1N0XH

Crystal structure of a broadly neutralizing anti-hiv-1 antibody in complex with a peptide mimotope
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
228
structure length
222
Chain Sequence
b'QVQLVQSGAEVKKPGASVKVSCQASGYRFSNFVIHWVRQAPGQRFEWMGWINPYNGNKEFSAKFQDRVTFTADTSANTAYMELRSLRSADTAVYYCARVGPYSWDDSPQDNYYMDVWGKGTTVIVSSASTKGPSVFPLAPSSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN LIGHT CHAIN
publication title Crystal Structure of a Broadly Neutralizing Anti-HIV-1 Antibody in Complex with a Peptide Mimotope
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 222
sequence length 228
chains with identical sequence K
ec nomenclature
pdb deposition date 2002-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n0xH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n0xH01
4GOSA 5ESAB 3PP3K 1FZKB 1IGYB 1T1WB 4NSKA 3OB0H 3M8OH 3RX8A 5HGAA 2CIIB 3JVGA 5FF6B 2XZAH 4I48B 4H26B 4PJAB 1ZE3C 4LRIA 5KSAD 1G7HA 3ARFC 3GJFH 5F97E 3S36H 5JORA 2XKNB 4MJID 4R96A 4F7CB 4NQXA 5C0CE 1TNMA 1KENL 3D0LB 3FT2B 3U4AA 5C09B 3UYOD 1ETZB 1N3NA 3KAAA 2ZP0T 5IR1A 2QSTA 4NQVB 1XH3A 5BVJB 4RBPK 5JHDE 2BRQA 4OV5B 3PWVB 4WUUD 4IRJA 4NRXA 5IWLA 3L9RA 3ZT5A 4NDMB 1CVSC 2IH3A 4QXWA 2VR9A 4PJCE 3JV0A 1JGEB 3DGCR 1ZGLB 3SJVE 2VLKD 1DQTA 4QT5A 1F4WL 2VITA 5DC9B 2X1QA 5DEGA 2NNAA 1GZPA 1BQHG 1CN4A 3T2NL 4M7LT 2JK5A 5SWZD 1IT9H 4I0PB 4HW6A 5MP6L 4U1SB 4Z7WE 1CXIA 3EUUA 3O6KL 2W9LA 3WIIL 5F9OL 5FK9A 3G6DL 4ZTOH 5DZOA 4LLQA 4QHUB 4KZDL 3VXMA 4HS3B 1RIVH 2X44D 3C5ZD 3JWDC 1PSKL 3NZHH 4HUNB 4KAQH 4LF3A 3JTTB 4LBEA 1I9EA 4HIIA 4HWNA 1IVLA 2YXFA 4QTHA 1CS6A 5D7SL 4B53A 4PJHE 4EI5A 4NYLA 1N59A 2IAND 3CZFA 3OJDB 3DYMA 4FG6C 3R0MA 3ZDZF 3PHOA 5J11B 4AENB 1YEDA 2A73A 5DJXB 2I27N 1M7DB 4R7DA 4XH2A 2X4OA 1FYTE 4MNQE 3CVIL 4MDIA 4UMGA 2IQAA 1A0QL 5LWYH 1N6QH 3ZE0E 1IBGH 3W9DA 1AR1D 4UU9B 4W70A 3TZVC 2XQBH 4JO4H 4AMKH 2H6PB 5F9AC 2H32B 4PJIF 3LS5L 3HI6L 4EOWH 