1N07A

Crystal structure of schizosaccharomyces pombe riboflavin kinase reveals a novel atp and riboflavin binding fold
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
154
structure length
154
Chain Sequence
RPEIVGPEKVQSPYPIRFEGKVVHGFGRGSKELGIPTANISEDAIQELLRYRDSGVYFGYAMVQKRVFPMVMSVGWNPYYKNKLRSAEVHLIERQGEDFYEEIMRVIVLGYIRPELNYAGLDKLIEDIHTDIRVALNSMDRPSYSSYKKDPFFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold
pubmed doi rcsb
molecule keywords PUTATIVE riboflavin kinase
molecule tags Transferase
source organism Schizosaccharomyces pombe
total genus 37
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2002-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1n07A00
2P3MA 2VBSA 2VBTA 1N05A 4UZFA 5FO0A 5A8AA 1N06A 2X0KA 1T6ZA 1N07A 1Q9SA 5TRDA 1MRZA 3OP1A 5FNZA 2VBVA 1S4MA 5A89A 1NB9A 1T6YA 5FO1A 3BNWA 4UZEA 2OYNA 3CTAA 1NB0A 5A88A 2VBUA 1P4MA 2I1LA 3ZUGA 1N08A 1T6XA
chains in the Genus database with same CATH superfamily
3QE2A 3I55B 2BGJA 3NE5B 4UZFA 3ONUA 4XKWA 1VQ7B 3QFCA 1BX1A 3ZZUA 1ZM2A 3A8JA 3CESA 1KK0A 3H94A 4RD4A 1D2EA 1VQ9B 5HZAA 3AGQA 1S4MA 2C2WA 1MABA 1NB9A 1KK3A 4KKSA 1WORA 1VF7A 4NCNA 5A89A 3OJXA 1PJ7A 4P12A 2BGIA 3OPOA 3T56B 2C5HA 1QFYA 1VQPB 2GJRA 3FKSA 4HIZA 3ONYA 4TSFA 1QFJA 3G4SB 3BH4A 1G7RA 3SJZA 4AF7A 5KW9A 1RQRA 3AVTA 4TMZA 1HA3A 1E79A 1WOPA 3OEHA 4RCZA 3ISXA 1I8DA 1QUFA 2OBSA 2VBTA 4K1XA 5L46A 2Z6BD 3OZUA 1NRKA 4B3FX 4LC0A 1E62A 2XGJA 1T6ZA 3LQ6A 2HLDA 3GSIA 5TRDA 4XNFA 4RD3A 5E6TA 3CP2A 5FNZA 4XORA 1V0FA 1FNBA 2R9VA 2CRVA 3OAAA 3CCSB 2Q6KA 4AC9A 4Y9RA 4C0SA 2XEXA 3CPXA 2QMUA 1YJ9B 3AGPA 1VQLB 1XB2A 2VYQA 2VNJA 3ZUGA 2YWEA 3ZC3A 1W35A 3G71B 2WJYA 1Q86D 4XONA 4AF6A 3OEEA 4DNRB 1N05A 2ZBVA 2X6WA 3J81k 4B4DA 5THXA 1EFUA 3VO1A 5HZBA 5LMZA 2CC2A 4B44A 1DDIA 2LZJA 4LBYA 1KRHA 3GVLA 4RCYA 4XKVA 3G6EB 2YWFA 3CC4B 2QN6A 4G6IA 2VBVA 4ZCLA 5F4JA 4ACBA 2E1BA 