1N07A

Crystal structure of schizosaccharomyces pombe riboflavin kinase reveals a novel atp and riboflavin binding fold
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
154
structure length
154
Chain Sequence
RPEIVGPEKVQSPYPIRFEGKVVHGFGRGSKELGIPTANISEDAIQELLRYRDSGVYFGYAMVQKRVFPMVMSVGWNPYYKNKLRSAEVHLIERQGEDFYEEIMRVIVLGYIRPELNYAGLDKLIEDIHTDIRVALNSMDRPSYSSYKKDPFFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Schizosaccharomyces pombe Riboflavin Kinase Reveals a Novel ATP and Riboflavin Binding Fold
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
molecule keywords PUTATIVE riboflavin kinase
total genus 37
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.1.26: Riboflavin kinase.
pdb deposition date 2002-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01687 Flavokinase Riboflavin kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.30 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Riboflavin kinase-like 1n07A00
1S4MA 1N07A 2I1LA 1N08A 2VBSA 2VBTA 5A88A 2VBUA 5FO1A 1T6XA 2X0KA 3ZUGA 1NB0A 1MRZA 5FO0A 4UZEA 3OP1A 3BNWA 1N05A 5TRDA 1T6ZA 1T6YA 5A8AA 5FNZA 1Q9SA 1NB9A 2P3MA 1N06A 2OYNA 1P4MA 5A89A 4UZFA 2VBVA 3CTAA
chains in the Genus database with same CATH superfamily
2XGJA 3AGQA 2M5SA 1WPCA 2ZBUA 2I1LA 3A8JA 4ROXA 4XORA 3OW2B 4XLCA 3G4SB 5A88A 1KTVA 3OE7A 3CMMA 3OZWA 2CRVA 3P26A 1VLYA 1A8PA 3WNCA 4Z4WA 1QX4A 3T51B 4RD3A 1DDGA 3PUMA 1BMFA 1IHMA 2C4TA 1KK3A 1OB0A 1WTHD 3OW7A 1FNMA 3AVTA 3BQJA 1Q86D 4X7CA 3OEHA 4OOSA 4P2NA 1NJID 2D9RA 1I7PA 2WR8A 4YAWA 2DERA 2Q6KA 4Y9UA 1W9XA 4ACAA 2DYIA 2GQFA 4TMWA 2OBRA 1S72B 3WYAA 4N3GA 2V7WA 4HE6A 4ACBA 3CCQB 4EH1A 5CDFA 4MYTA 4PABA 3W5HA 1VHOA 4G1BA 3AVUA 2XOKA 2QA4B 1UD2A 4X7EA 3ZZTA 1N0VC 3Q6QA 1E3XA 4G5GA 3CP2A 4G1VA 2BPOA 3W2FA 3OJWA 1QFYA 1EP1B 3OEEA 3CCVB 2FVGA 5FA6A 3B78A 1H42A 4E0FA 3WXMA 1VJSA 2VBSA 2GJKA 2GPJA 3R6KA 4Z1MA 1UD4A 3OAAA 5EMNA 