1XIWA 1NBVH 4RX4A 4U1HB 5L8LB 3PGFH 3L3GB 2A6DA 1CBVH 4WVRA 1F3JB 2Z8RA 2ADJA 3PWLB 2AEWA 4G9FA 5EH1A 2E6QA 3DTXA 3UZVB 1CTOA 2ZPKH 3TF7C 3KPOA 4TTDD 3TA3D 3DJ9A 3RWIA 4Z7VA 4APQC 4Y5YA 3FT4A 1EBPA 4YAQB 3D0VB 1UT9A 3ZMRA 4S0SD 4H25B 2BSSA 3AUVA 3DGGA 3FQUA 3JUYA 4PG2C 5FUOL 1A4JA 5I30L 3QR2A 4S1SH 3CSYB 1JGLL 2B1HH 4OLZL 2APVA 4C55A 1UWEH 1CFQA 4ALAH 2QADD 1BIHA 5ID1A 4MA7H 2DB8A 4Z7QF 3LIZH 3M45A 4JFDB 1JCKA 1QLEL 1HWGB 3IFOA 3RA7H 2B0SL 3MZGB 1WUNT 5TDPA 4XNYH 1RJLB 3PGDA 4R3SA 1JK8A 4RRPA 1T1ZB 2JTDA 1VEMA 1EGJH 4P2QA 4RAHA 4JLRA 3MRCA 4LEOA 3FCTB 2GFBB 4M6OL 3W0WD 3IDNB 1QBLL 1YEKH 4LSTH 4QTIL 5AYUH 5HYIA 1MJUH 3SO3B 2ZKHL 3REVB 3OQ3B 4Y4KD 5DK2B 2I5YH 5DS8A 4IOIA 1RJZB 1A5FL 1H8NA 5J6HA 2BOCA 1DANT 3RJDA 3U9PH 3LKNA 3KR3H 4WW1B 5K9QI 2FO4A 3ARFA 4J3VA 5D72H 4YGVA 5DRXA 4BH7A 3MV7A 3P4NA 3QULA 1MFAH 4YEEA 4HUXB 4R2GB 1OP5K 1G0XA 1YZZA 1FO0L 4LPTA 5I1GL 4Y4FB 2FD6L 3I3EA 4XVUD 2VDML 3KJ4B 4ISVB 4Z95L 1YNLH 3MLTA 3PDDA 4X80H 3FONA 4R4NC 2Y4SA 5TE6H 5F7EH 5CJXC 1DBJL 3ARQA 5I1AA 4YBLC 4UIKH 4UB0H 5IV2B 3G9AB 5C9KA 1FL6B 3T8XA 5EBWB 2OCFD 2MSPA 3QUMA 2CGRL 1NC4B 4IS6A 5E00A 1ZANL 2WWMD 3K74B 2R0LL 3O4LA 4OCSH 3DUSB 4EXKA 2R8SH 3TBYB 1CICB 3BMWA 2Y07H 3QPQD 1CGTA 2FCBA 1FBIL 3LD8B 1I7RB 4KJQC 4M7LL 3BPCB 2F53D 4M5YH 3FFCD 2BVYA 4M48H 2AV1A 4WCYH 5GS2H 1U0QA 1FFOB 1BBJA 1A7QL 2DKSA 5E7BA 2GQHA 3HC3L 4H8WH 1P53A 3PL6C 4PJXB 1IC5H 4OZ4B 2DIJA 2F58L 4N0UA 1C12B 4POUB 4FXGB 4PJDF 3QNXA 5FO9B 1UM4H 2ZZUT 1S9KC 3T04D 1WFOA 1P7HL 5E94A 3ARWA 2P44B 2BMKB 3EJZD 2RCSH 2XXMB 4RSVA 1XZ0B 4NQDB 1QZ1A 3BIBX 3SE8H 4KKCC 3AGVA 3GJEB 3TZVA 3FL7A 1SJEA 3MRNA 1NSNL 3D39A 1VFUA 1L7IL 2QR0A 1GSMA 5CCKH 1JPGA 1KXVC 4C59B 4W4NA 2CPCA 1H3GA 3G5ZB 1NUNB 4KROD 5C0DA 2LV4A 2E9WA 1QFWM 3VXRA 4M43H 1CQKA 4APQA 3BEWA 5T3XL 3WNLA 4JB9H 4ZFOA 1IM3B 3AS2A 4YGAB 1GOHA 5FGRA 4ZOBA 4BQBA 1HE7A 4YBQD 4OB5L 2PO6D 1INEH 3TN0A 3OAUL 1T03L 1KG0B 5KVMC 4YUEL 