1MZZA

Crystal structure of mutant (m182t)of nitrite reductase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
334
structure length
334
Chain Sequence
VDLSNLPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVSGTAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVAVMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGTAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The High resolution Crystal Structures of Nitrite Reductase and its mutant Met182Thr from Rhodobacter Sphaeroides Reveal a Gating Mechanism for the Electron Transfer to the Type 1 Copper Center
rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
total genus 87
structure length 334
sequence length 334
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1mzzA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1mzzA02
3OM3B 1DYZA 4F7KA 4YSEA 1HFUA 2I85A 2QPDB 1JZFA 2FNWA 3NJHA 1PZBA 4DP2X 1WS7A 6PAZA 1GS8A 4JHUA 2XVBA 1XB8A 2PCFA 3UAAA 2QDVA 1GY1A 3WNIA 2WO3B 3OD3A 4HHGA 4YSCA 1J9RA 2XUWA 4NAJA 2FTAA 3G5WA 1TU2A 3N55A 2FQFA 4M3HA 1EHKB 1CYXA 7PCYA 2IWEA 1QLEB 3ABKB 1NWOA 5F7AA 1PLAA 5IY5B 4YSSA 3PPSA 3MX0B 4NB7A 4YSTA 2GB2A 2PPEA 3S3BB 4DP5X 3NYKA 3CG8A 4YSPA 2HXAA 1PCSA 1L9SA 2YAPA 3AZUA 4KO6A 4YVUA 3X1EA 1FFTB 6PCYA 2EINB 5TK2A 1IBYA 3QJUB 2HLEB 2FJSA 2UX6A 4P5SA 2YAEA 3BQVA 1BAWA 3QJVB 5ANHA 3JTBA 2X87A 1JXGA 2PP9A 1X9UA 1TEFA 3GXUB 1N70A 2MRYA 3HEIB 4HAKA 1BYOA 5I6OA 4DP1X 5AFAA 1OE3A 2YAMA 1M57B 2H5UA 3FPXA 4KOBA 4E9RA 1BXVA 3FU9A 4GYBA 2J5WA 2ZOOA 4W9ZA 4N4YB 1W6WA 2IDQA 2XXFA 2HX9A 4HIPA 1OCRB 1AAJA 2AVFA 2XXGA 5B1AB 1JXFA 3FQ1A 2BW4A 4A2DA 4BXSV 1RZQA 1A4CA 4P5RA 3OMAB 3NJGA 3FSAA 3SBPA 4RH4A 4UAHA 1HAUA 1E65A 5PAZA 4MFHA 2YARA 4KNUA 2TSBA 2BWDA 3X1FA 3CVDA 4DPCX 2HX8A 4A2FA 3ABGA 1NIEA 1OE2A 2FQGA 2I7OA 3GDCA 5LDUA 2A3TA 4DPBX 2VSMB 3IN0A 2EIJB 2X88A 2DWSA 4ZK8A 1YLBB 2PP7A 2NRDA 4W1TA 3H4FA 3ASOB 3NJNA 1DZ0A 2P80A 2P80D 3H56A 3X1NA 4JKNA 5F7BA 2ZWNA 1SFHA 3ASNB 3NSFA 1CUOA 4HHWA 1L9RA 1NIDA 1JERA 2IDFA 1W6LA 1KBWA 2CALA 3ZX1A 4QLWA 1BQRA 2FQDA 1ASQA 2XX1A 2PPCA 3T6WA 4E9VA 3T6VA 1AZCA 2CAKA 2IH9A 1WAEA 3WIAA 4DP4X 4DP0X 1SHXA 2GC4C 3HB3B 2J56A 4KO7A 2YAFA 1J5DA 1AR1B 1PNDA 1NIBA 1A4AA 4A67A 2Y1AA 3RYMA 3QJRB 5I6KA 2PP8A 4UF7C 3FQ2A 1ILSA 4GP8B 2YAOA 1ET5A 2FT6A 4BXVA 2FWLB 2QPEB 2BZ7A 2YXWA 2N0MA 4FA7B 3CVBA 1PY0A 3ABMB 3NJIA 1V55B 5I6NA 3UACA 2AFNA 2BP0A 4AX3A 3X2QB 2CUAA 2UXFA 3T6ZA 1AZBA 2H47C 2BHFA 2BP8B 2E86A 3QQXA 3CDZB 4A68A 2BO0A 5FC9A 5PCYA 1E5ZA 3JT2A 2IH8A 4BWWA 1BEXA 3NSCA 4E9QA 3T6XA 3ERXA 2EIKB 5D4HA 3S8FB 2HZHA 2Y69B 1MZZA 4L0PB 1AANA 1ID2A 2YQBA 3PCYA 3TU6A 5AKRA 3V9EA 3T71A 1IUZA 2GI0A 1L9PA 3FS9A 1V10A 4BDVA 1URIA 2BP0B 4CSZA 2XV3A 1TEGA 2VW4A 1N68A 3KW8A 1JZJA 2VM3A 1OF0A 2GIMA 1NZRA 1OOWA 1W8EA 2IDTA 2GBAA 4G7RB 1PZAA 4DP7X 2EILB 1SNRA 1VLXA 1JZIA 3AG2B 1SJMA 2W8CA 1XMEB 2UXTA 2YAHA 1JVOA 1L9OA 4K9JA 5I28A 1ZPUA 1KYAA 1M9WA 4X4KA 1PZCA 3WKQA 2AZAA 1BXAA 1CC3A 3IBOA 4A2HA 2VW6A 3PAVA 1KV7A 1V54B 3TA4D 1MG3C 4A2GA 4AZUA 1NDTA 5E9NA 5I5IA 2PLTA 1GYCA 2XWZA 1AQ8A 1EZLA 4F2FA 1RKRA 3ZIYA 4WKXA 1NIFA 3NP3A 3DTUB 3WG7B 3CVCA 4G7SB 3QPKA 2W88A 1ASPA 4BWUA 2R7EA 3ZDWA 1RCYA 1NINA 3UAEA 3QJQB 4YSRA 2BW5A 2ZONA 4PAZA 2LLNA 3FQYA 2RACA 1J9QA 1ET8A 4YSUA 1IBZA 2FT7A 1PLCA 5B7FA 1JZEA 3AG4B 1KDJA 5I6MA 1BXUA 4YL4A 2B3IA 1QHQA 2CJ3A 2OCCB 2YAQA 3FSZA 4GP5B 3X1GA 3NT0A 1E67A 2IWKA 3ABLB 1NPJA 5B7MA 4WTQA 1XB6A 2QT6A 3SBRA 1NTDA 1ADWA 3WNJA 3CDZA 3FU7B 3UADA 4YSQA 4G71B 4AKPA 5I5JA 1T5KA 3EF4A 2PPFA 3ZBMA 1IKOP 1KDIA 2AANA 2GC7C 2R7EB 4BK5C 2GHZA 4ENZA 3NJMA 4EF3A 2JFCA 4UANA 4GXFA 1GSKA 1AS7A 1GY2A 2BWIA 5AZUA 1GW0A 1A8ZA 2DY2A 1ETJA 2IDSA 4BDVB 4BWTA 2Q5BA 4KNTA 3AW5A 1BQKA 5EHFA 2IDUA 5I5MA 2FT8A 4YSOA 1AACA 3FSVA 1MDAA 3IE9A 2XLLA 3FYEB 2PPDA 2XYBA 5B1BB 1JOIA 4KO5A 2Q9OA 1SF3A 1MZYA 3OQRA 1B3IA 1PF3A 2TSAA 4M4RB 2YXVA 2XU9A 4GY4A 2VW7A 2XV2A 3EH4B 1XB3A 4GP4B 1BQ5A 2ZXWB 1NICA 1JZHA 2IWFA 1BYPA 3KW7A 5B1KA 4F2EA 9PCYA 4A66A 3NJLA 3FT0A 4E9WA 1RZPA 5I6PA 4DP9X 4FAAB 2HRGA 3OMIB 2OJ1A 1AZUA 2CBPA 3BVDB 3AG3B 2UXGA 1IC0A 2DWTA 3TBBA 1OCZB 2I7SA 3PLYA 4KOCA 5B1JC 3PAUA 3SQRA 1ZIAA 2B08A 1KCWA 3C75A 1FWXA 4HZ1A 4DP8X 7PAZA 2IAAC 2WO2B 4CSPA 1NPNA 4YSAA 3QJSB 3FU7A 1GR7A 1AG6A 3PXLA 1AZRA 3UABA 1OV8A 2VN3A 1GS7A 1ILUA 4G72B 2PCYA 1AZNA 1R1CA 2WSDA 1AIZA 4YVNA 4KO9A 3WI9A 1E5YA 1AS8A 2H3XC 2AZUA 1WS8A 1UATA 4DPAX 4AI7A 3IN2A 1ET7A 2BZCA 1KBVA 3SBQA 4QKTA 1L9QA 1WA1X 4KNSA 3UGEA 4TXVB 2VMJA 1ZDSA 3AG1B 3CZUB 1AOZA 3NJKA 1E30A 4G7QB 1M56B 3D12B 2XV0A 3NSDA 5A7EA 1KGYE 2QDWA 4Q8BA 2GSMB 4G70B 3T9WA 4AKOA 3FU8A 2DV6A 3DKHA 4HCGA 3MBWB 3N2JA 1L9TA 1GS6X 1CURA 1OCCB 3GYRA 2DYRB 1J9SA 5I6LA 1SF5A 2VM4A 5B3SB 4E9TA 3U25A 1SHWA 5D4IA 1ZIBA 3V9CA 1F56A 5TK4A 2J55A 2EIMB 1ZDQA 1SDDB 4A2EA 4E9YA 3IEAA 4E9SA 1JXDA 2HX7A 3PAZA 1I53A 1WA2X 4PCYA 4N8UA 1KCBA 1PMYA 3TASA 1HAWA 1ASOA 1AG0A 1A4BA 3OMNB 1X9RA 3H4HA 3EH5B 3S3CB 1SFDA 3S3DB 3FSWA 1J9TA 3DIVA 2PPAA 2UX7A 5B7EA 4AKQA 1A3ZA 1OCOB 3AY2A 1PAZA 2FQEA 2OV0A 1J5CA 2HRHA 2XX0A 1TKWA 3X1BA 1WA0X 2MTAA 2J57A 2DYSB 3NP4A 1FA4A 1SDDA 1OE1A 3EH3B 2JXMA 1JZGA 4HCIA 4HCFA 2BP8A 1ZV2A 1QNIA 4JHVA 5I26A 4DP6X 1CYWA 3WKPA 1NWPA 1JVLA 1MG2C 2VSKB 1NIAA 1AS6A 3NJFA 3S8GB 1PLBA 4NERA 3QJTB 1A65A 4HALA 3NSYA 2JKWA 2CCWA 4Q89A 4YSDA 3TBCA 3L45A 5D4JA 3NJJA 2UXVA 1PNCA 3FYIB 4E9XA 5B1JA 8PAZA 3EHBB 3FPYA
