1MZZA

Crystal structure of mutant (m182t)of nitrite reductase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
334
structure length
334
Chain Sequence
VDLSNLPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVSGTAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVAVMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGTAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title The High resolution Crystal Structures of Nitrite Reductase and its mutant Met182Thr from Rhodobacter Sphaeroides Reveal a Gating Mechanism for the Electron Transfer to the Type 1 Copper Center
rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 87
structure length 334
sequence length 334
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1mzzA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1mzzA02
2OJ1A 1PCSA 3CVBA 1X9RA 4DP6X 2DWSA 2P80A 1OE3A 3NSCA 5I6KA 1W6WA 4CSPA 2BP0B 1AR1B 4DP0X 5I6PA 4DPCX 1OCZB 2YQBA 2WSDA 2XUWA 1E67A 1KDIA 3N2JA 3ABLB 4F2FA 3X2QB 4YSUA 3FU7A 2VW4A 2NRDA 4HCGA 2DY2A 4YSPA 2E86A 4W9ZA 2PP9A 1A4CA 5D4JA 1A8ZA 1J9TA 2HX9A 3X1FA 2FT6A 2XX0A 3CZUB 3NT0A 1OV8A 3QJUB 1AZCA 4KO6A 1AG6A 4UAHA 1NINA 1AZBA 1DYZA 3IEAA 1OOWA 4KNTA 1JZGA 1KCWA 1IBYA 1BEXA 2FJSA 1KDJA 1SF3A 5PCYA 4E9XA 4CSZA 2FQGA 1A3ZA 2XV3A 3H4FA 5I5JA 3SBPA 4A2HA 2IWFA 1RZPA 3NYKA 2PCYA 4E9TA 2FT7A 3AG1B 1SF5A 1HAWA 4A2DA 1L9QA 2JXMA 4EF3A 2VM3A 4FA7B 3EH4B 1EZLA 3ASNB 4NAJA 1ASQA 1JZJA 3V9EA 4YVNA 1OE2A 1ZDQA 3AG3B 2Y69B 4YSDA 5E9NA 2J5WA 1N70A 3NSDA 1AACA 2ZWNA 1BAWA 1KCBA 5B7FA 4AKQA 2HRGA 3AG2B 5TK4A 1JZFA 2HZHA 1GS7A 3EH3B 2UXVA 4NB7A 3C75A 4WTQA 1ILUA 1E65A 2IAAC 1AZNA 2IDUA 3NSFA 4G7QB 1NIFA 3BVDB 4AI7A 3GXUB 2YAFA 3KW8A 5F7AA 4YSEA 2GB2A 3NJFA 1L9PA 2AZAA 1NIEA 3NJNA 1HFUA 4F2EA 1SFDA 1I53A 1JVLA 4X4KA 1F56A 4E9SA 1KBWA 3HEIB 1RCYA 4DP5X 8PAZA 2EIKB 5I26A 1SDDA 4Q8BA 3U25A 3DTUB 2XXGA 2J56A 4A2GA 1GS6X 1AZRA 2QPDB 1JXFA 4PCYA 1AG0A 2IH9A 2CBPA 1J5CA 1NIDA 3T71A 2HLEB 3OMAB 5B7MA 2H47C 2FT8A 2YARA 3EF4A 5I6MA 1M57B 2QDVA 3FU7B 3S3CB 1XMEB 2AFNA 6PAZA 5I28A 2YAHA 1ET5A 2YXVA 1ETJA 2UXTA 2XXFA 5ANHA 3ABMB 4YL4A 3TASA 4BDVA 1BYPA 2BZ7A 1NPJA 3WNJA 2FTAA 2TSBA 1JZEA 2DWTA 1PLCA 4YVUA 3HB3B 1OCRB 1W8EA 3KW7A 1OF0A 2YAQA 5EHFA 3FSAA 2FQDA 3FSZA 3DIVA 2IDQA 4G72B 3SQRA 4DP7X 3SBQA 1V55B 1WS7A 1FA4A 1E30A 3UAAA 1L9OA 1J9RA 2TSAA 5PAZA 1JVOA 3FQ1A 1PMYA 4F7KA 6PCYA 2X88A 1AAJA 1OCOB 4BXVA 3MBWB 2YXWA 2IDFA 4DP9X 3L45A 5LDUA 2UXGA 4Q89A 2FWLB 2LLNA 1A4AA 1BXVA 1GR7A 2CALA 3IE9A 3UAEA 1ID2A 3NJJA 1PLBA 4KNSA 4KO7A 4N8UA 3T6ZA 2XYBA 4ENZA 3QJRB 5I5IA 1RKRA 2CAKA 3RYMA 3WG7B 3ABKB 4FAAB 2BP8A 1BQKA 3ZDWA 3IN2A 2BZCA 2HX8A 5B1AB 1M9WA 1QHQA 5IY5B 2DYSB 4BWWA 2IWKA 1GW0A 1RZQA 1SDDB 1AS7A 1MDAA 1A4BA 1B3IA 2X87A 3WKPA 2VMJA 1EHKB 1J9QA 3GYRA 2PCFA 1NWOA 1CC3A 1PLAA 1ADWA 2H3XC 2HRHA 2FNWA 2GHZA 4BDVB 4A2EA 1MZYA 1OE1A 3MX0B 1R1CA 1OCCB 2EINB 3FQYA 1FFTB 4QKTA 3ABGA 3D12B 2UXFA 2MRYA 1NWPA 1J9SA 1A65A 3BQVA 9PCYA 3WKQA 4E9VA 1ZV2A 3AZUA 2EILB 4BK5C 4YSAA 2OCCB 1GY1A 2QDWA 1KV7A 4JKNA 3QJQB 1WA1X 2XX1A 1GSKA 2FQFA 3ERXA 1HAUA 5AFAA 1JXDA 1W6LA 2IWEA 4W1TA 2J55A 3NJHA 4A2FA 2J57A 2Q5BA 3T9WA 1AZUA 3FQ2A 3UGEA 1J5DA 1E5ZA 3OQRA 3T6XA 2ZOOA 3ZBMA 1PNCA 5AKRA 1SFHA 3N55A 1PAZA 1TEFA 4GP5B 5A7EA 4K9JA 3OMNB 2YAMA 1URIA 1E5YA 3NP3A 4GP4B 3AW5A 4TXVB 1JXGA 5D4HA 1IC0A 4E9WA 1WA0X 1XB3A 2YAEA 3X1BA 2BP8B 2BW5A 3EHBB 3TBBA 7PCYA 3CVDA 3SBRA 1NIAA 3WIAA 1GY2A 4UANA 4L0PB 1GYCA 2JKWA 1PZAA 2R7EA 3S8GB 2CCWA 3ZIYA 3X1NA 1BYOA 3S8FB 4E9QA 4YSCA 2H5UA 1ZDSA 5B1KA 3OMIB 1GS8A 1JERA 2VSMB 1JOIA 2XLLA 2IH8A 3FS9A 3NSYA 3T6WA 3TU6A 4BWTA 4DP1X 3IBOA 1ASOA 1WS8A 5B1JC 1WA2X 4YSOA 4GYBA 4AKPA 4M4RB 3PAUA 4N4YB 3T6VA 5TK2A 3V9CA 2PPAA 3IN0A 2GC4C 1YLBB 2PP7A 1BQ5A 2W8CA 4HIPA 1PZCA 2BWIA 3ASOB 3UABA 3FT0A 3GDCA 1NPNA 2P80D 2IDSA 3NJIA 1JZIA 3DKHA 1X9UA 2GC7C 2XV2A 3FSWA 4KOCA 1NZRA 2PPDA 1NICA 1DZ0A 1MZZA 3FU8A 4M3HA 1UATA 3FSVA 2XVBA 3H56A 1MG2C 5B7EA 1SNRA 1KBVA 4BWUA 2FQEA 1TKWA 1M56B 1MG3C 2W88A 4JHUA 1AOZA 1QNIA 2ZXWB 4A66A 3QJVB 3QPKA 2B08A 4KOBA 4NERA 1WAEA 1PNDA 2VN3A 1CYXA 3TBCA 2JFCA 2ZONA 4HAKA 1AQ8A 1ILSA 2XV0A 2PP8A 4AX3A 1L9RA 4YSTA 4P5SA 2BW4A 2N0MA 1AS6A 4YSSA 4A67A 2XU9A 5F7BA 2DV6A 1XB6A 7PAZA 1N68A 2EIJB 3CG8A 3AY2A 4WKXA 4G7SB 2GBAA 2GIMA 3FYIB 1BQRA 3FU9A 2RACA 5I5MA 1ET8A 4BXSV 1NDTA 4A68A 4GP8B 3CDZA 2XWZA 3EH5B 4PAZA 2BWDA 3WI9A 2UX6A 1CURA 1BXAA 2AVFA 1XB8A 2AZUA 4DP2X 2R7EB 3NP4A 2PLTA 4E9YA 1VLXA 1KYAA 5FC9A 1AIZA 1PF3A 4DPAX 1SHWA 2BP0A 3ZX1A 5I6NA 4GXFA 3PAVA 3OM3B 4QLWA 1CYWA 3FPXA 2QT6A 2I7SA 4G71B 2HXAA 2A3TA 2VW7A 3UACA 5B1BB 1ASPA 1IUZA 2IDTA 4GY4A 2PPEA 3UADA 1L9TA 1KGYE 1NTDA 4E9RA 1CUOA 2PPCA 4G7RB 4HHWA 3NJMA 3X1EA 1V10A 4KNUA 2UX7A 1L9SA 1IKOP 3FPYA 5I6OA 2GI0A 2DYRB 4HCFA 3NJGA 2VSKB 3PXLA 4HALA 2HX7A 1ZPUA 4KO5A 4MFHA 4AKOA 4YSRA 1ZIAA 3JTBA 5I6LA 2AANA 1PZBA 2EIMB 2Q9OA 4YSQA 4P5RA 1PY0A 3QJTB 4G70B 4UF7C 5B1JA 3NJKA 2CUAA 2CJ3A 1BXUA 2I7OA 1TU2A 2YAPA 1AANA 2YAOA 4DP4X 2I85A 4HZ1A 3PCYA 3PAZA 1FWXA 2Y1AA 2WO2B 4DP8X 1TEGA 3TA4D 4DPBX 4HCIA 1NIBA 4KO9A 2OV0A 2BO0A 3AG4B 3X1GA 1IBZA 1QLEB 3CVCA 4JHVA 1SHXA 4HHGA 5D4IA 3S3BB 3OD3A 5AZUA 2QPEB 3H4HA 3WNIA 3NJLA 4RH4A 1SJMA 2MTAA 1V54B 3QQXA 1ET7A 1JZHA 3JT2A 1AS8A 3CDZB 1ZIBA 2PPFA 3QJSB 4ZK8A 5B3SB 2WO3B 3S3DB 2VM4A 2BHFA 3G5WA 4AZUA 3FYEB 2VW6A 2GSMB 3PPSA 3PLYA 2B3IA 1T5KA
