1MZZA

Crystal structure of mutant (m182t)of nitrite reductase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
334
structure length
334
Chain Sequence
VDLSNLPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVSGTAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVAVMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGTAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title The High resolution Crystal Structures of Nitrite Reductase and its mutant Met182Thr from Rhodobacter Sphaeroides Reveal a Gating Mechanism for the Electron Transfer to the Type 1 Copper Center
rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 87
structure length 334
sequence length 334
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2002-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1mzzA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1mzzA02
3TASA 5F7AA 6PAZA 3IEAA 2E86A 5F7BA 3H4HA 3EH4B 3V9CA 1CURA 3FU7B 1BQKA 1ZIAA 4HCFA 3WI9A 1NZRA 2DWSA 4PCYA 2UX6A 4Q89A 1PY0A 5B1KA 4YSAA 1JVOA 2BWDA 3PXLA 1J5CA 1JXFA 1X9RA 1JVLA 1WS7A 5B7FA 1PNDA 1I53A 1J5DA 3AG3B 4A2HA 4F2EA 1ZDSA 3TA4D 4KO5A 1XB3A 2WSDA 1BXVA 3JTBA 2PLTA 2QPDB 1AOZA 2CCWA 3X2QB 3U25A 2FNWA 2W8CA 2PPCA 1E65A 4BK5C 2ZXWB 3X1NA 4A2DA 1CC3A 4E9QA 3CZUB 3PCYA 3X1EA 5I5JA 4CSPA 1KV7A 2MTAA 1BQ5A 4N4YB 3PPSA 3BVDB 1PMYA 3C75A 2BO0A 1X9UA 1SDDB 3X1FA 2EIMB 1CYWA 1KBVA 3QJQB 1JZGA 3GYRA 4F7KA 1NIDA 4E9RA 2BP8B 2XLLA 3CG8A 4EF3A 2CJ3A 4GP5B 2FQDA 1OF0A 1E5ZA 3ABGA 1BAWA 3NJHA 1ADWA 3DKHA 1T5KA 2EILB 2JXMA 2R7EA 2AFNA 1ET5A 1KCBA 1TEGA 3OMAB 5AFAA 3T9WA 3QPKA 1PZAA 4QLWA 1OCOB 4AX3A 1PZBA 2Y69B 4YVNA 3N55A 1HAUA 2IWKA 4KNTA 3UAAA 2N0MA 2WO3B 1PNCA 1IKOP 1JZJA 1NDTA 2BP8A 3QJSB 3NP3A 4ENZA 4A67A 4G72B 4YSSA 2LLNA 5D4HA 1ZV2A 2JKWA 1ZIBA 4YSQA 4KOBA 2CBPA 4UAHA 4DPCX 1A8ZA 4DP4X 2XV3A 2J5WA 1OOWA 4HAKA 3NP4A 4HALA 2XV2A 2VMJA 2XUWA 2FT7A 3FPYA 1ZPUA 3AZUA 2B08A 3OMNB 4E9VA 1AR1B 3CVDA 2VSMB 2PPEA 4YSCA 4F2FA 1A4CA 5I6NA 4DP0X 3CDZB 2GC7C 3TBBA 1M9WA 1GY2A 5EHFA 5B1BB 4E9XA 4E9SA 3FPXA 4KO7A 3OQRA 1ZDQA 2BW4A 2I85A 3S3DB 3DTUB 5D4IA 1JZEA 3NSFA 3G5WA 3NJKA 4DP5X 1QLEB 1WA2X 3AG2B 1PLBA 1W6LA 1FA4A 2DYSB 4NERA 1SFHA 2TSAA 3FSZA 1MG3C 1OCRB 1NWPA 2GBAA 3UGEA 4BWWA 2PPFA 2HXAA 3ASOB 3WG7B 1AQ8A 3IN2A 4DP1X 2I7OA 1PLCA 1JZIA 3NSCA 1E30A 1M57B 3OM3B 4YL4A 4JHVA 2XV0A 3PAZA 2AANA 2FJSA 2GSMB 4RH4A 1ET8A 3DIVA 3NJNA 5PAZA 2Y1AA 1W8EA 4YSUA 1AG6A 3SQRA 2OV0A 1MZZA 3AY2A 2IDTA 1GY1A 2YAQA 4A2GA 1ASOA 5LDUA 1RKRA 1F56A 4A2EA 2H47C 2J56A 1NIBA 1ASPA 1BQRA 2DY2A 3FU8A 1WS8A 4M4RB 1PCSA 5I26A 4AKPA 4KO6A 2P80A 2HX7A 2NRDA 1PZCA 2FTAA 1V55B 1UATA 3FU7A 5B7MA 5ANHA 4A2FA 2YAEA 1N68A 1A4AA 6PCYA 1XB8A 4YSOA 2CUAA 2ZONA 4GYBA 3MX0B 1DYZA 1SNRA 2CAKA 2HZHA 2YAOA 3NJLA 3QJUB 3OD3A 2EINB 3EHBB 8PAZA 1NPJA 1KDIA 3UADA 2GB2A 3KW8A 2IDQA 4G71B 3L45A 1B3IA 2XU9A 2HRGA 3ABMB 1AZNA 3V9EA 1IBYA 4KNSA 2XYBA 2UXVA 1L9SA 4ZK8A 4TXVB 4G7RB 1AACA 2OJ1A 4GXFA 4YSDA 1IUZA 4KO9A 4G70B 2BW5A 2BP0B 3N2JA 2HRHA 2IWFA 1OE1A 2UX7A 4DP8X 3X1GA 1KYAA 1HAWA 1AS8A 1ILSA 1JZFA 4NB7A 1NINA 1SDDA 2PPAA 2QDVA 1JZHA 1KBWA 3UAEA 1XB6A 4P5RA 2Q5BA 1AANA 3FYIB 2PCFA 1EZLA 4AKOA 4BDVB 1GYCA 3QJVB 3X1BA 1AG0A 1E67A 1SF3A 3WKPA 2IAAC 4DP7X 1MG2C 1HFUA 3BQVA 2I7SA 1URIA 1CUOA 1BYPA 1N70A 2YARA 5I5IA 2YXVA 3HB3B 3IN0A 4AI7A 2BP0A 1BXAA 3ABLB 3AG1B 4E9YA 3FSWA 1RZQA 2YAMA 2BZ7A 4UF7C 3SBRA 3TBCA 1AS6A 1L9QA 2AZAA 1J9TA 2PP8A 2QDWA 1BYOA 2PCYA 4G7QB 1L9TA 2ZOOA 1GR7A 5B1JC 3S3CB 4HHWA 1AAJA 2P80D 1TEFA 5AZUA 2J57A 4QKTA 4BDVA 1GS6X 3FSAA 4K9JA 4P5SA 3WNIA 3NJGA 4UANA 2QPEB 1SF5A 2IDUA 3CVBA 2FQGA 2JFCA 5E9NA 1AZRA 2YXWA 2FT8A 3OMIB 2DYRB 2PP9A 3IE9A 4DPAX 4YSRA 1GW0A 1SJMA 2ZWNA 3S3BB 2EIKB 2XVBA 1ILUA 1RZPA 1QHQA 2WO2B 3FQYA 5B3SB 4FA7B 1VLXA 4AZUA 4AKQA 2GC4C 4HCGA 1OV8A 1AZCA 2XXFA 3QQXA 2IWEA 3NJFA 3CDZA 3FQ2A 3NYKA 2XX1A 1GS7A 3WIAA 3NJMA 2RACA 2YQBA 1AZBA 4GP4B 3EH5B 4N8UA 3H4FA 2YAFA 3QJRB 1RCYA 4NAJA 3FU9A 3SBQA 1OE2A 2VSKB 1BEXA 2UXTA 2IH9A 1JOIA 1KGYE 3EH3B 2MRYA 1NIEA 3KW7A 1J9QA 2FWLB 2IDSA 3QJTB 5TK2A 3IBOA 1NIAA 2BWIA 4A66A 5TK4A 9PCYA 2J55A 2GHZA 5B1AB 2H5UA 4HCIA 3CVCA 4HIPA 4X4KA 3PAVA 5I5MA 1ID2A 1PAZA 4YVUA 1W6WA 2YAPA 3GDCA 4W1TA 3AW5A 1JXDA 1NIFA 1XMEB 1CYXA 3NSDA 4KOCA 3ERXA 4BWTA 1DZ0A 3TU6A 1GS8A 7PCYA 1WAEA 1NPNA 3ZBMA 5A7EA 2GI0A 2AVFA 2Q9OA 2R7EB 2X88A 5I6OA 3S8FB 4HZ1A 4YSTA 3UABA 1OCCB 5I6KA 1KDJA 3WNJA 3EF4A 3NJJA 5PCYA 3JT2A 3RYMA 2BZCA 5IY5B 1L9PA 1MDAA 3ZIYA 4JKNA 1IBZA 2CALA 1QNIA 2VN3A 1SHXA 3FSVA 1L9RA 2FQFA 1YLBB 3PAUA 4G7SB 2XWZA 4DP6X 1V10A 2GIMA 1A65A 1A3ZA 4Q8BA 2VM3A 4E9WA 2VW7A 1J9SA 1GSKA 1NTDA 5I6LA 4JHUA 3FT0A 1TKWA 1ASQA 2BHFA 4HHGA 1WA1X 3T6XA 1BXUA 3AG4B 1WA0X 1NICA 2VM4A 2EIJB 1TU2A 7PAZA 4PAZA 1OE3A 3T6ZA 4KNUA 2IDFA 1SFDA 3PLYA 4M3HA 1A4BA 2IH8A 4E9TA 4YSEA 3ZX1A 3WKQA 3NJIA 2FT6A 1ET7A 3ABKB 3FS9A 2AZUA 4FAAB 3MBWB 5I28A 1L9OA 4BXSV 5I6MA 1ETJA 2OCCB 3NSYA 2UXGA 2H3XC 3ZDWA 1NWOA 3S8GB 1R1CA 2QT6A 3UACA 4L0PB 5B7EA 1J9RA 1SHWA 3NT0A 1OCZB 1JXGA 3GXUB 2UXFA 3SBPA 1PF3A 5AKRA 4BXVA 4GP8B 4A68A 2VW6A 5B1JA 4MFHA 5FC9A 4WKXA 2FQEA 3D12B 4DP9X 2DWTA 4GY4A 4BWUA 2TSBA 3T6VA 2PP7A 2HX9A 3T6WA 1KCWA 2B3IA 1MZYA 5I6PA 4DP2X 1V54B 1M56B 2DV6A 2HX8A 3FQ1A 2X87A 1FFTB 4W9ZA 2YAHA 3T71A 1IC0A 4YSPA 1JERA 4DPBX 2PPDA 2HLEB 5D4JA 1AIZA 1EHKB 2A3TA 2W88A 4WTQA 4CSZA 3ASNB 1PLAA 1E5YA 3FYEB 2XX0A 3H56A 1AS7A 2XXGA 2VW4A 3HEIB 1AZUA 1FWXA
