1N07A

Crystal structure of schizosaccharomyces pombe riboflavin kinase reveals a novel atp and riboflavin binding fold
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
154
structure length
154
Chain Sequence
RPEIVGPEKVQSPYPIRFEGKVVHGFGRGSKELGIPTANISEDAIQELLRYRDSGVYFGYAMVQKRVFPMVMSVGWNPYYKNKLRSAEVHLIERQGEDFYEEIMRVIVLGYIRPELNYAGLDKLIEDIHTDIRVALNSMDRPSYSSYKKDPFFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE riboflavin kinase
publication title Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 37
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2002-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1n07A00
1NB0A 2VBTA 5A88A 3OP1A 2VBSA 1MRZA 2I1LA 5A8AA 3ZUGA 1Q9SA 5TRDA 1NB9A 1T6ZA 1N05A 3BNWA 2OYNA 2VBUA 4UZEA 2VBVA 4UZFA 3CTAA 1N06A 2P3MA 5FO1A 5FNZA 1T6XA 2X0KA 1T6YA 1S4MA 1P4MA 1N07A 1N08A 5A89A 5FO0A
chains in the Genus database with same CATH superfamily
1KK0A 1BX1A 2ZZFA 1OGJA 3W2HA 4U9UA 4ZGQB 2D3LA 1D1NA 4XN0A 4WQMA 2ZXIA 1W2BB 1PJ6A 3CCJB 1IB0A 1YX2A 2QDXA 3SJPA 4TN1A 1WU8A 1OB0A 1UMKA 3B78A 4PC3A 1VJSA 3PUMA 4M0LA 3AGQA 3FKSA 1EFRA 3PA2A 3NE5B 4MYUA 4LBZA 2X0KA 2LZJA 4GQNA 5FIUA 2DERA 3ZPNA 2FVGA 3GSIA 1S72B 3I56B 4ROXA 1UD6A 4TMZA 2JN9A 1Q7YD 3D26A 3ONYA 3P26A 1GAQA 3U2QA 1KQSB 4X07A 4N3NA 2QMUA 4M4SA 4Z4WA 1K9MD 1TVCA 1JNYA 5H5JA 4TSFA 4JMQA 5THXA 1KC8D 1I18A 3ONUA 3A35A 2BF4A 3ZBUA 3Q39A 4Z4RA 4NBSA 4YAOA 2OBSA 1FNBA 2BGJA 1ZM9A 4G1VA 4LBWA 2ZBUA 2GJKA 4ZCLA 1QX4A 2BVNA 4XKVA 4LBVA 1QGAA 3H9NA 5HZBA 4AF6A 1M90D 1KMHA 1XE1A 5A8AA 1EFCA 1QFYA 4EH1A 3WYAA 2JDIA 2Q6OA 4P3IA 1CNEA 3A1PA 1GO2A 4PC6A 2QTLA 3BNWA 3AVYA 1QGYA 4XMYA 3OAAA 3CMMA 4UAJA 2P3MA 1VQKB 3CCUB 2ZBVA 4OPOA 4ZCMA 4C0SA 2J7KA 1N0UA 4TMWA 3CP2A 5IYNA 1DDGA 5DN6A 4XORA 3CCRB 2BPOA 1YJWB 2X6XA 4G1BA 2GK6A 3WNDA 2BV3A 3OJXA 1K28D 3CRZA 1K73D 5A88A 4P2NA 3AVWA 1KRHA 2X3UA 4DK0A 1EFUA 