chains in the Genus database with same CATH superfamily
4ETQA 3IMRA 2O5XL 4GW5B 1B4JL 4FJYA 4TSCH 3BAYA 1Q0EA 3QRGH 4XBMA 3ZHDA 1XAKA 1EVUA 4PV9B 5DZJA 3SSGA 4F7EB 4QO1A 2FCBA 3VD7A 1AR1B 3DHPA 4JMXA 1A5FL 4XPBH 2GJRA 3G6DH 3IDNA 4NPYA 2J88L 2AERT 5KG9B 3X12B 4Z7QB 1T0OA 3KPMB 4OIIL 4LSUL 4F93B 4F2FA 1JUFA 1YNKL 3O6KL 3QIWD 5IZ7A 5L2KA 1BFVH 2FX8H 1FYTD 1SOSA 4QT5B 5KZCD 1UHVA 3L6FA 4FJZA 4KJWD 4OD2B 1J9TA 1PBYA 1U8QA 3ZDXF 4E41D 2EDRA 1SLVA 2NW3B 4RGMC 3NT0A 4BKTC 32C2B 1NINA 1G0DA 4IRZH 5LBGA 5C0IB 1PCXA 2ZNWA 4HC1A 4UBDD 3L5HA 2ZKMX 1RQ5A 2WZ0A 1SUHA 2IPKA 5EIVA 1FZJB 5FYJE 4CSZA 5TE7L 2GBTA 3GKWH 2F15A 4WO4B 1P5UB 1WCBB 3QFGA 3SBWC 5IEKB 4JHWL 4OGAC 4Y7MA 4QHNA 4UV4H 4WUUA 1K2DA 5GZND 2AXWA 2GT9A 5BQDA 3ASNB 1KXTB 2OLDA 4POYA 2C3WA 1RJCA 1MEXL 3LH9A 3ARXA 2ZCKL 1NFKA 4RDBA 3WTUA 1X5JA 4W9EC 3K6SB 1R5IB 5ECGA 3MV7D 4X6EB 5H35B 4H20H 4B60A 1P6WA 3C75A 4TUKH 4WTQA 2O6EA 5HDBF 1J0KA 1AZNA 1NOFA 4LVHB 3FUDA 2DQTL 2V2WB 5CUSL 4RETB 2XWBA 4F8OA 5KTEH 4MBRA 1P2CB 3C8KB 5C6WH 2ZWLT 4JZNA 3BI9X 4K94L 2AGJL 4XI5C 3UZEA 4ZPVA 5FGBA 2X4OB 3MRCB 1WFMA 4Q8BA 3C5SB 2C9VA 2Z9TA 4XP6L 2ERJC 3SE4C 5MERB 4NCDA 3MNWA 3FT4A 2D73A 1EO5A 5E1IA 4EI0A 5KVFH 1EAOA 2A83B 2VAAA 4H40A 4APQD 2HFEA 2PTTA 2WUCH 1NCAL 1RJZB 3ATDA 3FT9A 4WEBH 1DQJA 4MDIA 4UYPA 3SDCB 1AR1C 5T3ZH 4LOEA 5EA0L 5CEZH 3ZR5A 1OM3H 1ZSHA 5EWIL 5DRWA 3II1A 1I8KA 1UCBH 3MYJB 4HWZB 4IMLA 3UP1A 4ZFGH 5ICZB 3K74B 4Y1SA 4QRPE 1W8EA 4MJIB 4GSQA 4NZFA 1U8JA 2N7SA 4LCWA 2RH0A 5EF3A 2BCKB 3OAWA 4GSUA 1DBJH 1CDUA 1JF1B 1WZ1H 4PB0H 3FFCE 1FG9C 5ICYB 1KN2H 3RWDB 1E28B 2A99A 1B0GA 3EAKA 3EH1A 4RMSA 5EDXA 5KSAB 1T3FA 3LSOA 4G8FA 4XT1C 3CFJA 3UTTD 4AGPA 1IZKA 1A1OA 3ETBF 4JEGB 5HDBE 3EYUL 5EEXA 5I1CL 1EHLH 3LB6D 1MRCL 2ID5A 3V95A 2FEDD 1HL9A 4H26B 3BJLA 3ZOAA 1MJJA 4IBTA 2VLME 5KBMA 1E4WL 1I3GL 3D08A 2VWEE 2XZZA 3PNWB 5E8EB 4HA1A 1UD8A 4UNVA 3L8QA 3QXTA 5K39B 4Q0XH 4G7YH 3V55A 4R0LB 3TIDA 2JB5L 5DR5L 2FD6H 1KENH 5DVKA 1S46A 3ZYOA 4FNTA 4M1CD 3S98A 1WFUA 1ETB1 2BOBB 3GI9L 3M17A 1DVSA 4JFFB 3GSUB 1S8DA 3NJJA 3VCLB 3ZDXB 3S9DB 1RUKH 4KNSA 5EZIH 5FGCE 4WSKA 2EAEA 2OQJA 4RAHA 2ZTBA 1IM3B 1JK8A 3BKMH 1HH9A 1TQBB 3OZKA 5F1NA 4I9WD 1I7ZA 3HS8A 2J20A 3NDZE 4V1DB 4G82A 1MIMH 4LVHC 3QC6X 5I82A 2RCSL 1DJYA 1WD9A 3ESMA 3FHQA 2VDNH 2ITEA 2N0KA 3HB3D 1AS7A 4JQIA 4OLUH 1H3UA 1QRNA 4X6DA 5IB1B 1F3JA 4FP8L 5J1AB 1M7DB 1HL8A 1LMKA 3QUHA 4WZ9A 1GGBL 2X12A 3QQDA 3FB7A 3QEGL 4KRPB 3GLDA 1EHNA 5AW5B 5DMKA 2FWOA 2WXPA 3JVGA 5HDWA 3CFIC 4JRFA 1MCPL 5F0JB 4LLUA 3GSWB 2DM4A 4Z3IA 4YHPA 4E42A 2WPGA 3MROA 5DHXB 4EOWH 2Q76A 1GGYA 4FFWC 4PS4L 1I9JH 4L5FH 4NWTH 1OPGH 3A22A 2AKRB 3SDCC 1E43A 5F97E 5TFSH 1TJIL 3WXWH 2JLPA 2DWDA 5AW4B 3SQOH 3D33A 5AB9A 3RVVC 3AT9A 4FLHA 3STLA 4PUBL 2XJLA 4AE1A 1B4RA 3VSTA 5F7KC 3RAJH 5IHUL 4ISVB 2QLYA 4L1DA 4G8GD 4GW1B 4HH8A 4LP8A 2K6ZA 5IFHL 3W2DL 3IDXL 4RISH 4JO2H 1Q9WB 4HBCH 4L1SA 4OH2A 3RVUC 3BSZA 5J3HC 2ZYHA 1HXMA 1UWXH 3Q1SL 5AVQB 5KSAC 3FQ4A 4LSSL 3BX7C 3UGEA 2OMVA 3FQTA 1E4KC 1XO8A 3H2QA 4LPXA 4M6OH 4K9EL 5FUZL 3TOPA 5MHSE 1GHFH 3HZYB 3T1WA 1ZMYA 4H88L 3L7FB 4OGYL 2Y07H 3X11B 1I1AA 3OZ9L 4UNIA 3GBMH 1TEFA 3U2SA 3BDXA 4JHBA 1VEOA 3E0GA 3OBAA 4HEPA 1WRFA 3CV5A 4OFKA 1AXSB 1OB0A 4ZS6C 3Q8FA 1FNFA 1G1YA 1G6RB 4F2MB 5J6HB 3OKDB 3GS0A 3O3BA 4ONHA 5FGRA 2IAMA 5EF0A 3VFGL 5EOQL 4QHLB 4R0LC 1E2WA 1F58L 3SBRA 4KZ0A 1ACXA 5DQDL 3RJDA 2JH2A 3BGFC 4AM0B 3P4OB 5GGTH 5JR1H 2AK1H 2WQAA 3N42B 3TEWA 2P5WB 4WY7H 5G4OA 2HAZA 4XMKH 5T1DL 1TQBC 2NY7H 3HRZB 3NZHH 3H9SE 1CL7H 1ZLUK 2VM9A 4M7JH 2QFRA 3IJSA 4ZW7A 3QEHB 3FB8A 5C0CE 1R3JB 1QW9A 3W9EB 2BXZA 2VR7A 4FABH 4NKDB 1KYDA 4WFGE 2Q7YB 2ZYSA 2GC4C 1YLBB 1CFQA 2AAAA 3LKNA 3G5VA 4KRPC 1FZKB 2J1YA 1A9BB 1DUZA 2BWIA 3E1ZA 2EO7A 4P3CH 2H3NB 2VRQA 4OJEH 1D9KA 1V7MH 4URTB 4W9HC 3WUWB 2B1HH 2R2HA 2IDSA 3O6FA 4YS4A 1G5GA 3TH3T 2HKAA 3FSWA 1SJHB 2YK1H 3IETA 3UAJA 4O2CB 4KH9A 1N0LB 4R90L 3ARFD 5CEYB 1Z2KA 5D1ZI 3I50L 4FXKA 1LEGB 2FO8A 1XGTB 1KBVA 1I75A 3HG2A 2FQEA 3W0WD 4U31A 4CW1A 5ESVA 3LEYL 1HIML 5JW4Q 4UT9L 1QNIA 3NH7H 2WLLA 4LNRB 2GAZB 4NERA 3ZHLA 1KLFA 1O7SA 3BEVB 1SMAA 2VH5H 5FHBL 3T3PF 2VWEC 3DDFA 3QDMD 4JFHD 1R33A 1AQ8A 3F00A 4YXKL 5F7MC 5C3LD 2ODHA 3MRFB 4PRIB 5IFAH 4P5KB 4DW2H 4O4YL 4Y5XC 3VD1A 2VMCA 5I74B 3BPLB 2GBAA 4MAYD 5GSVB 4JFYA 5CLYA 3VQ2C 5I5MA 3ILDA 4LPTA 4FQ2L 4UOW1 3V4UH 4BXSV 3A4FA 3RWJB 4G42B 4P99A 2IC2A 5KVFE 3L4WA 1AO7A 4LRNH 5HYIA 3LIUA 4ORGA 3OWRA 3KCPA 1MNUL 4QXVA 4TTDD 5K9OB 5T3ZE 4F5CE 5CEZE 1LP9F 1OLZA 2OR7A 1S78D 1RULL 2F5BH 4BFKA 1F3DH 1MDTA 1A7RH 2I07A 2WBXA 2FATL 4GRLB 4U0QB 2W0FA 5DD5L 5CBEA 4QLWA 1CYWA 2JIXA 4NZDA 4Z1PA 2WMPB 1KPUB 1MJ7L 2L04A 2IPUK 4OF6A 5EU3B 1QTPA 5HJGA 4ZMZA 3FJTA 1LDPL 4KMTL 4LSRH 4AH2A 3BWAB 4XN9A 3HRZC 3Q3GB 2DMCA 1PX3A 1TJMA 4G7RB 3W5MA 4HJJH 1V10A 1TSRA 1INQA 3AS1A 1JF5A 1IKOP 3FPYA 