chains in the Genus database with same CATH superfamily
4CN1A 3G04A 1MRCL 4ZG1A 5HDLA 2AXFA 2V7HB 2R1WA 4PTTA 2X2IA 3GHPA 3UTSB 3V6OC 2OYPA 1RVFL 5B8CB 2F54B 1M7DB 5K1VA 4WUUA 3JTSA 1X9RA 4JJ5B 5IQNA 2EXYD 2GJ6D 3FONA 2V33A 3A6CH 3GZKA 1DTUA 4XC1H 5HHMD 3EFOA 2VTFA 4N87A 3S7GA 2WSDA 1C08A 3WUWG 5JW5B 1SXAA 4JDVB 3RDTA 4ZMWA 2EABA 1JNNH 3JYCA 4AZ8A 4P4RB 1Q1JH 4O4YH 5J89A 2Z3FA 3ZZLA 5HGHB 3C5ZC 2PPCA 3HRZB 4N2GA 3G6JB 2JKNA 2Q8AL 2OK0H 2WQWA 1HE7A 1A7RH 2AK4E 4CU8A 1EX0A 5HHVH 1JPSL 4CSPA 3DVFA 4P23B 3L3OB 4MMYB 3KPOA 3AQYA 4PCSA 5DZ9A 3PNWB 4KRLB 4ZNEA 5BVJA 2ADFL 4HUWA 4N5ED 1WBYB 4U1KA 3SDDC 5J3HD 1SEBB 1E4XL 5IFHL 1N5YH 3ZQXA 4X5LA 3NIGF 4N2DA 1DFBH 1A21A 4RDBA 4XCEB 1A3RH 4XE5B 1AGCB 2L4OA 4HLEA 1YQVH 1TTAA 2V9RA 1JS4A 5I2IA 3I6GB 4PRAA 5I19L 1ACCA 2HFFA 5EU6E 1U42A 2CO6A 4UTBH 4XMKH 3TCLA 4Z7WF 1AGFA 4A63A 4J23A 3EHBC 1J7VR 3FC8A 3HFML 3DKHA 4PJIE 4R9HA 1Q94B 3ARGB 4Y9FA 4PJXB 1NFDF 2X2YA 5T5NF 3MGAA 3O0LA 1S7RA 3W3BA 2VDNL 3MV01 2VMEA 3WL9A 4BINA 4H26B 1F90H 1OAXH 1OCOB 2FEDC 4AX3A 1IAIH 2BNUA 5E8DH 2OXHA 4X6EB 2F19H 2HTKD 4R7LA 3LD8B 4TSCL 3U1PA 3F00A 3UJJH 2BNQB 1J8SA 3MRIA 2BIHA 3MRCB 4GAYA 4Z7VA 4I9WD 1VESA 3O3EA 4A67A 4KRPC 4LASH 2IEPA 3UIZA 2BNRD 4IBTA 4R7DB 3T2PA 3TEZA 3D30A 3LH9A 3R4DA 4PJDE 2R2EA 5DT1L 4DP4X 4IRSD 4KK6C 4MNQA 1NC2A 1SGKA 3G7TA 5FHAH 5MP6H 1J1PH 1QR1B 2YUWA 4IBLT 2NUTB 4NYLA 5F3BA 1BIIB 1MVUA 5KSUB 1NDMA 3LCYA 3VRLE 3UAJC 4KI5F 3JSSA 3TBWB 5I6NA 5AL8A 4Y19E 4WY7H 2WBKA 2VZOA 4APXA 4WNQA 4M6NL 4TUJA 3RNQB 3BVUA 2WB1A 4EOWL 1T7WA 4XP5H 1VZHA 1TQSA 2IFFL 1T0PB 4X5XA 3BW9B 4A6YA 1MFNA 4MYPA 4AMWA 3DDFA 1QFHA 1T21A 2I5YH 4H8WH 4M6ML 4OLVH 1PCXA 1F3DJ 4WHYG 3U36B 4LSPL 4UM9B 1RJLB 5I1CH 2VXQA 5ID0A 4FQHB 2OX5B 1HOCA 1NLDH 2N7SA 1EK3A 1HH6B 4U1SB 3N1QC 3T3PB 3VFPB 5KJRL 3PXHA 3ARSA 1OHQA 43C9B 3DBSA 4IS6B 1AD0A 5E00A 4JBSA 3ZTCC 3DJSA 1FG9C 3V2AR 1GJIA 3BT2L 1FRGL 4JRWA 2EUZA 1F41A 3B2VL 2RHEA 5DYOB 3RZCD 2VDPH 1IE4A 2EDXA 5E9DA 2VJ0A 3EGXA 4LCWE 4XNAA 3I2CH 3VD5A 4ZFGL 2KQMA 1N3NA 2ZUQB 5KOMC 4KKNA 3ZMEA 5AKVA 2JK5A 5FAAA 4LHQB 4EUPB 4P3DA 4G3YL 1KXTB 1S8DB 1RD6A 4Y5XC 1IM3D 4E41A 4LSRH 5ANMB 3S36L 1VFUA 4IRJC 3EGDB 1OVZA 3SKJH 4X6DE 5G2NA 2PTTB 3A6BL 4L8DB 3ASWA 1PCSA 4AKPA 1LO4L 2WJ7A 2PXYD 3GT6A 4BJLA 4ELME 2FTAA 2GY5A 1CGSL 4YDNA 5AVZB 4U3CA 1WV7T 1BPLB 3O41B 2MFNA 3VVVA 1E6JH 1O9WA 3WJJA 1SJVA 2A74A 3P9MB 1SM3L 4JPVH 3LZPA 2WKLA 1KTDA 3V0VB 3TZVD 3H42L 3FB7A 1FORH 1GZHC 3QUZC 3ARTA 3QZPA 3QDJB 4H8HA 4HJ0D 4L4TE 4N24A 1CZ8H 1MJUL 3QEHA 5KJ4A 2OI9C 4WO4B 5FUOH 4NFDA 2ATPB 1EDYA 3QEUB 4JQXA 3UCQA 4BFOA 1SJHA 4UV7H 2TRHA 5EO1A 1HK6A 5LN8A 3VB9A 5J12B 4JO1L 3DX7B 4XPFL 1TZGL 2HRHA 2JJUA 2UX7A 5ICUA 1UD5A 1TUPA 4Q6IA 3NCBB 4LSTH 2XVLA 5BRZB 5E8OA 5EEUA 2D4DA 4B5ZA 4R4ND 1CMOA 4ZUVA 2JI2A 3BQUB 3D2UB 4G8GD 5F96H 1X5XA 3TURA 2Q5BA 1AANA 2M26A 3MMEB 4F7CA 3RVTC 3CN0A 3OAYK 4BDVB 1MI5B 1B0WA 2W07A 1JTOA 5JUEL 1A14H 1HFUA 3ARFD 5TF1H 1BVNP 1WD8A 1FP5A 1KY6A 3G08B 4WFFE 2X38A 2K70A 1JNLL 5L9DH 3B3IA 4DN4L 1YPZF 2Q2EB 1OF2A 3B2UD 3BFWA 2X6MA 4NNPH 3AMKA 1ZGLM 3N1MC 2CLRB 3QUMA 3FSWA 3ALWA 4R0LB 3O2DH 1KCLA 4FFZH 1TJXA 43CAB 1P53A 1UZ6E 4DGYH 5AW3B 5GGRA 2H3NB 4KUCF 3PP3H 3BEWB 3GSVB 1G7MB 1F8TL 4TV3A 5B1JC 2I9LB 3I75A 4WI6A 1OARL 2R0ZL 3BN9C 1D7DA 4NWUH 3SY6A 4JZOA 1A7RL 3NIDF 2QPEB 1G84A 3TEXA 2GT9A 3CVBA 4FE9A 4MD0A 1XEUA 4FG4A 1IIIA 5FKPA 2OSLB 1TQBC 5GHWL 4MAYB 2NY7H 3JWDC 1KLGA 3M1OA 4GSDH 1M6UA 1A6VL 1KJVA 3V4PL 4HWEH 4L29B 3DHUA 4WTWA 4KJPD 5LGHL 1EGJL 4RFOL 1QHQA 1VLXA 3FB6A 4MZ2A 2G75B 4HCGA 4J8RA 5DJDA 4KKAD 4A38A 2G4GA 2GCYA 3HNTH 4HEME 4U31A 4UTBL 5DRZA 4UYQA 3ZTNH 1UXLA 3KLDA 4LSUH 5EORL 5JW3H 2IQ9H 4HG4J 3U30B 2APFA 1HWGB 1LDPL 1NGZB 3KJ4C 1HCYA 1NCCH 4PGEA 1BEYH 4X0KB 1FBIH 4PV1C 1AC6A 3OXSA 2EDLA 1JG9A 5BV7H 4ZXBA 7TAAA 3V8CA 2GYSA 4XAKE 5IROC 4WEEA 4LO9A 3MRLA 3SBQA 3CQFA 1LEGB 4M1DH 2JF1A 4HK3J 4ZPTB 3QEQD 3KW7A 4KDWA 2G5BA 3UG3A 1M1SA 3EO9L 5BUAA 3IXAB 4N90E 1ONQA 3IBOA 4P9HH 4WFHD 2FIRT 1ORSB 3N04A 1RPKA 3B2MA 3B5HA 1TQCC 2DQDH 1KWGA 4LF3B 5J6SA 4C56D 1XL6A 3GIZH 3WIHL 2DTSA 1DJWA 2I26N 3UZQA 3ZGHA 2CLVA 1UURA 3BAWA 4OLXH 2VB5A 1XMEB 4IMKC 1YUKB 2NY0B 3MRFB 2UZPA 4LVOC 2NLJA 4ALAC 3Q05A 3RIFK 1JFQL 3DRQA 1OANA 3L4UA 4Q97A 3OXRB 4J3XA 4HOZA 1E28A 4PMEA 1CDBA 4GBXA 5D5MA 1RLBA 4P48A 4Z5RB 3VQ1C 2R2BB 4H5SB 2D0FA 5I6XB 5T1LA 4KU1A 4HUCA 3EFFB 4ONHA 4H8WL 4KKCD 4S1DC 3C60C 1ZLUH 3L3GB 5F9OL 5E1GA 3BUTA 2VDKH 5ESQA 4DKDC 4ZMAT 1VKXB 1P7BA 3L4YA 1V10A 3AREC 2GIMA 4JPWH 4PSRA 4NN6B 1B9ZA 1YEIH 4LLWA 2EP6A 2YRBA 5E8EB 3SJVD 5I76A 4OSUL 2G2NA 4OY9A 2ZXBA 1BBDL 5CZVH 4PJCB 4ZUTA 1TKWA 3WMSA 1ZLDA 4N25A 5A16A 3PWNB 1FYHB 1U8MA 2NR6C 4H1LA 1VFAA 1TCRA 3QJFB 4YL9A 1BXUA 4HJTA 1NCTA 4P04A 5ACZA 4FZEL 2DJ4A 5F0PB 1Q72H 4PJEF 4QAWA 1G6VK 