4RD2A 3CCMB 2XEXA 2WJYA 1D8TA 4XLEA 1V0FA 3W2FA 4PGOA 1SKYB 2CW5A 3ZBTA 1YLOA 3LQ6A 3G71B 1I8DA 2DYIA 4RDKA 3MCAA 3W2IA 1JA0A 1G7CA 3I1FA 4QUZA 4RD1A 4ZV4A 1KK3A 3G6EB 1WOOA 1BJKA 3PVDA 4RCZA 3WXMA 4WZKA 1N8RD 3PA1A 4XR6A 1VQ9B 2QEXB 5JBQA 4Z4ZA 3JQPA 1WSRA 1XQBA 4UZUA 2B7CA 2NPFA 4RDLA 1E43A 3ISXA 1JA1A 2XNDA 3FPPA 4Y9UA 5FL7A 3WY9A 4B3FX 1ZM2A 1Q9SA 1VHOA 4RCYA 1NDHA 2M5SA 2C77A 2RC6A 1Y0YA 1J9ZA 2JJ1A 2C5BA 1N0VC 3QFSA 1N05A 1XFOA 5H59A 3CD6B 2OBTA 2VNHA 1NRKA 2D74A 4XN3A 3G4SB 5HXBA 1E64A 1VQ5B 1HA3A 5IYWA 1B2RA 1YITB 3VR6A 2FX3A 1WP6A 2WYRA 2BMWA 1T5EA 1U2RA 4P22A 1NJID 3E20A 4YHBA 2X6YA 3CCEB 3WNCA 3CW2A 2F4NA 3JQQA 3OJWA 3OPOA 4FN5A 4QFMA 2V31A 2JIZA 4YEJA 3V76A 2GQFA 1W9XA 1WORA 5A89A 4P6YA 4ASUA 1TTTA 4XD7A 1IJEA 4YAFA 1E62A 3OP1A 5TR9A 2WR8A 3U6BA 2XGJA 1UD2A 2WSSA 4TMVA 1KK2A 3W5VA 3T56B 2F1MA 4G5GA 1SM4A 3QFCA 5F4JA 4M53A 4QVAA 3GVJA 3AVXA 2EIXA 4PABA 2WZNA 1E79A 4RD0A 2PMDA 1QVGB 3JQRA 5TV2A 2Q6LA 1S0UA 1M1KD 2V7XA 3CXCB 1VQMB 1AIPA 1Y0RA 3BY1A 3QFRA 3CC2B 1QFJA 2VYQA 1WSVA 2WZPP 3SLDA 1VQOB 2DOGA 2HMAA 1HVXA 2BGIA 2V7QA 3R6KA 4NNJA 4XLAA 4ACAA 1AMOA 2XZOA 1OB5A 4FK8A 2GJRA 4P1VA 1NB9A 1PKVA 3SJZA 1F20A 1QGZA 1H42A 1IHMA 2OYNA 2VBVA 2CK3A 1UD5A 2DEUA 5BSYA 2VZLA 5IYRA 2V7TA 4WWVA 1WOPA 3H94A 2HCJB 3CMEB 4OPSA 4X0CA 1N07A 1W0JA 2JJ2A 4YAWA 4L8JA 2YWEA 1W87A 1Q81D 4KKTA 4LC0A 5DSZA 5KNLA 1GR1A 4RDJA 4Y9RA 1BPLA 2VBSA 4TMXA 4X06A 2YWGA 1BLIA 1PJ7A 2PIAA 4OOSA 4RLZA 3ZUGA 2E1RA 2VJJA 3CP8A 3CCVB 4DK1A 1G7RA 3AVUA 1YIJB 1VQPB 1BQEA 1Q82D 3Q38A 4P26A 4KKSA 3W5HA 2V4DA 4R71A 2XNJA 2ZL7A 5FNZA 3CMAB 1KZLA 4AF7A 2D9RA 4LBYA 5B6IA 4QHYA 1QUEA 1OHHA 2BM1A 1G7TA 1YHQB 1DDIA 1NB0A 2R6HA 5GV7A 3RY8A 3OZVA 3SKBA 1K8AD 1YJNB 1VHEA 4RM0A 2B7BA 2OTLB 2YWFA 2ZZGA 2C4TA 2BN4A 2GREA 5GV8A 3VO1A 4DNRB 2Z6BD 4RD3A 3QE2A 3MHPA 3BQJA 1T6ZA 4Z4YA 3GIRA 4J0QA 2F43A 1FX0A 4OOXA 3P27A 2QTZA 