1MZZA

Crystal structure of mutant (m182t)of nitrite reductase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
334
structure length
334
Chain Sequence
b'VDLSNLPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVSGTAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVAVMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGTAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPVGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title The High resolution Crystal Structures of Nitrite Reductase and its mutant Met182Thr from Rhodobacter Sphaeroides Reveal a Gating Mechanism for the Electron Transfer to the Type 1 Copper Center
rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 87
structure length 334
sequence length 334
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1mzzA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1mzzA02
4Q89A 1PNCA 1F56A 2N0MA 1BXUA 5AZUA 2DY2A 4E9YA 4M3HA 4UF7C 1JERA 3JTBA 3QJRB 3WKPA 4YSDA 1PCSA 2UX7A 2IAAC 1XMEB 3OMNB 1E5ZA 5B7FA 2E86A 5TK4A 1PY0A 5I26A 2P80D 2IDFA 1KCWA 3FU9A 1CC3A 1GS6X 1JZJA 3IBOA 1GY1A 2PP8A 4GXFA 7PAZA 3AG1B 2AZUA 1FFTB 4DP8X 2XYBA 1J9SA 2WO2B 1DZ0A 2XXGA 2EIJB 1ZDSA 1OE3A 2DWTA 4PAZA 5I6LA 4F7KA 3NP3A 3ZX1A 1X9UA 3T6ZA 3NJJA 4KO9A 2EIKB 3N55A 3S3CB 2IH8A 4RH4A 3GYRA 1TEGA 4W1TA 3TU6A 2YAOA 3NJMA 1V10A 1CUOA 4KO6A 4GP5B 3FSWA 3FT0A 5F7BA 4A68A 4G7SB 1NICA 3AW5A 4BK5C 4DP1X 1DYZA 4KNSA 1L9OA 1KBWA 8PAZA 5I6KA 1WAEA 4QLWA 1BXAA 2XXFA 4A2HA 1IBZA 1AS7A 1ZIAA 2GSMB 2YAFA 5FC9A 1A4AA 3D12B 2FQFA 4W9ZA 1PLCA 4M4RB 4YSCA 3JT2A 1JXFA 4F2FA 2ZOOA 4G7QB 2HLEB 2IWFA 1PAZA 4Q8BA 2QDWA 6PCYA 2GI0A 3UABA 2XV0A 1MZZA 5D4IA 4YVNA 1OV8A 2TSAA 3X1EA 3WIAA 2FQGA 4JKNA 4KNUA 3G5WA 2AFNA 1HAWA 1PLAA 1BQKA 1NTDA 3UAAA 5B1JC 1FWXA 4ENZA 4N4YB 4A2GA 1RZQA 2IDTA 3TBCA 3KW7A 4G7RB 3QPKA 1M56B 3ZDWA 5B7MA 1JXGA 1ZV2A 3CDZB 2GC4C 1OOWA 4F2EA 1AOZA 2HZHA 2BP0B 2VMJA 4GP8B 3IEAA 1M9WA 2J56A 2YAQA 1T5KA 2VSMB 5PAZA 2PP7A 3EH5B 5I5IA 1CYWA 2XU9A 1AZUA 4YSSA 2FNWA 1JVLA 1NIBA 3PCYA 3CG8A 1NIEA 1R1CA 1M57B 1AS6A 1L9SA 4HCGA 3PAUA 2Q9OA 1L9TA 2QT6A 2RACA 3FSZA 4E9QA 5A7EA 3QJTB 1URIA 3DKHA 2WO3B 1J9QA 1SNRA 4DP4X 3S8FB 2BWIA 4KOCA 2I7SA 4PCYA 3NJKA 3T6VA 3FU7A 1W6WA 5D4JA 4GY4A 5B1JA 3MX0B 1GS7A 3FSAA 4A66A 4BWTA 1J5CA 2FTAA 4BWUA 2PPCA 4AKQA 2HRGA 3PXLA 1IC0A 3ABGA 2J55A 4DP7X 1AZBA 1BQ5A 5EHFA 4E9WA 1OF0A 1N70A 2GHZA 1KDIA 2VM4A 3QQXA 1AR1B 1BXVA 1JZHA 1BAWA 2VSKB 1EZLA 2XX0A 3V9EA 5TK2A 4L0PB 3UACA 4A67A 3IN2A 1ILUA 3NSFA 2J5WA 3CVBA 1ZIBA 4NERA 2DWSA 1L9QA 2VW7A 4P5SA 2P80A 3V9CA 2IDSA 3SBPA 3H4FA 4TXVB 2YQBA 2GIMA 1AG6A 1NPJA 1AZCA 3ASOB 2YAHA 4G70B 3PAVA 3S3DB 4JHUA 2DV6A 4NAJA 5F7AA 2BW5A 3FPXA 3AY2A 4HHWA 3AG4B 3X2QB 3KW8A 3H56A 2TSBA 2VN3A 5I28A 3DTUB 3PLYA 1VLXA 4G72B 3QJUB 1SHXA 3FPYA 2JXMA 3EHBB 3WKQA 2H5UA 3FQ1A 1QHQA 1BYOA 4HAKA 1CYXA 4BXSV 3T9WA 2B3IA 3NJNA 4YSOA 3OQRA 1AZNA 1WA1X 2OCCB 1V55B 1PF3A 1QNIA 4YSUA 2CALA 5B1BB 1ADWA 1GSKA 1IKOP 3FSVA 4A2FA 1PZCA 1RZPA 1WS7A 1EHKB 5I6NA 4DPAX 2PCYA 2PLTA 1JZFA 3T6WA 2CBPA 4E9SA 3IE9A 2Y1AA 3ABKB 1A65A 3WI9A 2IWEA 1KV7A 2YAMA 1JZIA 1W6LA 3X1BA 1IUZA 1NWOA 2IH9A 2VW6A 3DIVA 5D4HA 2YARA 3CVCA 3OMAB 1OCCB 4HCIA 1KCBA 1SF3A 3NJFA 4BDVA 3S8GB 2BP8A 2XV3A 1V54B 1XB3A 4DPCX 5B1AB 1L9RA 1N68A 1ASPA 3N2JA 3BQVA 3UADA 2XLLA 1ZPUA 2PPEA 1SF5A 2QDVA 4YSAA 2FWLB 1RCYA 4HZ1A 3NT0A 1I53A 4AI7A 2ZXWB 1NDTA 4KO5A 1KGYE 2XWZA 3NSDA 1AAJA 1ETJA 2YAEA 2UXTA 1GR7A 2W88A 5B3SB 1TU2A 3X1FA 4HIPA 1ASOA 2MRYA 2HX8A 3H4HA 4DP5X 1NZRA 2Q5BA 2GBAA 4YSRA 1JXDA 3NJLA 1SFHA 1AG0A 1AQ8A 2FT7A 2R7EA 4KO7A 3AZUA 3HB3B 1A4BA 5I6MA 3SQRA 1TKWA 3AG3B 3NP4A 4HALA 2GC7C 1XB8A 3TA4D 2DYRB 1J9RA 6PAZA 2EINB 4YL4A 1GS8A 3ERXA 5PCYA 4FA7B 1L9PA 1SDDA 4P5RA 4AKPA 3WNJA 2BZ7A 3WNIA 4DP6X 2PPAA 3FU7B 3X1NA 4E9VA 1JZGA 1ET5A 5AFAA 2FJSA 3FU8A 5B1KA 4CSPA 1JVOA 2YAPA 1KDJA 1A8ZA 3OM3B 2JFCA 1A4CA 3FYIB 3RYMA 4A2DA 3NJHA 2FQEA 2OJ1A 3SBQA 2IDUA 2XVBA 3PAZA 3QJSB 2Y69B 3BVDB 1E67A 1SJMA 2X88A 4HCFA 4ZK8A 2EIMB 2XX1A 2YXWA 3OMIB 1A3ZA 4N8UA 3TBBA 4WKXA 1NIFA 3HEIB 4K9JA 3ZIYA 2CUAA 5I6PA 3UGEA 3TASA 4A2EA 2JKWA 3T71A 1AS8A 5I5JA 3NJIA 4DPBX 5E9NA 4KNTA 4UANA 1BEXA 2A3TA 1BYPA 4WTQA 3FS9A 3U25A 3AG2B 1OE1A 1KYAA 4HHGA 1YLBB 1E30A 3QJVB 2CCWA 1AZRA 2H3XC 1CURA 2ZONA 1AIZA 1JOIA 1KBVA 1TEFA 2IWKA 1SHWA 1E65A 1IBYA 4QKTA 3WG7B 2I7OA 2EILB 2BO0A 1HAUA 2UXVA 1XB6A 1ID2A 1NWPA 7PCYA 3GXUB 1PMYA 5LDUA 1FA4A 4YVUA 2BZCA 5ANHA 2PP9A 4E9XA 2LLNA 2CAKA 1J9TA 3NJGA 3S3BB 3FYEB 3ABMB 1OCOB 2HX7A 3GDCA 2BHFA 2B08A 1UATA 2DYSB 1NIAA 2NRDA 1MDAA 1OCZB 2VW4A 4DP0X 2FQDA 3EF4A 4YSPA 4GP4B 1HFUA 3NSCA 1GYCA 1GY2A 1OE2A 1ET7A 1WS8A 2QPDB 1X9RA 1QLEB 4BXVA 2X87A 1PNDA 2QPEB 3CVDA 2UXFA 2PPDA 1NPNA 2YXVA 4DP9X 1BQRA 1RKRA 2AZAA 1NIDA 2GB2A 4E9RA 3OD3A 3CDZA 2FT6A 3T6XA 1AANA 4BDVB 4YSTA 4E9TA 2H47C 3QJQB 2BP0A 2UXGA 9PCYA 4AKOA 2HXAA 2BP8B 1W8EA 1ILSA 3MBWB 2W8CA 4DP2X 4AX3A 4CSZA 2BW4A 1ASQA 2J57A 5I6OA 1AACA 3EH4B 2ZWNA 1E5YA 1MG2C 5IY5B 1PZBA 3L45A 3NSYA 1NINA 1SFDA 1ZDQA 2I85A 3PPSA 2HRHA 2IDQA 2PPFA 4FAAB 1J5DA 2OV0A 1OCRB 4YSQA 1WA0X 2FT8A 1WA2X 2CJ3A 2MTAA 4EF3A 1GW0A 4UAHA 3FQYA 5AKRA 3X1GA 2HX9A 4BWWA 4G71B 2AVFA 2R7EB 2UX6A 4AZUA 2WSDA 1MZYA 3ZBMA 1PLBA 4NB7A 2VM3A 1ET8A 3C75A 3FQ2A 3EH3B 1B3IA 4MFHA 3CZUB 4YSEA 2BWDA 1MG3C 3IN0A 4KOBA 1SDDB 2XV2A 5B7EA 4JHVA 2PCFA 3NYKA 4GYBA 5I5MA 3UAEA 2AANA 1JZEA 3ABLB 3SBRA 1PZAA 2XUWA 4X4KA 3ASNB