4OFYD 4HG4K 1IAMA 2YN5A 3GO1H 3ARBB 1FIGH 4KZ0A 3P73B 2UVFA 4ZI8A 3CNKA 5C0BE 1DN0B 5TDNB 4TTGA 3CVHL 3SDYL 4H8UA 3V52H 1BLNB 2IV8A 3R0MA 3P3RA 1SEQL 4JFED 3TVMA 1P4BH 1M2VB 2ZP8A 3O6FB 1JD7A 2PO6B 3QXTA 1WC7B 2YSSB 4E68A 1P2CB 2DZEA 3N5AA 2LTQC 1RK1B 4TULH 5EU4A 3REWA 1P7QA 3H6JA 3MV8E 3T1FB 2QT6A 3MRRB 3SHSA 3VH8A 3WTUA 1MFBH 3QJXA 4XNXH 4HJ1A 3GMNA 5IHHA 3SGDH 5I0XA 2I9TB 1J0YA 4OGAD 3D12B 1JRHI 1CK0L 2Y22A 5INCA 4L3ED 2FR4B 1QO3B 4QT5B 1ZLWK 1UVQA 4ZUSB 4O02H 1W2KT 4GRWF 3J7HA 3ZDXE 2QVMA 4YHLH 3UC0L 3VO0A 1I9EA 2DV6A 1I8UA 4PRIB 5FUZH 1G0XA 1WFUA 5DMIL 1BF8A 3K6IA 1TTCA 4HV8B 1MCEA 3MV9E 4RZCB 5K9QI 4UV7L 2AVGA 5FB8B 3SDAB 3QDME 4QNPE 4NKMB 4N0RA 3QXWA 3WMQA 4JVPA 2ZYIA 4WSJA 1CD9B 3ZZQA 3DYPA 5DSCB 4FFVD 1RUPH 4JFFB 1YJDL 3PWJA 2H0JA 3F12B 1XVSA 1FO0H 4PJAE 5D1ZC 3VFTB 4DZBB 3MBED 2X1QA 4JM4H 1RPQA 1BQKA 2MHAB 2J6EH 3L7FA 2UX6A 5FYJD 2OAAA 1IE5A 4LHUG 3QPQC 3TBVA 1A14L 1AXSA 5GRVL 1FFPB 5B7FA 5GGTL 3RWJA 4GINA 4HS8L 4WI7A 4WEBL 2X0UA 2YD4A 4F2ME 5L9DL 3KHOA 3MUZ1 5E8NA 3TLRA 5H4YA 1QQDB 3P0GB 2VDPB 4RCAA 2OMWB 2VDQH 3AAZB 2D03L 2Z31D 3UTTE 3T2LA 2X9YA 4WK0B 4AYID 4B3VA 1I7UA 3GTVA 3RFZB 5KSBA 5JQ6L 3DX6A 2FEJA 1F6AA 3RWGA 4XNYL 3VWKB 3B1TA 1NBYA 1P0SE 1T83C 2ED7A 2NNAB 1J9CT 3GJEB 4TTDC 3CVHB 4WWPA 4OB5H 3VI3E 1NM9A 4K7FA 4NWUL 5GGRY 2HJLB 4FQLL 1E8XA 1X5LA 4UDUA 4ZAKA 1R0AH 4AC2A 5JOFA 4W6YB 4MMZC 4HWBA 2QQLH 3NZ8B 1I1YA 3ARXA 5HTSA 3WEOA 1YEHL 2XIBA 3N44F 3PL6D 3DVNB 5K9KA 5EU7C 2XPGB 2X3CA 4OZHE 1SBSL 1VACB 3FK3A 3MODH 4PJ7E 5F97E 1JF1A 5CJXA 3KYMB 1HQ4B 1P7KB 4XPTL 2CRIA 2LFEA 3FB8B 5L2KD 5H35B 3GM0A 3VXTB 1PX3A 4Y1AB 1H8OA 1FV1A 3GSOA 3KBFA 5C08A 2ICES 4GRLB 2CO7B 3B9VA 1V7NH 3NFPA 2MKWA 4LKCB 4YDKH 1ZA3A 2OZNA 3A22A 2COVD 4O2FB 1EZVY 3CXHJ 4NLAA 5B3JF 2AABH 2XYCA 4XPAL 2ZTBA 4YVNA 4ZT1A 4P4KB 4KK8C 1XH0A 3V7AG 4N8PA 1CBVL 1OPOA 1ZSDB 5GISL 3DX8B 4HS6B 1WK0A 4YXHH 1KIUA 1IU1A 1RUKH 3LIZL 5MENB 1EV2E 3TBSA 4CSTA 5DJAA 3PHSA 4NGHL 1ZT4B 5DEFB 3MJ9A 2MOVA 4KOBA 1AQHA 2P4AB 1JWMA 4Y1SA 5KBNC 4WK4B 5AVWB 1LO5B 4OAWA 4X6CF 5FUCC 1KNOA 5DJ8B 1OHZA 4LNRA 2PR4L 4WDIB 1U8OB 3T8MA 5TDOB 1J5OL 5K39B 3BAEL 5SWSE 2WOBA 1GYWA 3GIZL 3AXLB 2B4CC 1G9NC 2JKIS 2VR4A 1Q9WA 2Z8RA 1FGVL 3JZ7A 3ML9A 4PI0A 4E5XB 4O58H 2ICWA 3MRQA 4ODXB 3CDZB 4KTDH 1HKLL 4TNWK 5DRNB 2GJRA 4P46D 3W39A 3SBWA 1H5BC 2DH2A 5ETUA 5CJQL 1ZA6A 5KVFE 3TIEA 3O3DA 4P5TD 2JH2A 3IAGC 5D1XE 3R8BB 5FCUL 1JZ7A 2IIJA 4N2EA 5CU5A 2E74C 1XCWA 4YK4C 3IU3B 1FZOA 1KGCD 2E4TA 4NKOA 3RWEB 2IGFH 1G9MC 5GRJH 3H2QA 4URKA 4NQXB 2DBJA 3BUYA 1BA9A 4ABQA 3D3VA 4MA1C 2XKNB 4EUPG 1MKFA 4BZ1H 1PAMA 3W1ZA 4XAWL 2VDKL 5EO9A 4BSVB 5F1KC 1D5XB 3BE1H 4F58L 1LQSR 3DA0A 3TNMA 5DF0A 1OOAA 2VWEE 1UGNA 2PWDA 4LDOB 1WHOA 3VFRB 4BD4A 4OM1L 4P2QD 3PPEA 3ULUE 3MXVH 1J48A 4PJGF 1EAJA 5CZVL 3P0VL 4YXLH 5J7CC 1W8EA 4DVRH 2ZUXA 4J1UB 4XP6H 1JNHB 2AS5M 1S7UA 1U6AH 4L4VB 5AYTA 4MMXC 3CHSA 3VD9A 4AM0B 2X70A 3O9WC 1JSYA 2V5RA 4D7BA 2O61B 3CZJA 3KH3A 1RFDL 1RKRA 3M17A 3HAEB 5DDHA 2VJ8A 3RWFB 1WYJA 3ZKSD 1YY9C 3NIFF 3SPCA 5MI0C 2A4CA 1NIBA 3CXHK 4CL7A 5AD0A 1CD1B 1MXDA 3FN9A 3II3A 1XF3A 1CLYH 1N26A 1KB5H 1WS8A 3HC3L 3SYPA 3BFQG 1FN4B 5GS1B 1PLGH 5BV7B 2R0LH 2HX7A 1MAMH 1NFIA 1IARB 2GQHA 4L37B 2A77L 1ROCA 3T77A 5D7IE 2FX7L 1ES0B 3QDGE 1OPGH 4D0DB 2EE6A 4ZZKA 1R3KA 4ANXA 1AC0A 5FO7B 4IQHA 3OB8A 4IIQA 2DLHA 5DD0L 4TULL 3TBYA 3Q9PA 5DR5L 5EEXA 3CFBA 1E4KC 1UCTA 4K7PX 1PD0A 3MRBB 5TE7L 1XMWA 3R7QA 1GZPA 3L3KB 4AL8H 2YEZA 1FYTA 2VZVA 3BOVA 4K94C 5EIIB 5I16A 2C4FU 2Z6FA 5AW0B 2J2ZB 4HKJB 2RQEA 4JPIB 4KNSA 3EDJA 4XC3L 1MVYA 4O02L 5IEHA 1FE8H 2V2TB 4OZ4B 3FU6A 4AOFA 3LQAC 4KKLC 4TXVB 5TTRA 4HKXA 3KG5A 4WENB 2RH0A 4RQQB 4P2CG 2CU9A 1WZ1H 3IVKA 4M8UA 4ORGB 5EB9A 4ZMXA 7FABH 3ROLA 1N10A 1BFVH 1MIEL 4HJGA 3VXNA 3M8OL 1ZY9A 3QEGL 1FPTH 3MGTA 4F3FB 1OSZA 4GI6A 1I8LC 5LGJA 4AMXA 4ONGH 1C12A 3GQFA 3WKPA 4KV5E 3ARQA 3LNEA 2VDKB 4R3SB 5C0CA 5EZIL 3QNXA 3F5WB 2JKTM 4EVNB 2FO1A 1U3NA 2HRLA 1E42A 3P77A 1QEWB 1MWAH 2RJMA 3B4NA 5HD8D 3EYSL 3L4TA 5E2JA 3O6LL 1H15B 5I18L 3L1OL 5IBLC 3L2LA 1AD9A 1A5FL 4N6RB 2JV6A 2OMXA 4I48B 2H1LM 3F64A 3GHBL 3OLIA 4AITA 4HK0B 2V17H 1NCNA 2AV1A 1AS6A 3MGOA 2VDQL 5AB1A 1LMIA 2B77A 3T0BA 4D8PA 5CILH 4HHWA 3BZ5A 4MJ5A 4ZJ9A 2FX8L 2CRYA 4CADB 3NIGB 1MHHA 1YMMA 1F13A 3RJQB 4KNQA 3TL5A 3PY9A 4M62L 1C1EL 2DIEA 4FNLL 4QJ4B 4Z7WB 2C7UB 2DMKA 3BWUF 3RWCA 1U4FA 4EN3A 2DMCA 2HT3D 4HCRA 2Y6SD 3QVAA 3AJ7A 1NFDB 5E1AA 1H6FA 2JIXA 1G6RL 1AHWB 5DK0A 5ELIA 1XGPA 3TN0D 2CR0A 2E7HA 4MZRA 1HXKA 1TQVA 4AZUA 3OZ9H 1GIGH 4WK2B 3AWGA 1OV8A 2D7OA 3D25A 3MODL 4I85A 4G6KH 4P2OD 3QQXA 2NQDA 3N9GH 1R3IH 3TEWA 1F5WA 3HR5B 5FDYA 3SYOA 5E5LA 5LBVA 4G7YH 1A9VA 4K3DH 5E1QA 5TPWL 3SSGA 2MPVA 4O02B 2WKOA 4OD2A 4DCQB 2P26A 2CIKA 4Z76A 4EI5B 5F7NC 5I8EB 2V2WA 2R15A 5D1ZA 4NAJA 1KYFA 4UQEA 1KLUB 5AVXB 2VSKB 2ATKB 1BD2B 4TF4A 2RGSA 3CH1A 2MRYA 4GRWH 1DQMH 1YEEL 1KMGA 2V0AA 4XXCC 5D8JL 1CDUA 1F4AA 4N2LA 1E7VA 5ECGA 3IKCB 1DBBH 1AJ7H 2QKSA 5EULV 3VE0B 4AMKL 2IBZY 1CT8B 3WFDH 2IO5A 4XTRC 2FBRA 4XPBH 3L2NA 5TH2A 1OAKL 1RK7A 2AERT 1EBAA 2FB4L 3MA9L 1FZKA 3CCHB 4XT1C 4ZMQA 1ID2A 1U8NA 2YKLH 