1INDL 2J6EA 2FSEA 1MI5D 1UEMA 1A6WL 2DJ4A 2YWYA 3MRPB 4BUGA 1KN2H 3TBTB 5IQ7H 3VDBA 5ETUA 3L5WB 1CLZH 1QR4A 3EO0A 1U8KA 3CU7A 2NY0D 2ZCKL 4K3JH 1XAUA 4ZFGL 4JN2B 2IPUG 5A2LH 3NFSL 2HLAA 3NACL 1IC7L 1Q0YH 3I6LE 3QQ9C 4J1UA 2JIXB 1ZS8B 3GKWH 1FQ9C 5TE4H 3VGAB 4UBDC 2APXA 3RVVD 2G75A 3GSNA 4OFYA 1PYWB 2IEPA 2R4RL 3MJ9L 4HKJB 1YEEL 2PN5A 3TH2T 4MZ3A 1UWGL 3T4YB 3KXFA 2HJLB 5HDOA 3QHZL 5DHVH 1K6QL 3EOTL 2P4AB 3RPIA 5TH2B 1MJ7L 2ADFH 5DJAB 1KLGA 5LGJA 4U0RB 3VI3E 3BXNA 1ZHNB 3GSWB 4JM2C 2F74B 4U7KA 3TBWB 4ZYKB 1U93B 5I16B 5I1JH 1DBBL 1F97A 1RZKH 4OLWL 4EVNA 3RWJA 1PZ5B 5T1DH 5T5FL 2VYRE 1ZHKA 4JKKA 4KRMB 3L3DA 5CJXA 3HR5A 5HYJE 4LPWA 1CDUA 3LKQA 2OQJA 4HFUL 3K1KC 4LCYA 3BYYA 3B9VA 3WIFA 1KCLA 4DN4H 4ONGH 3ZYJA 5IOPA 4GMTL 3BAEL 2WIMA 3QWRD 2CUHA 1HXMA 3FKUS 4RGNC 1M05B 1YJDH 1M6OB 2ITDB 5DD6B 3JTSA 4P23D 4BH8B 4EDXA 5F8RC 5LBSL 3ZE2F 3NH7L 3VA6A 2FLRT 2HT3D 3PWJB 4ODVH 5CEZL 4UNTA 3CMGA 3QFJE 3V8CA 3WXVH 5ISZA 1S7WA 2C4FU 5CEZD 5EOQH 4LLYA 4WO4D 4U6HA 4YPGB 2E9JA 4MX7A 2XV6B 3PL6A 1ZT4B 2DQJH 3TVMB 5IT2L 1L0YA 2X6MA 3MRQB 4K23H 1WZMA 2HRPL 4GSDH 2PR4H 3AFLA 4XAWH 1B3JA 2XT1B 3VGGA 4X6EA 1EFXA 1T5WB 1JJUA 4L8SB 2FGZA 1TITA 2NTFA 4XWGH 3O3AA 4QRTA 3U79A 1TZIA 1QUNA 1MWAB 3KVQA 3DUUA 3V5KB 5DJDB 4OZFA 5IMKA 2AEPH 5E2UH 1CE1H 3FMGH 2Y7QB 4GAGL 4FTVE 1JGVH 2YKLL 3QRGL 4NO0D 5E4EC 4HXBL 4OZGB 1E27B 1T0MB 3IDXL 4KMQA 1CDHA 4QRPB 1JYXA 2EYTB 5BS0B 3RI5K 1FFPB 1AHWC 3U1SL 4M1GL 3ZKND 1YPZB 1J86A 1T20A 1Q9KB 5JQHC 4PJ7A 5CIPH 3WSQL 3GBML 3VD7A 5EORL 3IF1B 1DBKL 1F11B 1I3RB 2WSKA 2WUCL 4XBGA 1FORL 1QFWI 5E8NA 2R2HB 4S11A 4BA8A 4WU7A 4PV8B 1VFBB 1BBDH 4KRPD 3DXAD 1KJVB 4Z0XA 1YY9D 3G5YA 3ROOA 3ESVF 1EEYA 2NX5D 4JKLA 4Y19D 1KPUB 3CCHB 4TSAL 3IDMA 1J0YA 1S7UB 1BFVL 4WFFE 2ZSWB 2BVQB 4CU8A 5ACLA 4JFFB 3GSXB 3LH2H 3S8WA 2GIYA 1UVQB 2V2WA 4JO2H 3IAPA 1MJJA 4FP8L 3VFGL 5FYJE 4AIXA 3KPQB 4PLNC 3LKSA 3CDCA 2R56H 3ARPA 5L7XL 4X6CF 3D1MC 3CXHK 1KTDA 