1D2EA 2OBSA 1TTTA 4Y7CA 2QMUA 1IB0A 1YI2B 3U2QA 1VQNB 2YWFA 3CD6B 2NV4A 2ZZGA 4N3NA 3CXCB 4XD7A 2WJYA 3ZIAA 3Q3AA 3A35A 1YIJB 4B43A 2F1LA 3OZUA 2B5OA 1D8TA 1COWA 1N07A 4JMQA 4WZKA 1N08A 2D3LA 4PAAA 1VQ7B 1F20A 2Q6IA 2VBUA 3ONUA 1VQOB 1EXMA 2OK8A 3B82A 4M53A 3R6JA 1RQRA 4YAOA 1OHHA 5FO1A 3CPWB 3CC2B 5HKKA 4ZGNB 1PKVA 3A8KA 2X6WA 4PGOA 2GREA 3FJOA 1NB0A 3T56B 2BF4A 3OOCA 4P6VF 4ZCLA 3U6KA 5H5JA 4LBZA 4Z4RA 5FNZA 3U6BA 1NB9A 2Q6OA 4OOVA 4XOPA 1E79A 2V7XA 3QFSA 2W6JA 4QUZA 2BN4A 2WYRA 1UD8A 1VLOA 4ZGQB 3I55B 1VF7A 3ASPA 2HMAA 1G7RA 5KSWB 2VJJA 3ES9A 5IYQA 4Y9RA 1YHQB 1WU8A 1VQ6B 1W87A 4BPRA 5IYWA 4HIZA 4M0LA 4RD6A 2BMWA 2OBTA 3FPKA 4WZEA 5DS0A 1BJKA 1KJZA 2DY1A 5FIUA 2Z6BD 2X85A 4RM0A 1UD3A 1HZEA 2ZL5A 3OFNA 3I1FA 2WJVA 1G7TA 1XB2A 4G7XA 2ZZEA 3SKBA 2CBXA 2DOGA 4PC7A 2VNJA 2C78A 4RDJA 1K8AD 1EP2B 3ASRA 1QVFB 4RD4A 1BX1A 5B6IA 1YJ9B 2C5BA 4PC1A 4F7DA 3CC4B 4XKVA 4Z4VA 4X7FA 2E1BA 2VNKA 4NBSA 2QN6A 1DARA 1WP6A 2DIEA 4TMZA 2ZZQA 2CNDA 2RC5A 5F4JA 1EWYA 2PIAA 4QVJA 1Y0YA 4WWVA 3SJZA 1ZM2A 5DN6A 2XZPA 3VR6A 3W2HA 4RPDA 2QGGA 1FDRA 2V7VA 1KK1A 4P3YA 1JNYA 1B2RA 1G7SA 3T53B 3ISXA 2YWEA 5IYNA 4P25A 3MMPA 1DG1G 1W0KA 3ASSA 5H59A 4B4DA 1YJNB 2X3UA 1BPLA 2R6HA 4RD0A 3CCEB 2XEXA 4TMTA 4XM3A 3CCMB 3KL9A 2ZXHA 1QGZA 1OB5A 1ZM4A 2CC2A 4P26A 3CPXA 4X7DA 1TUIA 2R9VA 1T6XA 3WBKA 3ZC3A 1QUFA 5IYPA 4Z4SA 1GVHA 2BGJA 2OK7A 4YAUA 2RC6A 4DNRB 1MRZA 3BC9A 4P22A 2HLDA 3VNUA 2GJPA 3PVDA 1N05A 2C77A 5TRDA 4Q7JB 1SM4A 4R71A 3GVJA 1HVXA 4QVAA 3PENA 3BY1A 1EFCA 3RY8A 1CQXA 4NCNA 4KKUA 1JB9A 3CTAA 2NPFA 1TLLA 4Z4TA 3GIRA 1YLOA 4J0QA 1R5OA 4XN3A 2VZLA 1FX0A 3CCUB 1KMHA 3LNNA 4XLEA 3AVVA 4X8IA 1W2BB 3V76A 3CCRB 2DETA 1M1KD 4X07A 4WZTA 1B23P 4UZEA 1D1NA 4RDLA 5IK2A 1V0EA 4YEJA 4DNTB 4RPBA 2XZOA 4UZUA 3ZPNA 2V4DA 1XFOA 4OOXA 2C2WA 1BQEA 4PC6A 2E1RA 3HAGA 2YWHA 3A8IA 2OYNA 1E43A 1FNBA 4KKSA 4DQKA 4XQFA 3J81k 1E1RA 3B8HA 5GV8A 1WOPA 4TKOB 1VQPB 1VQ4B 4RD2A 