5B8CC 1PJWA 1W6WA 2KPWA 3JVGA 3QWOB 4QRUB 12E8L 3WUZA 3LQMA 3NSDA 4D3CH 1RIUL 2X4SA 4QXGH 2PF6A 3DI3B 4N0CD 2UWEE 2JJWA 4RVBA 4UIMA 3RZCB 3GRWL 5F1NA 4MA8H 4O58L 2AJXH 2JNZA 3US0A 4KTDL 4QRRB 3D18A 2VDQB 4ZO6A 5I6OA 5EUOF 5I0VA 5I6KA 2BC4B 2MPAL 5AW2B 1O0VA 2ADIA 4NRXA 4Q9RL 1F1DA 1G7IA 3HG2A 2C3VB 4IJ3C 1L9PA 1JGUL 1IM3B 5JPMA 3R18A 4KZCA 4KX7A 1EFXD 4Z8FL 4X8JA 2VAJA 2VRAA 1SXBA 1UQSA 2DQIL 3C08H 3I84A 2OYLA 2Y7OA 4X2UA 4W6WB 3MRHA 4P23C 3L3OC 4XO8A 1CFVH 2PXYB 3CZEA 4W4OC 3O0RH 3BPLB 4LLMA 5JIMA 4LMQE 4LOEA 2W80C 3JV6B 3FO9B 3NEXA 4JG1H 4UQ2A 4UT9L 1OP3H 1N9PA 2NNRA 1HU8A 3T6XA 3OR7A 5HYJE 1F1GA 4HK3N 4Y4HA 1CXFA 5JDJA 1J8RA 3OGOE 4MA7L 2EIJB 1TU2A 4BSWA 2C1PA 4XP6L 2GSGA 2MQCA 4OCLC 4XOCA 1HJBC 3BSGA 2VXUH 3M1BA 3ZO9A 4AIZA 4BFBD 1B6UA 3HUJB 3FFDB 4XXDA 3TZVB 3S0PA 4N2AA 1BG9A 1RZ7H 1HCFX 1I7TA 2MOQA 4AQ1B 1JWSB 3B83A 3E1ZA 3TIDB 1HZLA 3GJFA 4YZFF 4AENA 1CU4H 5HJ3B 4MXVF 2Q87A 3FT4B 1RU9H 3OTTA 6FABL 3LD8C 2D31B 1KJ2H 1KN4L 3EOTH 2G9HB 5DD5L 5EMYA 2OSXA 5F7DB 2GSIB 5LXGH 4L3FA 3VUAA 1PKQB 4AQEB 2AMGA 4ANWA 4TNEA 1T1YA 3LHPL 2OTWA 4WKXA 2NXZD 4DQOL 1DANT 3LX9A 3RX5A 1KCSL 3GSQB 5FGCE 4UI2A 1IL1A 1FL3B 2TSBA 4PRDB 4RX4D 2AEQL 4I89A 2C3WA 3C09B 3S3JA 4CRPA 3SQOH 3CXDH 3MBWA 1X9QA 3OC8A 2W9DL 3G5ZA 4LLQA 1X7QB 2GABA 3ZT7A 3FCUB 1F86A 1RV6X 2CJTA 2E8ZA 2DYPA 2Y6TE 4FXGA 3SDXA 3VX0A 2OR9L 5C9JA 1QKZL 1DN2A 2FJFB 3PJSB 5D7HA 1LP9F 4XCYB 4PVBA 3CFQA 3OGCB 3ASNB 4CSZA 5EPMB 3BWZA 1X5KA 3H56A 3MJ8B 4JY6B 2OFQA 3DROB 1T03L 3SQBB 7FABL 5I0ZA 4WHTA 1YPZB 5FM5O 1Q9OA 2PNDA 3MKGA 4IU3A 3RU8H 5C0FB 3MLZL 3CHRA 2LR4A 3KLLA 3RGVA 4PHZA 3RKDD 3F7VA 1FJ1A 1B9KA 2ZSVA 1IBGH 3ZE2E 3DOSA 4MMXA 1NJ9B 2XJLA 5IB3B 1SJEB 1A2YA 2H41A 3POCA 2MQ0A 3RWIB 4IK6A 1ZS8A 1J5DA 3MNDA 5FV2A 5M95B 3BDYH 3H9HA 4D0BB 3QO0A 2VQUA 2ERJB 3VDCA 4KO5A 1MWAL 4Q4EA 1T1WB 1JV5B 5I15H 3L6FA 2YIHA 2FH8A 1U8HB 4OM0L 4W93A 2FGWL 5C0AA 2ZKXA 2ZUQC 3MYZA 3TO4A 1UB5A 5F7FA 1E9QB 1OW0C 4H2CA 5FHBL 5IF0A 2V17L 4PS3A 4N2NA 1CDYA 4XI5D 5DJXA 1L6ZA 4R7VA 3VFGH 4MDIB 4DW2H 4OZIF 1TOXA 4QMEA 4PU2A 4EPSA 4KZDH 3CZUB 1G7HB 5HHOE 5DRWA 2X4RA 4V1DE 3WHE1 1KB5B 1BQ5A 3C75A 1X5IA 5DWUH 1X6NA 4MZ3A 3KWTA 1U8JA 2GITB 2WLKA 4I18A 2DQEH 1L3WA 4PVLA 4X5RA 5L4MA 4ZPVA 1YEKL 3DURA 3CLEL 3MO1A 1EANA 1BG1A 1YN6A 2V2XA 4WFGE 4BZYA 3BGMB 1CFTB 1GJUA 4DFHA 5ISZE 4CC0A 1D5BB 1HEJC 2WN3A 3FO0H 3FN0H 4FXKA 2J20A 2CBMA 4ODTL 2RAMA 5I17B 1GIGL 1QZ1A 4L8SA 2AC0A 2UYLA 1ADWA 3H3KA 3GSUA 3LN4B 5BQDA 3D39A 4FEIA 1PZ3A 1S7SB 2YMXH 3TM6A 4C56B 2JCCA 3DUUA 4G7YL 1TO5A 5E4OA 1DQQB 4FG6D 4U3XA 4PW9A 3PQYD 3QPKA 3T9WA 1I8MA 4WO4C 4PJ5B 4AGOA 4TNVK 1CLVA 4KVCL 2FRGP 5CIPH 4G42B 5LBSH 4LQ1A 4WUKL 3GS7A 3WLWC 2Q6WB 4BRVA 2Y06H 1WCBB 1S9VA 2N0MA 2NW3B 2QEJA 4UMSA 4X5WA 5J12C 2NT0A 5HGBA 1IMHC 5AW9B 4B9JA 4G8FB 2ZOLA 2CUMA 3RWHB 3IU4L 1EHNA 4ZSOE 2NYZA 5BRQA 4HFUL 1NCAH 4PJ6A 3BVWA 4KGLA 3BZ4A 3BZEA 2PABA 3PE9A 2YO3A 4JRXD 3O3AA 4K4KA 5E2TL 3QUHA 4C4KT 4F7EB 5AAWC 2RQ8A 4POUB 3AQZA 2NZ1A 3PP3K 1W8OA 4PBXA 25C8H 5FWRA 4EEEA 2FAUA 4K3EL 4YHKL 2A99A 2HT4C 2MEJB 1JGEA 4XPBL 3Q9QA 5FA4A 1FVEA 2VXTH 5HVGB 2P8MB 3CDFA 4KQ3H 4EZMA 4RMWA 4YQXL 1MWAB 5ILTL 5C07E 5CMAB 4HWUA 2ZUTA 4DP0X 2GEQA 4ES8A 3DYOA 1DQVA 2K8MA 3IT8D 1X5MA 4XBPA 1XH3A 3QIWA 4MNHA 4R0LC 5JHDE 5ADPH 2A6JB 4R8WH 4QOKB 2F53D 3L9RA 5MHSD 1Q9KA 3HC0B 5DHVB 1QSED 3OG4B 1YAZA 5T3XD 4J3OF 5JHLH 1DDTA 1OB0A 1A7BA 1OCRB 4G9DA 1A9BA 2GBAA 2W0KA 2PPFA 3ET9F 4PJEB 1I7RB 2A6KA 5JQIB 2EH7H 3LKSA 4ANKA 4MCNA 4ZS7H 3O0RL 4O2CA 3OAUH 3N85H 4NM8H 3AB0B 1JHLH 4UBDD 1EEQA 1JPFB 2Q3XA 1ZHBA 4N1EA 1SN0A 4XHJD 5L4JA 3RY6A 4BHUI 2YAQA 4UU9A 3EYVB 3KE0A 1E7UA 2EDKA 3TV3L 2YWZA 1FHNA 4MD4A 1UENA 3V5DA 1SYSB 4L3EB 3ZZSA 5C3IA 3O2WH 4NI6A 3ATFA 1HHIA 5CNHA 3T0EE 1JZDC 3U2SB 2BCMA 4Y5VB 5E6IC 4BE5A 3GBNL 3EBHA 5AVYB 4I1PA 3B9KB 5E2VL 2ZE0A 2EXWD 2MCG1 3IJ8A 3HNVH 4X9FA 1D7CA 1V55B 2O5YL 4Z6AT 4JG9A 4FZ8L 4S11A 1WZLA 4OLWH 5KVEE 1MLCB 2J1KA 2NY5H 2YJLA 5ALCH 4GRWB 4N8VB 3HMXA 4YSOA 3GMLA 4I0PA 3NH7H 4YOKA 2H1PH 4GMSH 2JKRM 3BIKA 3MROB 2F5BL 4NENA 4XMLH 4S1QH 4U1JA 4K7PH 4OGZA 3IAQA 3O4OB 3MBEB 4PHXA 2EYTB 1HKFA 4UNIA 4P4RA 1M42A 2VN7A 1S78D 2BSEA 1FH5L 3CDYA 1B3IA 4GQ9L 4HKZA 4NQCB 5FO9A 3HRZA 1D6EB 5F7MC 4YXKH 3RAJH 5CR1A 1IKNC 2VIRB 1AY1H 1UKSA 5IVOA 4AQAA 1L9SA 1ZLUK 2BRQA 2NY0C 5ERWB 1I7ZB 4JQVC 2ROXA 1A6TB 4IDLA 5IT2H 5DVOA 4CUCA 4PJIF 1SDAB 3OKNB 2Z31B 4P23A 2JJTA 3L8QA 5DEJA 1AS8A 3L3OA 3W57A 4RLDA 2NXYC 2YN3A 3PNWA 4NB7A 3VSQA 2XQYA 3MJGX 4HJEA 1S7VA 2WQSA 1BZ9B 1ZEAH 3HG1E 4NUJB 5JLZB 4WWKD 3CH8A 3TFKD 3OWEA 1O6TA 1BM3L 2VLLB 2WTRB 4MTMA 1Z9MA 4XCEA 4U1LB 5AVUB 3GGWB 4DAGH 4DVBB 4XCFL 1UH4A 2Z0BA 4I13B 2X9ZA 4M7LL 1FNEA 3SIKA 4Y7MA 1IBGL 1TYEB 1W0VB 1URIA 4NN6C 1WZKA 4P2YA 4MAUH 1Q94A 3ARGA 4PJXA 3HB3B 4PJDF 2ZZUT 4NZTH 3BDYL 4DHLA 2YOCA 1SLXA 3WGVB 3D0VB 3WS3A 3RB7A 1IVLA 1FC2D 4YBQC 4E9YA 1H3WM 1ZTXH 4H26A 5ESAA 2P5PA 2FDBP 4X6EA 1PZ2A 3VXMB 2BFVH 1QLEH 3G5YA 5C6PB 2BNQA 2OMYB 3UTQB 5HY9B 4IOSA 4G6JL 1ZK5A 3QI9D 3N44B 3VXUB 2E7DA 5F9AC 3UG5A 3UMNA 4LAJH 3JWOL 4UANA 2XQ0A 3SKNA 2HN7A 5C0IB 2WNWA 1DJIA 2VLKD 4PJ8B 