1MUJB 1YMMA 3SGJC 1FL3A 1A6UL 4KUZH 5EOCJ 3LKPB 4TVPL 4KMTH 4XBEH 1P69B 4OLVH 4MSWB 2YPLE 1MAJA 3TBVA 4UUJA 4L4VE 5AZEL 1YEJH 4RFOL 3VFVA 1YQVL 4P9HC 4KHXH 2DJSA 4TVPD 1S5HA 1H15A 3E6FA 3O11A 3QXAA 3VMNA 3N1FC 4XP6L 4HFWB 5HHNA 3V95A 3EDEA 1OAYH 1MCWM 1EAPB 4G7VH 4XVJH 5DWUL 4WHTA 3NPSB 1VGKB 5TF0A 1YN7A 1AD0A 2J8UE 2XQYK 2AJVL 3SKMA 1N26A 1QLFA 3HE7B 4Z7VF 5IVZB 3OZ9L 1OQXA 1XF3B 3C5JB 5IB2A 4PUBL 3THMH 3VH8G 5D2NE 5E6YA 5D1QD 1A47A 1OGAA 1EBAA 1FRGH 1U6AL 4FQIL 1TFHA 5IVXA 5CKGA 1G6RB 3EYUL 3PWNB 3QUZD 5I1KL 5C6TH 3RNQA 3GI8H 2HFGH 3NIDF 1FAIL 5I15L 1WBYB 5ID0A 5I8CB 1OHQA 4KQ3L 3S3SA 2BNUB 2B2XH 4N0CC 4KTDL 3BD4A 4OLUH 5AG9A 1D7FA 4ENEC 4ZXBC 3UCRA 3IDJB 4XC3H 1UGNA 2R2EB 4XNUL 3RWHA 3ARVA 2HTKC 4ZG1A 1JP5A 2AQ1A 4YO0B 1OTUD 2VLJD 3ZYIA 1EJOL 4IRJD 2H3NA 4X6DA 1MEXL 2AKRB 1C5BL 1IEHA 4JY5H 1F3DH 2X5PA 1F6FB 4ODWA 2R0KL 2EEBA 5CS7A 3SCMB 1KYOK 4ZAKC 5GGVH 3PQYD 3OKLB 3OAZK 5FM5O 4L3EA 3U7YH 3LV3A 1E28A 1HH9A 2YC1B 1OPGL 2A74B 2ZOLA 2R1YA 1FN4B 4WUUB 4HWEL 2VDRL 3EDKA 1GGYA 5F1NA 1AGCA 3T77A 3LMJL 1BOYA 1JFQH 1S9YA 5BXFB 2WINB 3KYNB 2IALB 2C1PA 3D3VA 4KKBD 4POZC 2VLKB 3ZKQD 5KSBB 1N5YL 4WFED 1QLRA 2I07B 1DANU 5FGCE 4OZHA 3HG1E 5SWZB 5F93C 1JN6B 4X6BA 4FZEL 4PRDB 5SX4I 5SWSA 1WZKA 1CG9B 4YDJB 2ERJC 3BGAA 4NWUL 1AHWA 3C2AH 3PJSA 4PJFE 1BVZA 5DTFB 1Q9WA 4X5XB 5SX4H 1XT5A 2XY2A 4M93C 4G8FA 5IW3A 1UH4A 3C5ZB 1KFAL 2QLVB 4EIGB 5HHMD 4FQLL 4NQSB 1G7LB 1NEZA 4N0FB 5GQBA 1GPOH 2IANB 4JQXC 4KDVA 1WCBA 3K8LA 1IGJB 3HA0A 2VQ1A 3D69B 4YFDB 1RZFH 3TWCH 3X3GL 4C58B 4R0LC 5C70A 5I1HH 5H35A 4YDLB 3CXDH 2ATPA 4HGKC 4F7EB 3QEQE 1X7QB 2FIKB 4LGRB 3ZTJG 4LFHG 5LGKA 4G9FD 1IGMH 4JFZH 4F9PC 3BP7B 3HZKB 3BH9A 5IHZA 2P7TB 5C0CA 5JIKA 3ABZA 1WWBX 1AP2A 1FG9C 5GZOD 1TCRA 2CDGB 4OFIA 4LEXL 1LILA 1MCSA 4GXVL 3SGJA 1CFSA 5ESVB 4DCQA 3NIGF 5JHDA 1DQLL 1T66D 4K7PX 2ZUYA 5FHAH 4DAGH 2QV2A 4XRCB 3TP4A 2A6IB 4MXWL 5DYOA 4PJCA 3W11C 3DVNB 3TA3B 2DM2A 