3CESA 5IYRA 2JN9A 2WSSA 3CMAB 3CMEB 1QVGB 3WNBA 2VNHA 4XNFA 3ONYA 5F4OA 3Q38A 1E63A 1W0JA 3NE5B 4P9SA 4XOTA 3JQQA 1KQSB 3GQBA 2F1MA 1RQPA 4P12A 5A8AA 4XONA 1E3ZA 3WBJA 2V31A 2F4NA 5HZBA 1QH0A 4AF6A 4DK0A 1K28D 5BSYA 3A3GA 3CB4A 3WQZA 2WZPP 1FRQA 1FNDA 5TY0A 1IJEA 1Q81D 3AVYA 1I18A 2ZTGA 2GJRA 1QGYA 1AIPA 4II3A 2BSAA 1H85A 1U2RA 2BV3A 2KVOA 2V7QA 5THXA 2JDIA 1EFUA 2X6YA 3JQPA 4CQJA 1KK2A 2W6IA 4RCZA 2HCJB 3JQRA 1KD1D 2BM1A 3ZZUA 4X05A 4FK8A 2ZTNA 4HE5A 5AN9A 1XQBA 4LBWA 4P3IA 1E62A 3SEJA 1J9ZA 3VO1A 4P1VA 1E64A 1FNCA 3D26A 4XLFA 2DEUA 2AHOA 2V7TA 2VNIA 2V7UA 4U9UA 4YXWA 4C43A 3QSYA 3E20A 4OP7A 1YJWB 3LVBA 2X8KA 4II2A 3ZBUA 1K9MD 2WZNA 4B3XA 1V5VA 2JIZA 4TMVA 4PC2A 1QFZA 2JJ2A 3CCLB 4QFMA 1W34A 1V0FA 3FPPA 2ZITA 3ZZ0A 3AVWA 3BH4A 5HXBA 4C0SA 4K1XA 2CF4A 1NRKA 3JU4A 1YITB 1CNFA 3QFCA 3GVLA 4YELA 1VHEA 1XE1A 1JJ2B 1T6ZA 1T6YA 1WOSA 1GJRA 2LZJA 3CW2A 4RLZA 1Q7YD 1KRHA 2C5HA 4XKWA 1PJ6A 1F60A 1N06A 3KEWA 3SLNA 3VMFA 3CRZA 4UZFA 3DDYA 4RDKA 5GV7A 3V7AA 2J7KA 1EFTA 4Z4YA 3PA2A 4G6IA 1KK0A 2C4UA 1GAQA 1ZUNB 3ASTA 4P6YA 4FXUA 1GR1A 5TV2A 2FX3A 1TVCA 3Q39A 1KC8D 1ZM3A 2VYQA 4WQMA 1NDHA 4M2LA 2F43A 2QTZA 2X53S 1PJ7A 3OP1A 4XL9A 5L46A 2XNJA 1UMKA 4LBYA 1BLIA 2ZL7A 2QE7A 3LO8A 4AVZA 4OPSA 5JBQA 2DCUA 1P4MA 5F4MA 3AGPA 4B3FX 2OTLB 1NBMA 3MCAA 4DQLA 1KZLA 1G7CA 3W5UA 3LQEA 1UD5A 1JA0A 4QHYA 2D74A 2PLFA 3WNDA 2VJIA 5FL7A 1CNEA 1S0UA 1WORA 5HZAA 1M90D 1WOOA 4XLHA 3ASQA 2VBTA 4LBVA 3SJPA 3VO2A 4L8JA 1T5EA 1PJ5A 3CP8A 2PMDA 2B7CA 1VQ9B 4GQNA 4QV2A 4Z4UA 3G71B 3OPOA 2XNCA 2XZLA 1BX0A 1Q82D 3P27A 4TT3A 3BCFA 1OGIA 2Q6LA 1H8HA 1VQ5B 2VBVA 5E6TA 3OKXA 3BY2A 1UD6A 4PC3A 3A3BA 3A1PA 3OZVA 1H8EA 4AF7A 4M1KA 2CK3A 3W2EA 1SKYB 4FN5A 4OPVA 1GO2A 1QFJA 1SKQA 4YHBA 3GSIA 4Z4ZA 2EIXA 1FRNA 3PUNA 2QEXB 4UAJA 4ZCIA 3Q6RA 3CCJB 3BNWA 1DDIA 1YX2A 2WPDA 4B48A 4WZLA 1Q9SA 4X06A 4ZV4A 1QUEA 4RCYA 4ZCMA 5TR9A 3E1YE 3G6EB 3AVXA 1QG0A 5A89A 2BGIA 4B44A 3LQ6A 