chains in the Genus database with same CATH superfamily
2VDKH 4AV4A 5HI5C 3PJLA 4UM8A 2HN7B 2OTWA 3ARDD 2IQ9L 4AW7A 1CFSA 1AO7A 1BQHG 2YA0A 2ZSVB 1UADC 5DZNA 3GHEH 4NQXA 1NJ9B 2J1ZA 4PVLA 3N1MC 2A74C 3OX8A 5B7FA 1E5ZA 1IAKA 2CKBA 3WCYA 5CS7A 3EYVA 1QPKA 5E00A 2IBZX 5ITFB 4JPWH 4OR1A 2I60H 4OD2A 5C0AE 1CJYA 4ZPVA 4KKZA 4G6KL 4IDJL 4NPYB 5I0VA 1CF1A 3DRQB 4JFDB 2WXNA 4DKFL 4Y9FA 1BBDL 4YBLC 1FQ9C 1FC1A 3JV6A 3OSVA 4UU9A 1KACB 3GSWA 3OAZH 1NKRA 1QD0A 4AE0A 5DD6A 2EZ0C 2ICWA 4HIIA 3MV7D 2LTQB 3W0WD 1P5UC 5FIEA 3BAYA 1A6VL 4ZMXA 2ENSA 4JRYB 4OM0H 1GAFH 3WS6A 3GYRA 1IAIH 3JT0A 5MENB 1QMUA 3TU6A 2HLAB 4OV6F 2W0FB 4NHUA 5J3HD 3UPCA 2A9ML 4EUPB 2Z1KA 4UAOC 4MJ5B 2Y4SA 2OW7A 3VMPA 1TZGH 3BUDA 3G5VB 4ZFQA 3ILDA 2OP4H 2VN4A 2DB8A 3LKNA 4MYWB 4OQ1A 2W0LA 3C8KA 3CDCA 3B1UA 3VU2A 5J6HB 3QUZD 4Z3IA 3D0LA 5F2FA 3Q2NA 1ZSDB 1A4AA 4YMPA 4JL2A 4BZ1A 3VXME 3P1VA 3POCA 2J1YA 5CJXA 5KVGE 3RGVB 4CU7A 2IAMC 4YSCA 3V5KB 5BUGA 3JT2A 4K7PX 4G6ML 4UWQB 2IPUK 1BVLB 2UYLB 4PJHF 5FYKE 4AQAB 3IGAA 3ULSB 2XQ0A 3K6SA 4HFUH 4YX2L 2VQTA 4FERA 4DO6A 4PWIA 1S8DA 4F91B 5LGHL 3ARTA 4JKNA 3ZT7A 4YXKL 1U3JA 1BHGA 1K2DA 5HI3D 3QZPA 5ENWB 3TA3C 5CBAA 1TETL 1VZHA 2P7TB 4ENZA 4N4YB 4K3EH 2C9XA 1XCQA 4MD0B 5E8EB 2E7LC 1BZ9B 1SMAA 2GK0A 3DGCR 4GAGH 3D2TA 4XMKL 1O7DE 3STZA 4OU3A 2WQUA 1QUNB 3HC4L 1RZFL 5CUSH 1M71B 3C5JB 4ZFZA 2AQ1A 2ILLA 4KQ4L 3MJ9A 3W37A 4E41D 2B1HH 1PZ5B 1HHIA 3MA9H 4P4KD 4U1JA 3M1BA 4ZAKA 1R3IH 5F3HA 3T65B 4I3SH 2H32A 3V6BR 4Z3EA 5AALA 4GAYA 5CIPA 4ABQA 1HH9B 4UUJB 5ILTL 5AKVA 3VD9A 2AAVA 2F15A 5AZEH 2QVFB 4KUCF 3II2A 4WNQA 1O9ZA 1RK7A 1RJLB 1KUMA 1GZPB 5E4AA 3TBVB 8FABA 1OB1A 5CM1A 2CQVA 1Q0YH 1YN6A 3SOTA 4ANXA 3PQYD 4OBRA 3EJRA 1XL4A 4KH2A 4WDIB 1GS7A 4K71C 3CN1A 2FWSA 1ADQL 1CLYL 3ZL4H 3TV3H 2AITA 4RNRB 4QY8A 4R7DA 1IC0A 2FE0A 3C8HA 4F9PC 3DGDA 4QF1A 1U33A 3QAZB 2R0LL 3KBEA 4GXUM 4X7SL 3F12A 1INDL 4OAWA 5C8JB 1VFOA 2WXJA 4BCZA 4FDWA 4LLWA 5DMKB 2Q7YA 2EECA 2AW2A 5D1XB 4J4PC 5ECJE 4JFDE 5C7ZA 2FYVA 3T04D 4A6YA 1L9QA 2P24A 3MLZL 1T5XB 2P5WE 4PP1C 4GMSH 4JHWL 3H4FA 3U7WL 4JJOA 5EOTA 4JO1L 5J11B 3L7FA 2YXFA 1S6NA 5IQMA 4MJ4A 1IT9H 2R69A 2VERN 3KLAA 4K5MA 3WTTA 1J1PL 2AJXL 5DEGB 3L9RA 1QZ1A 4PIRF 4NKIL 2ARJB 3H56A 2AJUH 2PO6D 4N8VA 2WUCH 2JTYA 5F8RC 3L3OA 5C86A 4GSDL 3AT8A 5T33L 2JELL 1IC5H 1WAAE 2HT2C 5JW4Q 3IU3A 2F5AH 3TIDB 1OSPL 2RIKA 2EIDA 2WKLA 4GRWH 3OF6D 1BZ7B 3NIFF 1IEAB 4O2EA 2EC9U 3EO9H 4OGQC 5ACZA 3MJ8A 2QKIC 4FQLL 1WA1X 5B4MD 4YWGH 1FVDA 1H19A 2ADIA 2ZCHH 4JO8A 5IROA 5IMMB 4D8PA 1AY1H 1USZA 1FCGA 4AYDC 3DV6A 4X8CA 5K9QI 3AU0A 1JZFA 1W15A 5C9JB 1L3NA 4WO0A 5EBWA 1DQQA 1YZZA 3BHBA 2IVFC 4WEMB 1UWEL 1IGCH 4HIJB 4BZ2L 1VFMA 3TESA 4O4YH 4HJ0C 4XCYB 4XOBA 1NC2D 3ARBA 5KS9E 2YEZA 1XR9A 5A2FA 3MRRB 5KJRH 3RIAF 1SEBA 1R5IB 3KL5A 2E3VA 2BDNL 1GYVA 1SY6H 1SF3A 3B7UX 3GXNA 1LXMA 2CDEA 4N0YL 1A5FH 4WGWB 5HSFA 4PLOB 5IQLA 3G04B 2R9HC 1M7UA 3OSKA 4ZI8A 1U8JB 3D1MC 3B1TA 3FB8A 2DJMA 3OHXA 4HHAB 4I18B 5EU5A 4G8EA 3OXSA 4J7RA 3DVNB 4W6WB 5I2IB 1A3LH 3GMQB 2PPEA 1RSFA 1SF5A 2QDVA 1LM8V 3HAEA 4OIIH 2Y0SA 4PMFA 1DE4A 5C0EB 2AJZA 5KSBE 4U6HA 1I53A 3MREB 1A4JB 4FG6D 1KGYE 4IRJC 4LNRB 1SN0A 3BPNC 1MCRA 2OMUB 4M8UA 2UXTA 3B9VA 4NKDA 4JR9H 4KK8C 4WWOA 5DRZB 3CUPA 3BYYA 2WB1A 3HE7C 1G7PA 3DMMB 5L4MA 4NUJA 2ARJQ 3V0GA 5EU3A 1D9KD 3E6HB 1OK0A 4PJ7A 5L2JB 5AAWA 2Z0UA 4ELMF 1DBJH 3TZVA 5IB4B 1V7MH 2IOMA 5FECA 4YL4A 4JQIH 1KCKA 3RVWD 2O5YH 1AHWB 5FKAB 5D7IF 1N3NB 5H2BA 1GZHC 2OJEA 5C08D 1SN5A 3C60D 4J3BA 2X4NB 3RKDC 3WEXB 4K3DH 1NBVL 3KBHE 3WTUA 4ONOA 2HN7A 5AFAA 4ENED 1PZDA 5L88H 4YXHL 3ZKXC 1A6ZB 2ZSVA 4EEEA 3NRQA 1NJ9A 4RVBA 4M1GL 2IH1B 3A6CH 3NJHA 4N24A 4P0DA 2H9GB 4Y4HB 5BOJA 3QJSB 3O6KH 3CZLA 5ITFA 2X0WA 1I7RB 2Y06H 4U3HA 1AHKA 2BY0A 4GKNB 5I6PA 4NUQA 4CKVX 4NPYA 3RA7H 4R7LA 1XF4B 2Y07H 3DRQA 4JFDA 4WTXA 3ZW3A 3HA0A 2LGNA 3WUWB 3SKMB 1N19A 2ZG1A 4NZRL 2JSFA 3VFUB 2X9WA 4L2LA 3R7QA 1SBSL 3BAEL 5IK3B 4D3CH 2EUZA 5CEYB 4JRYA 4WI6A 5ICXB 1KBVA 3VFOB 3N40F 2WW8A 1U8LB 5MENA 4YH6A 2HLAA 1FE8L 2GTZB 2W0FA 4Y4FB 3U1SL 1NL0H 1OO2A 1SLUA 5T3ZE 2P5ED 5I19H 4EUPA 4MJ5A 1XB6A 1BF8A 2F5BL 2KH2B 3G5VA 1WAAA 4OZHB 1ZSHA 5LDUA 4ZW3A 1BFVH 5E4EC 5ADPL 5J6HA 2EXWC 1GGTA 5F0LB 4AYID 3WGUB 4RDQG 4N8CH 3ZDXB 1ZSDA 4EI0A 1QPPA 4MXVF 1ZOXA 3RGVA 1XDTT 1T2QL 1IC1A 3V5KA 1ZE3H 1NCCL 1BVLA 2UYLA 4AQAA 1XGTB 4EMZA 3ULSA 3LQAL 1WLHA 4GP4B 1GYCA 1UOWA 2BNQD 3CSYB 4WIQA 1H15B 1DDTA 1AE6L 4AOFA 3CDYA 1MCOL 4P2RB 2ATPB 5SWSE 2NQDA 4DQOH 3BWAB 5BO1L 1Q94B 3C9NB 4P5TD 5ENWA 2QPEB 4UT7L 4WV1B 1WSST 4UT6L 4XVSH 1MJJB 2P7TA 4DW2H 2XN9E 3MACL 2K6WA 5E8EA 1BZ8A 1WP6A 4MD0A 1BZ9A 1DBKL 3I50H 2FT6A 2E7DA 3L2NA 1BIHA 2WIMA 3WN5C 1QUNA 1WT5C 3RDTC 5G4NA 1M71A 3C5JA 2J57A 1PZ5A 3CQPA 3T65A 1R4XA 2FLRT 4LRIC 1G0YR 2QELA 4LSPL 3HFMH 1WTGT 4XI5C 4HJEA 