2Q6KA 1NBMA 1R5OA 4RPDA 4P25A 2GK7A 5DS0A 1COWA 4DQLA 1EP2B 1EXMA 4MYTA 1Q86D 3BH4A 3OE7A 5HKKA 4OP7A 4XONA 1VLOA 3T51B 2HDNB 3JU4A 4X05A 3BY2A 1BMFA 1FRQA 4HE5A 3ZZTA 1E3XA 3LO8A 3A8KA 3Q6RA 1QVFB 4YAUA 3OW2B 2R9VA 1V5VA 2OBRA 2W6JA 4RD6A 3W2GA 3WNBA 4XOTA 2VNKA 4NCNA 2V7UA 4TMTA 5F4OA 4ACBA 3WQZA 1EWYA 3VNVA 1FRNA 1E1RA 5FO1A 2YWHA 4G6IA 4QVJA 1H8HA 4WZLA 1RQPA 1VF7A 4X7CA 1N08A 4RPBA 4X8IA 1KK1A 4XLCA 2BSAA 3W5UA 2WPDA 2ZZEA 1IJFA 2ZZQA 1WTHD 2QE7A 1VQNB 3W2EA 5KW9A 1EFTA 2HLDA 3B82A 5TRDA 4M2LA 4OPVA 4AVZA 3QSYA 5IYPA 3DDYA 3VNUA 3A3BA 3ASSA 1QH0A 1FNCA 1XB2A 2VNIA 4P12A 2DETA 3FPKA 2QN6A 1N06A 3BCDA 4P3YA 1I7PA 1WOSA 2CF4A 2VNJA 3CC7B 2AHOA 3OKXA 4OOVA 4PC7A 1VQ6B 2W6IA 1QFZA 4X7FA 1W34A 3GQBA 5KSWB 3CCLB 3Q3AA 2DCUA 2EFGA 4X7EA 2QA4B 4B44A 1E3ZA 1MABA 4II3A 1MRZA 4DQKA 4WZEA 4XLHA 4B3GA 5L46A 1ZUNB 4FWTA 1FNDA 4HIZA 5FA6A 3ZZ0A 3U6KA 2V7VA 3CB4A 2NV4A 4KKUA 2ZITA 3AVVA 3LVBA 3Q6QA 4K1XA 1UD4A 4II2A 2Q6IA 2ZL5A 3CTAA 3OFNA 4B3XA 1YI2B 1VQ8B 1KJZA 1EP1B 4TKOB 2VJIA 5TY0A 3OOCA 1T6XA 3ZC3A 4B47A 2GPJA 1TUIA 4G7XA 3KEWA 1FDRA 2CBXA 3LQEA 5LMZA 1DARA 3A8JA 3VMFA 2KVOA 4G7WA 4XKWA 4YELA 1OB2A 1OGIA 1GVHA 2C2WA 2DY1A 3ASRA 1TLLA 3BCFA 1F60A 4C43A 2CC2A 3ZZUA 1E63A 1PJ5A 1RQRA 4RJLA 4Z4TA 4ZCIA 1R5NA 5IK2A 3T53B 4PC2A 2PLFA 3OZWA 3WBKA 3GVKA 4B4DA 2X8KA 2X6WA 3AVTA 1FNMA 1CQXA 1QG0A 1ZM3A 4B48A 1D2EA 2RC5A 3OW7A 1EP3B 3ZIAA 3ASTA 1P4MA 1VQ4B 1HZEA 3BC9A 3HAGA 3OEEA 3PENA 4Q7JB 1G7SA 1UD8A 1E1QA 1QUFA 3PUNA 4B43A 1JJ2B 3A3GA 2WJVA 3CCSB 1VLYA 3AGPA 4QV2A 2CRVA 4FXUA 2XNCA 1WPCA 4IW3B 2C5HA 5F4MA 3OEHA 2PE3A 2X53S 1SKQA 3G05A 3SEJA 2D3NA 1CNFA 2VBUA 3WBJA 4Z1MA 2X85A 1DG1G 2C4UA 4Z4SA 1V0EA 4Y7CA 2BM0A 3CESA 1GJRA 1T6YA 1S4MA 1W0KA 3V7AA 3GVLA 4PC1A 5J3OA 1KD1D 2OK7A 3J81k 5FO0A 2XZLA 4HE6A 1W35A 2CNDA 3E1YE 5IYQA 2VBTA 5AN9A 2XOKA 3ES9A 1ZM4A 1KTVA 2E1BA 4E0FA 2I1LA 3KL9A 4P6VF 