chains in the Genus database with same CATH superfamily
4DGYL 3TC9A 3N43F 4MVBD 4N5EC 2A6JA 4ZMAT 4L4VA 4XX1E 4AT6A 3VDBA 1AHKA 4HIQA 4XO8A 2CUIA 2FNWA 4GRLA 4KKCD 1NBQA 1G7IA 2VLKE 4GAGH 3NK3A 4Q14A 3NZ8A 2DI9A 2RFXB 4ZFGL 3DX3A 1AC6A 4BA8A 4NFBA 3OGCB 2WBXA 2P4AB 3G5VB 2R2HB 4FFYA 3MJ8B 5FHBH 1A7NL 3UJJH 1B3JA 3E1F1 5IBLD 4UTAL 1A1MB 1N59A 4RSVA 4X7SL 4X9HA 4JPKH 3BUDA 4U7KA 5KYYB 1AKJA 2B7DT 5MI0B 1JRHL 2ZCHH 2AKRA 2WZ0A 3KYOB 3ZMNA 3BHBB 4KZEH 1VSCA 4H1LB 3HRZC 4WWNA 1JCVA 1UB5A 4F7CA 3LH9A 3PIQB 4FQXC 4B3VA 1I31A 3F62A 3EIFA 3HHSA 1A7PL 1FHGA 4F80A 1PZUB 2Z93A 4XAWL 1E8XA 2DW5A 4UZUA 4OZHF 4MLSA 4KHTH 4P5SA 2VUOA 4G8IA 3QP3A 5BOJA 2IWGA 4LF3B 2KZWA 4RWYH 3ZO9A 1DTUA 1DL7H 2CR6A 3PRZA 4HAKA 1DUYA 4P9ML 4A39A 4N2NA 3SBWA 5I8CB 3KLHC 2Q3XA 2YAMA 5EU6D 3L95B 4GMSH 1K5WA 2R69A 4LHUA 3MBEB 2Z0BA 1H19A 2E6JA 4GG8B 4O02H 5E1GA 2W5PA 5I1IH 1EERB 3LRKA 3P0YL 1FRGH 3DLQR 4LZKA 2DBLL 1A4CA 4NKMB 1CBJA 4ZRGA 1W72A 2ORBH 1M3IA 1YEDA 4MMYA 5JIQA 3NBNA 2NX5B 5DD1L 3W82A 3D39D 4X98A 5ESVB 2MFNA 4XOEA 2DIEA 4KKRA 4S1RL 3FO1B 4N1CA 2XTJB 1R6VA 2MSPA 3CSFA 2TSBA 4R8WH 4Y2OB 4ICWA 5GZND 1KZQA 4LVNB 1MI5E 2JTYA 3AROA 3MCKA 4MCYB 4NUQA 3GGWA 2GY5A 2R83A 1NGZB 4OR1A 1PGRB 1RZJC 1A7QH 3DX7A 4URKA 3QGVA 4MA7L 1R9FA 3QPXL 1QWHA 5HVWA 1VJSA 3T5WA 4PJ9D 3CFKA 1G94A 1QI5A 4XPFH 4JE0A 4NKMA 4WUUD 5LGJB 4RAHA 4XVSH 2CWRA 1J8HD 1LE9B 3FCGA 4OZGE 1GPOL 2XZAH 1BVKA 2VISA 4JKNA 4X5XB 1WEJL 1RIVH 1SFHA 4G6JL 4HUVA 3D39E 5L6YH 1I75A 1QG3A 2XWJB 1ZLWK 1AYOA 1EHNA 5F6HI 4HS3B 4PD4J 2CDFA 2J6EA 2AJXL 3Q6GL 4QLWA 1R24B 2VLKB 1E8WA 5B38A 4JFYB 3D50A 2FDBP 3WXWL 2XX1A 4LB8A 4MCYA 4I0PB 2BNUB 1S5HA 5AVRB 4YC2B 3GUTB 1T04A 3NEXA 1WAEA 1Q9WB 4HKBB 1A9BB 2YD6A 3DX7B 4G6KH 4GW5A 5IUCA 3JYBA 1LWJA 3BN9D 2ZAGA 5BQ7A 4OF3A 1QEXA 4ZS6C 2FECI 4A67A 2LE9A 4JUSA 5IBTH 2KS0A 3VQ1C 1G6RB 3NFPB 4IJ3C 4GT0A 3H9HA 2LAGB 1YY8B 3UFIA 2QPEB 2X1QA 3MRJA 4Z7QF 5F6IC 4YHLH 3ULVD 2NY4D 1S7QB 4GMTL 1I1RA 3LRGA 3LKOB 4BFBD 3P30L 2NW3A 1KCRL 2BP5M 3OKEB 1MQKL 4I3RH 3KPMB 2X4OA 4H8WH 4K55A 3DOHA 3QT2A 4PREA 3D39B 4BFRA 2VDNH 5IM7A 2WLZA 4Z9KB 5FC9A 3SDDD 3S3PA 4MKTA 3MRFB 5KSAC 4OQTA 2ADFH 4DGIH 1Q9LB 4XE5B 4N2AA 3O4LE 1QSED 3BSZL 1LO3H 1D5MA 4XCFL 5E1IA 4ANUA 1R3IL 2DH3A 4Q74A 2DD8L 3GRWL 2GKIA 4KX9A 2V7NA 3VW3H 1BHGA 4JFOA 4ZXBB 4ZD3H 4LPTA 3LH2L 3QORC 1URIA 3TFKD 4KZCA 4KTGA 5IESH 3QZLA 3BWAA 1KENH 3WEOA 3JUYA 2ZUUA 4NNYB 1YAZA 3KWVA 3REVB 4XPGH 4HCRA 5EH1A 1U8OA 4B5ZA 4N8VG 5B8CC 3DRQA 1JZ5A 1LWRA 2XJLA 3IFOA 3HJEA 5I1JL 4PJAA 1JZIA 3AU1B 3ZE1E 1SJMA 4FJYA 4HH9A 5SWZB 4PJDA 4F92B 2BCKB 4UT9L 2Z31D 4HLEA 2QZQA 4Z5RA 1IE4A 2YMXL 1KGCE 5HDBB 43CAA 2ICES 3WKQA 2N1TE 3NOIA 4A2HA 1MNNA 2YRBA 2XWCA 1KV7A 1JTOA 1UXWA 4HEPG 5IT2H 4M1DL 3MRDA 2XWZA 1DSFL 3E8UH 1RERA 3MJ7B 5KN5B 3PWPB 1FZKA 4QO1A 2CPCA 1YDPB 3WG7B 5BOZG 1CQKA 4BRJA 4QGTA 5D93B 1CBVL 3AT9A 2P5ED 2R1WB 2ZUXA 3QCTH 4MGXA 4PFEA 2FLRT 5KYUB 2LLNA 1K8IA 4YSUA 3BZ4A 3NJXA 3SE8H 3DSFH 5IVOA 1CGVA 2F7IA 3Q2VA 4HT1L 4IJ3B 5ID1A 4AWJC 3POHA 2OCCB 4GP5B 3ZDXF 4BSWB 2P8MB 2WQAA 4UBDD 4ZZKA 3LRLA 4NRYA 5CLWA 3C87A 2KT6A 1YNLH 2YKLH 1ZXQA 5ERWB 1HXYB 1H3VA 1NFDF 4K3DL 5HHMB 1W0WB 3FFDA 3GIZH 5FCUH 4OT1L 3ROLA 5CU9A 1D7BA 4PJ7F 1Z1WA 3UADA 3FRUB 5BVJA 5DD6B 3M8OH 5JOFA 3B9KB 1HKLH 4HIXL 5D1ZA 5GGSB 3NCYP 5CLXA 1LO3L 3LNEA 4PLKC 4LASL 3DVGB 3ATFA 2PCFB 5KZCD 1FLTX 5J1TC 4WO4A 5IQ9B 5CCGE 5DEGB 3HZ3A 4MJ6A 3IKCB 5I76A 2VXQA 4HH8A 3MR9B 4GRMA 5AZUA 3T3PF 1T7VA 2OULB 3CVHA 4JY6A 1BVLB 4KVPA 4QTHB 1MWOA 1UJ3B 4DJMA 5E23A 4CRPA 5H8DA 3VD2A 1DVFA 4WUKL 1YMHB 1CU4L 2CLZB 1BQKA 3OHMB 2N4IA 3BW9B 3ML9A 2AJUL 1KCRH 4TTDC 4IK7A 4F2ME 3SDAC 1FBIH 1LEKB 4LSSL 4X9BA 4S1SH 2B0SH 3MRLB 2AVGA 3QIBA 1A4JB 1DANT 1S2EA 4FYRA 5I1EH 4LBEA 2HH0H 3T77A 1KLUA 3FCTB 2AEOA 2O5NA 3AACA 4D9LL 3BPLB 4M56A 2C7UA 4ZS7H 5AVTB 5C0DB 2GK0A 3WSQL 3PWPD 3GMNA 1NOLA 1ZRUA 2A6JB 4N22A 4DKDC 4LLWA 3KGRA 2I60H 3ZHFA 5F1OB 3MLRH 4MAYB 5LWYL 4W70A 3WEAA 2V7HB 3N5AA 4ZQTA 1WFOA 1G7QA 5T1KD 2HTKD 4AEHH 2YA0A 4A63A 1OSZB 5ITFB 4P4KB 1K4CA 2Y06L 5GHWH 2C9QA 3OKLB 3PABA 5TDNB 3LB6C 1HHHA 4PJIB 3BH8A 1O7DC 5AALA 4NP4L 5DRZA 3E7JA 2B08A 2F68X 4X6DE 5F0JB 4YAQA 4ZXBD 2XG4B 1V7MH 3TYGL 3L4WA 3N40F 1QLEL 4G9FD 5JHLA 3DECA 3IGAB 2VDQL 3QDMA 2K6ZA 5IB4B 1JZ8A 2ESVE 3DDFA 2QKIC 2BVUA 3GSNL 4WFHE 3SYCA 2D7MA 3D4GA 2A83B 3P54A 3WI9A 1QRNB 1E5YA 3LS4L 1U8LA 1F86A 4FX5A 4GNKB 4Z7VA 2A6KB 3V4VL 3ZGIA 3FU3A 4JHZA 2O5YL 1QFUH 3ILQD 3GBNH 1XX9C 1H3XA 2Z65C 1WISA 1C5BL 5IVXA 4G8IB 2X4TB 3MGOA 4TXVB 2ED8A 3FC8A 4Y5YA 1QPKA 1YEWA 2ZNWA 3L7FA 4JE4B 4IOFD 1NC4A 3D85A 1UJ3C 2DMGA 1BZ7A 3BVNB 1T22B 3H3BC 2R8SH 1HEHC 4KKCC 4CAGA 5HVFB 4MZIA 2CJSA 4Z7WE 4ACPA 4V33A 4EDWH 4X6CA 4UDTB 1MFNA 1XR8B 2G9HB 3UC0L 2PWHA 3D8MA 5CCKH 1FFRA 3EGSA 4H8HA 2Y7OA 2IDCA 3POCA 1NH6A 3QZMA 1JE6A 2ZG2A 4YFLI 