4PWFA 1I75A 3EJZD 1WPCA 3V0GA 3OPZH 2JFCA 2KH2B 1ZXKA 2PO6C 3WKML 1IRAY 1D6VH 1QR1A 1RULL 3HE7A 4HQQH 5CLWA 2YC1B 3KL5A 3K2MC 2NUTA 1K5NB 4JK0D 1BIIA 3ARDD 5KSUA 4TLKA 2VRQA 3VM7A 2DLTA 1RY7B 3GZPA 2FECL 4NAMA 4R7NB 2QHRH 3TBWA 3FO0L 3FN0L 1DUYB 5FGRA 3IDXH 3Q8BA 3L3HB 2EO9A 2FWSA 3SPJA 4F8LA 1HWWA 2CJUH 2NOYA 3GF8A 4FQQA 4LIQE 3RNQA 1J11A 4GUPB 2QADD 4IEFA 3H85A 4Y2OB 4QRPE 4N0YH 1O7DE 3SGJC 4LPUA 4D94A 1RCYA 5SWQA 2N1KA 3MOQA 5FCSH 3ZE0F 2V5TA 4UM9A 3QDAA 4IMLB 2XA3A 4ZTOH 2OJZH 4X6CB 1LK3H 2OX5A 1MNNA 4AYFB 2Z0UA 4P46B 4MXWL 1HH6A 5EF3A 3VFPA 2R1XB 4NUPA 1RHFA 3QJTB 4IS6A 4X6DF 1K6QH 4HPHA 1WE5A 2EXSA 2YPLB 5GGSY 4DT2A 3HG4A 1GJWA 5DYOA 3HC4H 4NZDA 4CN4A 4KRNA 5F9JB 4ELMF 4H8WC 3RLSA 3FRUA 1SQ2N 1ZRUA 5E2WL 3SY0A 4NT6A 3FUEA 4EDWL 4X4KA 2JTYA 2NZ9D 4UM8B 5IJKC 5D7EA 4ODSH 4HLZH 1QRKA 4RISH 4JFTA 1JXDA 1S8DA 4QXVA 4NUQA 4YO0B 1MCJA 3MLXL 5ANMA 1GS8A 3VX1A 1CE6B 4X7SL 3BJ91 4HPOL 3SOBH 1A6WH 2V37A 4L8DA 2MCPL 3SCMB 4X9GA 4R90H 3C6LC 3UFIA 5DURD 3RFZC 3WKYA 3TJEL 5CAYB 3H0TB 3VWKC 5JPNC 3H53A 3EJUA 5IY5B 3HRPA 3KPSD 3EBAA 3BP5A 2AQRA 4XVTL 1NMCB 2YXMA 3V6BR 4PJGB 5JTWA 3L4XA 3A67H 3IETA 2FSDA 2HVJB 3OJMB 2G60H 4G7SB 5L4IA 4NZFA 3F58H 3TA3A 3OLDA 5ABDE 5DHXB 4J2XA 3OLEA 4J3SA 4NNYB 3SEPA 2WNKA 4S1SL 3V0VA 1MFCH 1A02N 3NIFB 1JK9B 3QWQB 1VDGA 3L5HA 2WNGA 4ZS7L 3N0PB 3RVWD 4M43L 1MF2H 4DGVH 2ATPA 3VCLB 2X3BA 2NY3D 1H8SA 5IKCA 5T1KD 4H0LC 4Y1TA 1DQKA 3NK4A 1CICD 1UJ3B 2IDFA 1KBGL 1IAIM 2CIIB 2DDQH 2ZUUA 5JNYA 4PGCB 3HZVA 2IH8A 1R5IB 4ZYKA 5C97A 3PWPD 4N0UE 4GRLC 2R0WH 1KCUL 3LTVA 1H3PH 3BQUA 3D2UA 1EUUA 1UZ6F 2R29H 3QORA 4Q58C 1ETJA 2OCCB 1UWYA 5CIPB 1ZS2A 1CFSB 1MI5A 1VHPA 1PU0A 2E47A 4ZX4A 3ZDWA 1F1AA 4IHOA 5JORB 4QEGA 5DWPA 1JZ2A 3QNYB 1J9RA 1SHWA 4OLWL 3WY2A 5JA9A 3GXUB 4RBPH 2EE3A 4F7MB 1PF3A 3LKOB 5DD1H 4HJSA 5LAPA 4XN9A 2WQAA 3E80A 3NH7L 4ATWA 4BKLB 2BY1A 5F21B 4K5LA 1WGVA 4HEPA 4AGPA 4OR1A 2HX9A 2A1WH 1BMWA 2Z1PA 1N5AB 4R0LA 4KXZH 4RA3A 2IDCA 2B3IA 4F7PA 2H3NA 3KPRB 5FGBC 3BEWA 3GSVA 1QSFD 1G7MA 5F2FA 3GS4A 1X7TA 4MQSB 5EDSA 1PX8A 4YXKL 5K9JH 2YQGA 5IOKA 2XHNA 3Q2NA 3WN5B 4LLDB 1B0GA 1N19A 2ZYSA 3KD4A 3WXWL 4JO3L 3P4MA 4NPKA 5GGQL 3HS0B 1TVHB 2GBVA 4M02A 4RAVB 5DQDH 5BZWA 5K69A 2OSLA 1AS7A 4CA4A 4MAYA 1XSOA 5H94B 5AB0A 3T08A 1ITBB 1SY6L 3DX0A 4L29A 4WWOA 1HZHL 2Z7UA 3RJOA 3RTQC 4F5CA 5HPMB 1MJJA 4P07A 3WI9A 2DWSA 1GOHA 2PYFB 4JM2F 1G9EA 3GXMA 4DAGL 1ECZA 1JVOA 4QTIH 4JFUA 4NO0D 1OZTG 3WXVL 1I53A 5DVMA 1ZDSA 3I85A 1Q9LB 4J3OH 1ZANL 1NGZA 4CC4A 1HEZB 2HFGH 4X0KA 4JM2D 3TN0B 4UILH 1E0OB 5IK3A 1KPUA 3FZUC 3GMMA 4KKRA 4PS8A 1CR9H 4JRYD 3OKDA 3WEMA 1UASA 2NSQA 3L1GA 4KY2A 1LEGA 1CC3A 2C3XA 2Y23A 4KHTL 1QLEL 1HE8A 1KTKE 1BJ1H 1RUAL 3II1A 1OAUL 3PREA 4MNQD 4L5FE 3IXAA 4P2RE 3KBEA 1ORSA 5GS1C 4R4BA 3R4RA 2XVKA 4S1RH 2VYRE 1UXWB 3IJEB 2BO0A 5ACMA 3G6AB 3X12B 1SDDB 5BV7C 1HZKA 4WLCA 1L3NA 3GKWL 4NQEE 4M5YH 2YPVH 3ZL2A 3IDGA 1CYGA 2QZQA 2I69A 3NESA 4H88L 4MJID 5GS0H 2M2DA 3QFJD 4YWGH 2BVPB 1S9XA 4HWNA 3ZYIA 3E3QC 3VJ6B 2XN9A 3FKUS 4JY4B 2BVEA 4P9HC 5DI8B 3MACH 5A2AA 4UOW0 5TE4L 1N0LA 1YYML 2D7PA 2B9BA 4GKSA 2VUOA 3OXRA 1TVDA 1RZGB 1FL6B 2SEBA 4WUUE 4C47A 3LKPA 3BAKA 1BQLH 4ZFQA 2R2BA 3UP6A 4GSXA 4FHBD 4MJJA 3ME0B 3M7OA 1DJSA 2TAAA 5I75C 5EBLB 3EFFA 4PRPB 2WO3B 1PNCA 3WTTA 4B53A 4PGBB 2YGOA 1V3LA 3CMOL 1C7SA 1LJMA 5E56A 1OGAB 5E8EA 1B4TA 1T5WB 1JZ8A 3DBXA 3DUSB 1QASA 4X5PA 4UAHA 3V4PA 1MOEA 1S3KH 1EGJA 3PWNA 4HAKA 1GKOA 3NP4A 4UT6H 3QR0A 1KENH 3BP4A 4NXKA 5EUOB 5T1MA 4ES9A 1VERA 2NY1B 2EC8A 3BDXA 2ITDA 4F8QA 4ZNEE 1G43A 4UTBA 4HBCL 2HKFL 3MJ7B 2XXCB 2YR3A 2VXSL 3M88A 3MLSH 4WCYL 3ARBA 3P73A 3RZWA 5I5RA 4MQTB 1I3RB 1KYUA 4LLYA 1SOSA 1ZD6A 2GC7C 4OW6A 4QGYA 3WS6A 4NC1C 4EI6A 3Q6FB 2ZOUA 4D8OA 1M2VA 3SOBL 3BCFA 2WXQA 3O6FA 3P4OB 4HHAB 3U1QA 1T3FB 1WC7A 2YSSA 3DTUB 1HDMB 3NJKA 4JB9L 1QVOA 1GGBH 1QLEB 1RK1A 1ZT1A 3T8VA 1PLBA 5CP7B 5KANG 2FUQA 2VGLM 3FSZA 3T1FA 1XZ0B 3MRRA 4M7ZC 4TVPD 1LE5B 3X3GL 4HUXB 2ZX6A 4QNPF 3RNKB 4XR8C 2AW2A 1WITA 2B9AA 1DBKH 4NNXB 2R1YB 5D7KD 2JKLA 3F58L 4QF1A 3B43A 1R46A 4PUBH 1IBBA 1QO3A 3WIHA 3BUIA 2K7PA 1EH9A 4EZKA 4GAJL 1BX2B 3DIVA 1AHWC 2B0SL 3CUPB 2J25A 3CU7A 3SGJA 3KL3A 4PRIA 2QSCH 3N91A 1MF2L 3KCWA 5KSAD 3QXDA 5K33A 2EIZB 3RX8A 5LDUA 3QRGL 5FB8A 3SDAA 4K71B 4A2EA 3W5MA 1LM8V 2H47C 2X28A 3OKOB 4NKMA 4P5KB 2EZ0C 1H3UA 5DJCB 2YUZA 5CJOH 2DQGL 3FU8A 4NM4L 1WFIA 3HNSL 4UQ3B 3WIIH 1T04A 4FNRA 2DL2A 4JFFA 4EI5C 4KMQA 1PFOA 5FK9A 4HIEB 2P80A 4DZBA 2ZXDA 1H3PL 4KROD 4U1GB 1GCYA 5EA0L 3V4VL 4H44C 1WG3A 1UATA 3PP4L 5F3HB 5ANHA 1PZDA 2NQCA 4XOEA 3QQNA 2F2HA 2D7TH 3VI3F 3OKMB 4NCC1 5ABZA 4M5ZH 2P5EB 5AZEL 1FFPA 1O9ZA 4BK5A 4KI5C 3QO1B 5AQ0A 5IMOA 2WUBL 1UH2A 2JB5L 2H6OA 1OTTC 1BMGA 1LXMA 2W0FB 4FULA 1CL7I 2OMWA 3AAZA 3NK3A 1S6NA 4G71B 4WI0B 1LP9B 3RDJA 4M8QB 5IVZB 3C5SA 1OEZW 3ARUA 3RFZA 4AYMC 2TRYA 2A1WL 1VGEH 1MFEH 4OZHF 3TNNA 5HHXH 2XRAL 3ZO0A 4JQIL 1A7PH 4L9LB 1LWRA 4F8PA 2EDYA 1KXQA 3FRPB 3LKQB 3CVHA 4I3RL 1UFGA 1ZTMA 3T8XA 3ZJAA 3ULVD 3JV5A 5E9DE 4FMFA 1B4JL 2MWCA 5K9JL 2BP0B 3EBGA 2HJLA 4L1DA 1JI1A 5EUKB 4U6HA 5G4NA 1CCZA 1EAQA 4ZOCA 1IC5L 5DQDL 1CFNA 