4RWYH 5EUKB 2GI0A 1OF2B 3U1SH 1FG2B 3ULUC 3RNKA 2EKSB 2XN9B 3HI1A 3VQ1C 1BMZA 3B9KB 5I6LA 1GC1C 4WWID 2Q9OA 2CHZA 4HC1H 1JHKL 4M6NL 3BZFA 4ODTH 3VFTB 4M5SA 3C2AH 1NLBH 3VRIA 3NFNA 5JDJA 2G5RA 2CIKA 4CVZB 3D85A 1MCBA 4DP4X 3KPSD 1IFHH 5IV2A 4MJ2A 3DX8B 1G9NL 3ISRA 1C16B 2NXYD 1O9WA 5AW1B 1NLDH 5EZLB 1PZDA 1GCFA 2OM5A 5A6LA 1P7HL 2ZG3A 4G7VH 4KKPA 5CD3A 5T3XH 1K8DB 2X4NB 2MCAA 1KB9K 3V5HB 4CAGA 4JRLA 1Q1PA 1KJVA 4JHVA 1OB1B 4MJJA 3EGXA 5IG7B 4MMZB 2JKJA 2DDQH 2BNQD 3Q6FB 4F58L 5AENA 3WTTA 3NJVA 1QSED 1PX4A 2ATKA 1NM4A 2VDMB 3KJ4C 2CDGB 4P5MB 4OZGE 1IKFH 4LARH 1TOXA 1KELH 3U4EA 1U8KA 4TOYH 1E9OB 4L3EA 3AY4C 3ULVD 3TM6A 5I8OH 1E5CA 5I74C 5HVHB 2E46A 1I3RB 2EEXA 2H2PD 2JKXA 4Y4KA 3WN5B 4JPWL 2GSMB 3ML8A 4K3EL 2HRPH 5TQ2L 4DH2A 3RI5F 4HD5A 4ZQKB 3CDYA 3CFEB 3LN5B 1C5BL 5KVDH 2DWSA 4L5FE 5C0GB 4Z7OE 4G2AA 3VWKA 4MQTB 5J7CC 3IU4L 3UG3A 3H0TB 3RPIB 2FE0A 1W16A 4KI5F 4JG1H 4M02A 3IPBA 4KX7A 3C87A 1IIKA 3KMDA 1AQMA 4DK6A 3VXUA 4XH2B 4X9BA 3HPLB 3DVNB 5E5LA 4MAUH 3T3PB 2VW4A 4GRLC 4HCGA 4XXCA 1TZOA 5LDSA 1FVCA 4HJSA 4PSRA 1O6TA 3X1FA 4ZMNA 4AUUA 1UD5A 3T8VA 4LCYA 1E27A 2Y9RT 1KPVB 3SYOA 4QXGL 1AOHA 3DX7B 3AFLA 5C08A 5EF1A 3L54A 5D2NE 3PUUA 1MHCB 1ZVHA 4XNYH 5D7IF 3GM8A 5CGMA 5DU7A 1TDQA 1N64L 3N43F 1SF3A 3CZKA 3KEDA 4TSBL 4NCC2 4ELMB 2P8LA 4ALAH 3BE1H 1TU2B 3HZVA 4JRXB 2FLBT 4NKOA 4PGBB 3OSVA 4WTZA 2ADFL 4N9OB 3TONA 3KYMB 1XGYL 2PCYA 4YHYB 3B9KC 5DJ8B 2YD8A 1HAWA 3QJFB 1LP9B 5ENWB 3HAEG 3O2VL 4S1RL 3LRMA 4QRAA 2VDOH 3CSYA 5IB4A 3VO0A 2CBMA 5DDHA 2E5EA 2AEWA 3C6LB 4YVNA 4MMYB 4UOJA 1DBBL 4YSDA 4MRCA 5ERWA 2J5WA 4GIPD 1WO2A 3J2PA 4LCIL 3QUML 3LHPL 4JO4L 4K73A 1L4IA 4X9FA 2XVLA 4AQEB 4J3VA 5E70A 3ARGD 1J86A 1U2CA 5HI4D 4XMPH 4PLKD 4L4JA 4OZIF 1DQQB 1EO8H 4ENED 1HSBB 2KZKA 2QV2A 3MFGB 4R4ND 1DVTA 4Z7UF 5HHOD 4OM0H 1VERA 3SDAD 3IFNL 4MMZC 4G7QB 4KHXH 5AVZB 3V6FA 4JY6B 5C3IA 5F71A 1XL6A 2WGNB 2QTEA 1VPOL 2NUTA 3DURA 1Z3GL 2BVUA 3MODH 1YMMA 3L95B 3JZYA 4P4RB 4JO1L 4R97B 4B9FA 3BP5B 5HJBA 3CGTA 1RURL 4F2EA 4KY2A 1JVLA 1A3RH 3GSRA 4X4KA 1IEAA 3TIEA 4E9SA 4RMTA 1F00I 1F4XL 1QFWM 1YA5A 5HVHC 3RGVA 3GBEA 4FNQA 5C0RL 4JQIH 2QPDB 2A77H 2OAAA 3WN5C 2IXQB 4J3OH 3WLWD 4NQCB 4Z23A 4I1PA 3D07A 4HIXH 2J2ZB 4EIBA 3E2HB 5DYFA 3QWRA 2DQCL 1ONQB 3OB8A 3RZWA 1XCXA 1ZK9A 4JUTA 3GDBA 1ZA3A 4X7FC 1BF5A 1KJ2L 1M2VA 3BVUA 4PG9A 1Z66A 1DQMH 4U6VL 2XFXA 1J11A 2Z0UA 2J4WH 3E9TA 3KW7A 3T5WA 5JQIB 1HVXA 4OZHF 3RGHA 1OAUH 4G6KL 4HKJB 2NY6B 4TQEH 2JELH 3OKNA 1KBKA 1BFTA 4CN4A 2ADGA 2X6AA 3HC4H 4HUWA 5M95B 1JSYA 4L4VE 3V0DA 2NX5E 4RZCA 5TJWK 3GWJA 5T1KA 5DVMA 2L7UA 3Q6GL 4MA1B 4OZIE 4HF5L 3N91A 2YD4A 3AWGA 1FIGH 2IANE 4OVVA 4Y16A 2FBRA 1YEFH 2XN0A 3HE7B 5BS0A 4F7KA 1P7KB 2DJ4A 1YNLL 5C0DB 3CX5K 5D1XB 2ZXQA 4YHYC 4Y9BA 1NBZA 2Y5TA 4JREB 4OCWH 4UB0H 4DNLA 3PGCB 1S9XA 4DT2A 3UPAA 3I75B 3U0PB 1FAKT 1JPGB 2OXGA 5JIKA 2AQRA 2QQLL 2CALA 3RNQA 2VZUA 5D1QB 1RHHA 2D3JA 1ID2A 3HG5A 5LGJB 1CGUA 1S7SA 1UQSA 3X13A 2ZG1A 1HEHC 5EZJA 2PYEA 1BOGB 5AB2A 3MPCA 4NYLB 5AW2B 2V5RA 3ZO9A 5D7IB 5L2KE 3GO1L 2HX8A 2VERA 4IRJA 4K3DL 5JIPA 3N43B 2UZYB 1MCFA 1F18A 3KD4A 2DB8A 1KBPA 2WTRB 3P69A 3CQFA 3MRHB 5TDPA 5I76B 4PWFA 2CO2A 3HE6B 3WFCH 1RAMA 2WJ7A 4R97C 3ZE1E 1KCLA 4NOBA 4HISA 5HJ3B 4NNPL 3V0WL 4K0OA 2X42A 1P84K 4XAWL 4K7FA 3LKRB 2VLKA 5A7BA 4WV1A 3MA7A 1ZLUH 1NMBH 2ICES 4YHZH 4CSTA 2PXYB 3E2HC 5ALBH 4IYKA 2EINB 1K4DA 4JR9L 4HEPG 1CFVL 5J12B 4W6YB 3ABGA 1T0MB 1BW8A 4WUUE 1A65A 5IQ7H 4G8EB 4Z7UB 5FO9A 1CWVA 3V6ZB 3KPPA 4FRWA 4CU7A 3FT2A 1BZ9B 2ADJA 1LO4L 2MNJB 1AD9B 1KFAL 4KTDH 1EJ6A 2IIJA 4HU2A 1T2JA 3T0XA 5DMGC 1JYWA 3PQYD 5GGSB 1QA9A 3DLQR 3UXFA 5I1EL 2NY6C 4JB9H 2IBZX 3QVAA 1QI3A 5HI3D 1X9QA 4HS3B 1FL6A 4YDJA 5IQLA 3FO9B 3V0FA 1WIOA 3N6YA 4UT9A 1UB5A 4WJ5A 5CS7A 2WBJA 5EPMB 1JI1A 3T6XA 4MA1C 3JTSB 5J11C 2EUVA 2WXLA 5DGQA 4KX9A 5C0FA 1YEIH 3HE7C 3O45B 5FUCE 3LY6A 1JYVA 4XCYB 4PY7B 5AOKA 4WNSA 5D1XC 1JTOA 3WAJA 2P5EB 4JREC 1GYUA 4KI5C 3HC3H 1HKLH 1E5AA 4AQ1B 5LLIC 4NIKB 2BP3A 1R75A 1W0VA 1KTLA 5F21B 4L0YA 4WI7A 1KBGH 4M56A 4GG6A 3TO2A 5HP5A 5KYXB 2RFXA 4OZHB 1UZGA 1SN2A 2C9SA 3WN6A 1AY1H 4AV5A 3DX9A 1A9EB 4JG0H 4UIMB 4Y4HB 3SQBB 4H0HB 3O3DA 4XNQB 4OJYA 3MLPA 2BSTB 1BQSA 4X6DF 1V3JA 3NTCL 1KYOJ 4FEIA 2O5XH 5DHEA 1B4JH 5AW9B 1T4KA 3WO4C 3MRGA 4GAJL 3FS9A 2W1NA 4TVPE 5KW9L 5TDOB 4LCWE 5E5UB 2V7HB 4NJAL 5HHMD 5IOPA 1A5FH 3HE6C 5ISZB 2J88H 5KS9B 4D8OA 2WUBL 4OIIH 4LSUH 1YNKH 3O6KH 3QIBB 1MH5A 4W81A 3BIKB 1KNOA 1L6XA 3VXNB 4LDOB 3DXAA 1HQ4A 3R06B 4Q6KA 3MJ8B 3HCVA 5TGBB 1C1EL 2PXYC 3D0VB 4GT7A 2YEZB 3S96A 2PPDA 1AGBA 1G6VK 5C0EA 4NQED 5E1AA 3IFPA 3CZJA 1BQHG 2XVBA 3H56A 1G7MB 4KVNL 5J12C 1MJUL 4QRFA 5B7EA 4EI5B 3ECQA 4GEJA 2X89A 2Q6WA 1AOZA 1E8XA 5TE7H 1NCTA 2X0WA 1VGKB 3HUJA 3HAEB 3UX9B 3NDYE 1XBDA 2F6AA 4JHWH 3LVEA 2YMOA 2EXWC 3AREB 3LQAC 2VLJE 4Z8FL 4NO2B 4AYFA 4PJEA 1OCWL 1NUFA 4TNWF 5BMFH 4AIEA 1MEXH 3WJMB 3U0TA 4DUXA 4I8DA 3GEWB 2ZCKH 1CIUA 1Z9PA 2WYZA 1JRHL 2O61A 3QWNA 2RACA 4H13C 2XY1A 4P2YA 2QQQA 3DHJA 4X6DE 5K9QG 5ITFA 2FSDA 1QRNE 4XPGH 2KPNA 3OPZL 2Z7ZA 2HLFC 5TDNA 3FCTB 4HIEA 4KKZA 4KTYA 5IIEB 3ZHFA 3CZEA 2V2TB 2DQTH 1UOWA 