2ZL6A 3W5VA 1E1QA 1VQ8B 4B47A 5BSXA 1S4MA 2OTJB 3CCSB 5KNLA 1EP3B 2ZBVA 4OPOA 1R5NA 3ZBTA 3WY9A 2BM0A 5DSZA 4H9GA 5LMZA 2QDXA 2ZZFA 2X0KA 4XR6A 4KKTA 1VQKB 4MYUA 4DK1A 3QE2A 1N8RD 3BCDA 3CC7B 4X0CA 3PA1A 1AMOA 3G05A 1MABA 2BVNA 3H9NA 1EFRA 3QFRA 1IJFA 2QTLA 1ELOA 2ZXIA 1W35A 2GK7A 2JJ1A 5J3OA 4RD1A 1VQMB 2GK6A 4XN0A 2YWGA 4AC9A 3MHPA 4RJLA 3W2GA 5KW9A 1Y0RA 3OJXA 4M4SA 4IW3B 4XLAA 3QFTA 1WDTA 2XNDA 2EFGA 4LC0A 2X6XA 4FWTA 3VNVA 2CW5A 4TMXA 4NNJA 2PE3A 4YAFA 1JA1A 3GVKA 1I8DA 1ZM9A 4TN1A 5FO0A 4B3GA 1K73D 4ASUA 1OB2A 4G7WA 3FKSA 2HDNB 3SLDA 1QGAA 1R5BA 2B7BA 1N0UA 3W2IA 3H94A 2D3NA 2P3MA 1VQLB 1WSVA 1HA3A 1OGJA 4TSFA 3I56B 4YALA 4XMYA 1GAWA 5J35A 1WSRA 3ZUGA
chains in the Genus database with same CATH topology
1S4MA 1N07A 2I1LA 1N08A 2VBSA 2VBTA 5A88A 2VBUA 5FO1A 1T6XA 2X0KA 3ZUGA 1NB0A 1MRZA 5FO0A 4UZEA 3OP1A 3BNWA 1N05A 5TRDA 1T6ZA 1T6YA 5A8AA 5FNZA 1Q9SA 1NB9A 2P3MA 1N06A 2OYNA 1P4MA 5A89A 4UZFA 2VBVA 3CTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4M A;  1N07 A;  2I1L A;  1N08 A;  2VBS A;  2VBT A;  5A88 A;  2VBU A;  5FO1 A;  1T6X A;  2X0K A;  3ZUG A;  1NB0 A;  1MRZ A;  5FO0 A;  4UZE A;  3OP1 A;  3BNW A;  1N05 A;  5TRD A;  1T6Z A;  1T6Y A;  5A8A A;  5FNZ A;  1Q9S A;  1NB9 A;  2P3M A;  1N06 A;  2OYN A;  1P4M A;  5A89 A;  4UZF A;  2VBV A;  3CTA A; 
#chains in the Genus database with same CATH topology
 2XGJ A;  3AGQ A;  2M5S A;  1WPC A;  2ZBU A;  2I1L A;  3A8J A;  4ROX A;  4XOR A;  3OW2 B;  4XLC A;  3G4S B;  5A88 A;  1KTV A;  3OE7 A;  3CMM A;  3OZW A;  2CRV A;  3P26 A;  1VLY A;  1A8P A;  3WNC A;  4Z4W A;  1QX4 A;  3T51 B;  4RD3 A;  1DDG A;  3PUM A;  1BMF A;  1IHM A;  2C4T A;  1KK3 A;  1OB0 A;  1WTH D;  3OW7 A;  1FNM A;  3AVT A;  3BQJ A;  1Q86 D;  4X7C A;  3OEH A;  4OOS A;  4P2N A;  1NJI D;  2D9R A;  1I7P A;  2WR8 A;  4YAW A;  2DER A;  2Q6K A;  4Y9U A;  1W9X A;  4ACA A;  2DYI A;  2GQF A;  4TMW A;  2OBR A;  