3V2AR 2X4TA 3UTOA 5E5RB 3K6SB 3V0VA 4GO8A 5IVNA 2WAHA 4F24A 4OZIB 1F4HA 2EDYA 2QR0B 3ZO0A 3H4HA 3RNQB 3AM8C 3HZVA 4KX7A 5ACLA 4JM2B 5EPMB 1UYWL 5D9SB 1NGZA 2F5BH 1OK0A 1SOXA 2AJSL 3AY2A 3IFPB 3VCLB 4JFXB 2HH0L 1E9OA 3W9DB 2V17L 3X1BA 1XEUA 2C9XA 2IMNA 3CNKA 4QWWC 8CGTA 3P2BA 1QX1A 1JPGB 3RVXD 3UBXA 4WSJA 3SDXB 3AQZA 4OJCA 2A0LD 4OLVL 4LRNL 3RL1B 3T09A 1CF8L 4JZJB 1U3HD 4S1QL 4OQTH 4Y5XA 4DSYA 35C8H 4EZJA 5GZNC 4A7GF 4MA7H 3T8VA 1PLBA 4FP8H 4N0UE 5EF0A 2CCWA 3CH1A 3A0OA 3Q6FA 3WKYA 1CLOH 4K3DH 2J1KA 3WNMA 1S5HB 4BBWA 1Q9KA 4H4NA 2TAAA 4X5LA 3GUTA 2AJSH 5HGDB 5DMGD 2X42A 4OJFL 3VGGA 1JAEA 4N2BA 1F3DH 4QRUA 3Q0HA 2LQRA 4N24A 3ULUF 5AVVB 3RI5F 1KYOJ 1YHPA 4ZOEA 1T66C 3SKOB 1NA8A 3B9KD 4J3VA 2EYSA 4RMWA 1KUMA 3JV4B 1QEWA 2FVNA 1GZHA 5EIIG 3STBA 4Y9CA 2ZZUT 4JHUA 4Q2ZB 4M7LT 3VRIA 4ZUSA 3WMQA 2K8MA 1S7RB 3ZE0F 4UT7H 4F9PA 1O6SB 4QAMB 4Q97A 1CGWA 4AYGA 3K71B 4KC3B 5KS9A 1IEAA 1R5WA 2C26A 1XH2A 1MVFA 1S9VB 2GSGA 2J8UF 1AGDA 1FZJB 3ATEA 4OLYH 4XBEH 5F7AA 3VXPB 1XD0A 3ARBB 4GRWF 4P06A 1C8QA 4YSSA 1DJXA 3PPSA 1P4IH 4N2CA 4NGHH 3NPZB 5E4AA 1MCWW 3KLKA 5EA0L 2VUKA 3ZE2E 4JRYE 2F58L 2O61B 1IIIA 3ECWA 4KHTL 2D8KA 4M1DH 1KG0B 3DUSA 1MQ8A 4YVUA 4Y4KA 4YPJA 5TDOA 2OKMA 2PO6C 4G9DA 3AWEA 4P49A 3DJRA 1HH9A 4JANB 4JM2C 1CLYH 3MA9L 3WIIH 3S6CA 4ZX6A 1L7IH 1THCA 2MMXA 1MWAL 1HHGA 3GTTA 4HW6A 4GSDL 1Z9LA 3NABH 4QXUH 5EU4B 1FN4B 4U0RC 3QWQB 5BZWB 1TMCB 5A16B 2BSSB 5FKAA 4ELMF 1ZSHA 3HEIB 1G7MA 4XVUC 1B2WH 4GXUN 1P7KA 1IEBB 2FK9A 4UT6L 4PWFA 4OGXH 43CAB 5FWRA 4O58H 3HMXL 4L1DA 4NZJA 4KDTA 3BP4A 3O6KH 2X4NB 3EDFA 2NCMA 1JNNL 2VLJD 1CDYA 3G5ZB 3GZQA 4YUEL 5JIMA 3VTAA 4OM1L 4QRPB 2FUTA 2BS9A 2VLRD 3ARGA 1A6TA 3P9LB 4A2DA 3VFOA 5EC1A 5E51A 4TUJA 4WK0B 3ILDA 1YUKB 3UTTB 3US9A 2J44A 2PETA 4DUXA 1NGXA 1S7WA 1CI5A 2HAZA 3C5XA 1IBFA 5AB0A 1HWWA 4AYDC 1T7XA 4AVHA 3AMKA 1MAKA 3U7YL 3FZUC 1F11A 3K46A 2FQGA 5AG8A 4ORZC 2OW6A 5IREA 3A22A 2HG5A 5FS5A 4ZX4A 1FFOA 5L2JB 4EJ1C 4H8WC 3UYRL 4XRCA 1CL7H 3K0YA 2UV3A 4W9DC 1K3ZA 2GI7A 3VFOB 5L6YL 2P44B 5DD6A 3L54A 3FTUA 2FAUA 3GK8H 2H2PD 3IPFA 4FG6D 4JLRA 4LSSH 1M2VB 4NC2B 3FO9B 2Z31C 3NQIA 3CN1A 4BFFA 2ITFA 4KUCD 3T3MB 3V9FA 3TVMA 3P3TA 2EO1A 3RGVA 3BD5A 3EGDA 3ZX1A 3P1VA 3HZKA 1BOYA 4QAWA 2FIKB 1DJYA 2GT9A 3CXFA 3SN6N 3P4LA 3BPOB 2ZSVB 2ITDA 3G6JA 5IZ7A 3C5ZB 1UUNA 1FFOB 5L2JA 1P84K 5E2UL 2OZ4H 2QQQA 1BVOA 3MLWL 4PJ6A 5C9JA 2ZWLT 4M6ML 2QSVA 2I26N 3JZ7A 3UIZA 1TOXA 4CUCA 4S1RH 2Y1AA 1FDLH 5B39G 1VIWA 2FT6A 1LXMA 3IYLW 3DV4A 1D5XB 4MMZC 5FA4A 4ZYKA 3ULUH 3GF8A 5F7NC 3IVKB 1SMAA 4MA1B 2AFNA 3JV6A 1N0XL 2AXGA 4ZMOA 5DMYA 1XF4B 3W39B 4OV6F 1CLYL 5BMFH 1NUGA 4MYWB 4X7DC 4FNSA 2E6PA 5JTWA 3ZHKA 2Y4SA 1UXLA 1FIGL 4XBPB 2XQBH 4PJGA 1QVOA 4UUJB 3HKZA 2YQBA 1GZQA 4IRSC 3UJTH 3NSXA 4AGQA 1PQZA 1IGCL 1AD9A 4L5FE 1DQDH 1AFVL 2ITCA 4WI0A 4Y2DA 4XGZB 4JQIL 5C0BE 1MRFL 4GW4A 5HDBE 1L0QA 1A7PH 3JV6B 2W07A 3BJ91 3KW8A 2DZEA 4F7MB 2RQ8A 5HDWA 1A6ZA 4PP1C 2VZ3A 3D51A 3FQ4A 4HX1A 3EBGA 3D3VE 4GAJL 1OOWA 3LVEA 4G7RB 4KUZH 2E3VA 4I1PA 1VB9A 1QRNA 5F1KC 4KRPC 2J20A 4A04A 2IGLA 2WIIB 2C1PA 4LVHB 2OMWA 5DK2B 3NFNB 5GS0H 1CD0A 5C0JB 2P24A 4FQIL 1USQA 4UTBL 1XGQB 2GJ6A 1JHLH 4XWOC 4U33A 2H3KA 2ZOLA 4PJFE 4QEGA 3SJVD 1AQ8A 2BY3A 1JDDA 3IKKA 4GW4B 1LP9B 1VFMA 5IHHA 5KJRH 2A73A 2VR3A 4V1DA 3FB8B 3TO4D 2AEQL 4F7MA 5TD4A 4F8PA 2JXMB 1F2QA 4FJZA 3ZDWA 1FVDB 3BXNB 1HE8A 2BW5A 1M4KA 2J4WL 1HXKA 2FL5A 4APXB 1OSZA 2C9VA 4JFFB 5LG1A 3A3YB 4Z78B 3D69A 3EO1A 3NFNA 4PJBE 3FSZA 3BAIA 1XGRA 1FYHB 2Y3NA 1S7SB 3SGDI 2E7CA 2F8OA 3FUIA 3OPZL 4WTQA 3B9AA 3AABA 4Y9EA 4WSKA 4DETA 3KCPA 3SY0A 4G8EB 2EYRA 4B50A 1T5KA 2PPFA 3QJXA 3BUBA 3EGXB 3QIWD 4PUBH 4AENA 3SQBB 2NXYB 1QLFB 5I0XA 5I16B 3HS0A 2E4TA 2D3VA 4RWHA 2TRYA 4AIZB 5LGHL 1YEKL 3ARFB 5M7QA 1QR1B 3MROA 3IDYB 1PZ3A 2A6KA 4MYPA 4X9YA 2Q5BA 1KCVH 3VFRB 4UQ3B 1T0MB 3CSYA 5E6YA 4YIQB 4MXWL 3SZKC 4FKKA 1NMAH 1MJJA 4LSPL 4EBQL 1FL5A 3C5ZD 3S98A 2YRLA 4RSYA 2Y9RT 1I1CA 2FT8A 4B27A 4HXAL 2DMBA 3FYEB 1I8KB 4N1HB 4NZTL 3FO1A 2ZUQC 3C6SB 3OQRA 1YEHL 1MCEA 3MV9E 3SY6A 3B7UX 1XZ0B 1B90A 1DN2A 3MRRA 2Q8AL 1T1XB 2D4FA 3D2UD 4KI1A 1KFAH 1CE6A 4OD2A 4FQXD 5FO8A 3O3UN 2AK4A 2XVKA 3IRCA 4PY7B 1FZMA 3UTSB 1UC6A 4F27A 4NXKA 2MPVA 1NUDA 3UTZA 3MUY1 4JN1H 2ZJSH 5CJQH 5EO1A 3VYNA 1KPRA 1PU0A 1MCOH 1NCHA 5DD0L 4LARH 3VFMA 4HSQA 4D94A 1G7JA 3VSUA 2F18A 2RD0A 3U46A 3V95A 3VXSA 2RCSL 3RVTC 4ZMPA 3WLBB 3GZPA 4YE4H 4R0LC 1GTNA 5FYJH 4EN3D 2AF2A 2ZXBA 2ITEA 4XOAA 3VJ6A 4U1LB 5JHBA 3S8WA 4JN1L 3D18B 5EU6B 2EDDA 3BD3A 3OKDB 1IC0A 2Q1EA 1J0YA 1WV7T 1X5XA 5E6ZA 5KUKA 1OAZH 2WQWA 2CBQA 5J8OA 2F1AA 5H37H 1QRNE 1WH0A 5GJSH 1ZSDA 1NM4A 3QNZA 2EH8L 2I24N 3P0YH 4JKKA 3V0HA 1IEAB 2W9DL 4U31A 1KFAL 3WN6A 4FYTA 1NPNA 1TJXA 2CMRH 5GS2H 1G7PB 4QWWD 2XFGB 2Z7ZA 2XI9A 5F93C 5T3XL 4P8QA 2WLNA 2VMDA 4POUB 4L3EB 4XP9L 3GI9L 2FYYA 2CDEB 4MXQD 3VI4B 4DAGH 5K1VA 1I7RB 2VDRL 2OTWB 3NACL 2X4PB 4V1DE 3KNBA 4K3HA 3SOBL 3RUGB 5I1EL 5L0QC 5EU3A 1T4KB 3ARED 3U4AA 1B4RA 4XVOA 3TN0D 4FLQA 3LN9A 3FB5A 4JQIA 2Q87A 3KBPA 4XNXH 3KBEA 1QABA 4PJ8B 4GI9A 1SMOA 4N2IA 4LCCC 2OQJA 1F3JA 1X9LA 1IL1A 4Y2LA 5MENE 3NTCL 1MIML 