1V05A 5CUSH 4AQ1C 1SJHA 2LLLA 1KWKA 1DO6A 4K5PA 1T21A 3A21A 1HEZB 4WFHE 4OQ1A 3P9MB 5J0BA 3UTPD 1U95A 3KL5A 4K94H 1KJMA 4JKKA 1W91A 3F2LA 4MJHA 3TNMB 1W72H 4U1KA 3SPCA 2NQDA 3UACA 5BXFA 4U6TA 5E0FA 2WZAA 2XWTA 2D7TL 3D25A 1NUNB 1U3JA 2O6CA 1EBPA 4PLNC 4K7PL 3OR6A 1JP5A 3PL6A 2CLZA 1ZVYA 1NCAH 1RLWA 4HUXA 5B8CA 3O8XB 1TR7A 3IMSA 5EA0H 3QQ3B 1XXDC 2VLRA 2H41A 3ZE2E 2WN2A 4X5PA 4XWOC 5EWIH 4TNGA 3HHMA 5I16B 5IKCB 3L48A 3QIBC 5HPMB 4YO0B 3JWDL 2VLJB 2EDOA 4NUJA 5FKPA 2FO4B 2YAPA 2I85A 4ZUSA 3KGRA 5L9DL 3ZHKA 4MJ6B 1R3KB 1N12A 4CADB 4QRRA 2VLLB 1PEWA 5CEXB 4DPBX 1EXUA 3H9HA 5JO5A 4AM0Q 3C09B 4HH9A 4EI5C 1YY8A 1LQBC 4PVBA 5AVVB 3QK0A 3EYUH 3EADA 5I1CH 1YEDB 1MRCH 5DUPL 5IEHB 4LGPB 3GJFB 3QUMA 1EZVX 2KZWA 5D7JA 1E4WH 1I3GH 2HFTA 3RVXD 1CFTA 2ESVB 5CF3A 1BZ8A 4L8BB 2BX5A 3PDDA 4RFOL 2JB5H 3CUPB 3L4VA 5DR5H 1TJXA 4ZXBD 1P4BL 3AQDA 5J1TC 5C6PB 3GI9H 2XPGA 1M7UA 4MTMA 5FF6A 2B3IA 4P2AA 3VGAB 4KXZH 1AZVA 3WMSA 2AVGA 2WSPA 1BFOB 4P5TA 2A9AA 3KVQA 1MCJA 1RMFL 5AOIA 3B8YA 2P28B 4WTZG 1S5HB 4BE6A 2VDQL 3TLRA 1CFBA 1RUPL 2RCSH 2X1XR 4WHCA 2YQBA 5DC4B 1KIUB 5JW4N 2XN1A 4OFYA 3CAFA 1FRGL 2YBRB 3AMLA 4FP8H 3MNDA 4U1IA 4JLRA 1GGBH 3IBEA 7PCYA 3QEGH 1PZUB 1DLHB 2C9RA 3UGXA 3V4VB 1MCPH 4Z7VB 1MWOA 3WJLC 3KBHE 2QPUA 1AZCA 2L8AA 1KJ2A 1EAPA 2YN3A 3BVNA 3EGDB 4HS6A 4KO6A 4QRQA 4L18A 5IB5B 3C5JB 1TZIA 5FA3A 4ERSL 4PS4H 3FU5A 4EVNB 2ZCHL 4Z7IA 4P5MA 1ZS8A 4JM2A 4R3SB 4M93B 4U1LB 2GFBB 2HTLD 2FAUA 2FJSA 2GY7B 3O8XC 5C0AA 2GCYA 3T6QC 1TJIH 4E9XA 1I4FB 1OAKL 5FWRA 2R1WB 3MJ9L 3SJVD 3NYKA 3S5ZA 4PJBF 1UOVA 4PUBH 1D5XB 5I1IL 1YNTA 3E1F1 2JXMA 4PRHB 5IHUH 4EF3A 3CXDL 4EJ1C 1L6PA 5IFHH 4YAQB 1GJIA 1JZJA 1H6EA 3K81A 5IHZB 3W2DH 2OSLB 3IDXH 2BJML 1T7XA 1AO7E 4IK7A 4PMEA 1MI5B 3KL0A 5J13C 1BM3L 2D7QA 3HN8A 3Q1SH 5DJ0B 2HRGA 3AG2B 2Y5QA 4LSSH 5FUZH 4TVSa 3LKSB 4WLCA 3HPLA 4K9EH 1VF5C 1WAAA 3TEZA 4WVRA 2UXVA 3C09C 4H88H 4OGYH 5E8PB 2A0LC 3T04D 3OZ9H 4KK8C 1MLCA 2IAAC 2F1AA 3W39B 4BH8A 3BVDB 1V3LA 3UC2A 4KK6D 2HN7B 4OGZA 4N2IA 2GB2A 3FTYA 4F92B 5T33L 3MV8B 3D3VB 3WS6A 5I2IB 2FGWL 1HFUA 3TYFB 1N6QL 2BSRB 5DVOA 3V0VB 1I53A 3RB5A 5EOQH 1AH1A 5DUJA 1F58H 4D0CA 4DP5X 1RCYA 2OSXA 2OMXB 3VRLE 3H9YA 4OCYL 4XBEL 5HSFA 2YSSB 5KJRL 5HI5D 3NPSB 4PJDF 2CBPA 1J5CA 1AKJA 3VGAC 4QPEA 1JGEB 2H32A 3LAFA 1OGSA 4CNIA 5B7MA 5T1DH 5KYWA 4E68A 3ZDYE 1MOEA 1IKNC 3W11D 3U7AA 4JO5A 5EIQA 3OG4B 1G7LB 1F11A 1T83A 2CMRL 5FIEA 4X5LA 2AXFA 4XO9A 1AVAA 2Q2EB 4NRXB 5HGGS 1VACB 5EO1A 4YVUA 2IGFL 1XCTA 3MBEB 2W94A 4HJGA 4FN0A 1BWWA 3SGJA 5CKGA 5EHFA 2FUQA 2DYPB 2YR3A 1P9MA 2FBJL 4JG9A 4XC3L 4NQXA 1BQHB 2ZOUA 3ZTJG 5C71A 5FYLL 1SHMA 3P0VL 5CGBA 5F3HA 3WY4A 4M93C 4HAGA 4R90H 5AZEL 3I50H 2QEJA 1CG9B 5I5RA 2IAMC 2Y24A 1ZLDA 2ITFA 2HJKB 3PUCA 4XO8A 6PCYA 4L3EE 1GKEA 2X88A 1HIMH 3IJ9A 3LEYH 2JB6B 4UT9H 4WUKL 1A7BA 3WLBB 2ILLA 5C0JB 1U3HB 5MEPA 2ZSVA 5T3ZD 2EC8A 4J12A 4A7TA 1J8HA 1CS6A 5FHBH 1S7TA 5IQOA 3G08B 4YXKH 3PDGA 2L0DA 1D5ZB 4ZO6A 3DVGB 4UWQB 2GSIB 4XBGA 5BO0D 4O4YH 3QB7C 3L7EB 5HVFB 5DEJA 2ZKHL 1KPRB 2GUOB 2NT0A 3GM0A 1BQKA 3QCVL 4FQ2H 4G1MB 4KROD 1T7YA 1MKFA 2Z31D 2H1PL 2XQYK 4FTVA 4OBSA 5DUBB 2E7CA 2FJFA 4MQ7B 2JJUA 2XA8L 4WNQB 1MNUH 2PO6D 3ROLA 3KHQA 3LPWA 3KPLB 4FG0A 1ETZA 2XQYA 4JL1A 4OB5L 3ZDZE 5C0BA 2UZXA 4LKCA 3CD4A 4PJBB 5FFGA 3BPOC 5C08E 1RULH 2IO5A 3EDDA 5BZWA 3QUZA 3UTOA 4AJYV 1EHKB 1UVQA 2WYTA 1CD1A 5BRQA 1A7QL 2FATH 4WRLA 2NW2B 3LD8B 5DD5H 3B34A 4YZFF 3CU7A 3NPSC 4KQ4L 1K5WA 2OMTA 3P4LA 2HRHA 2PKDA 2ZUQB 3QNZB 4A2EA 2E7BA 1LDPH 4KMTH 4MJ4A 3SE9L 1PG7W 4XNUL 3VMNA 2UY6A 1SQ2N 5ID1A 1XIWB 4Y8AA 3VAEA 5JQHC 4X0KB 5I8EB 4FNLL 2J3SA 3OG6B 4LPUA 4M43L 3CQQA 3S48A 4HX1B 1G6RH 4BK5C 4GSRA 2SODB 4AQAB 3DPBB 3EO1B 2OL3B 3MBEC 4KK5C 1JZ3A 1UXMA 3HG1A 5HYJB 4MD5A 3MREB 1NANI 2BM3A 4QNPF 1JHKH 3ERXA 3D87B 2F54B 4M6NH 4WEEA 5AFAA 5F3BB 5H2BA 1OSPL 1M53A 4JO3L 4FFVC 2HTKC 4PJDB 1EWHA 3BPNB 4HULB 1G9NH 3D18A 3JYBA 2XJKA 2AMUA 2CR0A 3E80A 1E5ZA 3B5TA 2E9JA 3DHMA 1SHSA 5FS5A 1BECA 4FF9A 1YMME 4TYUA 3UDWA 5F7YC 3IF1A 1XF1A 5I17A 1G4MA 1TQCB 4KXDA 2X0VA 4F58H 3NP3A 1U3HC 5D9SA 1GZQB 3T2NL 4WI0B 1GC1H 4ZAKA 3F8UB 3DX6A 4LPVA 1OSEA 2WN3A 1HYRC 1MLBB 3GSQB 1O6SB 1VRSA 2WIMA 2VQ1B 4YZFE 1BX2A 1CQKA 3T8MA 4E41B 1A6AB 1HK6A 4WHDA 4NXSA 2DQFB 1G7IA 1UUSA 2VDRB 5EBLB 5H94B 1Y6NR 2MQ3A 3TZVD 4YFLF 3VSQA 4JPWH 3HKFA 4K3EH 4UQAA 4P2OB 5TQ2H 3S8FB 2YQ3A 4AIZA 1NBYB 5IJBC 1P4LA 1C5BH 3I02B 2BZDA 3BP4B 1R6VA 2EXSA 5AWNL 4ZZKA 3IU4H 4H8HA 3ZKQD 4OCRL 4M4RB 3NCEB 3VFMB 1UM4L 3TT1L 3ZMNA 3ASWA 3CFKB 3LD8C 1IGML 3P9LB 5H37A 3LV3A 1NPNA 4DUVA 4JFDA 5F89A 5DHMC 3D69A 1ADQL 4PGJA 4JFWA 3QG7L 5CKAA 1JCKA 3B9AA 4TQPA 3TJPA 2CO6A 5BS0E 2ZUQC 2KDYA 3MV7B 3KPRA 4QXGH 1OEZW 3SZKC 4JJ5A 1OARL 2C34A 4DVBB 3IU3B 2XVKA 4AQ8C 4N0UB 1R5VB 3MGTB 4JFED 3PGDA 4NRYB 1XIWC 3FSVA 3TJHD 2JJWA 3WIFB 4EZLA 3D1MC 3GRGA 5C1MB 1KIPB 2J6EL 1HI6B 4HZAA 1L0YA 1PZ5A 4DKTA 4XVJL 2JCWA 5A3IC 4IKLA 3SGEI 2ITDA 3K0WA 2ADFH 1XGYH 4JO8A 3BZ4B 4Y4KC 1ILSA 3UG4A 3O2VH 2WGXA 3V5DB 4F8LA 1IMHC 2PYEE 4N2LA 4AX3A 1BVNT 1XSIA 2Z93B 3RWEB 2JV6A 4HUMB 1XL4A 2DV6A 4O9HL 4XP9L 4L1HA 4NQTA 1DBBH 