4CQJA 4XLFA 1H85A 2V7WA 4X7DA 1WDTA 3ASPA 3CCQB 2GJPA 2B5OA 4DNTB 3LNNA 5J35A 1A8PA 4YXWA 3MMPA 4UZEA 2OK8A 5CDFA 3SLNA 2ZXHA 1R5BA 4XNFA 5BSXA 4WZTA 3B8HA 2C78A 4N3GA 4Z4UA 4F7DA 1ELOA 1H8EA 3R6JA 4XL9A 3ASQA 1VQLB 4M1KA 4BPRA 2ZTNA 2XZPA 4XOPA 1B23P 1BX0A 2ZL6A 3CPWB 3CPXA 5E6TA 3VO2A 2QGGA 4TT3A 3QFTA 1VQ7B 4AC9A 4P9SA 3A8IA 4RD4A 2DIEA 4XQFA 4H9GA 4ZGNB 3OZUA 4UZFA 3I55B 4PAAA 2ZTGA 3FJOA 4Z4VA 1JB9A 3CC4B 2F1LA 5HZAA 5EMNA 1UD3A 4YALA 4XM3A 1YJ9B 1GAWA 2OTJB
chains in the Genus database with same CATH topology
1NB0A 2VBTA 5A88A 3OP1A 2VBSA 1MRZA 2I1LA 5A8AA 3ZUGA 1Q9SA 5TRDA 1NB9A 1T6ZA 1N05A 3BNWA 2OYNA 2VBUA 4UZEA 2VBVA 4UZFA 3CTAA 1N06A 2P3MA 5FO1A 5FNZA 1T6XA 2X0KA 1T6YA 1S4MA 1P4MA 1N07A 1N08A 5A89A 5FO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NB0 A;  2VBT A;  5A88 A;  3OP1 A;  2VBS A;  1MRZ A;  2I1L A;  5A8A A;  3ZUG A;  1Q9S A;  5TRD A;  1NB9 A;  1T6Z A;  1N05 A;  3BNW A;  2OYN A;  2VBU A;  4UZE A;  2VBV A;  4UZF A;  3CTA A;  1N06 A;  2P3M A;  5FO1 A;  5FNZ A;  1T6X A;  2X0K A;  1T6Y A;  1S4M A;  1P4M A;  1N07 A;  1N08 A;  5A89 A;  5FO0 A; 
#chains in the Genus database with same CATH topology
 1KK0 A;  1BX1 A;  2ZZF A;  1OGJ A;  3W2H A;  4U9U A;  4ZGQ B;  2D3L A;  1D1N A;  4XN0 A;  4WQM A;  2ZXI A;  1W2B B;  1PJ6 A;  3CCJ B;  1IB0 A;  1YX2 A;  2QDX A;  3SJP A;  4TN1 A;  1WU8 A;  1OB0 A;  1UMK A;  3B78 A;  4PC3 A;  1VJS A;  3PUM A;  4M0L A;  3AGQ A;  3FKS A;  1EFR A;  3PA2 A;  3NE5 B;  4MYU A;  4LBZ A;  2X0K A;  2LZJ A;  4GQN A;  5FIU A;  2DER A;  3ZPN A;  2FVG A;  3GSI A;  1S72 B;  3I56 B;  4ROX A;  1UD6 A;  4TMZ A;  2JN9 A;  1Q7Y D;  3D26 A;  3ONY A;  3P26 A;  1GAQ A;  3U2Q A;  1KQS B;  4X07 A;  4N3N A;  2QMU A;  4M4S A;  4Z4W A;  1K9M D;  1TVC A;  1JNY A;  5H5J A;  4TSF A;  4JMQ A;  5THX A;  1KC8 D;  1I18 A;  3ONU A;  3A35 A;  2BF4 A;  3ZBU A;  3Q39 A;  