4K23H 3PPSA 1L4IA 3AAZB 1HH9A 3DOHA 4UUJA 2Y7QB 3SE3A 4PJXB 1J5DA 2E8YA 3WNLA 4HAGA 1B4JL 2Z1PA 2HRPH 3WIHH 4CL7A 1KPVB 2CO4A 1TT6A 4KKAC 1GZPA 1KOAA 3BMVA 5GGVY 3FQYA 4XP9L 3T0EC 3TBVA 4AL8H 3OLEA 2KDGA 4WDIA 2EEBA 1P5VB 2FEDC 2MH4A 5D1QC 1L6PA 3NZ8B 3T2NH 3ZBMA 4GAJH 4X5XB 3T2LA 3G6JF 1RMFH 1OAKL 2FBJH 2VM3A 4YHKH 2Y36L 3WUWG 2ICES 4RNRA 1ORSB 4NKMB 4HBQA 2LU3A 4NXSA 3PG2A 1YEIL 1QAWA 4LLAA 1PY4A 2C34A 1CK0H 5T1DH 4XO9A 5I6XB 3UAEA 4F58L 3KPRE 3S37L 3LZOA 3UO1L 2VE6B 5C8JA 4M5YL 1YMHB 2CPCA 5DMKA 1HN1A 3JV5A 5D1XA 1X7QB 2QQKH 1AMYA 2QV2A 1Z7JA 3R0MA 4JDTL 2BRRH 1T5XA 3WFBL 3O2DL 4X4MA 1CFMA 3ZKSD 1BAFL 3MLXH 3OAYK 3LPWA 4I1NB 4PCSA 3IFPB 5TK4A 1A6WL 3LKPB 4MQXC 2HMIC 4Y5YC 1PY0A 1MQ8A 1WK0A 5I26A 5JIIA 1VFUA 1HX0A 1RUKH 2BNRD 3GI8H 3IBOA 1DP0A 2OW6A 2ZUSA 2P1YA 4IEFB 4GXFA 4JFQB 4Q0XL 5DEGA 1FFTB 5CJ8A 2ARJA 3MLSH 2X2JA 1U4FA 4KHTH 1J9SA 2WSKA 3RZCC 1MCJA 1A7PH 1E4XI 1I7ZB 2EE6A 2G3NA 3D51A 1EZUA 1MQKL 1FGVL 1A1MB 3T2OA 1HHJB 3CN4A 4ODTL 4L0ZA 1HL8A 2OSXA 4MDJB 3U4KA 3TIDA 4IKJA 1MAML 3QJFB 4H5SB 4O2CB 1BZ7A 4RH4A 1IEAA 4NNPH 5HHXL 4IYKA 2H0FA 4HU2A 2VYRE 2CO1A 1J1XL 4KVPA 2K4WA 2ZOKB 4WI3A 1EDQA 5CD5D 2XA8H 2X89A 4MZ3A 4U1GB 4L3EE 4Y2NA 5IMMA 5BMFH 4PJDB 1R5WA 1JL8A 3HC3L 3T6QC 2DTMH 4UT9L 1AMXA 3VWKC 2XCMC 5DQJB 4QLWA 4JW3A 4W6YB 5DD1L 1NGZB 3FTSA 4KJQD 3SE4A 3X17A 4PJGB 4XCYA 2HRLA 4Z7QF 5GZND 1FSKC 5F0PB 3QG6B 5EF1A 2HLEB 4XP1H 3L54A 3MRRA 1HYSC 1UT1A 1VCAA 1MHEB 1R5IA 1EMTL 1HHHB 3V0IA 4ABVA 1YAZA 3VD4A 3CNKA 1MZZA 1Q72L 1KCSL 1SXSA 2ZG2A 3G04A 2FJHB 1U8JA 4HHAA 3QHZH 2APVA 3QULB 2FQGA 2PR4L 1ZVSB 4FJZA 3D4ZA 4I18A 2Y25A 2XZQH 3DVNA 5I2IA 3GMQA 3VAEA 1PLAA 2WMPB 2YN5A 1FG9C 1OAZH 3CV5A 3GRWA 4FXKB 5C0EA 5LLIC 5L0QB 1N10A 2QSTA 3GBNL 3MREA 3QH3A 1A4JA 1BMZA 5TDOB 4LNRA 1N9PA 2G3XA 3CMOL 4J3TA 3BDBA 3C09B 5CEZH 2OMUA 4GW1B 5FA4B 1WCBB 3PPEA 1TTAA 5DRZA 3BPLC 1IFRA 4JJ5B 4JBSA 3NJVA 4XH2B 2YA2A 4Z3HA 5I5IA 3FUJA 3DMMA 4AW4A 5DHEA 3ML9A 1YEWA 4QXGH 2YFNA 1NEPA 1KXQA 2XZAH 3E6HA 3JYCA 4OCMC 5L2JA 3ZTJG 1M1SA 5A6IA 3KXFB 2P5PA 3H7LA 2Q8AH 5IB4A 4KY2A 3CK0H 1OTTD 4YBHA 4KZEL 1AHWA 5E99L 3TX4A 2W1NA 5FKAA 3ZE0B 1PX3A 1N3NA 1JWSB 2VR7A 1IM9D 5JLZB 4JX0A 1D6EB 1A22B 5H37G 1F4XH 1MH5B 2OMBA 1YNLL 2BY1A 3MFGB 2X4NA 3QDJD 3LXBA 3WEXA 3BAJA 6TAAA 3GC3A 4X80L 3RY5A 4U1KB 4AGOA 4Q9QH 3N9GL 1A6ZA 2W07B 1MJUH 2XIIA 2YMXL 4CUCA 3B8YA 1QUPA 2IH1A 5CMAB 5A6LA 4Q14A 2H9GA 4Y4HA 2CJUH 1WVZA 4TOYH 1QKZL 4XMPL 3DNKA 5IREA 1ZLUH 5IB2B 1I7RA 1H3XA 4MB1A 1UA6L 4GKNA 3WMQA 1F2QA 5JOPE 5ICUA 5E56A 1XF4A 4WEUD 3SZ6A 2DEWX 4PV9B 3WUWA 4QRTB 5HYJB 1RZ7H 2F7PA 4E36A 1N5YL 3SKMA 1KZYA 2VW7A 2WANA 3GK8L 3NFSH 5GIRB 3WFDH 3VFUA 5E23A 3VI4F 3T4AB 1VHPA 3NK3A 5IK3A 4M7JH 3K8KA 5CEYA 1AG6A 1M6UA 3KPSE 3QCVL 5ICXA 2ENJA 2YAHA 4GXVL 3VFOA 2IGLA 4HWBA 2EQDA 1U8LA 3O6FD 1XCTB 2GTZA 4Y4FA 3VXUE 3PP4H 2J5LC 3MC0A 3D50A 4M6OL 3QFJB 3N42B 1QI3A 2E7MA 4UQDA 4XB3A 4OZHA 3C08L 5IHUL 4H8UA 1MCDA 4MD4B 5DD3H 1SHXA 2WZAA 4ZYKB 1ZANL 2XWJB 2D0GA 3I6SA 43C9B 3FQ1A 2GPZA 5CHNB 4HK0B 2ADFL 3NJNA 3O3UN 3LX9A 3QHFH 3APFA 3Q8EA 4DGYH 5EDSA 2ZOLB 5CR8A 1ADWA 4CRPA 2DEYX 1XGTA 4OCYH 1TR7A 4WFGD 5HP5A 1PZCA 4N1EA 4X5PA 3CSYA 1I9RL 3QRBA 1H15A 4MMYB 6FABL 3WFCH 3WDIA 2XJKA 2VDMB 5DVMA 1OT4A 4P2RA 2ATPA 3BSZL 3CMGA 3BWAA 1A65A 1Q94A 3C9NA 3G5ZB 3GIVB 3IJ7A 2P28B 1JZIA 3QIBC 1W6LA 4R4ND 4WV1A 4D9RD 5DJXB 1MJJA 4QTHA 3DO4A 2ZIDA 4YC2C 1HESA 4P59L 5JW4R 1HZHL 1KIPB 2YBGA 5FYKH 2CLZB 4GG6B 1JGIA 1P7KB 1VKXB 4XNXH 1T2JA 4RISL 4LLUB 3GZOA 4RFOL 4DPCX 1AGFB 1KC5L 5SX5H 2ZE0A 2OYKA 2VH5L 3VW3H 4I3GA 4CILA 1TCRB 4HKJB 1OGPA 4M8QB 2LHAA 2Z64C 5CEZD 3TURA 2JKXA 4J27A 5EU6E 5EEZA 4PEEA 5KBKA 1AGEB 3AAZA 3A6BL 1C8QA 5D6DC 2Y7QA 4QXVA 1PFOA 2ADGB 4PJXA 3U83A 3E3QE 3VG9B 4RAVB 5FO8B 3KMDA 4GKZB 2J1XA 1KPVA 2GBAA 4NQVB 1SM3H 3JVGA 3K6FA 2R8SL 5EC1B 3FTGB 1P5VA 1NUDA 3NZ8A 4X5XA 4HXAL 2DYRB 2PKDA 3TVMB 1COBA 5BZXA 1ORSA 2DM3A 2GI7A 3FBQA 3BLKA 4FFZH 4NKMA 1L9PA 4OCNC 4UOJA 3S98A 1J1OH 4S0HA 1S3RA 3HRZB 2XWBB 2VLMD 2G2NA 3ESOA 3WNIA 1FZOB 1KYUA 1SVCP 5DK0B 5DRWB 1NCAL 2ID5A 4U6YB 4ODSL 2VB5A 2VE6A 3K5SA 1QASA 2YPVL 5TTRA 1YMHA 2NXYB 5D72H 2ZJSH 5IR1B 4TRPL 1X7QA 2DQIH 5F6HJ 2AK1H 4F80A 1F11B 3WJLA 4B41A 3IFPA 3LKPA 2IDUA 1I1AC 3LS5L 5F9OL 1AKJB 2CHWA 4XPTL 1CICB 3GKZA 1CD8A 3VGEA 3TO4D 1NCDH 4Z7AA 4IEFA 3FZUC 4E42B 5BUAA 3QIUB 1RLBA 2JKWA 3T71A 4JFQA 3WTWA 3F7KA 4IGBD 1HIML 5F6IB 2C26A 3BGAA 4H1LB 4KNTA 4Y4KB 2A3TA 3MROB 3WNKA 4A7VA 3OMZA 4JFYB 1I7ZA 3QFJE 1RJYB 4HDIB 1A1MA 4LHUD 3P30L 1HHJA 3KJ4C 4LRNL 5L2KE 4MDJA 3NPSB 1UWXH 2VXUH 4KKQA 5C0AD 3QJFA 4PJ7F 4H5SA 1Y7VA 3V0FA 4NCC2 5TE4H 4AJWA 1GXEA 3KYKL 1HKFA 4JGJA 3GHPA 1A66A 3SY6A 2Z6FA 4KRPB 2ZOKA 2PF6A 4AY0A 5GHWL 4LSRL 4PJDA 5IBTL 4RZKA 3KNBB 2JLLA 1IKNC 1NOFA 2O6PA 2QTEA 3N41F 5DQJA 4HOXA 4XAWL 1NGZA 3EKCA 3CZSA 4PJGA 4PCTA 1S78D 3EZJB 4QJ3B 4G8GE 3HI1B 4OFYD 2PXYD 2BHFA 3DJRA 3D3VB 2Q3AA 5E6IB 3QG6A 3KWUA 4PI0A 4IJTA 4LVHB 4NJAL 1MHEA 4WWKB 5I1KH 4TQEH 1HHHA 2CUMA 4JRWA 4JQXC 1I31A 1QW9A 1KJ2B 1VEPA 5I73C 4GG6E 2WVSA 3EW3B 3VGHA 2FJHA 2DD8H 4XTRD 3QULA 2OCJA 3UZVB 3VXMD 1JI1A 