1S72 B;  3WYA A;  4N3G A;  2V7W A;  4HE6 A;  4ACB A;  3CCQ B;  4EH1 A;  5CDF A;  4MYT A;  4PAB A;  3W5H A;  1VHO A;  4G1B A;  3AVU A;  2XOK A;  2QA4 B;  1UD2 A;  4X7E A;  3ZZT A;  1N0V C;  3Q6Q A;  1E3X A;  4G5G A;  3CP2 A;  4G1V A;  2BPO A;  3W2F A;  3OJW A;  1QFY A;  1EP1 B;  3OEE A;  3CCV B;  2FVG A;  5FA6 A;  3B78 A;  1H42 A;  4E0F A;  3WXM A;  1VJS A;  2VBS A;  2GJK A;  2GPJ A;  3R6K A;  4Z1M A;  1UD4 A;  3OAA A;  5EMN A;  1D2E A;  2OBS A;  1TTT A;  4Y7C A;  2QMU A;  1IB0 A;  1YI2 B;  3U2Q A;  1VQN B;  2YWF A;  3CD6 B;  2NV4 A;  2ZZG A;  4N3N A;  3CXC B;  4XD7 A;  2WJY A;  3ZIA A;  3Q3A A;  3A35 A;  1YIJ B;  4B43 A;  2F1L A;  3OZU A;  2B5O A;  1D8T A;  1COW A;  1N07 A;  4JMQ A;  4WZK A;  1N08 A;  2D3L A;  4PAA A;  1VQ7 B;  1F20 A;  2Q6I A;  2VBU A;  3ONU A;  1VQO B;  1EXM A;  2OK8 A;  3B82 A;  4M53 A;  3R6J A;  1RQR A;  4YAO A;  1OHH A;  5FO1 A;  3CPW B;  3CC2 B;  5HKK A;  4ZGN B;  1PKV A;  3A8K A;  2X6W A;  4PGO A;  2GRE A;  3FJO A;  1NB0 A;  3T56 B;  2BF4 A;  3OOC A;  4P6V F;  4ZCL A;  3U6K A;  5H5J A;  4LBZ A;  4Z4R A;  5FNZ A;  3U6B A;  1NB9 A;  2Q6O A;  4OOV A;  4XOP A;  1E79 A;  2V7X A;  3QFS A;  2W6J A;  4QUZ A;  2BN4 A;  2WYR A;  1UD8 A;  1VLO A;  4ZGQ B;  3I55 B;  1VF7 A;  3ASP A;  2HMA A;  1G7R A;  5KSW B;  2VJJ A;  3ES9 A;  5IYQ A;  4Y9R A;  1YHQ B;  1WU8 A;  1VQ6 B;  1W87 A;  4BPR A;  5IYW A;  4HIZ A;  4M0L A;  4RD6 A;  2BMW A;  2OBT A;  3FPK A;  4WZE A;  5DS0 A;  1BJK A;  1KJZ A;  2DY1 A;  5FIU A;  2Z6B D;  2X85 A;  4RM0 A;  1UD3 A;  1HZE A;  2ZL5 A;  3OFN A;  3I1F A;  2WJV A;  1G7T A;  1XB2 A;  4G7X A;  2ZZE A;  3SKB A;  2CBX A;  2DOG A;  4PC7 A;  2VNJ A;  2C78 A;  4RDJ A;  1K8A D;  1EP2 B;  3ASR A;  1QVF B;  4RD4 A;  1BX1 A;  5B6I A;  1YJ9 B;  2C5B A;  4PC1 A;  4F7D A;  3CC4 B;  4XKV A;  4Z4V A;  4X7F A;  2E1B A;  2VNK A;  4NBS A;  2QN6 A;  1DAR A;  1WP6 A;  2DIE A;  4TMZ A;  2ZZQ A;  2CND A;  