4Z4R A;  4NBS A;  4YAO A;  2OBS A;  1FNB A;  2BGJ A;  1ZM9 A;  4G1V A;  4LBW A;  2ZBU A;  2GJK A;  4ZCL A;  1QX4 A;  2BVN A;  4XKV A;  4LBV A;  1QGA A;  3H9N A;  5HZB A;  4AF6 A;  1M90 D;  1KMH A;  1XE1 A;  5A8A A;  1EFC A;  1QFY A;  4EH1 A;  3WYA A;  2JDI A;  2Q6O A;  4P3I A;  1CNE A;  3A1P A;  1GO2 A;  4PC6 A;  2QTL A;  3BNW A;  3AVY A;  1QGY A;  4XMY A;  3OAA A;  3CMM A;  4UAJ A;  2P3M A;  1VQK B;  3CCU B;  2ZBV A;  4OPO A;  4ZCM A;  4C0S A;  2J7K A;  1N0U A;  4TMW A;  3CP2 A;  5IYN A;  1DDG A;  5DN6 A;  4XOR A;  3CCR B;  2BPO A;  1YJW B;  2X6X A;  4G1B A;  2GK6 A;  3WND A;  2BV3 A;  3OJX A;  1K28 D;  3CRZ A;  1K73 D;  5A88 A;  4P2N A;  3AVW A;  1KRH A;  2X3U A;  4DK0 A;  1EFU A;  4RD2 A;  3CCM B;  2XEX A;  2WJY A;  1D8T A;  4XLE A;  1V0F A;  3W2F A;  4PGO A;  1SKY B;  2CW5 A;  3ZBT A;  1YLO A;  3LQ6 A;  3G71 B;  1I8D A;  2DYI A;  4RDK A;  3MCA A;  3W2I A;  1JA0 A;  1G7C A;  3I1F A;  4QUZ A;  4RD1 A;  4ZV4 A;  1KK3 A;  3G6E B;  1WOO A;  1BJK A;  3PVD A;  4RCZ A;  3WXM A;  4WZK A;  1N8R D;  3PA1 A;  4XR6 A;  1VQ9 B;  2QEX B;  5JBQ A;  4Z4Z A;  3JQP A;  1WSR A;  1XQB A;  4UZU A;  2B7C A;  2NPF A;  4RDL A;  1E43 A;  3ISX A;  1JA1 A;  2XND A;  3FPP A;  4Y9U A;  5FL7 A;  3WY9 A;  4B3F X;  1ZM2 A;  1Q9S A;  1VHO A;  4RCY A;  1NDH A;  2M5S A;  2C77 A;  2RC6 A;  1Y0Y A;  1J9Z A;  2JJ1 A;  2C5B A;  1N0V C;  3QFS A;  1N05 A;  1XFO A;  5H59 A;  3CD6 B;  2OBT A;  2VNH A;  1NRK A;  2D74 A;  4XN3 A;  3G4S B;  5HXB A;  1E64 A;  1VQ5 B;  1HA3 A;  5IYW A;  1B2R A;  1YIT B;  3VR6 A;  2FX3 A;  1WP6 A;  2WYR A;  2BMW A;  1T5E A;  1U2R A;  4P22 A;  1NJI D;  3E20 A;  4YHB A;  2X6Y A;  3CCE B;  3WNC A;  3CW2 A;  2F4N A;  3JQQ A;  3OJW A;  3OPO A;  4FN5 A;  4QFM A;  2V31 A;  2JIZ A;  4YEJ A;  3V76 A;  2GQF A;  1W9X A;  1WOR A;  5A89 A;  4P6Y A;  4ASU A;  1TTT A;  4XD7 A;  1IJE A;  4YAF A;  1E62 