1ZVSA 4E5XB 5SV4A 1T83A 2I27N 2X87A 2A0LD 2WMPA 3PWUB 4KTEH 4FXKA 1B4TA 4EZMA 1I3UA 3BT2H 5FYKD 3H3PH 1RKRA 1GJWA 1BDYA 4L9LB 5TDOA 3NIDB 3QNXB 3ABZA 3FTXA 3HOGA 5BZWB 3QR2A 2OSYA 2AJVH 4GW1A 5FA4A 1WCBA 4YSTA 4XNZB 2VAJA 4P23C 4B9GA 4DVBB 1BF5A 1CI5A 3LEXB 4CN6A 4JJ5A 3L1FA 1CB4A 1PD0A 1W8EA 4XH2A 3MBWB 3R7RA 1WAAF 3LTVA 2FX9H 3BEWB 3RVVD 4NZFA 1WIOA 1KENH 5TJWK 3WOVA 4GKLA 4NXKA 4XVJL 5D96C 5I30H 2VT0A 2WBXA 1KJ3L 1UT2A 3NSYA 1G6RL 1RUAH 4OT1L 5FDWB 1VRSA 3GSRB 3KXFA 5K93A 5B3NA 2A4ZA 5E9AA 1GGYA 4OLZH 1KLFB 2DOCA 3T0WA 1MRCH 1JWSA 4ZTEA 5JLZA 4KI1A 5A16B 1D6EA 3TCTA 1OAJA 2OMNA 1MH5A 4BBWA 4FQQB 3L6FB 3N0PB 5I0ZA 3X1GA 4M00A 4XPGH 5DT1L 5EMYA 2VZ1A 4AZUA 1CGUA 4Z3FA 3IDJB 3P77B 5I0WA 4U1KA 5AOLA 1G9HA 3B9AA 2W07A 1ZCRA 2K1MA 4H1LG 2JCWA 4NQEB 4PUBL 3KPMB 5KS9F 5CMAA 3ZYOA 1U6AL 2JB6B 3UIYA 2Z31D 4W4NA 2P52A 4JHVA 2GY7B 5IHZB 4YUEH 3ZKMD 4GYBA 3Q6GH 2VDLB 2WYTA 3SBRA 4BFGA 5IB2A 2JKLA 3NAAH 4C56B 1Y1DA 1F3DH 4Q89A 4GKSB 3SPCA 5GS2H 1ITBB 4PV9A 4BE5A 5HYJA 4QRTA 3DUUB 5I8EB 5DJYB 2ZSWB 3GJEB 3JTBA 2AK4B 4UQAA 5GIRA 5CLZA 3FCGA 5KSBF 3X12B 4RSYA 3T4AA 3L8QA 1M9SA 4BZYA 2YK1L 2R29H 1E28B 3LY6A 4F9LA 5CJXC 4MAUL 3L1OL 3K1DA 4FMFA 3E80A 4PWEA 4V1DB 1JZJA 2DQHL 2GYSA 1DUYB 1XCTA 3SQOL 4EI6B 1P7QD 3KVPA 2UWEB 3WGVB 2EH8L 4JFDD 4P46B 3CVHH 4KX8A 3QFJA 3QQ9C 2AXHA 5JYLA 4HJIA 1BM3H 3F00A 3FC8A 5L9DH 1OE3A 4PAZA 5DK3A 5EG6C 1SHMA 4MD4A 1C5BH 4ZYKA 3ZX1A 2XWJA 1BGXL 3FO2B 4H20L 43C9A 7TAAA 2VC2H 5CHNA 4HK0A 4IMKA 3T3MB 5AKTA 1UUNA 5LHDA 3H42H 4MMZB 5HI5D 5AVYB 3VG0H 4P48A 5LVEA 3NJMA 4E5XG 4URKA 1I3RB 1OEZW 2C4XA 3KGSA 5FYJU 2VN5A 2ZOLA 5T3ZH 1FNFA 3JWNC 1DEEB 2VLRB 4G7SB 4ODHL 1X5HA 1RURH 4C4UA 5E0QA 3MBXL 1FV1B 4ODXB 4XCFH 1KB9K 4MMYA 5CN3A 4M62L 3FT1A 5HGAB 4KK5C 5A43C 4YFEA 3J8F7 2J21A 4ZAKC 1AS7A 1MFNA 1LMKA 3AMKA 3NQKA 4MS8C 3V4PH 3G5ZA 3GIVA 3VTTA 1VENA 4FQHB 5DJXA 5DS1A 1H0DB 3O4LB 4GQZA 3FFCE 5JW4M 4G7QB 2G0KA 1OPOA 2EZ0D 1KIPA 4J3OH 4A55A 3TWCL 2CLZA 4GG6A 4HCRL 1YAIA 1CF8H 1P7KA 1X5GA 4JHZA 3AQYA 4OJAA 1VKXA 2R4SH 3X3FH 4HZLB 3SDAB 3GXMA 2DLFL 2YWZA 3DIFB 3QORD 5D4IA 4LLUA 3AITA 1AGFA 4KK6C 3RL1B 4M7ZB 4WWNA 4GLRI 4Z7VB 1TJIH 5AENA 1TCRA 4AMKL 4HKJA 3FHAA 4M8QA 4NCDA 2CHZA 1T1ZB 2V5YA 1U0QA 1N2RB 1FCCA 2WYZA 4PJ9D 2W9DL 3TH3T 2GBUA 3K1KC 4OZFG 1AGEA 1MWAH 3ZGIA 3QFGA 4BRJA 3CX5K 3I02B 2ADGA 2G60H 5FO8A 4RAVA 4PJAB 1C1EL 4PJFE 5HYEA 5DURB 4GKZA 3U0TB 5IT2H 1M9WA 3MCKB 4NQVA 3LS4H 2IAMD 2OM5A 4L8BB 2WKOA 4ONFH 5GJSH 5EC1A 3FTGA 1YEEH 4ZG1A 3QZWG 4DGWC 2ZAIA 3MV8E 3K81A 4NQDE 1RUPL 3RU8H 2QMKA 2VSDA 2Q9OA 5IBUB 1DQKA 2D3JA 3B6SA 5JIKA 1YJDC 2BFGA 3HRZA 2XWBA 4J3OF 1XSKA 1TPXB 3L9EA 3LDBB 1Q9KB 4HG4K 1FZOA 4TNVF 3TA3D 5DK0A 4KGLA 1X9LA 5DRWA 1UM6H 3CXHJ 4M8RA 4U6YA 4YFDB 3BKYL 3LKSB 3MYZA 3VXRE 1OWRM 5IR1A 4HXBH 5L8JB 3FOMB 3L3OC 1IL1B 1TVDA 2J1WA 4WY7L 4BWTA 1E5AA 2EE3A 2PPCA 3L48A 4KROD 2HTKD 3SCMC 4DUWA 1NCJA 5C0BB 4FFYH 3VD2A 1F11A 5TH2B 3LHPH 3CZKA 3WEAA 1IM3B 3EJZD 3OAUH 1FHGA 1AKJA 3AU1B 5IKCB 1CICA 4XBPB 1AH1A 2L7JA 4AIXA 2XX0A 3N85H 3G9AB 5GS2D 4E42A 5BV7B 3QIUA 5F72S 5IROC 4E0RB 1KXHA 4A67A 1L3WA 4M1DH 5IEKB 4M5TA 2UWEE 4Y4KA 3D2UD 3MROA 4JFYA 3LV3B 4JJHA 1RJYA 2J8HA 4HDIA 2P80A 4JVWA 3VXQB 5F7KC 1HH6B 3BKCH 3FFDB 4ZFOB 5C6TH 3NH7L 3QDAA 4P9MH 3E1F1 4XVUC 1YSOA 4UTBH 4G70B 3OBAA 3PAVA 3ARBC 4ZDHB 3S3DB 3F5WB 2CK2A 2DV6A 3QI9C 3ULUE 1AXIB 2O72A 4A1RA 4FI6A 1ZLSL 4CBZA 3AY2A 4XPAL 4H8QA 4I9WE 4EIUA 5ANMB 4XP4L 2NY3C 1IFHL 4JFHE 2G3ZA 2H2SC 2EABA 3KNBA 2GBTA 1BZDA 3OHXC 1UFUA 2ICWJ 3FT4B 4R2GD 1WBYB 2EEAA 3P54A 4E68A 4GMTL 3L95B 1KTCA 4IDLA 2EDKA 5T3ZD 4R90H 3NK4A 3KYNB 4J4PD 3HI1A 5D5ME 1TQBB 3D3VA 5E6IA 4WF7A 3KDPB 1Z3RA 2EDEA 4R97C 3FAXA 4FKEA 1CLOH 1GSKA 3P3YA 4K0OA 4TNVK 5I18L 4LVNB 4A2FA 3BKML 4WWKA 1RZPA 5EWIH 1EHKB 1KJ2A 4KKCC 3ZKNC 5JTWA 5LB1A 4JGNA 4RFNC 4JZJB 3P0YH 3UZVA 2H1XA 1YEFL 4Y9CA 1WJ3A 3ABKB 4E5XA 1MRDL 3HFFA 3PWUA 3F64A 4J3OD 5GGRY 4TYUA 3TZVC 3WXVL 3OMAB 5BRPA 4L9LA 3QNXA 1OCCB 5BZWA 3NZHL 1SVZA 2N3JA 3OPZL 2Y23A 1ACZA 5IBUG 2IOOA 3F7LA 4DVBA 3LEXA 2I26N 3ALPA 5SWSD 2Q6WB 3MBWA 5FX3A 4OZHF 2D3LA 2H6OA 1IGTB 2XN9D 3BEWA 5FPIA 1FFNB 2FWLB 3K5RA 1JPGB 2YIHA 3D9AH 4UV7H 4C55A 2ZXWB 4R6UA 3GSRA 4H8PA 4XC1H 1AAJA 3ZDXF 1ZRUA 3CFCH 1LD9B 3ILEA 3DK0A 3OHMB 1KLFA 2LQRA 3ARGB 3FTVA 1U8OB 2OZNA 3PXJA 1LTXA 5A16A 1FIGL 4EZJA 4FQQA 1PD1A 4HJ0D 1BEYH 2DMGA 3D39B 3L6FA 2AHIA 3N04A 2F7IA 2PYFB 5FYLL 1J7VR 3IDJA 1SXZA 3ETBJ 3P77A 4N87A 3QRFM 5D8JH 4NQEA 2LTQC 2BSEA 1XHHA 3KPMA 2JB6A 2R9HD 3GUTB 4KX7A 4ZW7A 2OXHB 4U05A 5IHZA 1DLFH 3STBA 1IC4H 1SOQA 4C56A 4ZTPL 3B56A 4C4BA 1O6SB 4N25A 4R26H 5AL0A 4UTAL 1E50A 4WU7B 3WHE1 5I0XA 4GKSA 1ET5A 4IRJD 4JM2B 4MA7L 4CSPA 4YQXH 5I8EA 3DUUA 2V4LA 5DJYA 4NBXB 2ZSWA 1QNZL 4O02H 2XN1A 3GJEA 4XMZA 3DSFH 1L6ZA 2AK4A 4XVTL 4EQ2A 4QOKE 2G9KA 3X12A 2XQBH 2BVEA 3ULVC 3HE7D 2AXWA 2QVTA 1E28A 3PAZA 3C2SA 3KPRD 2CPUA 1ZA3B 3WKYA 4FNRA 2YXWA 4G1MB 3TBBA 4WKXA 4V1DA 3RGVC 3PWPB 1P0SE 3IJYB 4FJYA 1DUYA 1OM9A 4J6RH 4PJXF 5FW8A 4HJGB 4EI6A 2UWEA 4CN1A 4EOWH 1R0AL 4P46A 4B9YA 3MXVL 5E1AB 5EFIB 1C16B 2N1KA 4LL1A 1BYPA 5IHHA 1Q0XH 4O00A 