2RC5 A;  5F4J A;  1EWY A;  2PIA A;  4QVJ A;  1Y0Y A;  4WWV A;  3SJZ A;  1ZM2 A;  5DN6 A;  2XZP A;  3VR6 A;  3W2H A;  4RPD A;  2QGG A;  1FDR A;  2V7V A;  1KK1 A;  4P3Y A;  1JNY A;  1B2R A;  1G7S A;  3T53 B;  3ISX A;  2YWE A;  5IYN A;  4P25 A;  3MMP A;  1DG1 G;  1W0K A;  3ASS A;  5H59 A;  4B4D A;  1YJN B;  2X3U A;  1BPL A;  2R6H A;  4RD0 A;  3CCE B;  2XEX A;  4TMT A;  4XM3 A;  3CCM B;  3KL9 A;  2ZXH A;  1QGZ A;  1OB5 A;  1ZM4 A;  2CC2 A;  4P26 A;  3CPX A;  4X7D A;  1TUI A;  2R9V A;  1T6X A;  3WBK A;  3ZC3 A;  1QUF A;  5IYP A;  4Z4S A;  1GVH A;  2BGJ A;  2OK7 A;  4YAU A;  2RC6 A;  4DNR B;  1MRZ A;  3BC9 A;  4P22 A;  2HLD A;  3VNU A;  2GJP A;  3PVD A;  1N05 A;  2C77 A;  5TRD A;  4Q7J B;  1SM4 A;  4R71 A;  3GVJ A;  1HVX A;  4QVA A;  3PEN A;  3BY1 A;  1EFC A;  3RY8 A;  1CQX A;  4NCN A;  4KKU A;  1JB9 A;  3CTA A;  2NPF A;  1TLL A;  4Z4T A;  3GIR A;  1YLO A;  4J0Q A;  1R5O A;  4XN3 A;  2VZL A;  1FX0 A;  3CCU B;  1KMH A;  3LNN A;  4XLE A;  3AVV A;  4X8I A;  1W2B B;  3V76 A;  3CCR B;  2DET A;  1M1K D;  4X07 A;  4WZT A;  1B23 P;  4UZE A;  1D1N A;  4RDL A;  5IK2 A;  1V0E A;  4YEJ A;  4DNT B;  4RPB A;  2XZO A;  4UZU A;  3ZPN A;  2V4D A;  1XFO A;  4OOX A;  2C2W A;  1BQE A;  4PC6 A;  2E1R A;  3HAG A;  2YWH A;  3A8I A;  2OYN A;  1E43 A;  1FNB A;  4KKS A;  4DQK A;  4XQF A;  3J81 k;  1E1R A;  3B8H A;  5GV8 A;  1WOP A;  4TKO B;  1VQP B;  1VQ4 B;  4RD2 A;  3CES A;  5IYR A;  2JN9 A;  2WSS A;  3CMA B;  3CME B;  1QVG B;  3WNB A;  2VNH A;  4XNF A;  3ONY A;  5F4O A;  3Q38 A;  1E63 A;  1W0J A;  3NE5 B;  4P9S A;  4XOT A;  3JQQ A;  1KQS B;  3GQB A;  2F1M A;  1RQP A;  4P12 A;  5A8A A;  4XON A;  1E3Z A;  3WBJ A;  2V31 A;  2F4N A;  5HZB A;  1QH0 A;  4AF6 A;  4DK0 A;  1K28 D;  5BSY A;  3A3G A;  3CB4 A;  3WQZ A;  2WZP P;  1FRQ A;  1FND A;  5TY0 A;  1IJE A;  1Q81 D;  3AVY A;  1I18 A;  2ZTG A;  2GJR A;  1QGY A;  1AIP A;  4II3 A;  2BSA A;  1H85 A;  1U2R