1S46A 3L08A 1JAEA 1WGOA 2WWMC 4LDLB 1AR1D 4QWWC 4E41E 2EKSA 1X5FA 4OFPA 2J4WL 4B9FA 3MHZA 4IM8A 5CWSB 1WIUA 2IQAB 3BC9A 1EPFA 3DVNA 3J8F7 2XPGA 4KK9C 3QJVB 3DYMA 1JP5A 3ZHFA 2HH0H 1VACA 5DFTA 5T3XL 3X1BA 1IGCH 1HYSD 4JPKH 2IAAC 4DP7X 4OF0A 3KYMA 1HQ4A 1HHHA 1P7KA 4GUQA 5FECB 3ILEA 3SOTA 4JE4B 1XSJA 4L8BB 5H35A 2ADGB 3BPLC 4N2BA 3ES6A 2K3HA 4NCDA 4QXTA 1MXGA 1L7IL 2CO7A 3B6SB 2ZCZA 1ND0B 4GG6B 4XH2B 3LY6A 5A2CA 5JOEA 4LKCA 1WAPA 5IBTL 2HFGL 1J9TA 1INDH 2IC2A 3CZLA 4EO5A 1LLAA 2FR4A 4KX8A 4P4KA 4G6MH 3DX8A 2MTPA 2VE6B 2FECI 4OZFH 1MH5A 3UYOD 1BWWA 1A6UH 2HPTA 5KVGL 3DJRA 5I1AB 2BSTB 5F70A 4C54A 1GW6A 1DBML 2ZKYA 4AQ1C 4EXKA 5CCKH 1CF8H 1TT6A 2IDUA 3E6HB 3PQYB 4OFDA 3WJMA 3WAKA 3NABH 4JRFA 1RXLA 3C5ZD 5H37H 3V4VB 1LO5A 1EERB 3Q1SL 8FABA 3D8MA 1S7XB 1GW0A 4HIQA 4YDLB 1U8OA 5K39A 2EIKB 1A0QL 3UJIL 2W0PA 2HUHA 3AXLA 5GGTA 5GSRB 4BZ2L 3VXOA 1U8LB 1A6PA 4HS3B 2W94A 3T2QA 3RURA 3UEQA 3GBLA 4P9ML 1RZFL 2WUCL 4E5XA 3FFCE 2E76C 5IB1B 3CDZA 5DRNA 4HXAH 3SDDD 3BUQA 4A7QA 1U3HA 4M1GH 3ULUF 5T1LD 3HLAA 4XMVA 3C09C 4XHQA 1QOKA 1I1AD 3N42F 2EE0A 4BFRA 3BRFA 2R8SH 2OMVB 4XCNB 4AV5A 5D7SL 4LAQL 1LEKB 4JHWH 4CW1B 3EHBD 2XKNA 1JOIA 4ZUUB 2FWLB 3EYOA 4BSVA 2ZAHA 1D5XA 4KX9A 4MCMA 1O7SA 2FEDD 2QGCA 5TK4A 4U6TA 4BFFA 2ZXQA 4IBSA 4XRCB 1MFVA 1QSEB 1S7WA 5DUPH 4HXBH 5I0YA 5D70L 1P84J 2C3GA 5SWZA 4LFHD 4J1UA 5D7IF 4YHNB 2APXA 3C8KA 1HXMB 2YAPA 2X3AA 1JMXA 4AM0A 4W1TA 1NGWB 3COOA 4KRPD 5I1KH 2O61A 1HT6A 4KRMB 4FQCL 3RWFA 3HAEA 4K55A 3TO2B 3GSNL 4MS8C 2ERJC 4KK6D 3FU3A 1NPNA 3GD1C 2AVFA 3KYOA 4ISVA 2JXMB 4AEEA 1O75A 3QYMA 1DBAH 3LXUX 3DO4A 1FN4A 4HZ1A 1B2YA 3LXBA 1HIML 3OLGA 2VL5B 3VQMA 3UAJD 3V0WL 3N1FC 5IMMB 2G2PA 3QIBA 1MJ8L 1M05B 1ES0A 3ZTJH 2F0CA 4ONFL 3LIZA 3ECUA 1HINH 3IDNB 1F42A 4L48A 5FO7A 3MRNA 3OKEB 4HULB 2HKHH 4LSSL 2XWZA 3BKMH 4LLUB 5E6ZA 3D48R 4I8DA 1PY4A 2BDNH 3MRBA 4ODWA 2HVBA 2Z93B 3D0LA 1FNAA 3FBKA 3PHOB 4L2LA 3K0WA 3TOPA 3EH2A 1CN4A 1VENA 2H2PC 3GSXB 5EIIA 4OLUH 5K5YA 1QMUA 1ZLSL 2DBLH 4DOHE 4GQQA 3IJYB 3APMA 2V2TA 1NICA 2GJ6A 5IQ9B 3HN8A 3OSVA 4KV5F 2XWJB 3T6ZA 2BY2A 5E7BA 4KNUA 2QQQA 4OBRA 4NQDD 3SE9H 1CGTA 1D5MB 1V3KA 2WP3O 1RJZB 3HMWH 1JCVA 2E6JA 3RRQA 4AG4L 4ORGA 2AK4B 2XZAL 3K6DA 3A24A 4NLHA 2O5ZH 4AL8C 1Z3GH 2V5SA 3KVDD 4XWOC 2I60L 3IMVA 3WIIL 4HKBB 4BKSC 1QUNB 5I6MA 4ATTA 2PWGA 2Z4QB 1U21A 3T1WA 5IW1B 3NACL 4TQIA 5DRXA 4IRJD 1XXFC 1DEDA 2Q3AA 4NSKB 3F5WA 1DQIA 1OCZB 1LILA 1G7LB 3QUYB 4HGMA 5D5ME 2WZ0A 3LEXA 1BZ7A 3B7YA 5EU6B 3ZKMC 3GFUA 3FT2B 1IIKA 3IGUA 1KCKA 1KULA 2IPKA 1HL9A 1SLWA 1Y6MR 2A83B 4PJIB 5BQ7B 2EUXA 4G80B 4XP9L 1XHHA 2X2UA 5J5EA 3A4DA 3LPPA 1GC1H 3LKNA 1MZYA 4KVNH 1V54B 3MOBL 3BVVA 4UDTB 3KLAB 1KPRB 1VGEL 5B39A 3O8XB 1GPOL 2E8YA 2ODHA 4YSPA 4CADA 3FOMB 5JXEC 4X6BB 4BSJA 3ZQ9A 3BXNA 3GPEA 3FCSB 3QUZD 2DEXX 1PLAA 3FYEB 4K3JL 1FLRH 4PRHD 4Z7WA 5DGRA 2C7UA 1LD9A 3WTVA 3FQXB 5F7AA 5E5UB 6PAZA 1KELH 3M07A 4PJDB 2Y25A 1M71A 5GRXG 4I77H 1AHWA 3B1UA 1OAZL 3QAZB 3PIQA 1R3HB 5EFIB 5B1KA 3QZBA 4NEHB 5CEXA 1GYUA 3LQZB 2YGQA 1TMQA 3DUHA 3DV6B 5LWYL 4IRSA 2WZAA 3QXUA 3HR5A 1TJMA 1J05B 2IVFC 2XQBL 3AG3B 3Q1EA 4F2EA 3CQPA 4WU5B 3BRDA 4OGYL 4XNUH 3RVTD 2BOLA 4O02A 1VADB 5EOQH 3AB0C 1II4E 3FT3B 5I8EA 2I24N 3OG6B 1E65A 3EAKA 4G82A 1JUFA 5EO0B 3KDMB 2WCGA 2ATKA 4PJHF 4X7FC 2HT2C 2XDHA 3B37A 2VOTA 4TSAH 1PEWA 4K9EL 4HT1H 4E9QA 5HVFB 2UWEF 4PG2A 4XMPH 4Y5VC 3X1EA 5I5JA 2IGTA 1EEUA 1RL1A 2ITFA 1NDGB 2WZ6A 5FYLE 3B9KC 3IKCA 5E03A 1OP5H 1OSYA 3FN3A 3B7SA 3HG0A 1CYWA 1MREH 5J11C 4JKMA 3EDDA 3BN9D 3CFJB 4APQB 1U95B 3F2LA 5CCJA 3QWOA 2GPZA 4QRUA 1G1KA 3VDAA 3O4LD 5HI4C 4FTVD 2ATAA 1FVDA 2AEIT 3ZE0B 4YEFA 2DJSA 4OF5A 3RZCA 3O4OC 3C87A 3B9EA 1Z3RA 3FF7A 5C0DA 4AUJA 4GO9A 2XICA 1IEBA 1AFVH 1HNYA 3QHZH 1NCWH 1A4JA 5IZ7A 4RGNE 3MCKB 4X6DB 4DUVA 4JREB 3GS0A 2C3VA 5A1AA 1XBRA 4BUQA 1TFPA 1IM3A 5FW8A 2FVNA 3GXFA 4UIKH 3R1GH 1UD2A 1NMAH 4ELMB 4A2MA 1MRFL 1YQ2A 2DQHL 3K4AA 1L7TL 5ITFB 1I85C 2Z31C 3UBXB 4FQIL 1JE6A 2VMCA 3FQTB 3VD7A 5DURB 1EO8L 5IEKB 4ELKA 3WFBL 1VZIA 1CLZL 1QYGL 2PXYA 1SRDA 2CRZA 4KY1L 5KS9B 1RIVL 2R56H 3QQDA 1G6RA 5IJVB 5TF0A 3JV6A 3NQKA 4PWGA 5IROD 1KGJA 3RI5F 1LWJA 3HJ0A 2XV2A 2R23B 2PWHA 3MLUL 3D87B 2BVQA 3C5XA 1NCDH 4L4TB 3THMH 5DO8A 1U8QB 1EQWA 2VSMB 3HUJA 3FFDA 2K3TA 3D4ZA 3TZVA 5E0FA 4LPYA 1CWVA 4OH2A 2Y36H 3HB3C 2WZPD 4HPYH 5CEYA 4N1HB 1P1ZB 3PHAA 4E9SA 4YGVB 5JIQA 4HETA 1FCCA 5HJ3A 2BW4A 3FT4A 1BYNA 1IGFH 2D31A 1CICB 3BEVB 1BOGB 1WA2X 4N2HA 4KI1A 3LH8A 4OZFB 4P3CH 3DGCR 2Z65C 5C08E 2TSAA 2F8XC 2Z92B 3BPNB 4K5NA 1HSAA 3LH2H 5DEGB 3IDJA 4KJYB 3UGEA 3ASOB 4PJ8C 2CHZA 2VMFA 4G8GA 1XF2A 4OLYL 3S2CA 2EACA 3IJ7A 3J2PA 1B0RA 1OB1A 3LMJL 3CAFA 4QY8B 4PRDA 4BA8A 4ZFFB 3FUFA 2FYVA 5EOTB 4PR5B 1Q4NX 2HJFB 2NYYC 3MLYH 1T20A 3BP7B 1A3LH 5IB4A 5KVFH 4S1DD 2ZJSL 3K80A 3C60D 2XT1B 3ARVA 3ROOA 3NAAL 3ZE2F 1JJUA 4GAGH 3ARED 1E8YA 4RGOL 2YPKA 3GRWA 1F2XK 1F4YH 3BSHA 3MLRL 2CG9X 1ED3B 4LOVA 1WBZA 4HA1A 1VPOL 2W65A 3UIYA 4F92B 3OGCA 4FYRA 2E7LA 2DD8L 3SE9L 3C5JB 4GOSA 4JY6A 4XX1E 2NR6D 4QTHB 4ZX3A 5LLIC 1O6VA 2EH8L 4B9ZA 1N8ZB 3RL1B 3H3PH 4R7XA 1XR9B 5C0FA 4JY5H 5HYSB 4TNFA 2OPCA 1P5UB 