3I6KB 4Q0XH 1E50A 1FN4A 5BZWA 3S36L 3TJEL 4FS0A 2ZP0T 3BD4A 2DV6A 1BAGA 4OF7A 4NO5B 1MY5A 4Y4HD 3FRPB 5TQ0H 4IRSD 1DQIA 1JPTH 4YK4B 2E9GA 3O45B 5T1LB 2NT0A 4RDQF 2P8LA 1X5MA 4R7NB 2ZWKA 4L8BB 2OXHB 3SE6A 3QH3B 2N7SA 3MKKA 3MBEC 5FUCE 5DS8A 3RHWF 1OF2B 5I0WA 4R9HA 1BM3L 1EO8L 1E4XL 2CNYA 3FMGL 4ELDA 4JM2F 3HG2A 2KPWA 2HX7A 5FB8A 1RMFH 1WA2X 3RIFF 5HHPA 1PMYA 2OTPA 5SWZA 3DUHA 1DQJB 4DEPB 3IS1X 3QNYB 3HR5B 4AMWA 4PRNA 1H0DB 3S3DB 2ZCZA 2HG5B 1K2DA 2F5AH 3KBHE 3ECVA 5KVDE 4HUCA 3LZFL 2I5YL 1LYQA 1OB0A 1UT2A 4LVOC 4YBQC 2MTAA 4YX2H 2YQ3A 5CP7A 3ZDZB 2BVOA 4TTGA 1ZV2A 2UZIH 1SEQL 3ESPA 4X80L 3T6QC 5A16A 3E9UA 2GPZA 2RJMA 3CQFA 3RTQA 5MERB 2X4QB 3KYKL 3CX5K 3SE8L 5DO2C 5A2BA 1SRDA 1YMMD 4H7VA 4H88H 4LNVA 5D55A 3QJTB 2DJUA 5T3ZE 4H20H 2XY2A 3VXSE 1XMWA 3EOYG 3FQRB 3CZSA 1F4XH 3D06A 3NJJA 4P2QD 3N50A 5D1QD 1DDHA 2MHAB 4QRPA 4JVUA 4F7KA 4P57A 2I85A 2VDMB 1A02N 1X5YA 3GBNL 3N9GL 3N85H 4RISH 4ZTOL 5I0ZA 2VM9A 2ZYSA 3TBVA 5D2NB 1GS8A 4R5XA 5KYNA 3B8SA 1XB8A 3I74A 1KXVA 2WGXA 4WZ9A 1O7DE 1JK8A 1KTBA 1T1WA 5KBLA 2CBTA 3HLAB 5I1JH 3VD1A 3B5GA 2X9YA 3BQUD 3G5WA 1OHZA 5H94A 4P5MB 4IHBA 5DFTA 4YLQT 3FJTA 4N87A 5HPOA 1NWOA 4LL1A 2X6MA 4HKZA 4PRHA 2W9EH 3U0TB 1T03H 3WS6C 1U33A 2EH7L 4PJ9B 2YD7A 3DBSA 1W0VB 1YEHH 1CDGA 1ZA6B 4ZAKB 1NAMB 4YNYA 3APMA 3LKQB 3F12A 1GYVA 4UYPA 3Q2WA 2DWYA 5IBUB 1MFAL 1AIFB 1MHPH 1YQ2A 2J1YA 2BWQA 1PQZB 2NUPB 4X7CC 1JK8B 5GPRA 1KN4H 3E80A 3TT3L 4XGZA 5FYLL 3U82B 1CG9B 4UIMA 3QUGA 3CBKB 2WUCH 4AL8C 4UM8A 4B0MB 5EBMB 4M8QA 5A2CA 1KLGA 1J86A 3IETA 3WEBA 1G7QB 2WLMA 1RZJL 2YO3A 3QDJA 1LTXA 1ERNA 1NAMA 3HAEG 4E9RA 5DMJB 1NFDA 5EN2A 2D4DA 5SWSB 2CNZA 2G4GA 1NCAH 3PWVB 3TIEA 1FAKT 3U0WH 1MPAL 4UQDA 3V55A 2APFA 1OK8A 3HCVB 4S1SL 5JOEA 4GG6F 4AVKA 1MSPA 2GJPA 1F4WH 1LP9A 1QSZA 5J6GA 4FQCH 2J21A 5DZVA 3QDMB 3GMMB 3DVNA 2IH3A 2J25A 1XF4A 3W39A 2VC2B 1KLGB 1RIUL 2XT1B 4P3CL 1WDAA 3EBAA 1I85C 4GW1B 2QVFB 3L4TA 4J39A 5CJ5A 1PL3A 4QD2E 1TYEB 4KNUA 4OCXH 4Z7VB 3UX9B 1NEZB 3X3FL 2XOTA 4JG0H 3HOGA 2B0SL 1QW8A 3GTNA 2AGJH 1PJ9A 2XHNA 3OF6A 4FQ1H 4XWOD 2XN0A 2A38A 3QFJB 4QOKB 4U1SB 1CXLA 2C9AA 1AGCA 4PRIA 5AEAA 3QCUL 4PJAF 4FQJH 1KCKA 2EACA 1MLCB 5DMGC 5JO5B 3U9PL 5FF6A 3CLEL 4LRIC 1QSVA 2ILLA 4OKDA 4LSTH 5F96H 1IAKA 1MEXL 2B1AL 4ORGA 1AKPA 2IH3B 4FFVD 4M6OH 4L5FH 2BLFA 1ZT4B 3F6LA 4XP6L 4YDVA 4FMVA 5G4OA 5H4YA 2X4RB 5KZCB 4S11A 4JG9A 2C8NA 5D7IF 2EUXA 4N3UA 2ICEB 1BQRA 1U3HC 4OZ4A 1QA9B 4D0CA 1U8MA 4WV1B 3QDGD 4K7FA 1U4FA 4JFHD 3KXFA 3OKMB 1EAPA 4NGHL 4A7SA 4NN7B 3Q1SH 3CBJB 5FGCE 4X0KA 1DFBL 1ZJBA 4XODA 3E6FB 3BZ5A 4GT7A 4YDJB 3VYOA 2O72A 2YAOA 3PWLA 3RIKA 1XF5B 4L1BA 3IJHB 3MRQA 4GQPH 4LVOB 1S7TA 1YEIH 3G3LA 5GIRA 1NBYB 1J1XH 3IU4L 5CD3A 4N5UA 3ZDXE 1ECZA 3GTVA 2FYVA 1Z6JT 2UXFA 4WU7B 2M83A 5C9KA 5CM1A 1D5BA 1G4RA 5EORL 1SY6A 4BK4A 3VFNA 3QXAB 2W0LA 5HYJE 3O6MH 2WXNA 3DNKA 1IBGH 5FIEA 1FL6B 3B9VA 2QPFA 4K7PH 3ERXA 4XO9A 5CSGA 3OKDA 2XN9E 4Z0BL 2VRQA 3KYNB 4FC3E 4EXPX 1IGML 3QULB 4AE1A 4YDLB 2ZUTA 3SDDC 4BH8B 2DQHL 4CC4A 3QO1A 5HDLA 3SE4C 4AYSA 1T7ZA 1F3RB 1A4KA 3K1KC 4IU2A 4JFHE 3ULUL 5CEZD 1V10A 3BOVA 1G7PA 5CD3B 4FQPA 1JRHH 1QO3A 2LU5A 1F90L 3LZRA 4QHMA 1FE8L 2B14A 3GB7A 4NNPL 3ILQC 2UZPA 4YZFE 5JORA 5DJ2A 4P59H 5HDQH 4OIAA 2QQLL 2E47A 3ARGC 4PBXA 4Z7UB 4BFNA 4LAQL 4D9QD 1KBKA 1KEML 3SYQA 3U30B 3DHJA 4JAMA 1DO6A 2R4SL 3NG5A 3WNKA 4P3CH 4L05A 1UYWH 5DK3A 4RMRA 1MRCH 2EYTB 4AZUA 5DF0A 4D0DA 3I2CH 3FZUD 1KTJA 3TX4A 1S9VA 3I6KA 1IGYB 1D6VL 2WXJA 4QRTB 1CDJA 1MQKH 2JWYA 5CIPA 5BUPA 1NIFA 4F1SA 5E6IC 3CVCA 3ILPB 5DK0B 4YHMH 4NWUL 2FHCA 2ZOWA 2HT3D 1MRCL 2ZONA 4XXDA 2V2TB 3UTTE 2H0JA 3OLEA 3TEYA 4QRQB 5HHQA 3L4XA 1ETZB 3O81A 5F70A 4BZ2A 4I3SH 1KEMH 4Z7UA 3X3GH 4DOHB 1E9QA 2CR0A 4Y4KC 4IEFA 1QTSA 4WW2C 2XBTA 4R7VA 1WTLA 1SJEB 5D93C 3Q2CA 2VDOH 4X7TB 2IXQB 2QSCL 3VX1A 2G60L 4Y1AE 2DICA 1TFHA 1AOHA 2VC2H 3EJRA 3MRPB 1PKQE 3FAWA 4KKPA 4NO0D 3BMWA 1DCLA 4WLCA 3FTSA 1KNOA 1G7MB 4AYFA 4NQCD 1U6AH 3ZBMA 4RZKA 1AMXA 3VFSB 1BZEA 2VSCA 1RH8A 2B2XL 1XGPA 3DDGA 4N2HA 5KAQF 5CJXA 3OKKB 4I9XA 2YUVA 3RWGA 1YNTF 5EOQH 1VGKA 4J2QA 1JHLL 1ETJA 5CILL 1W8OA 3B2XA 2QFRA 2OBGA 5FGRA 3FU5A 1A1MA 1N59B 1V3LA 3S9DB 1E90A 1XH3A 1NCOA 1TVHB 4IOSD 4J6RH 4N6RB 4YZFF 5E7FA 5I5MA 3ZN6A 5I9QC 3L13A 2XLLA 4DK5A 1MCKA 4KO5A 2EVFA 5KVFL 1CICD 1F3DJ 2NW2A 3GLDA 4QRRE 3T4AC 1GAFH 3PWUA 4MHHG 5F88A 2EDRA 5EIIB 5I1IL 2L0DA 3FUFA 3ET9F 1JUFB 3RILA 2ARJQ 2DQCL 1NCDL 2XU9A 2XWXA 2VW7A 3QW9A 4OZFB 2NXYC 4CU6A 2FATH 4S2SA 2IGFH 5CO1A 3WS3A 2WXQA 3FQWA 2FBOJ 1V05A 3SEPA 1B0RA 2NY6D 4L4TA 1VFBA 1JK9A 1BBJB 1KTLA 2QMKA 4IBVA 1U95B 2VLMD 3PV7A 4DP9X 1MKFA 1IT9H 3KYAA 1LO0L 4U3HA 2CO4A 3T0XA 5ALCL 3IF1A 3IDXH 4Y8AA 5CD5C 2ADIA 1EZUA 2JJTA 1SEQH 4HUWA 1CYGA 4MJIB 2PWGA 2GFBA 1OPGL 3N1PC 3T2QA 3WNNA 4DP8X 1Q4NX 5HGBB 4OD3L 3F58L 3Q05A 1R5IB 4WW2B 2WO2B 3KAAA 1UWXH 3FH5A 5EU7E 4AGMA 3FMGH 3RUGF 2VN6A 1DJWA 5JPNC 2OI9B 5C1MB 4N2LA 2FJGA 4WWKC 3SPHA 1SUHA 2C3HA 1R17A 1MUJA 4L4TB 4NFCA 2NX5A 2WWKT 1INEH 2NDFA 3MDJA 2VTFA 3DV4B 4QTIL 2ENSA 4NUMA 3LKNA 4HWEH 3KPNB 2DKMA 3LIZA 2WBWB 3MACH 4PD4K 2V17H 1OGPA 3QUZD 3BP6A 3GMOA 2XA3A 