A;  2BV3 A;  2KVO A;  2V7Q A;  5THX A;  2JDI A;  1EFU A;  2X6Y A;  3JQP A;  4CQJ A;  1KK2 A;  2W6I A;  4RCZ A;  2HCJ B;  3JQR A;  1KD1 D;  2BM1 A;  3ZZU A;  4X05 A;  4FK8 A;  2ZTN A;  4HE5 A;  5AN9 A;  1XQB A;  4LBW A;  4P3I A;  1E62 A;  3SEJ A;  1J9Z A;  3VO1 A;  4P1V A;  1E64 A;  1FNC A;  3D26 A;  4XLF A;  2DEU A;  2AHO A;  2V7T A;  2VNI A;  2V7U A;  4U9U A;  4YXW A;  4C43 A;  3QSY A;  3E20 A;  4OP7 A;  1YJW B;  3LVB A;  2X8K A;  4II2 A;  3ZBU A;  1K9M D;  2WZN A;  4B3X A;  1V5V A;  2JIZ A;  4TMV A;  4PC2 A;  1QFZ A;  2JJ2 A;  3CCL B;  4QFM A;  1W34 A;  1V0F A;  3FPP A;  2ZIT A;  3ZZ0 A;  3AVW A;  3BH4 A;  5HXB A;  4C0S A;  4K1X A;  2CF4 A;  1NRK A;  3JU4 A;  1YIT B;  1CNF A;  3QFC A;  3GVL A;  4YEL A;  1VHE A;  1XE1 A;  1JJ2 B;  1T6Z A;  1T6Y A;  1WOS A;  1GJR A;  2LZJ A;  3CW2 A;  4RLZ A;  1Q7Y D;  1KRH A;  2C5H A;  4XKW A;  1PJ6 A;  1F60 A;  1N06 A;  3KEW A;  3SLN A;  3VMF A;  3CRZ A;  4UZF A;  3DDY A;  4RDK A;  5GV7 A;  3V7A A;  2J7K A;  1EFT A;  4Z4Y A;  3PA2 A;  4G6I A;  1KK0 A;  2C4U A;  1GAQ A;  1ZUN B;  3AST A;  4P6Y A;  4FXU A;  1GR1 A;  5TV2 A;  2FX3 A;  1TVC A;  3Q39 A;  1KC8 D;  1ZM3 A;  2VYQ A;  4WQM A;  1NDH A;  4M2L A;  2F43 A;  2QTZ A;  2X53 S;  1PJ7 A;  3OP1 A;  4XL9 A;  5L46 A;  2XNJ A;  1UMK A;  4LBY A;  1BLI A;  2ZL7 A;  2QE7 A;  3LO8 A;  4AVZ A;  4OPS A;  5JBQ A;  2DCU A;  1P4M A;  5F4M A;  3AGP A;  4B3F X;  2OTL B;  1NBM A;  3MCA A;  4DQL A;  1KZL A;  1G7C A;  3W5U A;  3LQE A;  1UD5 A;  1JA0 A;  4QHY A;  2D74 A;  2PLF A;  3WND A;  2VJI A;  5FL7 A;  1CNE A;  1S0U A;  1WOR A;  5HZA A;  1M90 D;  1WOO A;  4XLH A;  3ASQ A;  2VBT A;  4LBV A;  3SJP A;  3VO2 A;  4L8J A;  1T5E A;  1PJ5 A;  3CP8 A;  2PMD A;  2B7C A;  1VQ9 B;  4GQN A;  4QV2 A;  4Z4U A;  3G71 B;  3OPO A;  2XNC A;  2XZL A;  1BX0 A;  1Q82 D;  3P27 A;  4TT3 A;  3BCF A;  1OGI A;  2Q6L A;  1H8H A;  1VQ5 B;  2VBV A;  5E6T A;  3OKX A;  3BY2 