3CW2A 1K9MD 2BSAA 3WBKA 4KKUA 3OJWA 4ZGQB 4QUZA 4C43A 4XL9A 4PC3A 1QGZA 3H9NA 3WY9A 4L8JA 3HAGA 2WZNA 4XD7A 4DQLA 1EFCA 4LBZA 1S0UA 1OGIA 1GJRA 1WSRA 4AVZA 1GAQA 1QVFB 2GPJA 3GIRA 4YEJA 1QH0A 1T5EA 1KK1A 4QHYA 1BMFA 2OK8A 1SM4A 2V7XA 3ASQA 1W0JA 3QFTA 4II2A 5JBQA 1MRZA 4RDLA 1IB0A 4X7FA 1IJFA 2C77A 1F60A 4E0FA 2ZZQA 2PLFA 1BLIA 1QUEA 4M2LA 3P27A 4Z4ZA 4X05A 2QA4B 2XZOA 1UD8A 3OE7A 4PGOA 1OB2A 1GVHA 3Q38A 3CCRB 3A8IA 3WYAA 2DYIA 2GK6A 5KNLA 2DOGA 4Y7CA 4XLHA 2ZBUA 3JQPA 1OGJA 4TMTA 2D3NA 2QTLA 3Q39A 1EP1B 3CXCB 4XM3A 2BMWA 1E3ZA 3SJPA 3OP1A 2FX3A 3SEJA 4WZKA 2OBRA 1Q7YD 1FNMA 2OYNA 2V7TA 1Q81D 1VQOB 1H42A 2HMAA 2OK7A 4B3XA 3CMEB 1P4MA 3B8HA 4XLFA 1WP6A 3ZZTA 1CNEA 3PA2A 1YI2B 1EP2B 4X7EA 5GV7A 2QGGA 3ASRA 5DS0A 4OPOA 1UD5A 4UZUA 1I18A 2QE7A 2ZL5A 3W2FA 1E3XA 3ZBTA 3W2EA 1TLLA 5CDFA 4DK0A 3OOCA 3QFSA 1N07A 2DCUA 4QVAA 4YAOA 2GREA 2ZL6A 5J35A 1GO2A 3I1FA 2F43A 2JN9A 3CCQB 2ZZGA 1F20A 2YWHA 3W5VA 3MMPA 2VNIA 4XN0A 5FA6A 2GQFA 2XZPA 4B47A 1QVGB 4LBWA 3CTAA 2Q6OA 3JQQA 3CP8A 3ZZ0A 4M0LA 2J7KA 1Y0RA 2CBXA 1SKQA 4P6YA 1ZM3A 4P9SA 5H5JA 4TKOB 1EFRA 3CPWB 1DARA 2P3MA 3CB4A 4M4SA 4PC7A 4B43A 3G05A 3CCLB 3ZIAA 2ZZEA 4ZV4A 3RY8A 2CW5A 4ASUA 1XE1A 4PAAA 1NJID 4YAUA 4PABA 4X7CA 1WOSA 1ZM9A 2DY1A 3CCUB 1T6YA 3V7AA 1G7CA 4Z4YA 3LNNA 3ASPA 2VJIA 5HKKA 1VQ8B 4H9GA 2ZTGA 3BQJA 5F4OA 2BVNA 4FK8A 3ES9A 4DK1A 5A88A 3D26A 4Q7JB 4Z4UA 2XNDA 3CMAB 4QFMA 4YELA 1YITB 5IYRA 1Y0YA 1QGAA 3CCJB 1FRQA 2VBSA 1OHHA 2NV4A 3Q3AA 1B23P 1SKYB 3Q6QA 1GAWA 3V76A 1N06A 2GJPA 1Q82D 2OBTA 3R6KA 1WTHD 2BPOA 2D9RA 4HE5A 4YAFA 1FNDA 2WSSA 5BSXA 3QSYA 1W2BB 3ASSA 5DSZA 3WNBA 4XOPA 3LVBA 3AVUA 1UD6A 2XNCA 3FPKA 2D3LA 4RDKA 4X07A 4RJLA 5F4MA 3A1PA 3CC2B 2AHOA 2QTZA 3GQBA 4RD6A 1KMHA 4P3IA 2X6YA 4OP7A 2B5OA 2EFGA 2C4TA 2JIZA 4LBVA 1OB5A 4P2NA 3CCEB 2C78A 4TMWA 2JJ1A 1JNYA 4KKTA 4RDJA 4X06A 1BQEA 1ELOA 1JA1A 4WZTA 3WXMA 2VNKA 5TV2A 1KD1D 