MA 3HXQA 2O2XA 5DLDA 1RQNA 4C30A 4DLLA 4R7TA 2IRWA 3PJGA 4OUKX 3PUWA 4R54A 3LX8A 2H16A 3NH9A 3P94A 5ITSA 1H93A 3DBVO 3Q98A 4UUAA 4L7VA 3T4EA 1G9TA