A;  3OP1 A;  5TR9 A;  2WR8 A;  3U6B A;  2XGJ A;  1UD2 A;  2WSS A;  4TMV A;  1KK2 A;  3W5V A;  3T56 B;  2F1M A;  4G5G A;  1SM4 A;  3QFC A;  5F4J A;  4M53 A;  4QVA A;  3GVJ A;  3AVX A;  2EIX A;  4PAB A;  2WZN A;  1E79 A;  4RD0 A;  2PMD A;  1QVG B;  3JQR A;  5TV2 A;  2Q6L A;  1S0U A;  1M1K D;  2V7X A;  3CXC B;  1VQM B;  1AIP A;  1Y0R A;  3BY1 A;  3QFR A;  3CC2 B;  1QFJ A;  2VYQ A;  1WSV A;  2WZP P;  3SLD A;  1VQO B;  2DOG A;  2HMA A;  1HVX A;  2BGI A;  2V7Q A;  3R6K A;  4NNJ A;  4XLA A;  4ACA A;  1AMO A;  2XZO A;  1OB5 A;  4FK8 A;  2GJR A;  4P1V A;  1NB9 A;  1PKV A;  3SJZ A;  1F20 A;  1QGZ A;  1H42 A;  1IHM A;  2OYN A;  2VBV A;  2CK3 A;  1UD5 A;  2DEU A;  5BSY A;  2VZL A;  5IYR A;  2V7T A;  4WWV A;  1WOP A;  3H94 A;  2HCJ B;  3CME B;  4OPS A;  4X0C A;  1N07 A;  1W0J A;  2JJ2 A;  4YAW A;  4L8J A;  2YWE A;  1W87 A;  1Q81 D;  4KKT A;  4LC0 A;  5DSZ A;  5KNL A;  1GR1 A;  4RDJ A;  4Y9R A;  1BPL A;  2VBS A;  4TMX A;  4X06 A;  2YWG A;  1BLI A;  1PJ7 A;  2PIA A;  4OOS A;  4RLZ A;  3ZUG A;  2E1R A;  2VJJ A;  3CP8 A;  3CCV B;  4DK1 A;  1G7R A;  3AVU A;  1YIJ B;  1VQP B;  1BQE A;  1Q82 D;  3Q38 A;  4P26 A;  4KKS A;  3W5H A;  2V4D A;  4R71 A;  2XNJ A;  2ZL7 A;  5FNZ A;  3CMA B;  1KZL A;  4AF7 A;  2D9R A;  4LBY A;  5B6I A;  4QHY A;  1QUE A;  1OHH A;  2BM1 A;  1G7T A;  1YHQ B;  1DDI A;  1NB0 A;  2R6H A;  5GV7 A;  3RY8 A;  3OZV A;  3SKB A;  1K8A D;  1YJN B;  1VHE A;  4RM0 A;  2B7B A;  2OTL B;  2YWF A;  2ZZG A;  2C4T A;  2BN4 A;  2GRE A;  5GV8 A;  3VO1 A;  4DNR B;  2Z6B D;  4RD3 A;  3QE2 A;  3MHP A;  3BQJ A;  1T6Z A;  4Z4Y A;  3GIR A;  4J0Q A;  2F43 A;  1FX0 A;  4OOX A;  3P27 A;  2QTZ A;  2Q6K A;  1NBM A;  1R5O A;  4RPD A;  4P25 A;  2GK7 A;  5DS0 A;  1COW A;  4DQL A;  1EP2 B;  1EXM A;  4MYT A;  1Q86 D;  3BH4 A;  3OE7 A;  5HKK A;  4OP7 A;  4XON A;  1VLO A;  3T51 B;  2HDN B;  3JU4 A;  4X05 A;  