4TMVA 1HZEA 3PUNA 4IW3B 4NBSA 4QVJA 1NB0A 3SKBA 3BCFA 1YIJB 2CF4A 4ACAA 1EWYA 1XQBA 4YALA 4B48A 2ZZFA 4CQJA 1UD2A 4B3GA 3BC9A 4P3YA 4TN1A 1QX4A 4MYTA 4OOSA 2BN4A 4M1KA 2V7UA 3AVYA 4ZCIA 1BPLA 1H85A 1EP3B 4XMYA 3JU4A 2W6IA 3A3GA 4RD0A 5A8AA 3OW7A 2B7BA 2X0KA 1ZUNB 3FJOA 1VHOA 4X7DA 3WNCA 1WOOA 2HCJB 4XLEA 4PC6A 4WWVA 4G1BA 2C5BA 2XNJA 3W2GA 4OPVA 1M90D 1PJ6A 4XLAA 3WNDA 4N3NA 2GK7A 4MYUA 1E63A 4OOVA 2WJVA 2RC5A 1K8AD 2PMDA 2RC6A 1K73D 1VHEA 4QV2A 2JJ2A 1WSVA 1N8RD 2QEXB 1ZM4A 1W34A 4RD1A 1FNCA 3CD6B 2QDXA 5EMNA 3CCMB 2BV3A 1KC8D 1Q9SA 3A35A 4G5GA 4YXWA 1J9ZA 2VNHA 1UD3A 5IYWA 1PJ5A 4UZEA 1I7PA 3OFNA 4P1VA 4X0CA 1H8EA 3T51B 1HVXA 2C4UA 3CRZA 2I1LA 2ZL7A 3PUMA 3AVXA 1V5VA 1TUIA 3W5UA 3W2IA 3U6KA 4OPSA 4P26A 1W9XA 2X3UA 3DDYA 5B6IA 3OZWA 1QFZA 3LQEA 3Q6RA 1VQ6B 2JDIA 3VNUA 3KL9A 1OB0A 5IYNA 2M5SA 3ZPNA 1KZLA 1JB9A 1WDTA 1WU8A 3FPPA 2DERA 1YJWB 4WZEA 1TTTA 5H59A 4Z4TA 5FO1A 4RM0A 5HXBA 3WBJA 2CNDA 1AMOA 1YJNB 4FN5A 3OZVA 3R6JA 2X53S 2B7CA 3PENA 1G7TA 4II3A 2Q6IA 1W87A 4EH1A 1VJSA 4XN3A 3JQRA 5DN6A 4YHBA 1VLOA 2R6HA 2V4DA 4X8IA 3T53B 1W0KA 1EFTA 2X8KA 1VQNB 5KSWB 1VQ4B 4RLZA 3VR6A 4OOXA 4Z4RA 2FVGA 3I56B 3OKXA 4PC1A 1EXMA 5BSYA 1PKVA 3QFRA 1VLYA 4F7DA 4XR6A 5IK2A 5IYQA 1NDHA 1VQMB 2WYRA 3PA1A 5FIUA 5FL7A 2KVOA 2PIAA 2W6JA 1BJKA 4DQKA 1QGYA 4WQMA 1N08A 4HE6A 4Z4SA 1N0VC 2X6XA 4FXUA 1FX0A 2VZLA 4DNTB 5FO0A 1KTVA 1E64A 1JJ2B 4U9UA 1DDGA 1WPCA 2BF4A 5TY0A 3A8KA 4J0QA 3W2HA 2HDNB 2ZXIA 2WZPP 2NPFA 1E1QA 4Z4WA 1E43A 3CMMA 4FWTA 1XFOA 3SLNA 1KQSB 1UD4A 4P25A 3E1YE 1FRNA 2EIXA 1RQPA 4PC2A 4BPRA 4ZCMA 1CNFA 2CK3A 4G1VA 1QG0A 2YWGA 2VJJA 5GV8A 2GJKA 2BM0A 4M53A 1R5OA 3AVVA 1V0EA 3ASTA 4Z1MA 1JA0A 1UMKA 4P22A 1S72B 4XQFA 2ZITA 3OW2B 1H8HA 1IJEA 1D1NA 1YX2A 5J3OA 2V31A 4WZLA 2E1RA 2ZTNA 3U6BA 3BY1A 3GVKA 2PE3A 1YLOA 1KJZA 1CQXA 4GQNA 4G7WA 3KEWA 4UAJA 2OTLB 5TR9A 4N3GA 4RD2A 3VNVA 1DG1G 3GVJA 2DETA 