4P06A 5ELIA 4WKXA 4XXDA 3REVA 2YPLA 3BPNC 1BQLH 1XQ4A 3QUMH 3LHPH 4IRSD 4JO4H 4LCIH 4P2RA 4UT7L 5FWQA 1EMTL 3P54A 5IQNA 43C9A 4AT6B 5JORA 3WTXA 4FG6C 4LHUD 3WENA 3EJQA 2XWZA 4NEHB 2QGDA 4PR5B 3RWHA 4KHTL 5HYQB 4FQQA 1TQCC 4IEFA 3GMNB 5HGDB 3IFNH 1BXAA 4GG6F 3HI6L 2VLKE 2DI7A 1THAA 5DFWH 2MHAB 2AEOA 1LJMA 3C60A 1VPOH 4R6UA 1Z3GH 2R0WL 1EEZA 5K59F 4JO1H 3SCMA 1OAZL 5FC9A 3LN4A 1RURH 2XG4B 3QG6A 2EZ0C 5FLVA 1H8LA 3P73B 1F4XH 1ROWA 1CE6A 1ODUA 2VE6A 2EDNA 1Z5LA 3DUUA 3NN8A 3RDTB 5C0RH 1ASPA 1HNYA 2H0JA 1Z9MA 2KQMA 1G9ML 4P2OC 3AREA 2GYSA 3NRFA 4E9RA 4ODHL 5F7FA 2ARJA 1BMWA 4U3HA 2DQCH 1LWJA 3IKCB 4NKMB 3CX2A 3HLKA 2UX7A 3WNOA 4Q9BA 1L9SA 4JG5A 1T6VN 2C8NA 4HV8B 1KJ2H 3NJGA 4AKOA 1EFXB 4IKKA 5DYOB 2W60A 5FYKE 2DQIL 4GRWF 4I1NB 3VACA 4U6VH 5HGBA 4U4IA 3I6SA 4HPYL 1IQWL 1HSAA 1WEJL 3KLSA 2EDDA 4YDLB 1TQVA 4XX1G 4HXBL 1THCA 4K3JL 5J9PA 4G6KH 4HZ1A 2D3LA 3OC5A 3MJ9A 1T0NB 5I1AA 1CI3M 3QW9A 4PJ7F 4R7XA 3HUJF 1MFBL 1JG9A 2QQNL 3Q6GH 3DSNB 4WW2F 3K2IA 4HF5H 1J05A 1IBZA 4AQZA 3LCYA 3RVWD 4OY9A 4GG6E 3D0LB 4F7CA 4PJEF 4PJ5B 1YNLH 4QHKJ 4JAMB 2APSA 2NSQA 5DO8A 1R0AL 2YJLA 1LD9B 1VKXA 3E38A 4J6IA 4P23A 1HE7A 5K59E 3P02A 1FVEA 2O5NA 3INUL 3ECWA 1WICA 2DM7A 1HOCB 1T89C 2ICWB 1A4KB 2QQLH 3CDZB 5IJCC 5IMLA 3NIGE 4UILL 2EUZA 3VXRB 4YE0A 4C56B 4G8IA 3HBZA 2WWKO 3UH8A 1U8NA 4L2LA 4Q9RL 3MR9A 1XCQA 5DZVA 3TA3A 3MI6A 2R56L 3DECA 3OWEA 3MZGB 2R0KL 3TF4A 5GRYA 2FZ3B 2X41A 1XH2A 1CD8A 5JOPE 3VD5A 2JVUA 3CH1B 3GO1H 3QFJD 4Q7DA 2CA3A 4K3DH 4LDLB 2WLYA 3DXAE 4GBXD 1DQKA 3S3PA 3RE0A 4LAQL 4WO0A 4L4TD 4PSPA 5GHWL 1UGNA 5JUEH 1AQDA 4NNPH 3V0WH 3EYOA 3C12A 5JW4M 5CNHA 1VHPA 3OF6A 4NO0D 4XAWH 3BSHA 3QZOA 3RDTC 1QBAA 2XG5B 4B7LA 5FB8B 3QCTL 3QUGA 1NL0L 1IJ9A 1AZBA 4PJ7E 4EBQL 4L8DA 3HUJE 3MLXH 3S3JA 3CWGA 3IJYA 3F58L 2YD6A 3AADB 4JR9H 1CFVH 1PGRB 2Z6FA 1DQVA 4E0RA 1WZKA 2NTFB 5KN5A 3N44B 2F8IA 3N5AA 4PJEE 4Z77A 2IOIA 4ZX3A 2BIIA 3O6LL 2FT7A 2BNRA 5CGYC 4C83B 5HYSG 3TN0A 1LO4H 4YDLC 1KFAH 5CAYB 1X4ZA 1CLYL 3G6JF 3QPQD 1NJ9B 5I1EH 4WFEE 3MRQA 3A6BL 2BVPB 1KACB 3LIZL 1FL5A 2X2JA 4PWHA 3VDCA 1IC7L 3BUPA 1NFDF 1CFSA 3BLPX 2Q0ZX 4A7GA 5FA4B 1TJGL 2P24B 4WKZB 4RAVA 1TTCA 1X9LA 4JKWA 2F5AL 1C8QA 3T4YB 3IGFA 1FZOA 3QUYA 4Y9GA 2J5LB 4R4BB 3BEWA 3CDCA 4N85A 4AXWB 1HDMA 1F4AA 5EOTA 5BW7A 1OAYL 4GKLA 5I8KL 4U1GB 1P7QA 4G9FA 5HDQL 5IWLA 1BZDA 5AKSA 1ID5I 3OC8A 4GRWB 3NJFA 3ABZA 1NCBL 1FV1B 4U4BA 3G5XB 4GXVL 1WWCA 3O9WD 1X7QA 1FDLL 3U6RA 3H55A 4J23A 5ACZA 2A6KB 3FBQA 3FU3A 1SDDA 1M7IA 1YEEL 3I6LD 2XXGA 3DO3A 3KYAA 3DBSA 1CVSC 2VLRE 4JBSA 2MPAL 1TSHA 2P7TB 3HW7A 1RU9L 3ARFB 4Z95L 4BKLB 4PJ7B 4DAGL 2NY5C 3NTCH 1NFAA 3EF4A 1RSYA 1RUAL 3G5ZA 5F1IA 4KWUA 3FU7B 4WW2B 4GAJH 1BLNA 3BESR 3TL5A 1BVLA 3VI3A 1ETJA 43CAB 4YL4A 4EI6A 4U1NB 1R4XA 3MX0A 2KC0A 4N90D 3D2UA 4DZ8A 2UUDH 2EDYA 2XIBA 1JZ4A 2WUBH 1KCSL 4QRRE 4KPHL 1XTMA 2GJPA 1EJOL 3RIFF 4RMQA 4N0YL 2EDKA 2W5PA 5DHVB 4LCCB 1KTKE 1BWMA 1YN6B 4FE9A 1HE8A 4RSVA 4NZUL 2JI3A 4NGHL 1C1EH 5AD0A 5AUMA 5F7LB 4JRYD 1JK9A 4KVNH 4HUKB 1MJUH 1YNTF 3RWCB 4CMMB 4PHXA 3CFTA 3DPDA 4FQLL 3P2DA 4CVXA 1E6OL 2H7WA 4XX1E 5KEZA 1NGQL 3L45A 4UM9B 3CFNA 2Y7SA 2FWLB 2HUEA 3OKEA 1S7RA 3ZK0A 3JV0A 4Z8FH 3ME0A 1BXVA 2V33A 3QORB 4XNMB 1WAAF 3RVTC 5F6HJ 1OCWH 3N0PB 1P4IL 2L7QA 4AK1A 2WNGA 2BY0A 1C8PA 4GI8A 4Y4FA 4ZFOB 5G5DA 5BVPL 1EJFA 3EDKA 1FC1A 3WG7B 3ABKB 5D1ZA 4FZEL 2OKMA 4PWKA 5E9DB 1T0PB 4FXTA 1NUDA 4JVPA 2NZ1A 4JFXB 3U9PL 5CU5A 3OPZH 2J5LC 4OLZL 5FO8A 2BS71 5IY5B 1EH9A 3CBJB 3PAYA 3HZKB 4U1GC 4TNVF 1T7ZA 1W0WB 3KLQA 5EV7A 2RR3A 4PJFB 4WU7B 1B3JA 3DRQB 4NUQA 5AL8A 1HJBC 4UT6L 5MENB 4UNUA 2X87A 1QBBA 2A74A 4N26A 2ATAA 4DFIA 2D03H 3G6JB 2QR0B 1U8PB 3KPSB 4X5XA 4A7UA 3D39B 5C0AE 5C2UB 2EUXA 3WNNA 3CPLB 1NFDB 1QOKA 2D7TH 3APMA 3KDMA 3UCQA 1KXQA 1OCCB 5GGQL 3FKUS 4AQOA 5BPPA 4EKXA 4K7PH 1IQDB 4WW2C 5H37H 5DWUL 4DTGL 5CU9A 4W9IC 5DI8B 4E9VA 2EDEA 2ISDA 4JZJA 4UV7L 4YHIB 4DETA 1CF8L 1QBML 1PIFA 2OCCB 1ADQA 1UOKA 2IH1B 2IWGA 3H3PL 1GY1A 3FZUC 4BGLA 1SY6L 5I8CA 4MB4A 3I9IA 4B50A 1NC2B 1IAOB 5GS0C 4HPOL 3BXNB 4NDMB 3U2JA 2EE3A 1WA1X 1G7QA 1OSZA 3JWDH 4MZ3A 1J5OL 1WAAE 4KUCF 2E6PA 1XH3A 2J6EA 3KPNA 1NAKL 3LKOA 3BWUC 4LCCC 4LL1A 4X7TA 1QLRB 2HPTA 1NAML 4AVJA 2D3NA 4JCMA 3IDGB 5L9DH 3ZR6A 3E8UL 2QBWA 3ZO0A 4R7DB 3DYMA 4C8XA 5AKRA 3VFWB 1ROCA 3V6OC 4JN2A 1PAZA 2DBJA 5C2BL 4ZT1A 1XGUA 3L1EA 1G9HA 1L7IL 3GSVA 1N5AB 3PP3K 1URIA 5DUPH 1CICD 4B7IA 4XNBA 3PJSB 4NQDB 3GMPB 2NYYC 3ILQD 3MCYA 4K55A 2KDGA 4JFQA 2WB1A 5SWZD 3AABA 2B59B 2OMWA 2BP8B 3Q1EA 2Y1ZA 2AK4D 2Z92A 2ZOKA 3QORC 1DVUA 5CZRA 3TBYB 3X14A 4RFOH 3TH4T 5F7HA 5IW1A 1NFIB 5HDLA 1T66C 2UYLB 2VIRA 3EO1A 3TBSB 3MV9D 4K23L 5AALA 3QEQA 4W6WB 1WWAX 3KLKA 3X1NA 4E9QA 1ZHKB 2HVJA 5DD6B 5DA4A 4I0PD 3VD4A 3RRQA 1JWUB 2E7MA 3IXTA 1RMFH 4N24A 5EU7E 5A2FA 4XAKD 5JNYB 1HYSC 2ATPB 2O5ZL 2G75A 2XOTA 4BUGA 2VDQH 3FH7A 4FQXB 5CN3A 3RPBA 5DJXB 1RUPH 4FHBD 4EZKA 2R9HD 2DZEA 2O4EA 4MXQD 2XPZA 2GTZB 5LO7A 4HDIB 3GMRB 2EADA 4GUCA 1G7PB 3P30H 4YLBA 1J12A 2HMIC 2W8CA 1UWEL 4HIPA 1RSFA 1AYOA 1Z9LA 1YDPA 5IFJB 2C3VA 4RMBA 2YC1B 1AIFA 4LAJH 4AITA 2J8UF 3ARUA 5LWYL 3PWPD 5EO0B 