4PN6A 3V4UH 1NDMB 1PYWB 5DO8A 3GTTA 2AC0A 4F8TA 3FO2A 1AXSB 1AZRA 2VJ0A 3J2PA 2EEDA 1KGWA 4MMZA 3RKDD 4U49A 2ERJB 4JANB 1VCBC 2DRUA 2ZKMX 3G7TA 5FS5A 4POYA 1KLUB 3CFMA 5ICYB 1I3RA 1L7TL 3SPJA 3ZL1A 3WEBA 1DEEA 1XIWD 2VLRA 3O2VH 1L7IL 3WSQH 1SMOA 2QQLH 5DVOA 1FV1A 4X7FC 3NUKA 4ODXA 3QC6X 2HUEA 4PLJC 2A9DA 5HGAA 3SB3A 5I1JL 1Q9WB 3ZDZB 1X5IA 1WBZB 2JWYA 4HIEB 3TJPA 5DUBB 4F3FB 4QO1B 5C3LD 5DHVB 2NY0B 4DSYA 5A3IC 1M2VB 1NOAA 2LLNA 4K7PL 1FGNH 1OSZB 4H8VA 4WW2C 1Q1JH 2EH7L 4Z7NE 1KMGA 5A2BA 3FYEB 2FSEB 2MIZA 4FQHA 2VUKA 5JXEC 4L3ED 1H0DA 2PWDA 3O4LA 4PS8A 4Y1TA 3DYMA 3A23A 4QAWA 1CT8B 4LSQL 3U4AA 2X7LB 4NWUH 2AV7B 1X5KA 3GJFB 4YSPA 4BSJA 1EGJA 3NJXA 4OZGE 5B3JF 3LB6C 1JNNL 4HZLA 1IU1A 3SDAA 1YYLL 3DIFA 1W2KT 2AQTA 4XT1C 2BCMA 4G9FE 4TSCL 3BWSA 4KVNH 3RL1A 1JGLH 5E8OB 4Z7VA 3O6ML 3ECWA 2DLGA 2UXFA 5G4MA 2XWXA 5HYFA 4JPVL 2V5MA 1OT1A 4XPFL 1D6VL 1T1ZA 3BKJL 4YHYC 1N2RA 2D03H 4I0CC 3S5ZA 4DNLA 5HDQL 5DVPA 4Z7UB 2ZXCA 1WFJA 4DVRH 1H6EA 3I02A 5J7CC 5K59F 4FQPA 4PJAA 2ATAA 3GWJA 2WOYA 3U0TA 1UZ6E 1K4CB 1P4IL 2Z3FA 4I1RA 4YDZA 5E95B 2I9TB 1JDAA 5C2BH 3RVTC 4MQ7B 3MCKA 2VDOH 3L9YA 4PJDF 3VQ2C 2AXFB 4G42B 4L8BA 1E5YA 2F9BT 4TPRL 3VQMA 4CKQA 3FXIC 4LCWB 1TYJA 5GGTL 1IGFH 1KJMB 3IDYB 4P3CL 4ZXBC 5KAQF 1DSFL 1IBDA 1SXNA 4OF8A 1JTTA 5E51A 3PNWB 4PJGF 2D8KA 1GVIA 2ZWLT 4LLDB 4OCSH 4TUJB 1Z3GH 4N0UB 3DO7B 1DBAL 1KPUB 4BCXA 3LXCA 1Q9KA 3KL3A 2FUTA 1H3VA 1WA0X 4FI7A 5EA0L 3P02A 2WUBL 5HDWA 4FP8L 2VQ1B 1YY8B 3LKSA 4G71B 2WJ5A 1S7TB 3E9TA 4K3EL 3FOMA 1MZYA 1DJXA 1IL1A 2RTTA 2XFGB 3DHJA 4NB7A 4OD1L 1WHPA 4J12A 5C0BA 2BIIA 5TH2A 3RDTD 2VIRB 1CVSC 4PCKA 1IM3A 4UMSA 1TFPA 3AU1A 2FX8L 5IKCA 4XBPA 2WTRB 1G4MA 4UILL 1FN4B 1I7TB 3P3RA 4XP5H 3Q48A 3FQWA 2H6UA 3K2KA 3TBTB 4E0RA 4XI5D 3B8SA 5E6SB 5IEKA 1I9JH 5M94B 4PW3A 2ZX8A 3K8MA 1IGMH 3RIKA 5TQ2L 3LV3A 3VXQA 3F6LA 2VISB 1HH6A 1XMEB 3FFDA 4X6BB 1OZUA 4GEJA 4HUXB 4ZFOA 5D70L 4Y16B 3DJSA 4AQ1B 3AGWA 3MAWA 1WYJA 3GXTA 3L4ZA 5I9QB 5MERB 3VD5A 3GBML 5JOPD 4ZDHA 5IVXE 2VZOA 1D5BB 3F5WA 3WE1A 1KEGL 1DHKA 1JPSL 1X5AA 2WWKT 3L1EA 3WD5L 3WAKA 5ABAA 3N50A 5ANMA 1J86A 5ACMA 1B88A 2AEOA 2XXGA 1XXFC 5AVXB 3FT2B 4L9DA 1CG9B 4OFIA 3KPSD 3WFZA 4HV8B 3HNVH 4I18C 3FT4A 4ZJ9A 3GSNL 1WBYA 1E4WL 3N55A 3L95A 4PREB 2YD9A 4XGZB 3VXUD 4ZX3A 3AS1A 1AYOA 3KYNA 1OKEA 3ZR6A 2ZXEB 1H9DA 2VDRL 1JGDB 4DKEL 3BD3A 1N8OE 5LN4A 4NUGL 3IDIB 3TJEL 1QBAA 2XRAH 3AW5A 1CBJA 2CRIA 4MQXD 1ID5I 3PWVB 3FH7A 2X70B 4G6JL 2G5BB 2HLFC 5TE7H 1WAEA 4MNGB 4UNVA 1BXAA 1A8JH 1JRHI 3S2AA 4JZJA 4AYMC 2H7WA 1N64L 3PGCB 4M6ML 5E2UL 3FU3A 2YAFA 2BHYA 4U31A 3UBGA 3QPQD 4KI5F 3ARRA 4M4RB 1YC8A 4F5CA 4HIXH 3GKWH 3APMA 3RURA 2YO3A 5FO7B 4Z7UE 1KELH 2QSQA 2F8OA 2Y7NA 4B5ZA 2Q6WA 3RY6A 1KB9J 5DMGC 1SXAA 2MMXA 5FDYA 3N42F 3X1EA 3RAJL 1IGTA 1T0PB 3EO9L 1FFNA 4FG2A 4W81A 1JPGA 3AS3A 4YWGL 1OP3K 2IG2H 3TNMB 3VWKD 4BINA 1LD9A 3IFLL 1CBVL 5D2NC 3ARGA 4C4KT 1U8OA 3BAIA 3HBGA 2QGBA 1VEOA 4X8JB 3TPKA 1NFDB 3IEAA 2YAQA 3D39A 4LDOB 4JKKA 1IGCL 3ET9F 2IADB 2PYFA 1N6QL 5JHMA 5EU6D 4S1SL 3VVVA 5DJAB 3BZ5A 3OB0H 5D7JB 2X1OA 5H94B 3BVVA 3GUTA 2WY3B 3CX5J 3SY0B 5D71H 4L48A 4UQCA 2OXHA 4DP4X 1FO0L 3FULA 2IWGA 4OZIB 4Y4FC 1FORH 4GG6F 1O6SA 2ATKB 3T6VA 5DA4A 4HOWA 4WU7A 4GY4A 5DJDB 4ZSOE 4JM2A 5JOEA 4JG0L 3VE0A 4M56A 2X1QA 2YRPA 4HGMA 4JPKH 4M02A 1C9SA 3WY2A 2FL5B 4IIQB 4LT7A 4RWYH 1UH3A 4F33B 3ZU8A 3KR3H 1ZA3A 2EVIA 4G1MA 3PFQA 2W94A 4K8RL 4XHJC 4HG4J 3PWPA 1BAWA 3IJYA 4P2QB 2A9BA 1W72B 1MIEL 2OYLA 1MRFH 4HJGA 2QBWA 2NX5E 4KY1H 5C9KA 3V6OA 5E1AA 1ILUA 4NN5B 5EFIA 3VFSA 1C16A 2FHBA 25C8L 3C6LD 5JOFB 3M6DA 3P0VL 2A9CA 4PJCB 3EFDH 1NDMA 1PYWA 1BP3B 2WKOF 4BSVB 1UKTA 5DC9B 1AXSA 4NO5B 4LIQE 2YKLH 3PGFL 4FRWA 5HVHB 4EDWL 1UURA 5D7EA 1TFHA 4JANA 2X4PB 3X13B 4WGKA 2W95A 5A40E 1KLUA 5ICYA 4M6NL 1P4BH 4X98B 2R2HB 3QFJD 3AY4C 2YQ2A 3F84A 3NN8B 3CFQA 3UJJL 3QIWB 4OI9A 2FUQA 5L2KD 2P9RA 4OM1L 3DTUB 1TJHL 2R4RH 4IBVA 1T3FB 3UEQA 3ZVVA 1Q9WA 4Z7OE 4W70A 4NN6B 1WBZA 4HIEA 4GW4B 5DUBA 4F3FA 4QO1A 1DJGA 5C3TA 1CYXA 5DHVA 1M2VA 3HI5H 5EO0B 1OSZA 4CADB 3GLAA 1V3KA 2FSEA 3RTQD 4LHJB 1CT8A 3DETC 4MHHG 2J71A 5SWZE 4BH7B 5B1BB 2X7LA 1BZOA 4X7DC 2UVFA 2A6DB 2AV7A 4XO4A 5DGRA 1XGRB 3GJFA 5ALBL 2AI0L 1U8HB 4ELKB 3DRTB 4D3CL 1DJYA 1QYGH 3OPUA 2QGEA 3MJGX 3JVGC 5LWYL 5FF6B 1GTFA 2JJUA 3MRNB 4G8GD 5E8OA 1KGJA 1KV7A 5GRVL 1NL0L 1WFUA 1Y07A 5C07E 4R84A 1NCBH 3RVUD 4TLKA 3EOAB 2BSSB 1JZ4A 4KKPA 4HEME 2A77L 3MJWA 1MREH 4Z7UA 3D09A 1KCBA 5CZKA 4MAYD 2I9TA 5TDPB 1K4CA 4IW4C 4J2QA 2DYPD 4MQ7A 2UY6B 4KJWC 4N8CL 4KRLB 5F7LB 3WEMA 2VMCA 2OXGB 3N2JA 2AXFA 5IEHB 4G42A 4LCWA 2ZXAA 2MQ0A 1FBIL 3BC9A 4Y9BA 3WFHB 3MLYL 1KJMA 3FHQA 3WJLC 5EZJB 2BP3A 4B5EA 4OQTL 2VXQH 4FF9A 4PH8A 3PNWA 1ZXQA 2LU4A 1OAYH 4LLDA 3MOAL 4TUJA 3DO7A 4N0UA 1KPUA 5HHOE 2CA4A 4RZCB 4YDLB 1FNGB 1RPUA 1WH0A 3T1WA 3L1GA 4CAGA 3H9YA 1AG0A 1MHHB 2VQ1A 1YY8A 4UQEA 1S7TA 4FHJA 2JKSA 3LEYL 4EIBA 3RNKB 3HLKA 1SQ2N 2VIRA 1XH0A 5D2NE 4IOIB 2F61A 1J10A 3DHUA 2O5XH 2BZ7A 2WTRA 5JHLA 3NIDF 4G59C 1AFVH 4UIKH 2M1KA 1FN4A 1I7TA 5GGUB 3QWOB 3K74B 3TBTA 1LILA 4AYSA 4U1GC 4W9DC 5LO7A 4A7QA 4C57C 3UBFA 3HFML 1P69B 5KZCD 