3MHPA 3BY2A 4XOTA 3A3BA 1R5BA 3PVDA 2DIEA 1COWA 2D74A 3E20A 1NBMA 4Z4VA 2F1LA 4P6VF 2DEUA 2BM1A 4JMQA 2F4NA 4NNJA 2XZLA 1G7SA 1IHMA 1TVCA 3VO2A 3CCVB 3VMFA 3CC7B 5AN9A 2WR8A 1KK2A 4TT3A 4TMXA 3P26A 1AIPA 2X85A 3U2QA 3BCDA 3SLDA 4ZGNB 2V7QA 2V7WA 3LO8A 2Q6LA 4RPDA 5IYPA 1VQKB 1BX0A 1FDRA 2ZXHA 1D8TA 2OTJB 3B82A 3MCAA 4R71A 4G7XA 3AVWA 1E1RA 1GR1A 2XOKA 3W5HA 3BNWA 2WPDA 1YHQB 1M1KD 1R5NA 1K28D 2F1MA 4RPBA 3WQZA 4XLCA 1N0UA 1U2RA 3B78A 4Y9UA 2VBUA 3ZBUA 4YAWA 1VQ5B 2V7VA 4ROXA 1B2RA 1A8PA 1T6XA
chains in the Genus database with same CATH topology
2P3MA 2VBSA 2VBTA 1N05A 4UZFA 5FO0A 5A8AA 1N06A 2X0KA 1T6ZA 1N07A 1Q9SA 5TRDA 1MRZA 3OP1A 5FNZA 2VBVA 1S4MA 5A89A 1NB9A 1T6YA 5FO1A 3BNWA 4UZEA 2OYNA 3CTAA 1NB0A 5A88A 2VBUA 1P4MA 2I1LA 3ZUGA 1N08A 1T6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P3M A;  2VBS A;  2VBT A;  1N05 A;  4UZF A;  5FO0 A;  5A8A A;  1N06 A;  2X0K A;  1T6Z A;  1N07 A;  1Q9S A;  5TRD A;  1MRZ A;  3OP1 A;  5FNZ A;  2VBV A;  1S4M A;  5A89 A;  1NB9 A;  1T6Y A;  5FO1 A;  3BNW A;  4UZE A;  2OYN A;  3CTA A;  1NB0 A;  5A88 A;  2VBU A;  1P4M A;  2I1L A;  3ZUG A;  1N08 A;  1T6X A; 
#chains in the Genus database with same CATH topology
 3QE2 A;  3I55 B;  2BGJ A;  3NE5 B;  4UZF A;  3ONU A;  4XKW A;  1VQ7 B;  3QFC A;  1BX1 A;  3ZZU A;  1ZM2 A;  3A8J A;  3CES A;  1KK0 A;  3H94 A;  4RD4 A;  1D2E A;  1VQ9 B;  5HZA A;  3AGQ A;  1S4M A;  2C2W A;  1MAB A;  1NB9 A;  1KK3 A;  4KKS A;  1WOR A;  1VF7 A;  4NCN A;  5A89 A;  3OJX A;  1PJ7 A;  4P12 A;  2BGI A;  3OPO A;  3T56 B;  2C5H A;  1QFY A;  1VQP B;  2GJR A;  3FKS A;  4HIZ A;  3ONY A;  4TSF A;  1QFJ A;  3G4S B;  3BH4 A;  1G7R A;  3SJZ A;  4AF7 A;  5KW9 A;  1RQR A;  3AVT A;  4TMZ A;  1HA3 A;  1E79 A;  1WOP A;  3OEH A;  4RCZ A;  3ISX A;  1I8D A;  1QUF A;  2OBS A;  2VBT A;  4K1X A;  5L46 A;  2Z6B D;  3OZU A;  1NRK A;  4B3F X;  4LC0 A;  