3KR3L 3IU3A 3UGEA 1PLGH 5IKCB 3ESOA 4TOYL 3QUML 3RFRA 3O2WL 3SD2A 3JV5A 5FYKH 1U3JA 1O6TA 4J3OH 3IJYA 1T5WB 2QDWA 4Q8BA 3KPSD 4AKOA 3EJYD 4P2YA 1GW6A 5M95B 4ZFOL 3HG1D 4ZTPL 2IANB 4NP9A 2HT2D 3UOAB 1ZGLA 3MV01 3WTXA 4OFDA 2VL4A 3GDBA 3HCVA 2G5BB 2AK1H 2EO9A 1AQKH 1BF2A 1JFQL 4OIBA 1R24A 2VLKA 4OJYA 3X13B 1R3JA 3EO9L 1BBDH 4FTVD 4HIIA 3N44B 4TQEH 2BNUA 2CKBL 4PW4A 1FGNH 1XIWA 3ESUF 5T3XH 3RL2A 3RPIB 3T2OA 4XT1C 1X4ZA 1UWEH 1A3LL 1OAQL 5KSBA 4W9CC 3MUGB 4N2GA 4YGAB 4LEOA 2CHXA 5HY9A 4A1RA 3G08B 2FJHA 1R33A 2R2BA 1O7VA 3OMNB 4RCAA 4R4FH 2J12B 4CVUA 1QFOA 4QHLA 4MMXA 3DIVA 3TA3C 5DEFA 4GKLA 2OV0A 4X4XB 5IHLB 4UIMB 3ZRCC 4ODUB 3FB6A 3KPRB 4AK1A 2WXOA 1WE5A 4OZGB 2X1XR 3MRCB 4BH7A 2W9EL 3SE3A 3THMH 1MHHA 3RL2B 2LR4A 2CUHA 5I1HH 1CFTA 1GYAA 1EXHA 5L4FA 3O3EA 4JHVA 1FSKB 3OC8A 3LIZL 1CYWA 2IH1A 3QG7H 3EJQA 3GJEA 4R7DA 5B3JF 4WI4A 3S8GB 2BNRD 4WKZA 3CFJA 3SPGA 1SLWA 3NSYA 3H8NA 1DBKH 2CIKA 4MJJA 2GHWB 2NT1A 4O4YL 4A6YH 1SOQA 3R18A 3AJ7A 2AXFB 1QMUA 2A9AA 2VDLL 4ACTA 3SDYL 1SBBA 2Y07L 4N6QA 4U1HA 3WN5A 5IOPA 4JGNA 5HYSG 5C0BD 4JDEA 4WK2B 1SN2A 5C6TH 1TDQA 1DQTA 4GKZB 2WUBL 5ICXB 1Z32X 2AV1A 2YEZA 5DFVC 5J6SA 4KITB 3VH8A 3G6DH 5L2KD 1H6UA 3F7KA 3VD0A 4JDTH 1PZBA 3HBGA 4TUKL 3VFVB 2V5RA 5D1ZI 4DTGH 2YQGA 4OZFH 2HUEA 2EXYD 4X6BB 3ARZA 5GXBB 1DO5A 3EO9H 3V4PA 4YLCA 4FTVB 1T0MA 3B2MA 3EOBB 4Y19D 4LSDA 3BN9C 4JDVB 4NCDA 2Y5TA 2DQIH 1CTNA 2IFFH 2WWOA 4OB5L 3UBFA 1PLAA 1N8ZB 5KVEE 1F6AB 1ES0A 5AL0A 3V6OC 5CD5D 5LWYH 2C9SA 1T1XA 4MA8H 2QPUA 5C07A 5C0IA 2V3EA 1JGUL 3ZTDC 3JYCA 3Q8AA 4TOYH 3UDWC 1JZDC 1ZK9A 2AK4B 3TPUA 5MEQA 1LWHA 1T89A 3VACA 3EHBC 4FXKB 3VXQB 3CU7A 4UYQA 4HF5L 4NQVA 1ACYH 2VDPL 5GGQH 2ADGB 2DQDL 2FJSA 2H26A 4Q9RL 4IQHA 3EOBA 1NKGA 1W0WA 3FFDB 5ECGA 4NZUL 2Q8BH 3ARPA 4TNVK 4CJ0A 3FHQA 5JORB 5F7DA 5LXGH 5GJTH 5IP4A 2PO6B 4NWTH 3TNMB 3BCFA 4X8JA 4AOFA 1DR9A 5AYUH 1OE3A 5HI4C 3O3DB 5MI0C 4G8GD 4HULB 4O5LL 3V4VA 2KPNA 2YD8A 2BVQA 3Q3GB 2XXFA 5M94B 3GD1C 5DRXA 1SOKA 1KJ3H 5DLMH 1EA9C 2Y6SD 3GBLA 3ML8A 5CLZA 1ETA1 3B6SB 3C5SB 3QWRA 5J12C 1T0NA 2CCLA 1Y0LB 1HEJC 1YEFH 1FG9C 3LQZB 1XF3A 3MO1B 5F7KC 3ZKND 1DBMH 5HD8C 1RUPH 3QCTL 2VDNB 4HAFA 2B20A 4HXBH 3N1MC 3WUWB 4HDIB 1KJ2B 4KWUA 1R5VB 2ENJA 5KVGL 5IB1B 1YEIL 5INCA 3TBTA 3ZTEA 2OQJB 3TNNB 2BVQB 2WN3A 3KD4A 3C8KA 3Q3GA 5IGXH 3WELA 3DX8B 1I3RB 1RZIA 4MA3A 3DMMB 5FECB 2XWTB 3QRGH 4B41A 1R19A 3VU1A 1XGUB 1KT2B 2PYED 1OPOA 1RK1B 1WSST 1N18A 2BOCA 3DO7B 3H4FA 5TE4H 4N5ED 4TRPL 1GAFL 3H56A 5KVFH 1MVUB 3NZUA 3ASNB 2HKAA 4LRIA 4IGBC 4NT6B 4ZMNA 4A6YA 1PEZA 3A67L 3NPSC 4G6FB 3QQNA 4R97B 2NY4B 1B0GA 1VGKB 2XTLA 5ADOH 1UM6L 1UZGA 1G1YA 2VXQH 5FDYA 5KTEL 3PWJB 2I07A 3QFJD 3BIKB 5J06A 3T6VA 2BRRH 4IJTA 4EDXB 4JFEB 3VXOB 3SGJA 5I30H 1HIMH 4P5TB 4U4IA 2KDGA 4PWGA 5CIPB 1KZYA 1YEEL 1ZTXL 3GXNA 4HUUA 4MNQD 3IGAA 3TZVA 4HUKB 3VXRD 5AVWB 4EQ2A 4OTXL 5EIIA 3T2PA 1KULA 1WVZA 3EJSA 3QQ9C 4OBRA 4AQ1C 3L9BA 3DURB 1OARL 1OWWA 3OAWA 5T3XE 4A6YB 1KTDA 1MH5A 2DD8H 3HUJE 3UCQA 1BZQK 1EDYA 4NAMA 3VG9C 4ZW6A 1V55B 4PJEB 4XNZB 5I6NA 2DIBA 4YK4C 5DJDA 3AGVA 1PG7L 4ISVB 1NM9A 3CC1A 2OR9H 3R06A 5FM4A 2VITA 1KELL 1E3XA 2BP8B 5GGQL 2ZUQB 3DX2A 1JZ4A 1E5ZA 2ZKHL 3SPCA 3TZVB 3TJEH 2OCJA 3C6LC 4Y88A 1U21A 4X6DB 1M2OA 2ADIB 5A3IC 3CZJA 3PFQA 1ZANL 3SDXF 3RZCA 1QATA 3CZEA 4YR6A 1KCSH 1WWBX 3DGCR 2ZKHH 4I89A 4HFUL 3VWKB 3K5SA 4CSZA 2XV3A 4P57B 3MOBH 1WWAX 4DN4H 3EJUA 3PY9A 3U0PB 3PAYA 4ZMYA 1XH3B 4LAQH 1UWGL 4K8RL 1MUJB 3QIUA 4KY1L 1N8OE 4OM1H 1JD7A 3K1DA 2DQEH 2R9HD 5TTRA 1VLXA 1YY9D 4Z95L 3TWCH 1BQHB 3IB4A 1JGEB 2AJUH 3WTUA 3ZHLA 1BGXL 1W2KT 5FA3B 3FH8A 4G8GB 5A2KH 1SYSB 4HHAA 4LHUB 5J1SC 1GJWA 2VDKL 3F01A 3LIZH 4NZRL 3UEQA 2WYZA 3RZCB 1ZLSL 1TCMA 3VGDA 2PLTA 2WCGA 2A9MH 1G9EA 2YFNA 3WS3B 3WO4B 3ZW3A 1PCXA 4N2MA 3LHAA 1MJUL 3NZHH 3FAXA 1EJ8A 1ZA6A 2YD3A 2W88A 4NI6A 2O5YH 1MWAB 4BWUA 2R7EA 3NCMA 2XIBA 5CF3A 5HI5D 3CK0H 1NGWB 4GKOA 1M1XA 3BKYL 3L7EA 3BPNC 1E6JH 2Z1PA 2YSSB 1BQHA 3CC5B 3HUJF 1X5FA 4Y2NA 3PDOA 5E4EC 5T5NG 4NHCL 4PV1C 2CJ3A 2NZIA 3BPLC 2RA1A 5IB5B 1J1XL 3IU4H 5CFHA 1NPJA 1WBZA 1Q9KB 4FG2A 4PTUB 1TQCB 2PW2A 1PX4A 2FB4L 4QYAA 3CX2A 5DWUL 2V3FA 3EYVA 4JR9H 2YGPA 4G2AA 2L7QA 4R84A 2F7RA 4LLAA 1JPFA 2N0KA 2WOBA 4NM8H 3JTTB 5E03A 5DD1H 1GMIA 5GRUL 1AQKL 1JFQH 2X44D 3FQUB 3E6HA 4OLXL 3L7EB 3O0LA 5C3IA 3IFNL 1T1YB 3EOAB 2HJLB 2EDTA 3EYOB 3PDOB 5F7YC 4UV4L 2ZXAA 1IM3A 3NUKA 5EBWA 4QXTA 2AQ3A 4N9GB 5KW9L 2Q6WA 4OZGA 4BH7B 1EUUA 2CHZA 3KWXA 2KHAA 5HHMD 5HHOA 1YEFL 4PJBB 2I27N 2N7BA 1U91A 3T0WA 5IKCA 1TLKA 4JO5A 1QAWA 1Z0NA 3V7MA 3VXPA 2VNCA 2XYBA 1I85A 1WICA 3AU1A 2HA1A 2YBGA 2BVPA 1JPFB 5F3BB 1BA9A 4P04A 1C08B 1IKNC 1MI5A 3WD5H 4FP8L 1KYUA 1DSWA 3MV8A 2Y7SA 2YK1H 5KVMC 4X7SH 1PG7X 3BO8B 4WNSA 5IWLC 3UTPD 4LRNH 2OMXB 1FAIL 1R34A 3DARA 3KL0A 3D52A 1QI3A 2VE6A 3HHMA 5HHXL 1KPVB 1E0OB 1KY6A 2OI9C 3CQQA 3PQYD 5IMLB 5L4JA 4GKZA 1RUML 5KAQG 3L4UA 1YUHA 4WU5B 1ZT4A 1QLRA 3EF7A 3FT0A 2G9KA 4YZWA 3QG6B 4EIGB 4QHPA 3FUMA 4JKWA 5KYXB 1AZUA 1J0IA 5HY9B 1C08A 5GRJL 1J7VR 3DGDA 5KVDL 1JGUH 1Q72L 3IXAB 3R4DA 4HJJH 4I0PC 5FKPB 3L5XL 2CJTA 2DJSA 2VLLB 1RJYB 5F89B 1FWXA 