3BY2 A;  1BMF A;  1FRQ A;  4HE5 A;  3ZZT A;  1E3X A;  3LO8 A;  3A8K A;  3Q6R A;  1QVF B;  4YAU A;  3OW2 B;  2R9V A;  1V5V A;  2OBR A;  2W6J A;  4RD6 A;  3W2G A;  3WNB A;  4XOT A;  2VNK A;  4NCN A;  2V7U A;  4TMT A;  5F4O A;  4ACB A;  3WQZ A;  1EWY A;  3VNV A;  1FRN A;  1E1R A;  5FO1 A;  2YWH A;  4G6I A;  4QVJ A;  1H8H A;  4WZL A;  1RQP A;  1VF7 A;  4X7C A;  1N08 A;  4RPB A;  4X8I A;  1KK1 A;  4XLC A;  2BSA A;  3W5U A;  2WPD A;  2ZZE A;  1IJF A;  2ZZQ A;  1WTH D;  2QE7 A;  1VQN B;  3W2E A;  5KW9 A;  1EFT A;  2HLD A;  3B82 A;  5TRD A;  4M2L A;  4OPV A;  4AVZ A;  3QSY A;  5IYP A;  3DDY A;  3VNU A;  3A3B A;  3ASS A;  1QH0 A;  1FNC A;  1XB2 A;  2VNI A;  4P12 A;  2DET A;  3FPK A;  2QN6 A;  1N06 A;  3BCD A;  4P3Y A;  1I7P A;  1WOS A;  2CF4 A;  2VNJ A;  3CC7 B;  2AHO A;  3OKX A;  4OOV A;  4PC7 A;  1VQ6 B;  2W6I A;  1QFZ A;  4X7F A;  1W34 A;  3GQB A;  5KSW B;  3CCL B;  3Q3A A;  2DCU A;  2EFG A;  4X7E A;  2QA4 B;  4B44 A;  1E3Z A;  1MAB A;  4II3 A;  1MRZ A;  4DQK A;  4WZE A;  4XLH A;  4B3G A;  5L46 A;  1ZUN B;  4FWT A;  1FND A;  4HIZ A;  5FA6 A;  3ZZ0 A;  3U6K A;  2V7V A;  3CB4 A;  2NV4 A;  4KKU A;  2ZIT A;  3AVV A;  3LVB A;  3Q6Q A;  4K1X A;  1UD4 A;  4II2 A;  2Q6I A;  2ZL5 A;  3CTA A;  3OFN A;  4B3X A;  1YI2 B;  1VQ8 B;  1KJZ A;  1EP1 B;  4TKO B;  2VJI A;  5TY0 A;  3OOC A;  1T6X A;  3ZC3 A;  4B47 A;  2GPJ A;  1TUI A;  4G7X A;  3KEW A;  1FDR A;  2CBX A;  3LQE A;  5LMZ A;  1DAR A;  3A8J A;  3VMF A;  2KVO A;  4G7W A;  4XKW A;  4YEL A;  1OB2 A;  1OGI A;  1GVH A;  2C2W A;  2DY1 A;  3ASR A;  1TLL A;  3BCF A;  1F60 A;  4C43 A;  2CC2 A;  3ZZU A;  1E63 A;  1PJ5 A;  1RQR A;  4RJL A;  4Z4T A;  4ZCI A;  1R5N A;  5IK2 A;  3T53 B;  4PC2 A;  2PLF A;  3OZW A;  3WBK A;  3GVK A;  4B4D A;  2X8K A;  2X6W A;  3AVT A;  1FNM A;  1CQX A;  1QG0 A;  1ZM3 A;  4B48 A;  1D2E A;  2RC5 A;  3OW7 A;  1EP3 B;  3ZIA A;  