1E62 A;  2XGJ A;  1T6Z A;  3LQ6 A;  2HLD A;  3GSI A;  5TRD A;  4XNF A;  4RD3 A;  5E6T A;  3CP2 A;  5FNZ A;  4XOR A;  1V0F A;  1FNB A;  2R9V A;  2CRV A;  3OAA A;  3CCS B;  2Q6K A;  4AC9 A;  4Y9R A;  4C0S A;  2XEX A;  3CPX A;  2QMU A;  1YJ9 B;  3AGP A;  1VQL B;  1XB2 A;  2VYQ A;  2VNJ A;  3ZUG A;  2YWE A;  3ZC3 A;  1W35 A;  3G71 B;  2WJY A;  1Q86 D;  4XON A;  4AF6 A;  3OEE A;  4DNR B;  1N05 A;  2ZBV A;  2X6W A;  3J81 k;  4B4D A;  5THX A;  1EFU A;  3VO1 A;  5HZB A;  5LMZ A;  2CC2 A;  4B44 A;  1DDI A;  2LZJ A;  4LBY A;  1KRH A;  3GVL A;  4RCY A;  4XKV A;  3G6E B;  2YWF A;  3CC4 B;  2QN6 A;  4G6I A;  2VBV A;  4ZCL A;  5F4J A;  4ACB A;  2E1B A;  3CW2 A;  1K9M D;  2BSA A;  3WBK A;  4KKU A;  3OJW A;  4ZGQ B;  4QUZ A;  4C43 A;  4XL9 A;  4PC3 A;  1QGZ A;  3H9N A;  3WY9 A;  4L8J A;  3HAG A;  2WZN A;  4XD7 A;  4DQL A;  1EFC A;  4LBZ A;  1S0U A;  1OGI A;  1GJR A;  1WSR A;  4AVZ A;  1GAQ A;  1QVF B;  2GPJ A;  3GIR A;  4YEJ A;  1QH0 A;  1T5E A;  1KK1 A;  4QHY A;  1BMF A;  2OK8 A;  1SM4 A;  2V7X A;  3ASQ A;  1W0J A;  3QFT A;  4II2 A;  5JBQ A;  1MRZ A;  4RDL A;  1IB0 A;  4X7F A;  1IJF A;  2C77 A;  1F60 A;  4E0F A;  2ZZQ A;  2PLF A;  1BLI A;  1QUE A;  4M2L A;  3P27 A;  4Z4Z A;  4X05 A;  2QA4 B;  2XZO A;  1UD8 A;  3OE7 A;  4PGO A;  1OB2 A;  1GVH A;  3Q38 A;  3CCR B;  3A8I A;  3WYA A;  2DYI A;  2GK6 A;  5KNL A;  2DOG A;  4Y7C A;  4XLH A;  2ZBU A;  3JQP A;  1OGJ A;  4TMT A;  2D3N A;  2QTL A;  3Q39 A;  1EP1 B;  3CXC B;  4XM3 A;  2BMW A;  1E3Z A;  3SJP A;  3OP1 A;  2FX3 A;  3SEJ A;  4WZK A;  2OBR A;  1Q7Y D;  1FNM A;  2OYN A;  2V7T A;  1Q81 D;  1VQO B;  1H42 A;  2HMA A;  2OK7 A;  4B3X A;  3CME B;  1P4M A;  3B8H A;  4XLF A;  1WP6 A;  3ZZT A;  1CNE A;  3PA2 A;  1YI2 B;  1EP2 B;  4X7E A;  5GV7 A;  2QGG A;  3ASR A;  5DS0 A;  4OPO A;  1UD5 A;  4UZU A;  1I18 A;  2QE7 A;  2ZL5 A;  3W2F A;  1E3X A;  3ZBT A;  3W2E