5CR1A 3P73A 3R19A 5FCUL 3APFA 3LRSA 1QPXA 5K9KB 1EAPB 5JDSB 3MOQA 5AAWA 5JXEC 1AZRA 2IPTH 3AXLA 2ZX7A 1IKFL 1C1EL 2YZ1A 1RU9H 4U05A 1AZNA 3CE1A 3DX4A 3O41B 3Q8BA 2E7MA 2WSDA 2YPLE 2DQUH 3IMTA 4KO9A 1S7VA 4MD5B 5D1XA 2AQRA 2H3XC 5GGUA 5IK3A 3RBSA 1MXGA 3NAAL 4PJDB 5DJ8A 1WZ1H 3CHRA 4DWHA 1ND0A 5JW3L 5ANMB 3RB7A 3FUNA 2QSQA 5E8NA 4J3TA 4QF1A 4QKTA 2X2HA 3L3OA 5J11C 3K6IA 3VRLF 5HYSA 1UD6A 1XSKA 2B9AA 2ROYA 4K5MA 3VI3B 3CCHA 1AOZA 1KC5H 2XSKA 4M61B 4B9YA 1M56B 1YDPA 4XB3A 5JXAH 1KGJA 1IRAY 1NEUA 2BOBB 5L7XH 1MJ7H 3GSXA 2RCSH 5CLTA 3K4ZA 1T21A 1MHEA 2EIDA 2WB1A 4JFZL 3P2DA 4L29A 4YDNA 2XZQH 2B1HH 4PTTA 1JYXA 2HG0A 1J9SA 1V3KA 3BFWA 3MLXH 2Z91B 1UVQB 1WUZA 4CADA 5EWIH 3GMNB 4AGLA 2VABA 3S96B 5H4ZA 1KENL 2BNQB 3H1ZA 3DJSA 3F7QA 4OCYL 4G6MH 2WZPD 5EC2A 4YBLB 4OLEA 1P7QD 4EIBA 1CGSH 3ROLB 2VDOL 5JQ6H 1X5JA 2XY1A 2OL3L 4HP5A 1MJ7L 3TASA 1D5ZB 1JV2B 4KFZC 4KY2A 4G42A 3V6BR 3ARDC 2E7BA 4F37K 2X0WA 4TLKA 1T21B 4LLVA 5BZXA 3DXAD 3M6DA 1ID5I 2Y2YA 3Q5OA 4B95C 3LQAH 5FUOH 3RDTD 3RVWC 3C8KB 3GKZA 2FQEA 2IGTA 4LLYA 2Z7WA 3LZNA 2FUQA 2EE0A 2XZQL 3O9WD 4AW4A 2FH8A 3L9EA 4C56B 3L1FA 2HPTA 4RDBA 4U7SA 2AJZB 1J8HB 3WEMA 3VMNA 1WCQA 1WT5C 3PV6B 5FYKU 2DYPD 3L3DB 5CKGA 1I8MA 3LPPA 4DP6X 1EEZA 1JVLA 4HJGA 2VSKB 1H8OA 4MZ3A 1LP9F 4G5ZL 4J4PD 1ZGLM 3H9YA 3FB7B 2PTVA 3QEQE 4XAKE 2WLJA 5IVXB 3MGAA 3CFIC 1REIA 4W9EC 2WSPA 2VL5B 3L7FB 5E2WL 3HPLB 3QUMH 4E41D 5KVDH 1F90H 1CU4H 2W07B 3SGKA 3NSJA 4K15A 4OJFH 4MAYA 5A6LA 4HX1B 3MNMA 1TPXB 4MDJB 1J87A 2BY1A 1I1AD 2IPTL 1XGPB 1NC2D 1UGNA 1EFXD 3AFLA 4X6CB 3RWDA 3UAAA 3IRZA 5CJXC 5E8EA 1A6WL 5FUZH 3WUWA 5JQHC 5D1QE 2K7QA 3DI3B 6FABL 2HP4A 5TDNA 2YPLB 3LEXA 2EEBA 4OCSH 3K3QA 4WJ5A 1SLUA 5HJDA 3ULVH 1QYGH 5C7XL 3DX8A 1TVBB 4PJDF 1P7QB 2E8YA 2XG4A 5FUZL 1B2WL 1TXKA 4JW3A 5IROA 1M7UA 5C08E 3SPVB 4ZUTA 4ELKA 1IV8A 1RK1A 3GBMH 3RUGE 2BP3A 4FFWC 3HS8A 4PRPE 2NDGA 2EUWA 4PCKA 4N1EA 5TQ2H 3UCRA 2BH0A 2ZAHA 1QR4A 1AVAA 4X6DA 2YD5A 5BO1H 4AH2A 4ZPTB 2HXAA 5D9SA 4UT9A 2YGNA 3GMRA 2GABA 2WBJA 3G5VA 1OP3K 4Q9QH 5EF2A 1E9OB 1UACL 5CGYC 3BUIA 3L3IB 4FXGC 4P2AA 2PYFB 4MASA 2AI0L 2I07B 2NYYC 4FHKA 5EZIL 3BQVA 4MQXD 1IFHL 3O8XC 3O6FC 3HRZB 3D08A 1BFOA 3ZE2F 4JRWA 5DSCA 3TWYA 3AITA 1H6TA 2X53A 5CCKL 2JI1A 4FEMA 4XMVA 4FZEL 3WUWG 1JWUB 3QC6X 4PMFA 1R3HA 2GK2A 3F7RA 3MYJA 4M7ZB 5DQDL 4JFEE 4NOFA 5HJ3A 4Z0XB 5JHDB 3HHSB 1JJUA 1G5AA 1LDSA 2JKJA 1J0ZA 4X4YA 2E75C 1N4XH 3KM2A 1BVZA 3DGGA 4R4BA 3MVSA 2Z93B 3ZVVA 2LFGA 2D2CC 1TQTA 5IFJB 1I7ZA 4CU8A 3RWJB 1ANUA 4QI3A 1J5IA 1PD1A 3NJGA 1CLCA 3ZTJG 1MHCB 2A1WH 4XTRC 5DUBB 1FV1B 4NM8L 2H2SC 4ZO9A 4WI8A 4N25A 1F00I 5I71B 3LKNB 5PAZA 2VXUL 4RMVA 3FKUS 4CBPA 1BDYA 4P2OD 1J8HE 2ZYHA 1RUKL 3P40A 3TH4T 4U6YA 3PFUA 3ZDZF 1JPST 2G0LA 4PMEA 4UTAA 2XFXB 5TF0A 1UG9A 5JHDA 4IW4C 1XTMA 4KNQA 5EWIL 1UD5A 4KU1A 3DGGB 2F54E 1AGDB 1FZJA 1EVTC 2Z8WC 2DWSA 4G80B 5K9JH 4H8WL 1I1FB 2NCEA 4APQA 2DTMH 3GPSA 5IFJA 1WO2A 4I77L 3GSOB 4KXDA 1EFQA 2P49B 3AM8A 1JWSA 5GJTL 1A7NH 3NCFB 2E9BA 3ATDA 4MJHA 2P80A 5HHNB 5JPNB 1SLVA 4YQXH 4FI6A 4N0FA 5IHUL 3D25B 3KWWA 2D3LA 4PJXB 4RESB 4UOQA 4CW1A 4KMLB 2NY1C 3CH1B 4ZW8A 3GMLA 2WCPA 2DQ6A 4XN4A 4OFQA 3JWNH 1J0KA 5FW6A 2A77L 2F7QA 2YOCA 3HI6H 1WZ1L 3KPMA 4I85A 4J12A 3HUJB 5EF3A 4DGUA 5IM7B 1HQRA 1D9KB 2HKFL 1MFEL 2YPVH 5FYLH 1E27A 3OHXB 3C9NB 3NN8A 4WO4C 2C3VA 1JNJA 1AO7D 2R69H 4N0FB 3D25A 1J8RA 2OR9L 3KWWB 2F1BA 3PQYE 4MMXB 3BO8A 1UUSA 2BZ7A 2WLIB 2B9BA 2E27H 5I19H 3O3BB 3ECQA 5IEKB 1S46A 3TPKA 5D7JC 5IMKB 2EIBA 3LMJH 4MBRA 1FBIL 1UD8A 4UB0L 4AQ1A 2K9FB 1DJZA 2LVEA 3MRCA 2CUAA 4RA0C 3L48A 5IMLA 1L0XA 3NIDF 1HH6B 2A77H 3HI6L 1DJSA 4X6FA 1A9BA 1R5WB 2GSGB 4GW5B 5A40E 1IVLA 3SYOA 1SEBB 3OSVA 4NKOB 5BQ7B 5MEOB 3ARBA 3JT2A 1SVBA 4GPVA 1NJ9B 4BHUI 3AS2A 2CRYA 4IKKA 3E6HB 2IAND 2YGQA 3PCYA 5E9DE 1OTSD 3TCLA 4QOKD 3V9EA 3EFOB 4L8DA 3UPRA 3DUUB 2NY2D 2WLIA 1YRKA 3H3PH 1B6UA 1URZA 3GSUB 3QUXA 2ZX9A 3I6LD 5SX5K 4QXTB 4OGXL 4ABVA 5HYJD 2OSLA 3S2CA 3HG5A 5EBLA 5HVHC 5EA0H 5IW1A 4CVXB 1BVNT 2BJML 3KPPA 3T4AA 2B1HL 4MB4A 1XMEB 4FN0A 4K9JA 1L9OA 3MRGA 1KYAA 1M9WA 3QXDA 4X4KA 5SWSD 1AP2B 2AZAA 2P8MA 4JRXB 4B5EA 2C34A 1DJHA 4H8QA 3EFOA 1QRKA 3H9ZA 4JS7A 1LD9A 3QO0B 1NCWH 2KQMA 1Z5LA 1L0YA 5C97A 5EUOA 5ABZA 4KUCF 2ICWA 2CKNA 1IZJA 1IFHH 5DJYB 3OKOA 4RGNC 4EI5A 4K9EL 2XPGB 3KPOB 3MFFA 4XMTA 4P23A 1KCUL 5E94B 4D7PA 4LLQB 1N6QL 2DM3A 1A5FL 1IC5L 3EJTA 2ZF8A 2X2IA 3F7LA 3EDEA 4JQVC 4IRJD 1ZJAA 3NEEA 2D31A 3QQ9D 3KYKH 2BCKA 3AG4B 4K3JL 3QXDB 4UT9H 2HFGH 3IK2A 3X1GA 2CRIA 1GCYA 2WINB 4JRXA 3U7AA 1FO0A 4JFPB 1ORSA 5D6DA 1QOKA 2PKDA 1RJYA 4X50A 4PJ5A 3B7RL 3TONA 2O6CA 5EC2B 3V4PL 1FPTH 2D7NA 5K9KA 2QGDA 3CDZA 1TZ8A 3LPOA 1PZ5B 4OQTL 4EZLA 1G84A 5E2TL 4G71B 1CJYA 4AKPA 2ERJC 1J12A 5FXCH 2MNUA 2GTQA 2DEXX 5GRJH 4PJBF 1GZQB 1WBYB 4P48A 1H15A 2J73A 4TQPA 2WQ8A 3CAFA 1TZIB 4GAGL 4KZEL 3ZZSA 2CRMA 3BAXA 1RJLB 2MNWA 4WEUD 4IRZA 4FQJL 1RSFA 4K8RD 2ZT9C 1A6ZB 5HYQB 2AJZA 2QELA 5DO2D 5HYSB 3QQDB 5ABDE 4E2OA 5FFLA 3U0TA 1IGJA 1JOIA 3BH9A 1W0VA 4HJGB 5JIIA 4MJ2A 3VWJA 3FXIC 1Q0XH 4YEEA 4GUPA 4PBWD 5D7JD 3U9UB 4BV1A 1G9HA 3NGBC 5ACZB 4GBXC 2AAVA 1D5XA 