1ITBB 1U30A 4HOZA 4LLYB 3NEOA 3X3GL 4U49A 3WE6A 1MZZA 3QIWA 3KXFD 4WW1B 4ERSH 1FYTA 2CLRA 3SKOB 5HHOB 1J8HE 4IBLT 3WY3A 2GJJA 1SOXA 1MG3C 4NNXB 1JPFB 3RZCD 2A2QT 5HYSB 2VL4A 2Z34A 5K69A 3MJ9H 1X4YA 3HVDA 3RQ3A 1TCRB 4Y5YB 3ZJAA 5JZ7C 3TBCA 1T22B 3U82B 3D0AA 1QR4A 1AMXA 2JFCA 5E6ID 1T2XA 4Z7WF 3UOAB 5I1IH 4N28A 2Z7UA 3CXDH 4RAUB 1RK0B 1L9RA 1OM9A 3BQUD 4YSSA 4GUPA 2BJMH 4R96A 3RFZB 2EE9A 4KX8A 4ZFZA 3F5WB 4PPTA 1MCLA 2OXHB 3PWUB 4HGWA 1BM3H 5LGHL 1XMWA 1AE6L 1JJUA 3B2UC 3FU9A 1JGDB 1MCSA 4MB5A 3SEPA 5GZNA 4GP8B 1NBVL 4X9HA 5C0BE 3B1UA 3K6FA 4PAZA 5IQ9A 2HFFB 2J12B 5J8OA 1E3ZA 2IMNA 3IFOB 1KFGA 3O4LA 1QBLL 3VWJD 4XNXL 2V9RA 2AVFA 4PRNB 1MCWW 3TCLA 1QPXA 1SRDA 2IALB 3AB0B 3PXHA 4DP2X 2GTWA 4PRAB 2R7EB 1RZKL 5IBLD 1WBXB 5T33H 2R39A 1KGCD 3DGCR 2FGWH 3ULVL 4BZ2L 2AQ1A 1N6QH 3SIKA 4N8VG 1YMHA 2J43A 4XMVA 3PAVA 3GS4A 2GJ6D 4MNQD 2EUWA 1QKZH 4OCYH 3ARBD 4XBEH 4ZO7A 2EO9A 2I7SA 3MSPA 4G71B 5KJRH 2OSWA 3RWGB 5EEYA 4GY4A 2IDTA 4BM7A 2XWEA 2F68X 3VRJB 1BBJA 1RFDL 4J6RL 1A2YB 2N7AA 3I3DA 2YFOA 2B4CL 3MRDA 4U1JB 3HG1E 1BIIA 2Z93A 4RGNE 4GJTB 4FKKA 4KMLB 1FFOB 2OS7A 4FQXC 3WEXB 2CMRH 4B3EA 2DYRB 4KK9D 2WCPA 2D9QB 1X3DA 4GNKB 4GKNB 4JDVB 1WFTA 3E6HA 4APQA 4PS8A 2IGFH 3QWQB 4MA3B 1EEUA 4G70B 4Q56A 4X4ZA 1OGAB 5GGRA 1FHGA 1CFMA 1C08B 4ZUUB 4KI1A 3VFSB 2NR6D 4UU9B 4YX2L 1XAUA 1SOKA 5CBAB 2FBJH 4PGDA 4XC3H 4L29A 1D3CA 4B9KC 2FO1A 3RL2A 4P2QD 2CKBB 3OJMB 2WO2B 2CK2A 2WQRA 4HP5A 4ZUVA 4UUJA 3E7JA 4YOKA 4QR7A 4NI6A 3T65A 4BIKA 2XRAL 3A4EA 5FYLH 3P0VH 1RZIB 4UDTB 1Y0LA 1IAKA 3K80A 3GGWB 4P4KB 5AZEH 3C6SB 1QI5A 1N7ML 3LRGA 1QLEB 3MOBL 5FKAB 3WS6C 1AGEA 3CVCA 2EE6A 1I1YA 4Y5VB 2H4EA 5KSVA 4D7PA 4Y5YC 4MSWA 4KKRA 3VTAA 3OD3A 3LIZA 3HFFA 1P6AB 1SM3L 3G04B 3UTTA 4L05A 3UGUA 4K2UL 1A4JA 4YBQC 1WUZA 3MGOA 3T3MF 5I66B 2QPFA 3TBTA 1ZIBA 5CZXD 3RFZC 2ADIA 1GCYA 3P77A 3S3DB 3KHOA 2J8UB 3CXHJ 3PDOB 2R4RL 2BVOA 2DQ6A 4KKNA 1T83C 1I8IB 2VW6A 4IMKA 2WWKT 3L3KB 2ZKHH 1UZ8B 4PG2C 2HUHA 5LN4A 1OALA 4WI9A 3QCVH 4TF4A 3DMMB 4MD0A 4BFNA 2H1PH 4F8QA 2Y5EA 1I85C 4RGNB 5E8DL 2YKLL 4JFDE 4IBZA 4EE2A 3AB0C 4OGAD 1XF5A 1U21A 4G43B 4OB5H 1GL4B 1PKQE 4XPAL 3KPRE 4PRPB 4Z7WB 3FTGB 3MBXL 1UT9A 3K6DA 2ED7A 4YSPA 3BC9A 4H8VA 1MFVA 4G3YL 3VFPA 1A7QH 4CC4C 4PWGA 4U3SB 5FFOA 4GLRI 3RX8A 2AEQL 1WF5A 4I18A 4RCAA 3VH8A 3RTQB 4BSVB 4CJ0A 3SDDB 4KQ4H 1MY5A 2IQ9H 2YD1A 4YR6B 2JJSC 3EO9L 4IBVA 4UYQA 3IEAA 4R7NA 3SE9H 1ZT4B 1MVUB 2R2BA 2LFEA 4XNUH 4BSJA 4LBAA 1Y6KR 4YHOH 3BFWA 3DX3A 5E8OB 3FUFA 4HT1L 5IVOA 4FNLH 2LVEA 3IM1A 3L3OA 1RZFL 2YOAA 4M43H 2Y0SA 3LZNA 3S4SA 4HJ0C 5C07B 2LU4A 3K8MA 2D0FA 3APDA 3K4ZA 1A6WL 2YPLE 2ETWA 2B1OA 4P2RE 4MYWB 2V17L 4XI5D 2VM3A 4I77L 3JZ7A 3VXSB 1A47A 4JZOA 5LQBL 4MVBC 4RRPM 5AAPA 1XGZA 2FIKA 2XZCH 3O81A 4HUNB 2NUPA 1OSPH 4JY5L 5CSZA 3VDAA 4PRBA 4D2NA 3DO4A 4JO3H 5MEQB 1JPSL 4IIQA 4AW4A 2BK8A 1H9DA 3CLWA 2HZHA 4G8GA 3EO0B 5DS8B 1GS7A 4POZD 3VJ6A 4ACPA 4P4KC 4KGJA 1O5PA 3PHQB 1AR1D 1RZJL 4H8WC 4XCEB 5A2CA 1MHHB 4QJ5B 1MQ8A 3O41A 1JWMA 1RP8A 3QO1B 3NAAL 5FK9B 3E3QC 2GPZA 3ZT6A 3IMUA 3CN1A 4ZSOA 3T2NH 2JKTM 5F8QC 4ANVA 2Y7OA 4S2SB 3QJXA 1EHXA 2YPKA 4M61A 4U6XB 5DEGA 3EOBB 3DETC 1KXVC 1U8OB 1KBWA 4X8GA 3KLAA 2VMDA 4D0DB 4Y9EA 2VDKB 1U93A 3JV6A 1AZRA 1BSIA 1FN4A 1SXCA 2D7NA 4JNXA 4RIRB 4XVOA 4C83A 3UBXG 4K7PX 4PREA 3F12B 3VXMA 1T1YB 3DMMC 3NCXA 1BD2B 3B2VL 1SDAB 4UT6A 5E5MA 3OAZK 5L8LB 3WTSA 3T4AB 5CIPA 1SYSA 1VADB 4MQXC 4A2LA 3HC0A 4RGNC 5IB2A 4FHJA 4OIFA 1ET5A 1GXEA 3BP6A 4UMGA 1RH8A 5AWNH 2K7QA 4ZO8A 4HBQA 2FTAA 2TSBA 2DWTA 4OCRH 1XF3A 2R1XA 1ZLVK 1UM4H 1TVBA 1YC8A 4QRTB 3TT1H 3T3MB 1KB9J 3K2KA 1CFNA 1NDMA 3VXPB 2HKFL 1IGMH 3RTQC 3QS2A 2CJTA 3MJGX 3SDDC 1AP2B 1Z9SA 3IWVA 4QHUB 3QG7H 2OCFD 5AAMA 2NY4B 3WFDL 1XZ0A 5FM4A 3MNMA 4NP9A 4P9HC 5JXEC 1OARH 3QE5A 1DQTA 1SY6A 3GKZA 2VC2L 5MI0B 1XR8B 2RJMA 4GKSA 2PCPB 1XSOA 2J6EH 4ZAKC 1DSFL 3L9RB 5DHDA 1I1FA 5ESAB 2WLIB 1NSNL 4I48B 4LCUA 4BE5A 4XVJH 1HILB 3V79C 2IDFA 1NAMA 1ZWIB 4JQXC 2IEPA 3ARDB 3CZLA 2HJFB 1JD9A 2GTQA 3H6JA 3LKQB 3Q9QA 4M1GL 4UI2A 4X9YA 4HKXA 3T1FA 4C57C 2LLNA 2EDFA 2Y7NA 4B3VA 3B7YA 2W9EL 4HWEL 3W0WA 4Y2OB 3OGCA 3FRPG 4O9HH 5C8JA 4XP9H 1VFOA 1M05B 1KEGL 4BINA 3ZE0F 4GMSL 4FFWD 1N59A 3EJPA 4MBOA 4MMXA 4RMVA 4UT7H 1EMTH 1E3FA 3QDMA 3PP3H 4PRDA 5FAAA 4QTIL 3QIUB 4ZUWB 3SDCD 2E6QA 3A4DA 2ZOLB 3K72A 2X1OA 1N5YH 5D2LA 3BP7B 3FC8A 1HZLA 5BV7L 3N1FC 1UZ6E 1SJEB 5DJ6B 5FYJD 5F72S 4MAYA 4PCKA 3RVVD 1GW0A 4R5TA 5JW5B 4JGJA 5I23A 3ARSA 3HI6H 2XZAH 5ABDE 1MFAL 4MJID 3GTVA 4N8VB 4HIJB 2R0WH 3VFNB 1FSKB 3ROOA 3WKPA 1OAZH 5CCKL 2A6DB 1LEIB 4NZRL 5GGSY 4G6FB 3RVUD 3KPOB 5J3HD 2PWHA 4XMZA 5DJZA 5DQJB 2JLLA 5KSAD 1GRWA 2YQGA 5AZ2L 4NNYB 2FNWA 2VZ1A 3VI3F 4ZPTA 2XTSA 4RWHA 3R1GL 1MW1A 1D5IL 1G9MH 2AEPL 5EEZA 2BNRE 4ODHH 4QKTA 3U1QA 3EZJB 3D12B 2R29L 3WY2A 3T4AC 4JDEA 5IF0A 4NBZB 5FYLE 4F9LC 4LBEB 4R4FL 2NSMA 3ETSA 5DK0B 4IS6A 3KGTA 3I84A 1XH0A 3WFHB 1HC1A 2DQIH 1GA2A 2LU7A 4MDJB 5F7UA 4HPYH 2FBOJ 4QHMA 1WEJH 4HJ1A 4BFFA 1OAQL 3VQLA 3KS0J 5EIIB 4HXBH 3HTLX 2XETA 4K3JH 4L8CA 3PHOB 2WBKA 2NY4C 1U3YA 3H3BC 1JN6B 1IM3D 4IHOB 4G9FE 1PQZB 3OQRA 2YD3A 1ES0B 2G0KA 