A;  1TLL A;  5CDF A;  4DK0 A;  3OOC A;  3QFS A;  1N07 A;  2DCU A;  4QVA A;  4YAO A;  2GRE A;  2ZL6 A;  5J35 A;  1GO2 A;  3I1F A;  2F43 A;  2JN9 A;  3CCQ B;  2ZZG A;  1F20 A;  2YWH A;  3W5V A;  3MMP A;  2VNI A;  4XN0 A;  5FA6 A;  2GQF A;  2XZP A;  4B47 A;  1QVG B;  4LBW A;  3CTA A;  2Q6O A;  3JQQ A;  3CP8 A;  3ZZ0 A;  4M0L A;  2J7K A;  1Y0R A;  2CBX A;  1SKQ A;  4P6Y A;  1ZM3 A;  4P9S A;  5H5J A;  4TKO B;  1EFR A;  3CPW B;  1DAR A;  2P3M A;  3CB4 A;  4M4S A;  4PC7 A;  4B43 A;  3G05 A;  3CCL B;  3ZIA A;  2ZZE A;  4ZV4 A;  3RY8 A;  2CW5 A;  4ASU A;  1XE1 A;  4PAA A;  1NJI D;  4YAU A;  4PAB A;  4X7C A;  1WOS A;  1ZM9 A;  2DY1 A;  3CCU B;  1T6Y A;  3V7A A;  1G7C A;  4Z4Y A;  3LNN A;  3ASP A;  2VJI A;  5HKK A;  1VQ8 B;  4H9G A;  2ZTG A;  3BQJ A;  5F4O A;  2BVN A;  4FK8 A;  3ES9 A;  4DK1 A;  5A88 A;  3D26 A;  4Q7J B;  4Z4U A;  2XND A;  3CMA B;  4QFM A;  4YEL A;  1YIT B;  5IYR A;  1Y0Y A;  1QGA A;  3CCJ B;  1FRQ A;  2VBS A;  1OHH A;  2NV4 A;  3Q3A A;  1B23 P;  1SKY B;  3Q6Q A;  1GAW A;  3V76 A;  1N06 A;  2GJP A;  1Q82 D;  2OBT A;  3R6K A;  1WTH D;  2BPO A;  2D9R A;  4HE5 A;  4YAF A;  1FND A;  2WSS A;  5BSX A;  3QSY A;  1W2B B;  3ASS A;  5DSZ A;  3WNB A;  4XOP A;  3LVB A;  3AVU A;  1UD6 A;  2XNC A;  3FPK A;  2D3L A;  4RDK A;  4X07 A;  4RJL A;  5F4M A;  3A1P A;  3CC2 B;  2AHO A;  2QTZ A;  3GQB A;  4RD6 A;  1KMH A;  4P3I A;  2X6Y A;  4OP7 A;  2B5O A;  2EFG A;  2C4T A;  2JIZ A;  4LBV A;  1OB5 A;  4P2N A;  3CCE B;  2C78 A;  4TMW A;  2JJ1 A;  1JNY A;  4KKT A;  4RDJ A;  4X06 A;  1BQE A;  1ELO A;  1JA1 A;  4WZT A;  3WXM A;  2VNK A;  5TV2 A;  1KD1 D;  4TMV A;  1HZE A;  3PUN A;  4IW3 B;  4NBS A;  4QVJ A;  1NB0 A;  3SKB A;  3BCF A;  1YIJ B;  2CF4 A;  4ACA A;  1EWY A;  1XQB A;  4YAL A;  4B48 A;  2ZZF A;  4CQJ A;  1UD2 A;  4B3G A;  3BC9 A;  4P3Y A;  4TN1 A;  1QX4 A;  4MYT A;  4OOS A;  2BN4 A;  4M1K