4LGPB 5DRZB 4W6YB 1NGPL 3UYRH 1JD9A 2DTSA 4A7VA 3F64A 1UA6H 3EHBD 4YAQB 1IE5A 1JZHA 5ICUA 4WWKB 4M8UA 2JI2A 2WQSA 1BYPA 4F5CE 3KW7A 4WFGD 3IDGA 2ED9A 5L4MA 1KCUH 1CBVH 1ZOXA 3LV3A 1G7IB 3HG3A 2F53B 4XN7A 5D7SL 4E68A 2V33A 2Y36L 3GSWB 3G04B 4MNQE 1XXDC 4C47A 1GVIA 2CBPA 3VWJB 4OLXH 3S5ZA 3W11C 4L48A 2OYKA 1UZ8A 2QBWA 4FXLA 5E9DD 1OCZB 1U8JA 2I7SA 1UXSB 3G6JE 2A9CA 4I18A 2R1YB 5D1QC 4N8CH 3SQRA 1QKZL 3C08H 1K5NA 4XNZC 1H5BA 1OTUD 1QFWL 3N41B 3OJDA 3G5YB 4MS6A 4NQEE 2XWBB 2IAAC 2GK0B 4ALAH 3Q9QA 4YSAA 3EYFB 1LDPL 5I1LA 1GR7A 3BMVA 2W9DH 2KZ1B 4IOIB 3UTTD 1QSFA 5K39B 3KYMA 4DFIA 4ZFFB 2KMWA 3B37A 2Q86A 4JPWH 4RA3A 3HZMB 4WJG3 4N0CC 2X7LB 4NPYA 3PIQA 1AS8A 1WS8A 4BQBA 2WCSA 4L3CB 2DQGL 4JO4L 3QR1A 3TYFA 1OP5K 2BZCA 1G9NL 1OANA 2O93L 4UM9B 1D5IL 2YGVA 1L9QA 2YUXA 2E9IA 2XWBA 3NJKA 4J3OG 1U8IB 2F58H 2R2EA 3K6DA 2A73B 3H9SD 4V1DB 1L5GB 1TZHB 3F6IA 3QB7C 4C55A 2PO6D 1GA2A 5KJ7E 2AJVL 3KJ6L 4LGSB 1QSFB 1U8CB 4MX7A 4QHUA 4LKCA 3DKHA 1HTYA 1ZWIB 2H0EA 3C6LA 4WFED 2VC2L 2HUHA 3HZMA 3MLTB 4JPIB 4M7KL 2RFXA 3WIFB 4RISL 4Y4FD 4KTEL 2JCCF 5F0LB 3EUDA 4ELMB 1CZ8L 2X4SA 5TK4A 1CIDA 4N0UB 4DN4L 4WV1A 4JKLA 1KTRL 3SCMD 1AQDA 1VZHA 4QY8A 1AY1H 4XBGB 3A47A 1N64L 1VESA 3FO2A 3O4LB 3J07A 2EXSA 3QNFA 4G1EA 4N8UA 4BZ2L 4AJWA 4UDUA 1OTTC 1I9IL 4CMHC 1NAMH 2WC7A 3V0DA 2IQ9H 3G6JF 2VR7A 5FFGA 4N2OA 1XGTB 2WQVA 5TJWK 5CGBA 1CK0L 2E4FA 3ZL4L 3MUZ1 4EXKA 1OO2A 3GMRB 3MV8E 2Y7QB 3X11B 4JCWA 4G80A 4PEEA 2P52A 3QUYD 1Y1DA 2AEQH 4JQXA 1OQXA 4PHZA 4WHTA 2ZCHL 4NO3B 4P59L 3U2SA 1MWAA 1D5BB 4M5ZH 1TNNA 4HJJL 1HXMB 4ZUSB 5FO9A 3Q2LA 4GXVH 3W37A 4MB5A 4AMKH 3LRHA 4RGOH 2B1OA 4U4BA 4OF0A 5CZVH 4JMXA 2QADB 4WI7A 2J7LA 2CU9A 1JGDB 3WIHH 3QUZB 3ES6A 5HDRA 5GRVK 1T04B 3BIBX 2WSKA 2PW2B 3EHBB 4FXKC 1P84J 1CK0H 3ZL4H 2QTEA 3ZKSD 1DYZA 1HQRB 4QTIH 4KPHH 2TRHA 1TLMA 1KGCD 3KPSB 5D96C 4Y1AD 1TNMA 1E4KC 1DJIA 3SDXA 1I82A 3U46B 3VXSB 4MJIE 4DP2X 5E1AB 1JPTL 4JZJA 1P4BH 2GUYA 4YHZH 1UGKA 1LGVA 1JFHA 2XQBL 4JRYD 4LQ1A 3R7RA 4NAJA 4QR7A 3QH3A 3AXHA 2YLKA 4ODVH 2K1MA 5MHSD 3Q6FB 1TU2A 2FQFA 2NW3B 4OM0L 4D2NA 5ICYB 2B8OT 3HMWH 3RTLA 1E4WL 1MRFH 3BUQA 3EJJX 3Q13A 2BSSA 3IDIA 5FKAB 5BOPA 1MFUA 1YNTB 4P9HC 3QORA 2XRAH 3P11L 3VFGH 2Z1KA 1HHJA 5GZOC 4N0YH 5C71A 2I9TB 3NYKA 1EFXB 4ZUUB 4JFDE 4U7MA 4ANXA 2XWJA 1DE4B 3ALXA 1KN2L 3DYOA 3EG9A 1P4LA 1R4XA 1ZKAA 2WKGA 2OL3H 1QFUL 4WWKD 2CA3A 5CS7A 3MRKB 1RZGB 5I2IA 3KGUA 3GUFA 4RGMC 5LB1A 1KYFA 1AXSB 5ANHA 3HUJA 3VRLE 3DRQB 5GS2D 2PP9A 5ID0B 4FABH 4E9LA 4HH9B 4Z76B 3BEWA 3MX0A 4KOBA 5ENWA 4NJAH 4NQDB 1VFOA 2EVGA 4ERSL 4LHUD 5D5MB 5TH2B 4IGBB 3GHPA 2DJ4A 3LXBA 4Z23A 2VN5A 2CDGB 4Y5VA 1C5CL 1OCRB 2J5LC 1VGEL 5EUOB 4XPTH 1CFNB 4V11A 1MJUH 3NZHL 1MY7A 5FOBA 2FX8L 4BXSV 1NUNB 4M48H 5BUAA 4K5LA 3QXTA 4EI5B 2ZCKH 2HN7B 1CLZL 4LLQA 3D39A 2ICWI 2F54B 32C2A 2Z35A 4HWUA 4NKOA 3SBPA 1BPVA 5ID0A 2HKFH 1NJ9A 4G7VL 5E2WH 3TO4C 4Z76A 3NFSH 4DGYH 4GFTB 2N56A 4LCCB 1JL8A 1X5AA 2OJEA 2V6HA 4X99B 5GZNA 5T33H 4YXLH 5E8NB 4DKEL 2QJDA 3TLRA 3TH2T 2BIMA 3GS0A 4ZS7L 5I6XC 4M7LL 5F7HA 5B1CA 3QUXB 3UBHA 2P45B 2X88A 2V9TA 2K45A 3LN4A 3T08A 4M48L 4PJ9A 4HEMA 5K9OB 4TUJB 3DC0A 4JHBA 3X12B 3LKQA 1BD2E 3CFNA 4CVXA 3UTQB 1QTPA 3VTMA 4ZYKB 4Y5VC 1S9YA 1MCIA 4M8RA 2VABB 2C7FA 2ERJB 3S96A 1GOGA 4DPRA 4NC1E 3N42F 4JG5A 1RULH 2EAEA 4MTMA 3WTVA 1OW0C 1IKNA 4XRCB 1DDHB 4TS6A 1FNAA 4KH9A 3DOIA 4L2LA 1GOFA 2BDNL 3JWDH 4ANVA 1TJIH 25C8L 4TNVF 1Q8MA 4Z3TA 1PNDA 2XKSA 1U4EA 3Q06A 4UF7C 3FQ2A 3BGMA 5KYUA 2NSQA 3NIDB 3L5HA 3I3DA 4LXFA 1HOCA 3T77B 4BXVA 2W1NA 2EJ1A 4PJ7B 2C7UB 3HS9A 4TSBL 4Y2DB 2VH5H 4FGMA 4FA7B 3B2VH 4BFKA 4JRYB 1PY0A 2ZXEB 4TVPH 5AQ0A 3VFGL 1WJ3A 4GSDH 1QQDA 1WIUA 3LEVH 3NGBB 4JFZH 1BZ9B 4TTDD 2VDOB 2IOIA 4I18C 5KBMA 4EUPH 1JWMA 2BHFA 3JWNE 4R2GC 4XMXA 5DJ0B 1EAOA 3FUHA 5CBEA 4YHIA 3SDDA 1MAML 3VQ2C 4BWWA 5J13B 4KQ0A 4E9QA 3FT3B 3U1QA 2EIKB 1RZ7L 2HRPL 3AADB 3RWFB 3K8KA 5ESAB 1QSEA 1F18A 2BIHA 2HJKA 5DEGA 2LU7A 3HE6C 3U6RB 1DBML 3FS9A 4D8PA 2IPKA 3X13A 1IMHC 1EEYB 1F6FB 1CTMA 3BX7C 3I9AA 4M62L 3RG1C 2FBJH 3MCLL 3D9AL 3VGEA 3MV11 4KJPC 4DQAA 1KEGL 1NGYA 3W0WE 5IVZB 1RI8A 2GJZA 3QRLA 1NCCH 3HE7B 4HJIA 1QFHA 4XN9A 3P9MB 3MZTA 4ZODA 1XD1A 3ZDYB 1BX2B 2F74B 1NOAA 1RVFH 3HNVL 1CGYA 5ESQB 2UY7B 35C8L 1S9WB 2ZCLL 4TSCH 4GS7B 4XAWH 4UM9A 2X3AA 4E42A 1SPDA 3L16A 4XMUA 4X4XA 1YN6A 3NEOA 1ZLWH 4TSAL 1EEYA 2ZF9A 1NC4B 3CPLA 4WKXA 2CPUA 1KJVB 2PW1A 2IV9A 2B2XH 2OPCA 1OP5H 3ZLQC 4TF4A 3A24A 2EXTA 4LKCB 1ZLSH 2EXWC 4PSPA 3MRBB 4R96A 1OAJA 2IMMA 1M05A 2VDNL 3MLTA 3O3EB 4FNUA 1ET8A 1XF5A 4I3GA 5I16A 3WO4C 2C4XA 3KEHA 3ZIMA 3SYPA 3P9MA 3ARFA 2J6EH 1CF8H 2YA1A 4FD0A 3SCMC 3TXAA 3VFRA 2X09A 1OT2A 2XN9B 3OC5A 3MN8A 5INDA 4K8RH 3O8XA 2QT6A 3MCYA 3UROR 3TT1L 5BZDA 3HIZA 2OSXA 1YN6B 3FO2B 1L9MA 1OW0A 5F44A 4XC3L 3DBXA 1KJVA 3O0RH 3WFEL 4UDUB 1QFWM 1M6OB 3KYMB 4QXGL 4ZFFA 1UB6A 1FVDA 1P0SE 1S6NA 4TM9A 2X4RA 5HJ3B 4S10A 5IQ7H 4DTGL 4WO4D 3T0EC 4Z78A 2XG5B 3X11A 1BWWA 4UMGA 5I8OL 3W57A 3RB5A 2MPAH 4QGYA 2X89D 3RVUD 1XGRB 5LGKA 1XVSA 1B9KA 1T2QH 2C9RA 1F42A 4ZDHB 1MFCH 3COOA 2B4CH 4KVNH 2FO4A 2J8OA 2F54D 1KGWA 1U8IA 4H0HB 4ONFL 5DC0A 