4GFXA 3K5SA 4V1DD 1DJIA 1NCWH 1MFBH 1VZIA 2GK0A 4PJIB 3LNFA 4WI4A 2QQNH 1AMYA 3KBFA 3GBNL 4YDMA 4K9JA 2X4QA 4O00A 4PI2A 5CP7B 3SDXB 3VGDA 5EBWB 3P2TA 3FQXB 1MRFL 1WTLA 2YLHA 2A4ZA 4BFGA 3ARDC 1R0AH 3HA0A 4KRPD 5EF2A 3INUH 3X1BA 1DFBL 3EHBB 3GD1C 4ODXA 1K85A 3K71A 2AJYL 4R5XA 1NIAA 2YD2A 3WE1A 2BNQA 1M4KA 3QHFL 4N2KA 1TEYA 4HUCA 4UILH 4XWGL 1QSEA 4JDZA 4FMFA 1P1ZB 1PZAA 3GXFA 3RHWK 3VI3E 3ZUCA 1I8MA 1K9TA 2RMNA 3TBVA 4Q9RH 1BYOA 3QIUC 3MA9L 1LM8V 2L3BA 4J4PC 2R56H 1MFCL 3HR5A 1BVKA 3SD2A 2R0KH 1MAJA 1RV6X 2VSMB 1R3LB 4BZ2A 5C7XL 3SD5A 5DVLA 1DJZA 2K9UA 4P46D 5LUMA 3PAUA 4GKZA 4N4YB 3CHOA 5EO9A 4XNDA 4BCXA 3IN0A 2KT6A 4LAQH 4NN5B 1T03L 1FSKC 1IJNA 5GHWH 2Z91B 1D5BB 2WXNA 4X4YA 2LAAA 4CILA 5I30L 1Z0NA 2EXYC 4NM8L 1E9PB 2R15A 5D70L 4MCYA 3M88A 4YJZL 4EZJA 2F53E 3QXDB 4D0BB 3CX5J 3M7FB 1JZIA 2IH3A 5ESQB 3OX8B 4AOFA 3QCTH 4EDXA 1NL0H 3ZE0B 2V9QA 3MRLB 4LOVA 1DBKH 5DTFB 4EBQH 1H5BA 3FU8A 1UATA 2SEBB 4PJHA 3DV4A 5AW8B 3F58H 1MG2C 2JK5B 4M6ML 2R4SL 1XCWA 4ZDHA 3L4YA 4P05A 5E03A 1LO5B 2VZSA 1NFIA 1Q1JL 2W07A 3I85A 5B39G 2B08A 3QP3A 5JMRA 3MRBB 4KTGA 2V9UA 3O6LH 4EUPG 5FCSH 1TVHA 1GSMA 2XKNB 4FLSA 4JFPB 2ZP9A 1J1OL 1CLYH 3DK2A 4P5SA 3FUIA 5IMKA 1Q72L 2Z4TA 3A6BH 2CDFA 2EDWA 4M8UA 1EO7A 1IC7H 1IZJA 2QZQA 5I6XB 5L7XL 5JHAA 4RQQA 4ZMOA 3ES6B 3B2DC 1TJGH 4YN3A 5LCVL 1GGUA 5A2BA 3V8CA 2F5AH 2J8HA 1FYHB 1TYEB 4DKFL 3FB6A 4YH6A 4O2EA 5CSBA 5EH1A 1OAYH 5I8KH 3ULUD 4BQ9A 4LL4A 4O5LL 5AVTB 5HDQH 5JPNA 5IHHA 1UJTA 3ARGA 1NCBH 2EIZA 4JUSA 4GXVH 3EHBC 3IDYB 3GMLB 1FDLH 3SDAA 3SOTA 1HNFA 4BFOA 2BXYA 4M7KL 5L6YH 2CRZA 2Q7AA 1F97A 2J8OA 3V4PL 5IESL 3KM2A 1YEEH 5EU5A 2F53B 3JV5A 1IUZA 3UBXB 1WFNA 3FQRB 3SE8L 4ES8A 1KJ3L 3DRTA 2MPAH 3LXCA 2OJEA 4Z95H 1RU9H 4BSWA 3NCJL 4DAGH 3NACL 4OAWA 3WXVL 4OD1L 4FADA 3B56A 3ECBA 1B0RA 1RUAH 3LZOA 2N4IA 4LRIA 5DJCA 4G80A 5I6OA 2QZ5A 4UZUA 1KG0B 3W9DB 3B6SA 1UKTA 5C97A 4NN5C 1EK3A 3L3HA 3C08H 3T77A 3UTSE 4TKWA 5LB1A 3QO0A 4PRID 1KCSH 1RLBA 5B1CA 3NJKA 4KPHH 3I9PA 3QZPA 3A24A 4IJ3B 1KIQA 4Q2ZA 1EJOH 3QEUB 4KJQC 4N0YH 4OZ4B 2XWJB 2W95A 2YAOA 3N3EA 3GUTB 3GUFA 1FWXA 4BBWA 3L3IA 1RZGB 3MRIB 3IWUA 4NZUH 4KROB 4NGHH 1QYGL 1I8LA 1GGIH 2UY7B 2XIDA 2BINA 4ZFFA 3AM8A 2X2UA 2OYPA 4N9GA 2VDPL 4XO4A 4PJCA 4UQCA 1ECZA 5K9KA 1CGVA 4FQLH 1D6VL 2NNAB 1LQSR 1E6OH 2QLVB 2R69A 1KLGA 3VYOA 4WFGD 4TTGA 1HHJB 3OKOA 1MCIA 1NGQH 3UO1L 5GS3A 2JSFA 1W80A 4GRLD 3ZW3A 3QEQE 3FRPB 1JPST 1K5NB 1RUQL 3Q2WA 4IU3A 4U33A 5HI5C 1HTYA 1M6OA 5J57B 1P4IH 2ITCA 1FGNL 4PV1C 3UZVA 1C7TA 2C1PB 2H2SC 3FYEB 5J5EA 3PLYA 4OQTL 5BVPH 4N3TA 4WENB 4S1DC 1WIPA 3NOIA 4FZEH 4FLQA 2WQ8A 4FFZL 5DFAA 4UTBH 1E40A 3U9PH 2GITA 4Y9CA 1QO3A 4L8SA 2OYKA 4UZGA 4OLZH 4UZSA 1IGJB 1XGRA 1IX2A 2DKMA 2XN9D 3FHAA 2QSVA 2DF3A 4B0MM 3MRRB 3B9KD 1KIRB 2QGBA 1PFOA 3ABLB 5DSCA 3GSNL 4QD2E 4UT6H 4XGZB 5CIPH 1PKOA 2PP9A 3UTSB 1FYTE 4LEOB 1A8ZA 4FX5A 4X8JA 4FLRA 4L2YA 5JIDA 1E7VA 4QGTA 1CXIA 3RWFB 3ZQWA 2Y2TA 1SXBA 3OQ3B 2FLMA 4P3DA 2N7BA 3MVSA 4B9JA 4F27A 5IVXF 1SBSL 5FOBB 3U7WL 5DWUH 4DTGH 1ZLVH 1XZWA 2Z7WA 4OKVB 2GABA 3GSXA 1XH1A 4AMWA 1NGWB 1IL1B 5SX4I 3QJHA 4UV7H 5AB0A 3QUKB 4PS7A 1CF8H 1QBMH 2LT9A 2IWFA 5K33A 3H3PH 5F88B 3GHBL 1SF5A 1SY6H 5INDB 1LGVA 1CXHA 3O3EB 3PE9A 2CGZA 1ZOXA 3MJ7B 3QQ4A 2CQVA 2VXSL 1QUNA 2FJHA 2XCMC 4HPOH 3VD2A 3AUWB 1TQWA 3PWNA 2V2XA 1J5OH 2GBUA 5BJTA 1NAKH 1IEBA 2KLRA 1HCFX 3BDYL 4EEEA 3O4LE 3TZVB 4HKZA 1DQDH 1NAMH 4YHNB 5DGRA 2PW1A 2YUXA 4ODUB 3E8UH 5C9JA 1JZFA 5JLZA 2LU5A 3PQYA 1YEWA 2H1XA 3MCG1 3P4NA 2OPCA 4PJ6A 2BMKB 4CKQA 5AYQA 1E65A 3UIZA 2YGNA 5B4MC 4LQFL 4WDIB 4AI7A 3OKLB 1L7IH 3KPTA 1CXKA 4WGKA 2AQ2A 3PWJB 4HEMA 3AJ7A 4O02B 4XP4H 1V8HA 4TUOA 3IMVA 3T8XB 2AEIT 3BD5A 3VE0A 3UTZA 3MCKA 5EULV 2XSKA 1NC4B 4OV5B 1H0DA 1GS6X 3PWLB 5T1LB 2YZ8A 3H7BB 2BSSB 4X7SL 2VITB 4NQSB 4TUJB 4JFEB 3BW9B 3TP4A 3I3EA 1DQIA 5I6MA 2QDVA 4J3BA 3ZGIA 2EVGA 1XMEB 1C5DB 1JHTA 4N0CC 2I60L 2YAHA 1OLLA 4JRXD 2O5ZH 4Y8DC 1P53A 1E5UI 1DDHA 1NPJA 1FLRL 1TETL 3WNJA 2W9DL 3STZB 2PWDA 1G5AA 3NFSL 2X4TA 5IB3B 2CO7A 4AYDC 3P11H 1R24B 4XNZB 1UWEH 3Q2VA 4HFWA 2KQNA 3MNZA 1WSST 2R29A 3M1CA 3DUSB 4XN8A 4KVPA 5LWYH 3GMQB 2IDQA 2MNWA 2WUCL 5IVZA 2BVTA 4HJIA 3GK8H 5SWSB 2H26A 3GSOB 2WXRA 4LHUB 2Z35B 1X7SA 3ZVVA 2KUTA 4GO9A 4KZDL 3UTTE 1PLGL 4EDWL 4N5EC 5GS1A 5D4QA 5B39B 2CBQA 3I2CL 1D2PA 1HHHA 5IREA 2H9GA 4KFZC 1SUJA 4ZS7L 1XGQA 3F62A 3FUJA 3ESVF 4NQEA 3OJDA 4NPJA 3DO7A 4BHUI 3QAZB 4W4OC 1TVDA 5F7DA 3DOSA 4NN7B 3O11B 4I9XA 5AAWC 2DH2A 3IJEA 4S0HA 4C47A 1GZPA 5DJ2A 4IU2B 1UXWB 1GYWA 3OKYA 3QWOB 4KDVA 4N8UA 4PW9A 4YDVB 5E94B 5LGHH 4ESKA 3UPRB 1AE6H 3FRUB 4MJ5A 4Y9FA 4DCQA 5BUPA 5I0ZA 1MFMA 4WHYH 3WHXA 5JHLL 1UH2A 5GSRB 1NBVH 1G7HB 5KSBA 4O51A 5IVXB 2YEQA 4I9WE 4IK6A 3QDGB 4MNHB 2JNZA 2DQEL 4XO5A 1QHQA 4ELDA 4RESB 1QBLH 1KGWA 1SXSA 2VR3A 4N2BA 4XNXH 5TQ0L 2EE2A 4ZMLA 2Z3FA 5IBUG 5C92A 5GZOC 2X6BA 3MOAL 1A4BA 1RZKH 5DMGD 2P8MA 1HEJC 3ULVH 1F1DA 1FFNA 2NY6D 3B3IA 4BZ2H 3RX5A 2CWRA 4DGVL 1VZHA 2QKIA 3FSOA 3VFVA 5ICXB 3CHRA 5F6IB 1LK2A 1SBBA 2C3GA 2O72A 1ADWA 1SOQA 1BDYA 2H3XC 3K1KC 3LS5L 5KYYB 2X4UA 2YD0A 3SYCA 1HCYA 3OXRB 1IGYA 3HG0A 