3JZYA 4Y1AB 3RVXC 3PDOB 2K0RA 1F4YH 2N7SA 1E6JL 3LKOB 2IANE 3WXWH 2VISA 4X6BA 3QJHB 4HUXA 2XYCA 3FN0H 2XVBA 4Y16A 2HRPL 2MPAH 4IRZL 1AKJD 4UDTB 4LBAA 3TFKC 4AQ1A 4M9PA 1A47A 5MERA 1PG7X 5F7WC 3UEZA 3L13A 4HPYL 1D5BA 1R5VB 5F70A 1KEML 3U7YL 5ISZB 4NZTH 5KYXB 2D2CC 3ZDYB 4H0HB 2VR5A 2P47B 2XBZA 3T2NL 3QUYC 3WU1A 3X11B 2C9UA 3T09A 1MXGA 4EIGB 3FT2A 5JHDE 1DQDL 3U25A 1CG9A 2Z65C 1N4XH 4P2YA 2ZX5A 2BFVH 4HV8A 1CCZA 2DM7A 2VMEA 3PP3H 3QJVB 4IRSB 4JFEE 4LCCC 4OF0A 4QGTA 3SZKC 1T7YA 1T83C 4FTDA 4APQC 3LYRA 4PREA 4XGZA 4Z7IA 1UXLA 5ESAB 2IGFH 5L0QC 3EHBD 4Y89A 1PQZB 1JGDA 1MHCB 2B0SL 3Q8BA 4KRPD 3SKNB 4P9HL 3IDIA 1KN2L 3KM2A 4YHOH 4IBUA 3ARQA 4K9EC 3WIIH 4EAEA 2J8UE 3QUMB 3GXUB 3PWVA 2WD0A 4JKPH 2C1PB 2X70A 5DZVA 3UC0L 5DMIL 2G5BA 5D7LB 4Z0XB 4OLXL 3PIQB 3IXTB 4MNGA 4WCYL 3AXIA 3A0OA 1U3HD 4OV5B 2WZPA 2ETWA 3DVFA 3FZUD 1QRNB 3KPTA 3PGCA 3V6ZB 2PP9A 2EE0A 1S9WB 3FUDA 3GI8L 4ZNCD 3RWCB 1FPTL 4Z6AT 5J57B 4M4RA 3SDDC 2WZ5A 2ZOTA 4PHZA 3W9EB 3ZRCC 2KQMA 2WZ6A 4WWKD 4RGOL 5FO7A 2X0UA 3OWRA 4GT0A 2Q7AA 4X9HA 1KYDA 2XBDA 2UWEF 1ZT1B 4M48H 2Q2LA 3QUKB 5AD0B 4WW1B 3O0RH 4LCUB 4ZMPA 2CBOA 1LL1A 3VQLA 3FFCD 2E75C 2DS4A 5IB3B 2XA8L 3BVXA 3LN5B 1N0LB 3TNMA 4DP9X 4XWGH 4LFHD 3ULUF 2Q2EB 2QMJA 2DQTL 5HYQB 2JV6A 3MV9B 4HS8L 3EDEA 3NEXA 4LCYB 5D4QA 3VH8B 5I1CH 4DGIH 4JG9A 2XZCH 2N01B 1A14L 3O3DB 4X8JA 2EVHA 1X7SA 5CJQH 4U3CA 1NBCA 4JFPB 2BP8B 1NFDA 3D33A 3EOBB 2J73A 3THMH 3FQXB 2XHNA 2IADA 5E2VH 2H4EA 5A2AA 5EZIH 4UMGA 1C5CL 3M1OA 3CFTA 3BUQA 2D7QA 2VLKE 5IY5B 1G0XA 5EOQL 2DMKA 4OJFH 5DJAA 5B22A 4QYOB 3UBHA 5D7JA 2D7TH 4XX1G 3V4LA 5FUCC 4KFZC 2QR0B 3HB3D 5H94A 4PJIB 1QSFB 4G3YL 4JNXA 4LAQL 3SY0A 3BCFA 2WXMA 2OV0A 4HPOH 2JJSA 1T1XB 3QHZL 5DJ8B 2J6WA 4OZIA 3BAWA 3CFKB 4MBOA 3GTNA 2IQ9H 2ATKA 4FD0A 4JCMA 3CSFA 1TTUA 1NAMB 3MV8D 1XR8B 5DJDA 3ME0B 3HPLB 4NQDD 3I3BA 5C09E 1JHTB 4G83A 1QSZA 2CE6A 5DEJA 4MMXB 1ZK9A 3T2QA 4OIBA 2R23B 2UZPA 3VTMA 2FL5A 4IIQA 1HEHC 4F33A 3F58L 3ATFA 4GT7A 2DKUA 1INEL 2VDPB 2ZF9A 5TQ0L 3VFVB 2O93L 2L7QA 4IDJH 4WLCA 4ZOAA 3WTYA 4DKFH 3VXRD 4P2QA 1BBDH 4UM9D 3ASNB 3S48A 1W72A 4OFPA 3MNMA 1MCBA 4PJAF 4QXGL 5FKPB 4Q58C 1BLIA 5JOFA 4PRBB 5AOKA 5JHAA 4HGKC 1FVCB 2DWEB 4KXZI 1JERA 1JPEA 3K0WA 3QJRB 4NN7B 1PCSA 5F97E 5F1IB 3UTTB 4PJCA 2IAAC 2Z7UA 3N06B 3QEQE 1Z2KA 2RFXB 2M2DA 2XJLA 4BSVA 3CSPA 1I75A 2NXZC 4NO5A 1O9VA 5AVUB 2CIIB 2ED7A 2ZTBA 4JO4L 4H26B 4HUWB 2G3MA 3WNOA 2X4PA 2A9MH 1CC3A 2VXSL 5EN2B 3X13A 4HVBA 3FH8A 3RWDB 3CLFL 3Q1SL 2J1KA 3I6GB 2K4AA 4Q52A 2ODIA 3MGAA 4RMQA 1P9MC 2R2HA 1MLBB 1BM7A 4X98A 3NN8A 4DUXA 3I3DA 3B34A 3POHA 3QIWA 2EIJB 1MVFA 5GRWA 3B2XA 1DVFB 3ZT5A 3LH8A 1T3FA 3NJJA 1PIFA 4KO9A 1CE1H 1KPRB 2ROYA 1QSEB 4GW4A 1UZ8B 3ULUD 1FYTB 3H9SE 5EO0A 4I9WD 4CADA 1V10A 2KQNA 1TTCA 4G6MH 4KO6A 4JFHD 2MOGA 4KZCA 3QFDB 5F1OB 4IHOB 4BH7A 5DLLA 4YX2H 5EULV 2A6DA 4IHBA 3VG9C 5IIEB 4ZS7L 1DZBA 1XGRA 4DP1X 4XVOA 3H1ZA 1U8HA 4ELKA 3DRTA 3MODL 5LGHH 4WRLA 4G6AC 4YXKH 5FHBL 2VR3A 5ITBH 3QO1B 1MW0A 1E3FA 1YECL 1I7UB 2BSBA 2HJKB 1KIUB 2XXFA 3LD8B 1A6PA 4HS6B 1TETH 3MRNA 1YG9A 5FF6A 2GSMB 5FC9A 2CCVA 1YPZE 1U8PB 3QQ9D 4N3UA 1ZD6A 3DK2A 2PWFA 4XMKH 3EOAA 2BSSA 3V2AR 3TVMC 4D9LH 3EXJA 3HC4H 1RZFH 2V3FA 6PCYA 4YDVB 4KQ4H 4PGBB 3B2UD 3MV9E 5TDPA 3VGDA 4EI5C 1OV8A 5EZLB 1UTDA 2TSAA 3I6KB 1H8OA 2UY6A 4Z23A 4ZFGL 2OXGA 5IEHA 2NXYC 2E4FA 3V4VB 4ELDA 5CZVL 1HSAB 2BHUA 3APCA 3CQFA 4U0RB 3WFHA 2EICA 5EZJA 3WIFB 5ILTH 1ZV2A 2HB0A 2BXYA 3MRGB 1KTRL 4KK5D 4LCVA 2HJLB 3IF1B 5DJCB 3D4YA 1CICC 3VJ6B 1XL6A 5EUOE 1HCZA 4RZCA 3HVNA 3TL5A 3EBGA 1FNGA 5DRNB 5E5UB 3QISA 1CXIA 1HWHB 3EH5B 1MHHA 4Y4KC 1ADQH 1CLYH 1DVUA 4W9EC 3IS1X 2BJML 2VDNB 3RNKA 5FUZL 5J4MA 3PAUA 5GRJH 4KQ3L 1UWFA 3WDJA 2R0LH 4IOIA 5DZPA 5AVQB 4X7SH 4IOSA 1INDH 5E7BA 3QJXA 1RH8A 1NC4B 1XSIA 5GGUA 3KLQA 1M42A 3QWOA 1W6WA 3CCHB 3MLZH 2OSLB 4CC1A 4PJBB 5GSRB 3WN6A 4BFRA 4WNJA 4Y1AA 4JHWH 2HVJB 5F9WC 3PDOA 2J72A 5FUCE 3LKOA 3I84A 3T5WA 4FA6A 3QJHA 5J8OA 4FABL 3VXSE 1AQDB 4UDTA 5EHFA 4E9WA 1DFBL 5E24E 2DBLL 2IFFL 1J1PH 2AJXH 3CSBA 1R5VA 5ISZA 1TYEB 2XTJB 4B3VA 3EJYC 5KYXA 4ZMNA 1WD9A 4LVHC 4GSDH 4W9CC 4QOKD 3X11A 4EPSA 5T33H 2JELH 4NERA 2Z34A 3STLB 4MBRA 4FFZL 1WFMA 1OSPH 3B7RL 4JVUA 1J5OL 4PTUA 4IRSA 3SBPA 1F6AB 4NBYB 2WQAA 3ESNA 4X6CB 5LAPA 5ESAA 4FQLH 5SV3A 1QSEE 3BE1H 1PQZA 3SKNA 1MHCA 1JPTL 4L9LC 1HNFA 3SCMD 3QS3A 2DQIL 2EYSB 4B96A 4ABWA 2NY4B 3QUMA 4HJJL 2C1PA 3GS4A 4Z0XA 5D7LA 2V9UA 3PIQA 3IXTA 4LHQB 1ANUA 4BZ2H 4EZLA 4OV5A 5J12C 1QRNA 3O2WL 3V6ZA 2BS8A 2WPGA 4JFOB 1S9WA 1A7QL 3HZMB 4ZMLA 5JZ7D 3RWCA 3HJEA 1G5GA 5GXBB 2AQRA 2R51A 1MDTA 5E6UB 1AZNA 1GJIA 2BDNH 3BQUB 3SGEH 4N0YH 3W9EA 3VNYA 1PAMA 2YGPA 4CJ0A 3V0HA 1QG3A 2FEJA 1P6FA 2NT0A 4OCWL 2VZUA 1ZT1A 2IMMA 3QUKA 3LQMA 2PCYA 4WW1A 3HN5A 5AD0A 2ZKXA 4IKKA 4LCUA 5HDBE 1EHXA 1WHOA 3QI9D 4BFNA 3HZYB 2NW3B 1ZWIB 3WI9A 4OIAA 1OLLA 3PJSB 1JZ7A 1LQBC 1HHGB 2CBQA 3FRUB 3U4BL 5IB3A 2WP3T 4U2ZA 3LN5A 1N0LA 2LOEA 2DLTA 3ROOB 2ZKHL 5HYQA 3GBLA 1PIGA 3OZ9L 4HUMB 2WLNA 3H3BC 2E9BA 1U30A 3MV9A 4LCYA 4QLRA 5KTEL 3VH8A 4HUVB 3OGCB 4MD5B 4G9FD 4XNYL 3O3DA 3PWJB 4JFPA 2BP8A 2Q0ZX 3EOBA 3BAXA 1L9RA 