4HLZG 4ONOA 5IWLC 3ULUH 3BFOA 4R6UA 4A2FA 1HHJA 1TTRA 1R9FA 6PCYA 1NJ9A 4D9QE 5C8JB 2EDFA 4WGVB 3AS2A 1AGDB 1SJEA 5IB3A 4DH2A 5KVDE 3TCTA 3RWIA 2B1HL 2QMJA 3AT9A 4OFVA 3VFVB 2I07A 4D0BA 1RPUA 3CDGB 4UT9A 1K8DB 3D3VE 3KW8A 2A9AA 2VLRD 5AYQA 2NSXA 2Z8WC 1KF9B 1U8HA 3IMRA 5JW4R 4MVBC 4HJJH 4LCCB 5IMLB 2AJZB 1I8KB 1YMMD 4BQ9A 2F7PA 4N5UA 4Z23A 2UXVA 3JUYA 3MUGB 1BAGA 4KVNL 1D5IL 4DERA 1H9VA 1IUZA 2VXVH 1UEMA 2GUYA 1G7HA 5JHAA 2QKIB 3DMMB 4TYUA 3K4ZA 4I87A 4JM2B 1FNGB 3SCMC 2WOYA 2GITA 4NUGL 4B50A 4NCC2 3HA0A 4JRYB 2H32H 1NC4B 4JFQB 3DTXB 5C6WH 1SN5A 1NMCC 3QEQA 4MDRA 1LO2H 3BGMA 3L4WA 3ZMNA 2Q7YA 4TVPL 2ZCHH 3CHQA 5D4QA 5BS0D 1CUOA 2OMTB 2YARA 2NY6C 1S7SA 4C56A 3PJLA 5D1ZD 4MJIB 5DLLA 2HFEB 4XB7A 1MWOA 5CSGA 2YAMA 1ADQH 1G7PB 3L9YA 4KTEL 4PJ5A 3TBCA 4DPRA 4NPYB 4MD5B 3QBTB 3WNPA 3I50L 4G1EA 3VGFA 2VC2H 4G42A 3QPQD 4QYAA 5AKTA 2Q6WA 2P5WD 4Y7OC 2QV4A 4TUUA 4RBPK 3WELA 4QKTA 1FYTE 2WXIA 4G8FA 5GGVH 1RUML 1LYQA 5D2NA 3GDBA 4FFYL 4X9HA 4F7EA 3U48A 4JHBA 4KH2A 1RJCA 5EU5B 2FK9A 3MLWL 3T0XA 1CLOH 4B3EA 5IFJB 3LPWA 5C09D 1PQZA 5C6TH 4LEXL 1MELA 4YDVA 4U6YB 5CCHE 4I2XE 4TTDD 2ZNXA 1CL7H 4HVBA 2KZBA 1IT9L 3SJVA 2GTZB 2P8MA 1TPXC 3B2PA 4UT7H 1MWAA 1BQHB 4IU2B 3UPCA 2BSBA 2QGDA 2OM5A 3MFFB 2FWUA 3DXAD 3VI4A 3FQ2A 3ULAB 1ZJAA 4IDJL 3IFPB 3T04D 1OAYH 1IAKA 5C0CE 3L3JB 3GBMH 4OFYA 1PDKA 2A6JA 1NM4A 4NKIL 5E08H 3Q7JA 3QUKA 5KSVB 5DHVA 3WN5C 4NKDB 1T22B 1CIUA 1HCZA 1F58L 2UXTA 4UIKL 4L3AA 2IH9A 2VDRH 3O2VL 4L3CA 1I3GH 3N41B 4CVXA 4JFEA 3TS8A 4PJEA 2LU7A 3W0WE 3MV8B 4YE4H 4MLIA 1FQ9C 1I7RA 3IGAB 4J3OG 4F24A 2IMMA 4HISA 3F7PC 3DSFL 3HPLA 4NBXB 5H2BB 3SE3C 4X4ZA 5EZOL 3O6KH 3EYUL 4KK8D 5B22A 4GS7C 3MRDA 4N28A 4LOUC 4S2SB 2JSFA 5C3TA 1IBHA 5CD3A 1OALA 3CVCA 3L5WB 4HIPA 3RHWF 1DR9A 2CRMA 4J6RH 1PAZA 5GJSH 1WICA 2PYED 2HMIC 4QRQB 3BUBA 3EG9B 3BLBA 3VXSE 1IGIL 2X4TA 3QUXC 3THML 3D85D 2H4EA 4L3EA 3TU6A 3NEOA 3MV9B 3U6XA 1B4RA 2OA9A 4E0RA 3QDMB 5EF2A 4JFYB 15C8H 1YEFL 4ACTA 3KPLA 5TQ2L 3EGSB 1UM5H 3KYAA 3VXRD 4PWKA 1WFOA 3EF4A 3BWUC 5B4MC 4U2ZA 1HQRB 4WTZA 1XR8B 1IGFL 4GIOA 3ZDZE 4FQPA 4QGTA 3KDPB 1L9RA 5KBKA 4N8VA 1FZMA 5I1IH 4DGIH 3AS1A 2YRLA 2KZKA 4DP6X 2DLFH 1A1MB 4WI9A 2ADJA 1K8IB 4JO2H 4YHYB 1V3JA 1XIWB 3MBEA 3H9SD 4M48L 4AK1A 1BVLB 5CUSH 5T3ZD 1BOYA 5DVNA 3VFUB 1D6EA 4UB0H 4B9PA 2NY5C 1ZK9A 2VIRA 2XA8H 4HMDA 5AOZA 3UTTB 2VM4A 3BO8B 3MLYL 4BH8B 1L5GB 2IAMB 1EJ6A 2YHGA 5ERWA 1I7ZA 3L48A 4WI8A 1U9KA 4GAGL 1ZWIB 4KHXL 1JPGB 1XX9C 4LPTA 3UERA 4ZODA 1I85A 2Z31A 4QXUL 1E8WA 1A4BA 2FSEB 1YAIA 1LO0L 4JKKA 1AKJD 3VI3B 2FL5B 3ZX1A 2A4EA 4LCIH 3K72A 4KKZA 3RX7A 4P57A 3JWNE 1BZ9A 4F8TA 2CO1A 4NUJA 5JLZA 2WLNA 4I4WA 4PWIA 1XGRB 3O9WD 1S2EA 3EOAB 3GINA 4OVVA 3VTTA 1MAJA 4U1LA 4DVBA 3GGWA 5FDWB 1WRFA 1YY9D 2H0FA 4YNYB 3RL2A 4NQTA 1IFRA 1IJ9A 1YMHB 1W0VA 5F88B 4OZHB 3IKKA 4UUJB 4NRYB 3QAQA 1UM6L 3HPJA 5DJZA 1MPAL 2VW6A 1Z0NA 4PRBB 1EHLL 4QPEA 3E6FB 1PG7W 3FQRA 2ENPA 2YFNA 2PP7A 3PDOB 4KQ4H 3WBDA 2NY1C 3LRLA 5I6PA 4DP2X 3K2KA 2K6WA 3MRPA 1KJ3L 4HJJL 2EYRB 2QFPA 3IFLH 1E5CA 5GS2D 3UTQA 2OMYA 4NZUH 2XZCH 1F6FB 3T71A 1KIRB 2K4AA 5J6HA 2CR3A 3KNBB 3OJDB 4YHPB 1MCPH 5I8OH 3VXUA 4U6VH 3MRJB 1HSBA 4JFPA 4PJ9B 5HYQB 4GXUN 4DF9A 2WM0A 2CGRH 1HI6B 3F7RA 2BJMH 1QBLL 1AHKA 3IDUA 4OU3A 3VXQB 1JZ5A 2Y4SA 3WEXB 2BOBB 4KKLD 4MCZA 2YC1A 2DICA 2HCZX 5LAXB 2EC9T 2A6IA 3TT3L 3VYNA 4PCYA 3VFNB 4JFHE 1RURL 1J5CA 1PPIA 1YY8B 1A7NL 1J86A 1DUYA 1QLRB 1T5XA 3HI1A 3KHQA 3WENA 5I1DB 3S4SB 1S9KC 5HDRA 3U82B 1AO7D 4F8NA 1SXCA 2IG2H 4GUPA 5SX5H 2J1XA 1IC7L 4AH2B 1T2JA 4FJ6A 4AC4A 1URLA 2XWBB 1J8HD 32C2B 1R34A 4PBDA 5L6YL 4IMLA 1RSYA 4F57L 3L95B 3LJ3A 1T89C 3GHEH 2VC2L 4P46A 4AYFA 4BGDA 1JGLH 1X7SA 2VR6A 4K71C 5IBLD 4OLZL 4P5TA 5AAMC 4OTXL 3B3BA 4IRZH 4AEIH 5AVTB 5FXCH 2FZ3B 2NX5D 1KV7A 3F3HA 1I1AB 3T0DA 1V05A 1AGBB 3ARRA 4N4YB 4F91B 1YYLH 2GBUA 1N6QH 4D0CA 1THAA 4MSWA 5GIRB 2OTUB 1XCTB 5F9JA 2CDGB 1RZJH 3US1A 1G7JA 4R2GB 3TONA 4Y4KB 3NCYS 1KTLA 3SYAA 3KXFD 5EBGA 1E5ZA 1DDHA 3ABGA 1DLFL 3NPSC 4P2QA 1QACA 2EDDA 1AZZC 3EJPA 3G3LA 3SCMA 3LSOB 3L5XL 3CGTA 3HCVB 2FNBA 3OMAB 3VGDA 3H0TA 1W0WB 4K23H 3GUTB 4QLWA 2OSYA 1PZBA 1EHAA 2BVOB 1D9KB 3CHPA 3K6OA 1I8IA 4OJFH 2VZSA 1QW9A 4CDHA 3UBHA 2VAAB 2E6PA 4C58B 1UKQA 1MHCB 5FKAB 2HVJA 4EIUA 1IKOP 1S5IL 2X4PB 3QDGB 4OI8A 5C0AE 3QJSB 2VDRL 3Q3GB 4N86A 1ZV2A 1Q0YL 1ZIBA 2ZCLH 2YA1A 1T0NA 3MBXH 3T3MF 3RPIA 4YE4L 4WFED 3CFEA 4DPCX 2J5LB 1JK9A 2H32B 2CCLA 3GXPA 1JPTL 1U36A 3K6FA 4L8CA 3UYPA 5IQMA 4TPRH 1RHHA 1QRND 5CINL 1UXSB 1YHPA 3D7PA 4FLSA 4FLOA 4OZFG 1IVTA 4MJ6B 5CLXA 2Y0SA 1UJ3A 3UTZA 2CIIA 2Q86A 4GXVH 1E6OL 3K6SB 4HSCX 5CZRA 1AQDB 1ZGLB 1JI2A 4XTRD 5I1LA 5H37G 1YVLA 1KLFA 1PG7L 4Y88A 3UTSD 1KCRL 5D1QC 2F54D 1DEEB 2WWKO 2H8PB 1NMBL 5D4IA 3FTGA 2VC2B 3KR3L 5DJ6B 2EC9U 3AG2B 4OJCA 4OCSL 3D39E 4ZFOB 1FA4A 3FMGL 5JORA 2JCCE 2GTWB 2R59A 3LKRB 1TF4A 2X2JA 3QNYA 1NWPA 2ARWA 4FG6C 2IFGA 3MNZA 2HXAA 3LKOA 3OF6D 4QHNB 4AQOA 1F3RB 4DP1X 1OM3L 4BKLA 1XF4B 4Z77A 1AP2B 2H6PB 2DMHA 1B88A 1JF5A 3QIUB 1N5AA 3LXAA 3NJNA 4NP4L 3A3YB 3KPQB 3QA3B 4IRJB 4LHUD 1IFGA 5DK2B 5I66B 1F11B 5HSFA 4GH7B 3HBPA 4P23D 1C5BL 4PV9B 