4U1MA 1RFDH 4TLTA 2FH8A 4J6RH 3O2DL 1FNAA 4B5ZA 4D7BA 1FFTB 2B4CH 3ILPB 4GW4A 3HLAA 3OJ2C 4KDTA 2PYFB 3HE7D 1UXSA 2CPCA 4U1HB 3VU1A 1Q9OA 3LEXA 5D1XD 2EILB 1A1NA 2H8PA 4LLAA 4KI5D 1FO0L 3MRJA 4LLVB 5F1KC 3V5KB 1L0XA 2Q3ZA 2DD8L 3PXJA 3AU1A 5E4OA 4XNZC 3MQIA 2ZJSL 5D7EA 1U8HB 4NC0B 1UM5L 3EJTA 4G8GE 1GSKA 3J27A 3MUGA 4EOWL 5FM5M 1HAUA 1OOAA 1CB4A 3NIDE 4EIZC 3V0JA 4YX2H 5A6IA 4A2FA 1QFPA 2VN6A 4URKA 5CWSA 1B9ZA 1YHPA 3MC0A 3M46A 3FQ2A 4Y89A 1N10A 2KHAA 3ZTNL 5IMOB 2K8MA 2EIEA 1R5WA 4GQQA 2NZ9C 2NLJB 2XRAH 4ZSOE 3OXSB 4LP5A 3E6FA 3FFDA 3SY6A 3QFJB 3QULA 1U58B 3T0EE 3FQWB 1N7MH 2LOEA 3DGGA 5JW3L 2A38A 3HE6D 1E5YA 1ZSDA 4X4XB 2VERN 2V3DA 1S3KL 4L4TB 1IC0A 2BY3A 1IGTA 1SM3H 5KVGE 5LAXB 1HHKA 3QAZC 2A73B 4GMTL 4Y88A 3JV4A 3EIFA 2WCSA 2FJGA 5E2WL 5LCVA 1J88A 4NN7C 3TBBA 3CVDA 3VXME 4KMQA 1E7UA 1KULA 5AG8A 4MNGA 1BXXA 3L5IA 3Q7JA 4I5BA 1J0IA 1GYCA 2Z4QA 2OULB 2R4RH 5CJOH 2PXYD 4M9OA 2GW5A 5EU6A 5HY9A 3BUYA 5EBMA 4XE0A 4FMKA 2APFA 1UJ3B 1HQRA 2OP4L 5KSUB 4ZXBA 4KNQA 3T6WA 3I9GL 2Y7LA 3EYVA 1FF5A 1JZ2A 1ZD6A 3GZOA 4FI6A 5E8DH 4GYBA 3V4PA 2YKLH 5BZDB 2EXWD 4ZUTB 2CLVB 3LZRA 4Z78A 5I0XA 1U8IA 4XPAH 1OAJA 4X8XA 4Y2DD 3WKML 4LVNB 4HK0A 1KTCA 1PZCA 2DKUA 4OFQA 1U4FA 4I1RA 4S0SD 4G3YH 2QKSA 5F6IC 3APCA 1DVXA 2AEQH 5CP7A 3D9AL 3S0PA 2M1KA 2NY7L 2XV2A 3WNKA 3HNSL 4PJ8A 4ZTPL 2WVVB 5LKNA 4M7JL 3EO9H 3EJRA 2NYKA 4JFTA 2X4RA 1M1XA 3WNPA 1UASA 3UYPB 1L5GA 3FUMA 2HLFD 3CFQA 2ARJQ 1EDQA 2X2IA 3IDMB 5L2KD 1DE4B 4I2XA 3L3DB 3L5JA 4HT1H 1T20A 1DANU 1SGKA 3W0WE 4JHUA 2P5ED 3T0EB 1N0XL 4HWBL 4Y19B 1RZFH 4I3SL 3S5LA 4KOBA 4H7VA 5D5MA 4ZOCA 1JZ5A 2X1QA 1A6WH 2V17H 1OT2A 4YLCA 3QDME 4I77H 4JFHE 5LQBH 1QP1A 2XU9A 2VL5A 2O6FA 2FYVA 4FYRA 1FFPA 2XNAB 4XXWA 3RDJA 5D2LE 4GRMB 4PY8J 4JY5H 3SJVA 5BVJB 5IW6A 3TURA 1QR1A 2N59A 1JPSH 3TT3L 1MFNA 3CN3A 1WC7A 1CE1L 1UURA 1N3NB 3BO8B 3GC3A 1JWSB 2Z0BA 4H8QA 2BWDA 3CMGA 3LJ3A 4K4KA 1Z32X 2R1YA 2X6UA 1RZJH 1K4CA 3LPGA 3G6AA 4XB8A 1YYLL 4J3UA 3QRFM 4XOCA 1ZPLA 4XWOD 3SKNB 3NAAH 4I18C 1TTBA 2AXGB 2E0PA 1Q94A 3QIBD 5DJAB 4OQTA 4ECNA 4OLEA 2ICEB 5EN2A 3RY6A 3Q06A 1LTXA 2YGVA 3ZX1A 4K71B 4FFZA 2QMKA 4KZCA 3FPXA 1UH4A 2NCEA 4APXB 1YZZA 5FW8A 2A3TA 3ZIMA 1CGTA 2ZIDA 2O1AA 4WTWA 3O3AB 4H1LB 3LQZB 3L3OC 1AHWA 1UJ3C 1I82A 3GSNA 3B2VH 1KTDB 1LL1A 3D05A 1U0QA 4HIHA 3FOLA 3DJ9A 3RUGF 4K3GA 4MQSB 3CSFA 3B7UX 3CVIL 4Q58C 4GI9A 1OGPA 4ZRGA 2RIKA 4LLWA 3JTBA 1MCEA 2JJTC 3LKPA 4LO9A 2CJ3A 3LNGA 4PP2A 4RFEB 5LG1A 5A2JH 2GJZA 2HKFH 1BBDL 4LESA 4I87A 4YNYB 3VQMA 3I6GB 3CFDA 3WFDH 3WKNA 3OKKB 4HJJL 5CFHA 4KRLB 1XVSA 3NFPB 4OGXL 2EC9T 3IK2A 3UTQB 2AV7A 2CCVA 2VC2H 1KLUA 4FG4A 4TVPD 1ND0B 1DSFH 3T0EC 1U8MB 3GXTA 4QAWA 2QL1A 2FIRT 3KM1A 1JDCA 4X98A 1NSNH 2BNQE 2OX5B 2VUKA 1QSEE 3O3UN 4RH4A 3QH3A 1WV7T 1MWAL 1SJMA 4U7MA 4CGUB 5FV1L 3PS6A 1KCUL 4M1GH 3TWCL 1YUHA 3S37L 4AENA 1D7CA 1IFHL 5FDWB 4TL4A 4HWEH 2WIIA 2QV4A 5B3SB 4LPYA 3KWTA 4A6YL 3ULVE 4XOBA 4UAOB 1MCHA 2VJ8A 2WYHA 1KEGH 3CDGA 5IMMA 1MPAL 4GMSH 1NANH 5FDYA 1K8IA 2QVFB 5T3XL 1ULVA 3MV01 2VSCA 4JFZH 2G5BA 4FL4B 4MXWL 2WLZA 4QTIH 3O8XD 4I85A 1SXZA 2BS9A 3BIBX 4NBYB 5MEOB 3ALWA 4Y1AE 3VSUA 4HPHA 1OCZB 5IBUB 3LH2L 1UEYA 1PPIA 4UINL 1MFAH 2VLJD 2ICEC 2Z31A 4LSVL 1F4WL 4K71C 5CCKH 1C12B 4PJHE 1A4CA 4CMHB 1DP0A 1PZ2A 4YBLB 4NZRH 4F15B 2PO6A 3TBWB 4H0GA 2XTJB 4HCRL 2CDEB 5DJDB 1AG6A 3EDEA 4ICWA 1CLCA 4K8RL 1RK7A 4R2GB 4MCNA 2VDLL 3Q2LA 2VRKA 4UAHA 5F7EL 3BAJA 3ARVA 5AZ2H 5DK2A 3MN8A 3R1GH 4ABQA 3FQUA 1D5IH 2M2DA 3KVPA 2AEPH 5EMYA 1MSPA 2A0LD 4ODVL 4KK8D 2R29H 1KDJA 4RVBA 1X5IA 4JG1L 1T6WA 3KNBA 1CICB 1DUYA 4R4FH 5CM1A 4UTAL 1FL3B 3TNNA 2BSED 3WS3A 3JTTB 1JF6A 1WBZA 3F7YA 5CJXC 2ESVD 3A23A 5EUOF 2QSTA 4JFOA 4WFHD 3RIAK 1N8ZA 2IADA 3HN3A 1EZLA 4FNPA 5JIMA 1OAQH 2Q86B 2WK2A 2JCCA 2EDBA 4HLEA 5BQ7B 4GAYB 4QYOB 2H0PA 4Y2LA 3EJZC 3QFDB 1AACA 2BIQA 3QQ9C 1KB5L 2L4OA 2PCXA 3NZ8A 3IRCA 1QABA 1XGPA 5TK4A 3QXAB 5K93A 4XN2A 4NB7A 5T1MA 4LLMA 3GRWL 3PABA 1VFMA 3GBNH 5EC1A 4XCNB 1NIFA 4PTUA 5D71L 3RUGB 4Y1AB 4ODWA 3LOWA 1CT8B 2EYRA 2G2PA 3QXWA 2ZXCA 4YFDB 1MRFH 4PVNA 5E6UB 3MRNA 3GMOB 1J10A 5L4IA 2MOQA 3FMGL 2FR4B 2WBWB 3OR7B 5JHLA 2JQZA 1FVDB 4PV8A 2FL5A 1DFBH 3HEIB 8PAZA 3MRPA 3QNXB 4FULA 3SGEH 1KY7A 2EIKB 1PFCA 2AJYH 4BFRA 3HFML 4F57L 4UAOC 2AJZB 4ZW3A 3BHBB 2GY5A 5IR1B 2J56A 3QHFH 1JXFA 1Z5YD 4XWGH 3QHTC 2HG5B 3JWOL 1NIDA 2E4TA 2NY1B 4YGVB 4FL4C 3MA9H 2Z7YA 3CHPA 4CBZA 1MFCH 4D9QD 2AFNA 2IAMD 5DVNA 2I9LA 3BISA 4BFIB 3RLSA 2GSGB 5C7XH 5JOFA 3TASA 1M71A 1AGCB 2ZG2A 4R5VA 3MODL 4CVUA 1BYPA 1S7QB 3QQNA 2CUIA 5CCHE 4L0ZA 3AS3A 3TZVA 4DGYL 2ZP0T 4QHKI 3VFOA 1F45A 1TFPA 3D4GA 4H25B 4PRHD 1T03H 1O9ZA 4IGBB 5KBDA 4ZW6A 2DQMA 2E8YA 3MRMA 3O2DA 4CMHC 2JQAA 4YBLC 4XCFL 4NM8H 5LXGH 4U6HA 5D70H 4F15C 1MI5D 3VA6A 2W65B 2CE6A 2XTJC 1URZA 1AGFB 3CC5B 1C5CL 3FT3A 4R2GC 1GIGL 3ML9A 3UZQB 4HUVA 4M7LL 4LNVA 5C0NC 3MNVA 1FO0A 5F2FA 2XWRA 3ELAT 1H8NA 3WIIL 1FI8C 1L9OA 1F6LL 5IROC 4WWNA 2R4SH 2H6UA 4N8PA 1UT1A 4JQVC 4PJGB 4LF3A 5F93C 1CICC 1MRDL 3FQ1A 1X5HA 5EFIB 3S8WA 5I1LA 4G6JL 1Q1JH 4BXVA 1OCOB 3CTTA 1E5BA 1J1XL 4UOQA 2J4WL 2E7HA 3DSFL 3FDWA 3MV8D 4DP9X 4LASL</