3FQXA 3N0AA 1PSKL 1XH2A 3AQXA 2NW2B 2A9NL 3D52A 3ZDZF 3ZTDC 4POZD 4QYOA 1MWOA 2YQ3A 4MXQC 1N6VA 2QADB 5CZRA 3ZKND 2QR0A 3QBTB 5EUKB 3ZE1B 2C9QA 4PJIA 1QSFA 3SDXE 4WO4B 4XC3L 1QFWL 1Z5HA 5CSBA 3QNYB 2Q3ZA 4XN4A 3AB0C 1T1XA 2WZ0A 1NBVH 1KFGA 5DJ8A 3CFKA 4PY7B 4P46C 4MA1B 4YXHH 1BJ1J 1NAMA 1J11A 1XR8A 4PY8I 9CGTA 3ME0A 2X2UA 3HPLA 3O8XD 2V9TA 1XGZA 1AHMA 2DH3A 3H3PL 4M1GH 1JHTA 3I85A 3Q8CA 4MMXA 3RBGA 5IFAH 5GRXG 2R23A 4AJ0A 1BWWA 4QRSB 3IYLW 2EVFA 2VWEE 4MMZC 3NGBB 3RE0A 3VFVA 4AKPA 1X5JA 1V7NL 3Q7JA 4Z7UF 2J2ZB 1KENL 2PPAA 3DDGA 3CGTA 1H6TA 2PWEA 4QRQB 4F2MB 5I30L 5EF3A 5FKPA 2NY6B 5T3XL 3FU8A 4NZRH 5JPNB 1U8KB 4PRBA 3B3BA 3QEHB 1FVCA 2DWEA 1LHZA 3SYQA 1SBSH 3BAEH 3UTTA 4PIBA 5F1IA 4RMSA 3K6IA 4WEBL 3IKKA 2RFXA 2R1XB 2FQEA 1IVLA 2A4EA 2HG0A 1Q4NX 4MRCA 3BVDB 2CIIA 2VJ8A 5HYSB 3U2SB 1FE8H 3U1SH 4OGXH 4H26A 4HUWA 5GS0C 3ARDB 3HEIB 5EN2A 2DF3A 3Q1EA 2DAVA 5AW6B 2YRLA 3RWDA 2ZKWA 4Q6KA 3I6GA 4MJIE 2F5BH 1GZQB 2EXYC 4WHYG 1MLBA 3J27A 2HJFB 3T4YB 3RRQA 5FO9B 1MFDL 5KSUB 2AF2A 1NUFA 2A7BA 4EKJA 1KBKA 4LSVL 5LBVA 3UDWA 1PD6A 2GJZB 5ADPH 1DVFA 2QHLA 5E1GA 3ZYJA 1KG0B 4HHGA 2CCWA 4YUEL 1KPRA 1B0RB 1QSEA 3Q6GL 1UZ8A 2D3NA 4A2MA 5CU9A 3K71B 1FYTA 1JK9B 3TPUB 1UOLA 2WLZA 1NCCH 4MASA 4I4WB 1IBYA 2ZX7A 2OYPA 4AMXA 1QPXA 4TS6A 5E70A 5DJ0B 3LQAH 4WQOA 4JLRB 3QFDA 1AXTL 4MJJA 4IHOA 5SX4H 1HAUA 3MV7B 1L9NA 3W0WB 5IIEA 3N6YA 1AE6H 3Q2WA 7PCYA 3GJFK 4Q9CA 1THAA 1MCOH 1TTRA 3PL6D 1MCHA 3SGJA 5BO1H 4M4PA 3QO1A 5IVOA 1I7UA 2XXCB 2HJKA 1KIUA 4UT7H 3VGAC 4HS6A 1G0DA 4UT6H 5ANHA 2W80C 2JCCB 3NA9H 1LP9E 3MACH 1U8PA 2I07B 1DBKH 1OCOB 2DIBA 1J8RA 3CLEL 4KRMB 1TF4A 1UATA 4W6XB 4YDVA 2GSGB 2WWMD 1C5BL 3QUZB 1HFUA 1TPXC 4PJEE 3D18B 1A7NL 3MGOB 4PGBA 5FM5O 1I8IB 3MUJA 2X6CA 3QYNA 3ETSA 2WLYA 5EZLA 2QLYA 3VG0L 3I6KA 1ETZB 3WE6B 3V4VA 4BXVA 4ADGA 3FTUA 4LSPH 4Q2ZB 4GS7C 1HSAA 3VRLE 4F1ZA 2YXVA 1QQDB 3K7UA 5C6PB 3WIFA 2ZUQC 4E9RA 3BUPA 3MRGA 4PLJD 5JDJA 4GKOA 2BSTB 3RTLA 2HJLA 2OR9L 3IF1A 4XCFL 1QBLL 2CR0A 5DJCA 1QLEL 5DHMC 5GGSY 3VJ6A 1HQ4B 5A3ID 3QYCA 5EH1A 1E2ZA 4XP9H 1SJHB 1U92B 5BV7C 5DRNA 3RJDA 5JXED 3IAGC 1RY7B 3IDGB 3BP4B 5DS2A 4Z7OF 1OAKH 1U2YA 3K6OA 2Y36H 1BWMA 4NCC1 2NUTB 3RZWA 3C5ZD 4FOMA 3RWJB 1GGBL 2H8PB 4MSWB 2KDYA 1YEIH 2MFNA 4B6ZA 4PVNA 1OHZA 5KSAD 4LLQB 1IEHA 4FAAB 4F58H 2WLHA 4E41B 3S37H 5IBLC 3UO1H 1TZHB 3DROB 3DHMA 3B9KB 3GF8A 1NC4A 4J39A 2XKNB 3ZQXA 1JZDC 3CCHA 2AAAA 2HX9A 4HQQL 3TFBA 2VXVL 4JDTH 1QBML 4FX5A 1BVZA 2OSLA 4TTDC 4PJBA 3RJQB 3WFBH 5GSRA 2IBBA 1BAFH 3QQ4B 2HVJA 2ZAGA 1A6WH 2V17L 3ARVA 3ALWA 1ZEAL 1VDGA 5I17B 4MFHA 2L3BA 3LNIA 4KOBA 3ATDA 3HG2A 1AQDA 1PPIA 1ZAGA 4ZUVB 4IMLB 3OJDB 2TRHA 3Q5TA 3R8BB 1JZEA 3PQYB 2GEQA 5F9DC 1TQBC 5FCSH 3FF7A 2YPLE 4ZXBD 1F56A 2N0MA 3VGFA 1XEUA 4E9YA 4XO8A 1MQKH 3WMPA 1FGVH 1NFDF 1DJHA 2CBMA 4ODTH 5CN2A 4YK4C 3STLA 2VZ3A 1OGAE 1MAMH 5KG9B 2VDKB 3DLQR 3ETTA 1XH1A 4X5QA 1F90L 1F6AA 5HHXH 5F89B 5IJBC 4X6CA 1J8SA 2VUYA 1J1XH 2NX5D 2JH2A 3S37X 2LV4A 3BIKB 3HC3H 5HHVH 4PG2A 1OARL 2EYSA 4UT9H 5CLWA 3GM0A 4LMQI 5F7EL 1BOGB 1DZ0A 4OZIF 3ECQA 4NJ9L 4G82A 1NGYB 3RY6C 5DD1H 4QRRE 5BRZE 4PJHB 4U1LB 3S8WA 2DWDB 1I8KB 2DJUA 4GRLD 2RB8A 3N85L 4JFOA 3HZMA 4M3KB 1XGQB 3WHE0 4JAMB 4W1TA 5GRVK 1PEZA 4ACTA 2JCCE 1YY9D 2PO6B 3A67L 4M1DL 5IW1B 3BQUA 3KS0J 5BRQA 3PABB 4JN2B 3RB5A 4LEXL 4X6DB 1LO4L 3D34A 5BS0E 2WQSA 4ZBJA 2YZ1A 3IAQA 2PR4H 1G9ML 2OMXA 3S5YA 1IBBA 1DTUA 3HMWL 4OUOA 3H0TB 3HZYA 2NW3A 1ZWIA 5DZAA 1AGCB 3GBNH 3LZLA 1HILB 3PJSA 3Q0HA 4P2OC 4TL5A 4KJPC 4ZUSB 1HHGA 5SWZD 5JZ7C 2IPUG 3FRUA 3MMEB 2IF7A 3H2QA 5I76B 1JWUB 3KYOB 2FHFA 3ROOA 1BBJB 4DGUA 2VLLB 5IM7B 4HUVA 3OGCA 4MD5A 3PWJA 4HKBB 3MRLB 4JPIB 4WUKL 1NC2B 3BPOC 5FYLE 4FHBD 4HW6A 5C07D 2APSA 1QABA 2FBRA 2OR8A 2R2EB 2AMGA 2WO4A 4JM2C 5FR3A 3QXVA 2NW2A 2Y9RT 2WVUA 3EH1A 4DOHB 4KZEH 3BGFC 5DDHB 4YOKA 1OP5H 2Y1YA 1BD2E 5E99H 2HLFD 5EU4B 5EUKA 2FBOJ 4JFUA 5LUMA 4WO4A 4HWUA 4M5SA 1JHLL 3QNYA 1YNLH 1GIGL 2PWHA 2HZHA 4MTMA 1AOZA 1GKOA 2J8UF 2X6MA 1UCBL 3NDZE 5D7HA 1Y18B 4XWOD 4NQTA 4P2AA 1UD4A 3ROLB 3F6IA 4X80H 1OTUD 3V6OC 4CVWA 2Q76B 3N9GH 3ECVA 4CVZB 2YMXH 1NIBA 4H7VA 5T5FL 1PKOA 1JNHB 3JYBA 2D9CA 3F8UB 1QKZH 3AWFA 5GZOD 4XMPH 1QEXA 5HHOD 4QRSA 1UC6A 4DF9A 3KEDA 4FQJL 4GI6A 2ERJC 5HI4C 1UA6H 2ZNXA 3VD7A 3MBEC 4DK3A 1D9KB 2J2ZA 3ZTJH 2B2XL 4TVPL 5CKAA 4QRQA 4F2MA 2E27L 1L0PA 1PKQE 1N5YH 1GOFA 3GK8H 1F4WL 3W2DL 1OL0A 3LAFA 5JPNA 1U8KA 1BPVA 4A66A 3QEHA 1J5CA 1E27B 3WTXA 1Z0MA 4EJ1C 5H37H 3QCVH 2R1XA 4ADIA 1IILE 2YRBA 5C08B 3C60B 2NY0C 1OHQA 4J5VA 3HCVB 3U2SA 5HYSA 2OKMA 4FZEL 4J3UA 1N70A 3ARDA 2DQGL 2FVNA 1JZHA 3EJUA 2MQGA 4M6OH 4FQIL 1FNEB 3NIFB 2YQGA 1HE7A 1GZQA 2PYEE 5IHUH 3C08H 2HJFA 5KSUA 3T4YA 5FO9A 4UV4L 2J5WA 3D5OF 2IAND 1UACL 4KDWA 2Y1ZA 4FNLL 1ZANH 1KCRL 2GJZA 1XZ0B 3FF8A 4MLSA 1KG0A 4DZBB 1JGUL 2ADFH 1NSNH 1U9KA 3FO0L 1B0RA 1L0XA 1TJGL 1CD9B 1UG9A 4N28A 1A1NB 3K71A 1JK9A 2XZZA 3TPUA 3DBXB 3VWJC 1SJVA 2DQEL 4I4WA 2W91A 4I5BB 4HK3N 2ZUVA 1XH3B 2HKFL 5AAMA 5DJ0A 5J1TC 4U3XA 3OV6A 4JLRA 4JQVC 3RUGB 4JM4H 5JHDD 3MV7A 1I9RH 3W0WA 1X5YA 3OWEA 4JFED 3PS6A 6FABH 5I28A 1NUNB 3A4AA 2B1OA 3ILQD 3BSZH 3LIZL 