A;  2V7U A;  3AVY A;  4ZCI A;  1BPL A;  1H85 A;  1EP3 B;  4XMY A;  3JU4 A;  2W6I A;  3A3G A;  4RD0 A;  5A8A A;  3OW7 A;  2B7B A;  2X0K A;  1ZUN B;  3FJO A;  1VHO A;  4X7D A;  3WNC A;  1WOO A;  2HCJ B;  4XLE A;  4PC6 A;  4WWV A;  4G1B A;  2C5B A;  2XNJ A;  3W2G A;  4OPV A;  1M90 D;  1PJ6 A;  4XLA A;  3WND A;  4N3N A;  2GK7 A;  4MYU A;  1E63 A;  4OOV A;  2WJV A;  2RC5 A;  1K8A D;  2PMD A;  2RC6 A;  1K73 D;  1VHE A;  4QV2 A;  2JJ2 A;  1WSV A;  1N8R D;  2QEX B;  1ZM4 A;  1W34 A;  4RD1 A;  1FNC A;  3CD6 B;  2QDX A;  5EMN A;  3CCM B;  2BV3 A;  1KC8 D;  1Q9S A;  3A35 A;  4G5G A;  4YXW A;  1J9Z A;  2VNH A;  1UD3 A;  5IYW A;  1PJ5 A;  4UZE A;  1I7P A;  3OFN A;  4P1V A;  4X0C A;  1H8E A;  3T51 B;  1HVX A;  2C4U A;  3CRZ A;  2I1L A;  2ZL7 A;  3PUM A;  3AVX A;  1V5V A;  1TUI A;  3W5U A;  3W2I A;  3U6K A;  4OPS A;  4P26 A;  1W9X A;  2X3U A;  3DDY A;  5B6I A;  3OZW A;  1QFZ A;  3LQE A;  3Q6R A;  1VQ6 B;  2JDI A;  3VNU A;  3KL9 A;  1OB0 A;  5IYN A;  2M5S A;  3ZPN A;  1KZL A;  1JB9 A;  1WDT A;  1WU8 A;  3FPP A;  2DER A;  1YJW B;  4WZE A;  1TTT A;  5H59 A;  4Z4T A;  5FO1 A;  4RM0 A;  5HXB A;  3WBJ A;  2CND A;  1AMO A;  1YJN B;  4FN5 A;  3OZV A;  3R6J A;  2X53 S;  2B7C A;  3PEN A;  1G7T A;  4II3 A;  2Q6I A;  1W87 A;  4EH1 A;  1VJS A;  4XN3 A;  3JQR A;  5DN6 A;  4YHB A;  1VLO A;  2R6H A;  2V4D A;  4X8I A;  3T53 B;  1W0K A;  1EFT A;  2X8K A;  1VQN B;  5KSW B;  1VQ4 B;  4RLZ A;  3VR6 A;  4OOX A;  4Z4R A;  2FVG A;  3I56 B;  3OKX A;  4PC1 A;  1EXM A;  5BSY A;  1PKV A;  3QFR A;  1VLY A;  4F7D A;  4XR6 A;  5IK2 A;  5IYQ A;  1NDH A;  1VQM B;  2WYR A;  3PA1 A;  5FIU A;  5FL7 A;  2KVO A;  2PIA A;  2W6J A;  1BJK A;  4DQK A;  1QGY A;  4WQM A;  1N08 A;  4HE6 A;  4Z4S A;  1N0V C;  2X6X A;  4FXU A;  1FX0 A;  2VZL A;  4DNT B;  5FO0 A;  1KTV A;  1E64 A;  1JJ2 B;  4U9U A;  1DDG A;  1WPC A;  2BF4 A;  5TY0 A;  3A8K A;  