4DAGL 4B9GA 2XZAL 5D5ME 2EYRB 1ADQH 3QARA 5GRWA 1M6OA 2DQJH 3V10A 3T04D 2LLLA 3ZOAA 3C6LB 4L1TA 3F7YA 1P6WA 3MZGB 1JGDA 1RJCA 5K59F 1YAIA 3KXFE 2MJWA 4UT6H 3VWKC 2XV2A 4YHNB 1XB3A 3IJHA 4GP4B 3QIBC 5DURB 5E2JA 1WWCA 2NNCA 1BQ5A 1U93A 3ULUE 2MQGA 2ZXWB 1NICA 3V5KA 4QRUB 3EGSB 2IWFA 4Z7WB 3CSYB 3LOWA 4PP2B 4X6DF 4YIQA 1IGMH 1EV2E 1D5IH 2CDEA 3I9PA 5JLZA 4XPBL 1WC7A 5L7XL 1I8KA 3N41F 2IAMC 3VRIB 2QFPA 4PJHE 3MJWA 1NCNA 5AUMB 4G59C 1H3PH 3PLYA 5KSUA 1VADA 5E8DH 5TE7L 3U83A 1I9RH 1KCWA 1DN0B 5FM5M 4M5YL 4YH6A 4AUUA 1Q94A 7PAZA 2Y1YA 1QHPA 3ZMRA 5ISZB 3BWUC 1UM5L 1Q9OA 2CGRH 2WOYA 4Z7WA 2EDXA 4N8VA 3QDMD 1KB5B 4ZAKD 1L0PA 1QZNA 4MDIB 4R26H 4G72B 4XOCA 3V0JA 1FGVL 1QUPA 2Z4QB 3RIFK 4DVRH 2H45A 3CFCL 3K6NA 3QS2A 4YS4A 3B7TA 5AVXB 1RSYA 4HDIA 4NLHA 3IAQA 2UWEE 5CZXD 2AI0H 2OYLA 4I13B 3MRKA 5AW2B 3EDKA 1Z2KA 4Z18A 3GSVB 3WNPA 2EYTA 1HH6A 4D0DB 5DUJA 2BC4B 1FGNL 5CNHA 1AYRA 3B43A 2YUWA 2XWTA 3UG5A 5AOMA 1Q9OB 4BINA 1JMZA 3D85D 2RB8A 1BCIA 2IAMA 4XCNA 5DJ6B 5SWQB 4GRLC 1KB5A 5BW7C 2GSMB 3TF7C 4XN8A 3VM5A 3CDCA 3FT4B 2JKXA 2V9QA 4O51B 3TT1H 5FM8A 5CZVL 2V37A 3RTQC 3QFGA 3WJLA 3V5DB 2CUMA 2OM5A 5C07E 5DZJA 5B3SB 2CLVB 2YPKA 3MV7B 3ZKQD 4E9TA 2WVTA 2WXKA 4NWTL 3LKRB 4OZIF 2J55A 4FQ1L 4JJ5A 3BIKA 1XCWA 5DHVB 1SDDB 4AXWB 2BC4A 2RMNA 5EBLB 4Z7NF 1UT1A 3ZRFC 2CD0A 5G4MA 4E9SA 3MRIB 2HKHL 4WI6A 3WY1A 4HUUB 5MERA 2X4QA 1XCTA 2Z0UA 4F7EA 5CBAB 4CVZA 3EH5B 4H1LH 4PJCB 3ALWA 3PHOB 4IBTA 4BQ9A 3UTPE 3ZE1F 4MAZA 5B38G 4FQCL 4MCNA 3WDHA 2UX7A 2I25N 4UIKL 3RY5A 2FSEB 2J5LB 5K9QG 1BAFL 2Q7YB 4Q6IA 1JI2A 5I2IB 4NIYE 1SDDA 3QEHB 4N6RA 3EH3B 4B7LA 1Q1JH 4HCFA 2RH0A 2OR8A 2QSTA 3BN3B 1M71A 3PYCA 5C0CA 1II4E 3FH7A 3QRGL 3RNKB 1IEBA 2PUQT 1VKXB 5BRZD 1NAML 5BXFA 4TVPD 1BREA 2BIQA 5AKVA 5KS9E 5ERWA 2LT9A 1DQDL 2NR6A 3VFUB 5KANI 1NKRA 3G5ZA 5DVKA 4HGMA 5F7LB 3UPAA 4PGDB 1I9EA 1A6TB 1HJBC 4J6RL 2WANA 4ZNEE 1H3TA 1Q0EA 5C0GB 5IB3B 2Y07H 2J8UE 1WAAE 3B9KA 4ILDA 4DVBB 4TNWK 5IMOA 3H0TA 5E95B 3OR6A 2JTDA 1UM4L 5IBUG 2Z35B 2NY5C 2PF6A 1FP5A 2NNAA 3QWOA 3RIAK 3RWCB 4PVBA 1GY1A 1L9NA 2G3ZA 3BKJH 1Q90A 2HT2C 1TZIA 1H3WM 1J9RA 4L2YA 2WGNB 4PJFF 5FK9A 4QJ3B 4KKLD 4EKXA 3L4CA 3DHMA 2PCPA 3BISA 1QLEB 3I6GA 2AV7A 3EO0A 4NO2B 1INDH 5AYUL 1GHFH 4QNPE 1BF8A 4OGAD 2OP4H 4WGWB 4CC0A 4ZMTA 2O30A 3GHEH 4FLSA 5IB3A 3N42B 1BQSA 4Y1AB 4XCFH 4RAVA 5ACZA 5IF0A 2ZUYA 1KJMA 4O2CA 1NFAA 1VACA 1KLUB 3FCTA 2ZXGA 1ONQA 3D0LB 3R8BB 5C0DA 1YNKH 3UTSD 4NRZA 3L1GA 3H6JA 4POYA 2NX5E 4C4KO 2NTFA 3GBEA 2PCPB 2YAEA 1V7ML 1WG3A 2W91A 4XXWC 5IQ7L 1DLHA 1KB5H 1PX3A 3QEUA 3JTBA 4X4MA 5SV3A 3SOTA 3IDNB 4UB0H 2HSIA 2PR4L 3E3QC 1D6VH 3TOPA 1KB3A 3EYVB 4KKBD 4NM4H 5MEPA 1FJ1B 4DEUA 4MKMA 5CIPH 4U6HA 2UVFA 3GXUB 1Z9SB 4ABQA 2EE3A 3ZKMD 1A7OH 4HC1A 3IWUA 2H5UA 2K70A 1BX2A 2F74A 4LSPH 4EBQH 3W9EB 3BZFA 3O6FB 3RFZA 2R1YA 1ZGLB 3D30A 2N01B 2I5YH 4U1SA 4L9LB 4B9JA 2VLJA 3CFMA 2W0PA 12E8H 3OJDB 1SXCA 4B0MM 3WN5B 2VLRA 5H37G 5B1AB 2JCCE 4KJPD 3FB8A 3MV9D 4N9GA 4PJCF 1X5ZA 5EOCH 2YC1B 4JFTA 1NLDL 4CMMA 4ZMQA 2IBBA 1PLGL 3ZTJH 3QEUB 4QXGH 2ZIDA 4YXKL 3VH8B 2AEWA 5B4MD 1JHTB 3MQIA 3IMWA 4LU5H 2CKBA 5EOTA 5KSBB 5DJ0A 1QPPA 3IJEB 1HZHH 2VR6A 1G0DA 1HAUA 3VFVA 3H9SE 5I0DA 4JO1L 1KELH 3T2LA 2D0FA 4JFFA 2YARA 5DD3H 5GRZA 4EVNA 3RWFA 3W9EA 4I9WD 5A2AA 1P1ZA 1HHKA 3EYQC 3UXFA 4LFHG 3H85A 3FHEA 1CDBA 1INDL 5LAXB 1UWFA 2BIPA 4PB9H 5EORH 4PG9A 3R1GH 2NRDA 3A4EA 4HSCX 5J6GB 2NY6B 4AENB 3SQBA 3SSGA 4RZCA 5C0IB 1BIIB 3AY4A 2NY7H 3KLLA 1DBAH 5EO0A 3TA3A 2ZWNA 3WKMH 1RPKA 1UD3A 3LHPL 3UG3A 1IFGA 1UM4H 3C60D 1YECL 3RIAF 3DA0A 1SXBA 4U1NA 1EJOL 3FFCB 5GRVL 2FJUB 5ESQA 2VN7A 2WPGA 5IR1B 1J10A 1LK2A 3JWNG 4G1MB 5E6UB 1AZCA 1OEZW 1P2CA 4N90D 3UPCA 1FL5B 3Q1SL 4PRIB 5KSBE 1CB4A 5J56B 1P4UA 3ECUA 4ZOBA 1ZA3A 3IWVA 2VRKA 4PJGE 4ORGB 4YDZA 1KEGH 4PG2A 1L6XA 3BXNA 1PFOA 2IADB 3HZVB 3DXAB 5ICZA 1HI6B 5D1XC 3L2NA 3LHPH 4P5KB 3NRFA 4G8AC 5DVLA 3QO1B 1WBXA 5JHMA 5DJ8B 3SGDH 3EO1B 5DLML 2ZNXA 1CI3M 3CUPB 3UTZB 3ABMB 2NLJB 2LTQC 4JREB 5IEHB 1DJGA 1WP6A 3B6SA 4HOWA 5CSZA 3HBPA 3L3OB 1MCRA 2H47C 4XBMA 3LY6A 4W9FC 4ANKA 4Z7OF 3BP5A 1WC7B 4NRXB 5CP3H 2GJRA 1UACH 2ZKMX 3TV8A 1QBLH 1P7HL 3EFFA 4XN5A 3DOSB 3OB0H 4TVSa 3WUZA 1ZV9A 5CGYD 9CGTA 3AS3A 4YGVA 1AC0A 1XBRA 1KCLA 3U6XA 4S0SD 1NCBH 4FYQA 4MJID 4NC0B 1BQLL 5C0EB 3KL5A 4NQSA 4CNIA 2FZ3B 4BZ1L 4P2QB 3RVUC 5E0QA 1P1VA 1D2PA 5JW5B 2BPBA 4LSTL 1RZIB 4MA3B 4HG4K 1ACZA 3CZFA 1TQBB 1ZLUH 3AUWB 3R1GL 1BQUA 4PN6A 2AMUA 5EZJA 2ADGA 2BNQA 4X5QA 2P47B 1Z9PA 4ODHH 2NY5H 1ML0A 4PG2C 3IAPA 5FYJU 1YCSA 4E5XA 2FO4B 2AJ3A 1QEWB 4PS3A 4ZJ9A 1QRND 4G8FB 4JG0L 2W8CA 4KY1H 2UXTA 4GEJA 5AAWC 5TE6H 1RY7B 3U79A 3V8OA 3CDYA 1B0GB 5K1JA 4RMQA 1PY4A 2BXYA 5DC9B 4HF5H 4JFUA 5DS2A 4PJ8A 1SJEA 4P3DA 4LOUD 1KTCA 2GJ6D 3HI1A 5D2LB 3S5LG 1F3JB 1S9XB 4JFDD 2P5WA 4TQIA 3ZE0E 5BV7L 3SJVA 5JPMA 2APXA 1OGAE 1E5UI 3ZIYA 2WY3B 4M9OA 5LCVL 3MV9B 3TM6A 3TO4A 1G43A 3DTUB 3IDUA 4PP2A 5IMMB 1GGCH 1T0NB 2JELH 1EXUB 4FJ6A 4OZHA 4AQ8C 3BAKA 1MCBA 3L6FB 4OU3A 1VFUA 4P2RB 1GGYA 1UTDA 4M03A 2ZCKL 4NS0A 3F00A 5DQJA 4PLOB 4F7PA 1JZEA 3P3UA 3SE4A 3ZK0A 1KJ2A 1P4LB 4XHJD 4PU2A 4L8BA 1R75A