1BMWA 1TG8A 4GUCA 1ZHKB 5EEWA 4FFWC 4Q7DA 3ZTCC 1KGIA 2P5EB 2JCCA 3QEGL 4P59H 2I07A 1FZMB 1HZHH 4JG5A 3KL0A 2DM4A 3K8LA 2OCCB 1A3QA 3MTRA 2CCLA 3KGUA 3GZQA 4KTGA 2GSGA 1TJMA 3O4OB 3SGKA 4RISH 1WS7A 3QUZA 4QTFA 2YBRB 5CEXB 3D18A 4RFOH 3MGOA 2YEQA 1I8IA 1KC5H 3ARFD 5JW4N 4KITB 3U30B 4AE1A 3SPVB 2VH5H 4LDCA 4DGVH 4Z3TA 5I66B 3QGVA 3GD1C 1ETZA 3WE6A 3DDFA 4AVHA 4JFFE 1VACB 5DR5L 4Q2ZA 2W5PA 1RZKL 5IHLB 1G9EA 1QQDA 2X05A 3L4XA 1IAII 1UQSB 3A6BH 3KWXA 3IFOB 3QXUA 3BFWA 4J3VA 4PJ5E 4PR5B 2BNQB 2CO6B 4K9EH 4JRFA 4DOHE 1J0ZA 2BSTA 2QSCL 4BDVA 1KZQA 4RMBA 1HQ4A 1MIML 4Y2DD 5ALCH 5IWLA 1FFPB 1SJHA 2WIIB 1U92A 4WWID 1XB3A 3KE0A 4NFBA 2COQA 2R8SH 3FT9A 3P69A 4GQ9L 1U8CB 3DOIA 3IDGA 3BP4A 2QPSA 3V7MA 1V3JA 3NT0A 4HXAH 5LAXB 4FHKA 1ZJBA 1KB5L 4FQ2H 3FUNA 2DL9A 4QRPE 2NUTA 2IIJA 1LO3L 2H8PA 3RWJA 4MSWA 2DJ4A 3NSXA 3JXAA 1GC1L 1SUHA 4LLQA 4AQ1C 2V3EA 3WO4C 1IIKA 4E41A 1NCAH 1WITA 4ODSH 1TZHA 1S7XB 3DROA 4KVNL 4UB0L 5HJGA 2YPVH 3B9KA 4DP5X 3D07A 2VLKD 5DHYB 2XKNA 2XWRA 5L8LB 4TRPH 2CR3A 4QCIB 4OLVL 4HSCX 1S7SB 2EAEA 4EKXA 2FT7A 2OTPA 3EYQC 1X4ZA 4ZT1A 3QQ4A 1TXKA 3QCTL 5L7XL 1CXFA 4TNEA 5IJKC 1L0QA 2N7AA 5F9OH 5I17A 1CD1B 3LZRA 1FUNA 4XPTH 3TOPA 5DC2A 2VR8A 4XNMB 4ZX6A 2Y7MA 2GHWB 2WAQA 4ZUVA 4IMLA 3OJDA 1I1CA 2D0FA 1TZOA 3PQYA 1BVKB 1EFXD 2WWNA 3HZKB 1HIMH 5LN8A 4LP5A 2WNWA 5C09D 1G7HB 4ODVH 3P30H 4LRNH 2ZCLL 4PPTA 5KG9A 3TJHD 3UTZB 4I3RL 4HOMA 1Z3GL 4D0BB 3L3DB 4L1DA 4MDIB 3KYKH 5F89A 2J12B 1BLNB 3IE4A 1ITCA 4XB8A 1ZPLA 3MLRL 3TYFB 1URLA 5EUOF 4PJIF 5IP4A 2FO1A 1X5FA 2VXTL 3BIKA 4LSRH 5GHWH 5IBTH 3TH4T 1MW2A 5J89A 2FR4B 4AQEB 5EU7C 1B90A 1CLVA 4JDEB 1BOGA 4M93B 3QEQD 2EO9A 4HP5A 2E8ZA 1OOAA 2R0WL 4YHNB 3BH4A 4NQQA 4X5RA 4XN9A 1NGYA 3BO8B 4XAWH 4PJHA 4U1LA 2BNRB 2DWDA 1TQUA 1CXHA 1DCLA 1I8KA 4K3HA 2B4CC 3N91A 5GISL 4I0PC 3W3BA 1XGQA 3C6SB 4JAMA 5GS1C 1E65A 1MXDA 4CMHC 2PO6A 4NJAH 3ZQWA 3WG7B 1SUJA 3GLDA 3PHSA 3RVXD 5IW1A 1H6UA 1BVNT 3PABA 4JN2A 3VXOB 4X6DA 4K4KA 1XAKA 4S1RH 2BRQA 3ZT6A 4G6FB 4GRWE 4JPQA 3OF6A 5DWPA 4DHLA 4GI9A 1FA4A 3ZQ9A 3CIQA 3H9SD 3NABL 4FYTA 1GYUA 5E5RB 2J7LA 3H0TA 2AJSL 3UJTL 1AGCA 3VB9A 5IESL 1HILA 3DSNB 1YYCA 2C1OB 3QUYD 4YHZL 3AM8C 4ZUSA 3J7HA 3MMEA 3SKOB 2YZ8A 3VGBA 2OPCA 5I76A 5MEOB 1JWUA 3KYOA 2O61B 2GJPA 4RA0C 1BBJA 3DUSB 3FUFA 2VLLA 4F8OA 5IM7A 1F02I 3I6LE 2JJSC 2PWGA 4APQD 1JUFB 4HKBA 1GY2A 3DJZA 3IMUA 1KCUL 3MRLA 4JPIA 1LYQA 1MFEL 1T1WB 1NC2A 4ANKA 4XVJH 2DMHA 1KJ3H 4PWJA 2R2EA 2FK9A 5C97A 1G6RH 4PRHE 3HG3A 4NM4L 5FFLA 2FECL 4HETA 2DDQL 5DDHA 4IIQC 2BY3A 4L3AA 5EU4A 2BIOA 3HHRB 5KSVB 3MV9D 5KBMA 2ESVE 4PJ8C 3G6JB 4UZSA 1Y6MR 3QJQB 5DVLA 4AKOA 1BJ1H 2K9UA 5C0IB 1ZLWK 2V2WB 5DT1H 1Y18A 4AUYA 1JPST 4Z78B 1NMAL 4CSZA 4YZFE 4HJSA 3ROLA 4HC1L 3SDDD 2Q76A 3K4AA 4CVZA 2WHVA 4PUBH 4K5NA 1YEKL 1Z9NA 3HZVB 1JNHA 1U6AH 4HIXL 1SFDA 1ZDQA 1HXYB 5CJOL 5K1JA 2OL3L 1VZIA 3V95A 5HVHC 2QQQA 1QR4A 3HE6C 1NQBA 3FRPB 4YSQA 1D9KA 3VCLB 3UIZA 5F3FA 3AMLA 3LH2L 4NQSB 5FW6A 4BFEA 3DX0A 4NI3A 3TN0C 2DBJA 4WSKA 4DETA 1SRDA 3FK3A 3QIWC 3L2MA 1JK8B 3H6JA 3CAFA 5E6RB 3EDKA 1F1AA 1E27A 4AIZB 1IKFL 2YK1H 1IM9B 1AQMA 3GMLB 2W92A 1SJXA 3LNDA 3V10A 2PTUA 4NN6C 4PLKC 3L1OH 1LMIA 5C08A 1VJSA 2HG5B 3C60A 2DQHH 3QDJB 3HCVA 3SQOH 5I5MA 1LO0L 2IMNA 4M6AA 2EH8H 3Q6FB 32C2B 2ENYA 3I9GL 1FNEA 1JGEB 1CDCA 3MOBH 4H1LH 4S0SD 5FK9B 2GJ6E 2KUTA 2G2PA 2HP4A 5D2LE 2WBJC 3ARED 5DRXB 5T1JA 2XDHA 1XZ0A 3H85A 4H20H 3VXSD 4L4VE 5B38B 3QXDB 4L3CB 2IPTL 3KHOA 4DZBA 3OMNB 4QTIL 1JZ3A 4W9LC 3EJSA 1A1NA 3SDXF 3DBXA 3V0WL 3G6DL 5D7SL 1GY1A 4I5BA 3WYRA 1U8NB 1XH3A 4ODHH 4FG0A 2MTPA 1FP5A 4NQXB 3RUGA 3MBXH 1NEUA 4YHPB 4QIRA 2J43A 2BERA 1CS6A 3HBZA 3KPNB 1ZDSA 4CA4A 4M62H 4Z7QB 3V52L 1DANT 3RIFK 1AR2A 1M7XA 3O6FB 4PJBF 3QQDB 1QSED 1ZHKA 3EJQA 1FG2B 2P5EA 4FL4B 1QI5A 4GJTB 4LEBA 3QDHA 1FZMA 4LBEB 2YMTA 2SEBB 3TWCH 1R17A 4HCRH 2FWUA 3FT0A 3V5DB 4NP4L 3DPDA 2NXZD 2OFQA 3P9LB 2DLFH 2Y6SC 2G4EA 5CEXA 2YBRA 3L2LA 3WHXB 4KDVA 4CSSA 4J3XA 4A39A 3SPVA 5I66A 2RBLA 1TQTA 4BGLA 4AMKH 1KLGB 1HT6A 2C4FU 3L3KB 5I1IL 4EN3D 1VACA 1R3JB 3D12B 3AJ7A 4F8PA 1JDCA 2W9DH 2OCFD 2Y5EA 1P4BL 1K6QL 4MAZA 1UQSA 1JXFA 3IFOA 5AB1A 3CU1A 4PR5A 2BNQA 4X6CF 1MCLA 3ZHFA 2CO6A 5MEQB 1C1EH 2QDWA 3O0LA 3OTTA 1BV8A 1WDAA 3P2DA 2BZDA 3LKQB 3R8QA 2WIIA 2CGYA 1U8CA 1SY6A 4WVRA 3UAAA 1NCUA 2X1XR 5LAXA 3S4SB 1SBBA 3HG1B 5T1LD 1EERB 4RX4D 3ZDWA 2XACC 4G6AD 5T1KD 4HUUB 3UL4A 4KVCL 1S7XA 5FWQA 3BKYH 2HSIA 2MJWA 5DHYA 5PAZA 4KKNA 4F15C 5J6SA 4QCIA 1E3XA 2LLLA 3VI3B 1S7SA 4WY7H 2DI7A 3E38A 4OZFH 1QA9B 1RZ8B 3UPAA 4UI2A 4DPRA 4KKBC 4IRSC 3VFMB 4UOZA 1TEYA 1CD1A 4WZ9A 2RACA 4E9QA 4EI5D 1OSYA 4XNMA 3DX7B 2PTVA 5JQIB 4XMUA 5GGQL 5KYYB 1ONQB 4KQ0A 1MW1A 2XN0A 4NFCA 5AW2B 4P8QA 4NYLB 3VI4B 2LFGA 1BVKA 2I7SA 3HZKA 1NLBL 1TTBA 4JQIA 3PFUA 2BSDA 5LBSL 3I9PA 1I8MB 1G7HA 1MHPL 1DQJB 2WQXA 3FSAA 4K94C 4CU6A 4HPHA 1B4LA 3NH7H 3MUZ1 1H3WM 3UTZA 1PG7L 2KZKA 1C12B 4D0BA 3L3DA 1NGWB 4MDIA 1G7QB 1CDHA 1BLNA 2PCFB 3P4MB 5LCVL 1ZLSH 4L37B 4JO5A 4XPAH 2VSKB 2K8QA 3ZE1F 3TYFA 5TK2A 4XP4H 2E9WA 2YRZA 5FGCB 1E9PB 1IFHH 3AQZA 2WYHA 5K69A 3S5LB 2FR4A 4AQEA 1WUZA 4JDEA 4Y7OC 3HHSB 1I3V