3AST A;  1P4M A;  1VQ4 B;  1HZE A;  3BC9 A;  3HAG A;  3OEE A;  3PEN A;  4Q7J B;  1G7S A;  1UD8 A;  1E1Q A;  1QUF A;  3PUN A;  4B43 A;  1JJ2 B;  3A3G A;  2WJV A;  3CCS B;  1VLY A;  3AGP A;  4QV2 A;  2CRV A;  4FXU A;  2XNC A;  1WPC A;  4IW3 B;  2C5H A;  5F4M A;  3OEH A;  2PE3 A;  2X53 S;  1SKQ A;  3G05 A;  3SEJ A;  2D3N A;  1CNF A;  2VBU A;  3WBJ A;  4Z1M A;  2X85 A;  1DG1 G;  2C4U A;  4Z4S A;  1V0E A;  4Y7C A;  2BM0 A;  3CES A;  1GJR A;  1T6Y A;  1S4M A;  1W0K A;  3V7A A;  3GVL A;  4PC1 A;  5J3O A;  1KD1 D;  2OK7 A;  3J81 k;  5FO0 A;  2XZL A;  4HE6 A;  1W35 A;  2CND A;  3E1Y E;  5IYQ A;  2VBT A;  5AN9 A;  2XOK A;  3ES9 A;  1ZM4 A;  1KTV A;  2E1B A;  4E0F A;  2I1L A;  3KL9 A;  4P6V F;  4CQJ A;  4XLF A;  1H85 A;  2V7W A;  4X7D A;  1WDT A;  3ASP A;  3CCQ B;  2GJP A;  2B5O A;  4DNT B;  3LNN A;  5J35 A;  1A8P A;  4YXW A;  3MMP A;  4UZE A;  2OK8 A;  5CDF A;  3SLN A;  2ZXH A;  1R5B A;  4XNF A;  5BSX A;  4WZT A;  3B8H A;  2C78 A;  4N3G A;  4Z4U A;  4F7D A;  1ELO A;  1H8E A;  3R6J A;  4XL9 A;  3ASQ A;  1VQL B;  4M1K A;  4BPR A;  2ZTN A;  2XZP A;  4XOP A;  1B23 P;  1BX0 A;  2ZL6 A;  3CPW B;  3CPX A;  5E6T A;  3VO2 A;  2QGG A;  4TT3 A;  3QFT A;  1VQ7 B;  4AC9 A;  4P9S A;  3A8I A;  4RD4 A;  2DIE A;  4XQF A;  4H9G A;  4ZGN B;  3OZU A;  4UZF A;  3I55 B;  4PAA A;  2ZTG A;  3FJO A;  4Z4V A;  1JB9 A;  3CC4 B;  2F1L A;  5HZA A;  5EMN A;  1UD3 A;  4YAL A;  4XM3 A;  1YJ9 B;  1GAW A;  2OTJ B; 
#chains in the Genus database with same CATH homology
 1NB0 A;  2VBT A;  5A88 A;  3OP1 A;  2VBS A;  1MRZ A;  2I1L A;  5A8A A;  3ZUG A;  1Q9S A;  5TRD A;  1NB9 A;  1T6Z A;  1N05 A;  3BNW A;  2OYN A;  2VBU A;  4UZE A;  2VBV A;  4UZF A;  3CTA A;  1N06 A;  2P3M A;  5FO1 A;  5FNZ A;  1T6X A;  2X0K A;  1T6Y A;  1S4M A;  1P4M A;  1N07 A;  1N08 A;  5A89 A;  5FO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...