4FQ1H 4WI5A 2Q8BH 3WN5A 5GRZA 3JBG7 2ITCB 3W81A 2D2OA 5JQHC 4B9CA 2ZCKH 1MCOL 5BUGA 3HS0A 3NTCH 3NZUA 1TVHA 1LEIA 3JWDL 4FN0A 1IEAA 2DY2A 4A37A 5I30L 1M7UA 2CKBL 2DQUH 3VA6A 3MOAL 2R69H 3U4KA 1C5DB 5INDA 2DAVA 1HNFA 5I26A 5E94A 4P5MB 3RP1A 3EYFB 4XNDA 5E5MB 1TJIL 2YWYA 1E27A 3ARPA 1NLBH 4XBGB 4PG9B 3KWWB 5GZND 2PYFA 5D71H 2VDRB 1R5WA 2ZUVA 3QUZB 1IKFL 1UWEL 4OCRL 5IHZB 4PRHB 2ZONA 1D2OA 1UH3A 3MX0B 3PWLB 2OI9B 5K9OA 1A7QL 1LK2A 1ITCA 1MCSA 2YAOA 1Q9LA 1OQOA 2D8KA 2GFBB 2GEEA 3QC6X 1KTCA 4PBWD 1IAOB 1RZ8B 1HEZA 3LZQA 5C9KA 1GGIL 3ETSA 3SDCC 1SQMA 2BNQD 3TN0A 3AROA 2XU9A 3D9AH 3LEVL 4G6FD 3F84A 3SPVB 2ZX7A 4PV8A 3KM2A 2H26A 2EDMA 3ZTJG 2OMZA 4P2OA 4KQ4L 5DS8A 3G6DL 3ECQA 4DK5A 2A9ML 1MQKH 1V7ML 2WXMA 4JX0A 2R4RH 3T65B 4GXFA 1VEPA 2BINA 4KO9A 4X42A 4NQED 4J3OC 5DJYA 3HE6C 2EYSB 4GRMB 1MCPL 5I8OL 5KVEH 1U8KB 2PMZA 4R26L 2MKLC 4UTAL 4B0MB 1UXWA 3IJEA 1ZHKB 4FRWA 2AJUH 1SDDA 1XGYH 2QDVA 3X12A 2QQNH 4MRCA 3W9EA 2BJML 4P05A 5AOIA 1XB6A 1QBMH 4Y9CA 4UAOC 2EVHA 1EMTH 1MCCA 2B1AH 4QIRA 4WI4A 3IJSA 2OR7A 4YHOL 4ALAL 4YLQT 1F3DH 5BO1L 5KN5A 2LV4A 4JG0H 4EE2A 3I6KA 1GGYA 4ABVA 1CTMA 3SGEH 1XCQB 4HYTB 5IHLB 1F6LL 5TJWK 1EXGA 2AKRB 4PJHB 1FH2A 4TUKL 4ODHL 4WV1B 5ITBH 3GLAA 3DX9B 4PJFA 5FYKU 1I9JH 2EEFA 3VQ2C 3QT2A 3LS4L 5GS0C 1CB4A 4HOXA 2BZ7A 2O30A 3MVSA 3TYGL 3QCUL 3WE1A 4CMMB 1NEZG 3SYCA 4LQFL 4AQ8C 2FYYB 4NHCH 3WGUB 3ZW3A 4PGBA 1BQHG 1W0YT 4FXLA 2V8LA 3L3IA 1ANUA 4LSQL 1ECYA 2FQGA 3EJJX 4LEOB 1SY6A 4F7TB 2ZG3A 5E9NA 2F5AL 2AJYL 4YFLI 1HHKA 3UBFA 3IE9A 4EBQH 3ZHKA 1WEJL 3WFHB 3IDMA 1L6XA 1OIOA 2NCEA 1PD1A 4KVPA 1ZVSA 5LGYA 4CBZA 1MCKA 4C83A 4LB8A 4NZJA 4FA7B 2AQ3A 3QUYC 5HYJB 3NG5A 2Z1KA 3CIQA 3CWGA 5CLZA 3RY5A 2BOCB 1Y0LA 2VZUA 3NJFA 5IBUB 5FF6A 1AH1A 3RUGE 1KJMB 1RMFH 1ZLEA 4R96B 2HKAA 3WYRA 2B2XH 3T5WA 1OO2A 1Z5LB 3Q6FA 4LPXA 3QQ9C 1EDHA 1R17A 3P4OA 4F9PC 5FYKE 3BAIA 4PJXE 2Y5QA 1T66C 3O8XC 2FLMA 5CP7A 3ELAT 1XZ0A 3A6OA 2V5MA 2CK0L 2GUOB 4HUXA 2YJQA 3VGGA 4AT6A 2YOAA 5C1MB 3QDJD 3SE8H 4NNXA 4MBOA 1RK0B 4WI3A 4WO4D 1W9XA 4Z7IA 2VLJE 2KC0A 3CLFL 3E8VA 4IKKA 4LVOB 3WLWD 2UZIL 4Q6YA 1SHSA 5C2BL 2J8HA 4LIQH 2BMKB 4LT7A 2YD1A 4TPRL 1IQDB 4LL9A 5BRZD 2EIZA 1XSKA 4H20H 3HVNA 7PCYA 3K1DA 3D2UD 1WAEA 4HJUA 3UTPE 1UB6B 2K8QA 5DD6B 1OP5K 1HX0A 1BVOA 2NUPB 2F15A 2GI0A 4GXVL 4ZS6C 5KYNA 4PVNA 1S9YB 4KC3B 3STLA 4YFEA 1F4XL 5D96B 4H2AA 3HI5H 2L7QA 3QG6B 3VWJC 1OCCB 2XWDA 2HT4D 3AREB 4HIEA 2G2RB 1MIML 3WFCL 4KUZH 3VMNA 1KFAH 2BZCA 4IOIB 1JDCA 4JO5A 5F3HA 1MJ7L 4O9HL 3P3UA 4DK6A 5E2UL 3OV6A 4AK2A 1WWWX 2UZYB 3OKMA 4EZLA 4HF5L 2P5EA 1EWHA 3D50A 4QRTB 4LRIC 5FV1L 3ZE2B 3QO1A 5J8OA 1SMOA 1UT1A 2WPGA 3OKYA 5IGXH 2VQ1B 1CD8A 3D4YA 3GI8L 1IV8A 2EXTA 1AXTL 2W38A 3UJTH 2VDMH 2ZF9A 5IVXB 1GGUA 4TOYH 4WI0A 1BGXL 3WHXA 4M8QA 5F9WB 3T3PE 5J9PB 1F4WL 1T1XB 4PB9L 4APQC 3BGAA 4NWTH 3ZRSA 5GPRA 3CN3A 4NJ9H 4L9LA 5C7XL 5CEZD 1BW8A 4XGZB 3FRPA 1JHKH 3LKQA 5I74C 5C0EA 1NGPH 1MFDL 5ADOH 4HC1L 1WWCA 3LNHA 3DECA 1IBDA 5A2KH 5KYYA 2LTQB 3WD5H 3QZOA 1BBJB 1QFPA 3REVB 3K8KA 5HHOB 3O45B 3QZWG 2Y2WA 3M86A 3UPRB 2R69L 5ANME 3BPCB 2WLMA 5CWSA 3STZA 2ZG1A 1PTZA 4YPJA 3A0OA 2VMDA 4LLAA 4Z0BH 3H7BB 1AYRA 3Q8AA 1SOQA 3QR2A 4L1LA 4ZMZA 1JDAA 4HIHA 1V3MA 5FECA 1U3YA 5D71L 4JFZH 1JXGA 5E6ID 4Q0XH 4L8BA 3VD0A 5KTEL 2XN0A 1GCFA 1W72L 5CS7A 4W81A 1JHTB 4KDVA 3B6SA 4TRPH 2F7IA 2H9GB 2AXWA 3UDWA 4DETA 4GG6A 2EECA 2ICEA 4OCWH 4OIFA 4X80L 3VACA 2QSTA 1C8PA 5EWIH 3OKLA 5G5DB 1EAPB 4N9GB 3D9AL 1HS6A 4NRZA 2VE6A 5HI5C 4XMZA 1QI3A 4HUMB 3BH8B 3QYCA 4DPBX 4PRNB 4H8QA 1MQKL 1O5PA 2BSTA 4MQ7B 4F33B 2AXGB 4M7KL 5FLVA 4IBYA 3PGFH 3S4SG 1XGQB 3E6HA 3PQYA 4OF7A 4FQ2L 3LOWA 1WVZA 2CMRH 5D7JC 1QEXA 3V4VA 4LSVH 4ZSOB 4WHDA 3CZFB 3QHTC 4XP4L 3KYNB 2DMBA 4Y2DB 4DKFL 5LCVH 2B4CL 1S7XA 4H4NA 1G9NL 2NY0D 3FFCD 3VFWB 3NCEB 3VRJB 5FOBB 2W9EH 1UXMA 2KLTA 2O5NA 5GSRA 3I9GH 5F6HI 4L23A 4DO6A 4JRXA 3QNZB 2Z7ZA 3FCTB 3FUJA 4KH9A 4DTGH 2NXYD 5IG7B 4AGLA 4QUOA 3NGBB 1S5HA 1MI5E 1N7ML 1A3QA 3CK0H 5CLYA 2GAZA 1WT5A 5C07B 2C5DC 2Y7LA 5DMJB 5T3ZL 2QPDB 2F58H 4RRPA 3TP4A 1X3DA 5I24A 1G9ML 3MLTA 4JQIA 4BCYA 4FP8H 4Z95H 1RQ5A 4JN1L 5TQ0H 4HSQA 2W8CA 3U7WL 5T1DH 2VDLL 4K7PY 4OI9A 4XP1L 4B6ZA 1SJXA 1UM4L 5JHDB 3MV7D 2ZXWB 5HGDB 1DBJH 3S48A 3DXAB 4WJKB 4MMZB 4FC3E 5F9DC 4N22A 4WJ5B 3ZKNC 2JTDA 1N4XH 3FT1A 2Y7QB 4YBQD 2K6ZA 4WQOA 3T09A 3WSQL 5I1GH 2JELH 3DLQR 3DO7B 4XRCA 4JFDD 2A9NL 1QSEA 1I9RH 2WWOA 1P5UC 3QQ4A 3V5KB 3GYRA 1DQLL 2PCFB 1HXMA 3AM8C 4LPVA 4EF3A 1NGWA 5JOPE 3U1SH 3C9NA 4XN8A 1N64L 5AWNL 4J4PC 3TO2A 3LNFA 4IKIA 4F5CE 4MA3B 2WXNA 3HW7A 5DUJA 2PO6D 2EILB 2JXMA 3IMWA 4MKTA 1L9MA 1WFTA 2FX9H 3S2AA 2AJ3A 1VFOA 4M93C 2Z35B 4LCCC 4OZGA 3T0EB 4L5FH 5HDBE 2VL5A 1PZAA 3U6RA 5IMMA 5CN3A 2QMKA 5EIVA 1M05A 3D85B 3S34L 3N55A 1SMAA 3IDNA 4YR6A 3UAAA 3TPKA 3KGRA 3GXTA 2XPYA 3OKEA 2Y1VA 3DMMC 3K6NA 4OFQA 2AJVH 4LLUA 4YHMH 2XN1A 3GMQB 2BP8A 1MNUH 2OMUB 4YSSA 4JFWA 1CI5A 3VXRB 2JKWA 5ENWA 1XF5A 2E9WA 2G0KA 1HXYB 2Z93A 4K94L 2N56A 4WW2F 4XN2A 3GSXA 3LQAL 3G5VB 4BZ2A 5DJ0B 3TF4A 4LLVB 1WZMA 2WBJC 1PZ5A 1CO1A 5IQ9A 1WTGT 1OTSC 2HFTA 2VL4A 3PU7A 4JR9H 1IGTB 4DEUA 3RTLA 4H7VA 1D5MA</