A;  1UD6 A;  4PC3 A;  3A3B A;  3A1P A;  3OZV A;  1H8E A;  4AF7 A;  4M1K A;  2CK3 A;  3W2E A;  1SKY B;  4FN5 A;  4OPV A;  1GO2 A;  1QFJ A;  1SKQ A;  4YHB A;  3GSI A;  4Z4Z A;  2EIX A;  1FRN A;  3PUN A;  2QEX B;  4UAJ A;  4ZCI A;  3Q6R A;  3CCJ B;  3BNW A;  1DDI A;  1YX2 A;  2WPD A;  4B48 A;  4WZL A;  1Q9S A;  4X06 A;  4ZV4 A;  1QUE A;  4RCY A;  4ZCM A;  5TR9 A;  3E1Y E;  3G6E B;  3AVX A;  1QG0 A;  5A89 A;  2BGI A;  4B44 A;  3LQ6 A;  2ZL6 A;  3W5V A;  1E1Q A;  1VQ8 B;  4B47 A;  5BSX A;  1S4M A;  2OTJ B;  3CCS B;  5KNL A;  1EP3 B;  2ZBV A;  4OPO A;  1R5N A;  3ZBT A;  3WY9 A;  2BM0 A;  5DSZ A;  4H9G A;  5LMZ A;  2QDX A;  2ZZF A;  2X0K A;  4XR6 A;  4KKT A;  1VQK B;  4MYU A;  4DK1 A;  3QE2 A;  1N8R D;  3BCD A;  3CC7 B;  4X0C A;  3PA1 A;  1AMO A;  3G05 A;  1MAB A;  2BVN A;  3H9N A;  1EFR A;  3QFR A;  1IJF A;  2QTL A;  1ELO A;  2ZXI A;  1W35 A;  2GK7 A;  2JJ1 A;  5J3O A;  4RD1 A;  1VQM B;  2GK6 A;  4XN0 A;  2YWG A;  4AC9 A;  3MHP A;  4RJL A;  3W2G A;  5KW9 A;  1Y0R A;  3OJX A;  4M4S A;  4IW3 B;  4XLA A;  3QFT A;  1WDT A;  2XND A;  2EFG A;  4LC0 A;  2X6X A;  4FWT A;  3VNV A;  2CW5 A;  4TMX A;  4NNJ A;  2PE3 A;  4YAF A;  1JA1 A;  3GVK A;  1I8D A;  1ZM9 A;  4TN1 A;  5FO0 A;  4B3G A;  1K73 D;  4ASU A;  1OB2 A;  4G7W A;  3FKS A;  2HDN B;  3SLD A;  1QGA A;  1R5B A;  2B7B A;  1N0U A;  3W2I A;  3H94 A;  2D3N A;  2P3M A;  1VQL B;  1WSV A;  1HA3 A;  1OGJ A;  4TSF A;  3I56 B;  4YAL A;  4XMY A;  1GAW A;  5J35 A;  1WSR A;  3ZUG A; 
#chains in the Genus database with same CATH homology
 1S4M A;  1N07 A;  2I1L A;  1N08 A;  2VBS A;  2VBT A;  5A88 A;  2VBU A;  5FO1 A;  1T6X A;  2X0K A;  3ZUG A;  1NB0 A;  1MRZ A;  5FO0 A;  4UZE A;  3OP1 A;  3BNW A;  1N05 A;  5TRD A;  1T6Z A;  1T6Y A;  5A8A A;  5FNZ A;  1Q9S A;  1NB9 A;  2P3M A;  1N06 A;  2OYN A;  1P4M A;  5A89 A;  4UZF A;  2VBV A;  3CTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...