4J0Q A;  3W2H A;  2HDN B;  2ZXI A;  2WZP P;  2NPF A;  1E1Q A;  4Z4W A;  1E43 A;  3CMM A;  4FWT A;  1XFO A;  3SLN A;  1KQS B;  1UD4 A;  4P25 A;  3E1Y E;  1FRN A;  2EIX A;  1RQP A;  4PC2 A;  4BPR A;  4ZCM A;  1CNF A;  2CK3 A;  4G1V A;  1QG0 A;  2YWG A;  2VJJ A;  5GV8 A;  2GJK A;  2BM0 A;  4M53 A;  1R5O A;  3AVV A;  1V0E A;  3AST A;  4Z1M A;  1JA0 A;  1UMK A;  4P22 A;  1S72 B;  4XQF A;  2ZIT A;  3OW2 B;  1H8H A;  1IJE A;  1D1N A;  1YX2 A;  5J3O A;  2V31 A;  4WZL A;  2E1R A;  2ZTN A;  3U6B A;  3BY1 A;  3GVK A;  2PE3 A;  1YLO A;  1KJZ A;  1CQX A;  4GQN A;  4G7W A;  3KEW A;  4UAJ A;  2OTL B;  5TR9 A;  4N3G A;  4RD2 A;  3VNV A;  1DG1 G;  3GVJ A;  2DET A;  3MHP A;  3BY2 A;  4XOT A;  3A3B A;  1R5B A;  3PVD A;  2DIE A;  1COW A;  2D74 A;  3E20 A;  1NBM A;  4Z4V A;  2F1L A;  4P6V F;  2DEU A;  2BM1 A;  4JMQ A;  2F4N A;  4NNJ A;  2XZL A;  1G7S A;  1IHM A;  1TVC A;  3VO2 A;  3CCV B;  3VMF A;  3CC7 B;  5AN9 A;  2WR8 A;  1KK2 A;  4TT3 A;  4TMX A;  3P26 A;  1AIP A;  2X85 A;  3U2Q A;  3BCD A;  3SLD A;  4ZGN B;  2V7Q A;  2V7W A;  3LO8 A;  2Q6L A;  4RPD A;  5IYP A;  1VQK B;  1BX0 A;  1FDR A;  2ZXH A;  1D8T A;  2OTJ B;  3B82 A;  3MCA A;  4R71 A;  4G7X A;  3AVW A;  1E1R A;  1GR1 A;  2XOK A;  3W5H A;  3BNW A;  2WPD A;  1YHQ B;  1M1K D;  1R5N A;  1K28 D;  2F1M A;  4RPB A;  3WQZ A;  4XLC A;  1N0U A;  1U2R A;  3B78 A;  4Y9U A;  2VBU A;  3ZBU A;  4YAW A;  1VQ5 B;  2V7V A;  4ROX A;  1B2R A;  1A8P A;  1T6X A; 
#chains in the Genus database with same CATH homology
 2P3M A;  2VBS A;  2VBT A;  1N05 A;  4UZF A;  5FO0 A;  5A8A A;  1N06 A;  2X0K A;  1T6Z A;  1N07 A;  1Q9S A;  5TRD A;  1MRZ A;  3OP1 A;  5FNZ A;  2VBV A;  1S4M A;  5A89 A;  1NB9 A;  1T6Y A;  5FO1 A;  3BNW A;  4UZE A;  2OYN A;  3CTA A;  1NB0 A;  5A88 A;  2VBU A;  1P4M A;  2I1L A;  3ZUG A;  1N08 A;  1T6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...