1NKRA 3V5DA 1N0XH 3CIQA 3LQMA 2P8MA 3QWOB 4WNQB 3M07A 4ONFL 2WQ8A 3R4DA 1P4IL 2BNQE 4JE4B 2NW3A 2H1PL 4FHBD 3WJJC 1UB6B 1DLFH 3GKZA 4MDJA 4Z7WA 3UJJL 4NKMB 1OP3H 5CJQL 4P2QD 2ZJSL 1I8KB 4P48A 3QSKB 2ICWB 2V6HA 4U4BA 5IB5B 1ZT7B 4F8QA 5DD1H 4Z7OF 4QNPF 5JQ6H 4O00A 5DT1H 1B0RA 1ROWA 2DQHL 3QG6A 3FO0L 3MR9B 3D85A 4HIXL 1BQHA 5HHPB 1LEIB 3VE0B 5IFJA 4PJHA 1GOFA 4UT6L 4LLWA 2DKMA 5L6YH 1MOEA 5KW9L 3W0WB 2C9AA 1C7TA 2LTQC 1K8IB 4ZXBA 1UXWA 4OCMC 3I84A 1EAJA 1RUQL 1FYTA 4MNQA 4XWOC 5IMMB 4G6KH 1ZLWH 5D6CA 1CXFA 1TQCB 4HUWB 3JBG7 1DUYA 3UTQB 3H9SE 3TO2A 1QR1B 4PJ5E 4Y16D 4I5BA 4PLKC 3LEXB 3NTCH 3L1OH 3GSOB 1J0JA 4XMPH 5HYEA 4NHUB 3QUML 3INUH 2JB6B 5DD3L 4ZAKA 2VZ3A 3RU8L 1JZ3A 3QZWB 4YR6A 3DBXA 1CZ8L 4Z8FH 1EEZA 3P77A 3WFZA 5D2LE 4OZIE 1KIRB 2IQ9H 1FO0B 4ZDHA 5EFIB 3WN5C 4EBQL 3LQZA 3JWDL 3LDBC 3QT2A 1BOGA 1MHCA 1J1XL 4ACPA 5BO1L 5MEPA 5ITFA 1XCQA 3BUTA 4S1RH 2R4SH 4OIAA 3BP4A 3PP3H 1EK3A 4K2UH 5C3LD 4NQCB 2I9LB 3IXAB 4PGBB 3QI9D 3VA2C 1RVFL 1I1AB 3IJHB 1EHNA 1ORQB 3JV5A 4GKNA 1V3MA 3PP4L 5GISH 4FG6D 1W0VA 2JELH 4J8RA 4BM7A 3EHBC 1N6UA 3TIEA 2DMBA 3OR6B 5IGXH 1G7JA 5I0ZA 2F53B 4XVSL 4KZEH 3AXLB 5E8EB 1R5VA 2FJGB 3D18B 3FB6B 1AO7E 4LAQL 1J0HA 4GW5A 4ZUTB 1X5GA 1BEYH 4RBPH 3GSRB 3MV8B 4JQXA 1OAKL 2J7LA 1I7UB 1J1PL 1VHPA 2BC4B 1R3LA 1BLNA 4A2LA 1T89A 4HWBA 4JZJB 2G60L 4R0LA 5E2WH 5D71H 4WWID 4U6TA 1FIGL 4ELMF 1L0QA 2QQQA 4RQQA 4BFIB 4GRLD 2WZPD 2HG5B 3K2MC 3OHXB 4YHOH 1EMTH 4F9PA 1DLHA 2A9NH 2IF7A 3BQUC 1BIIB 2MMXA 4TUJA 4CMHB 2ORBH 1RIUL 1ND0B 4HX1A 1AQDA 1ADQL 1B0GA 2FEEL 3MLSH 4KROB 1J9CT 2LQRA 2P5EE 2X9YA 4HKZA 1LDSA 2DQFB 3ARDC 4A6YA 1NUFA 3EFDH 2BFVH 4PTUA 2YRLA 4YIQA 4QOKE 3KJ6H 4CVXA 3HZMA 3VFTA 4QXGL 5FB8B 3BO8B 3P0GB 1RK0A 2BJML 4FQCH 1ZA3A 4P3CH 2F54D 4Y88A 1FNSL 3WJJA 4JO1H 2PO6B 3HNSL 4LLMA 5I1IL 3DVGB 2MPAL 4UQ3A 1AFVL 2D0FA 3SDYH 3LHPH 1J8HD 2ZCHH 3WNNA 4PBWD 1YC8A 1SVCP 2EO1A 3GSNL 2MQ3A 5F88A 3UBXI 1KPVA 1ZAGA 4IDJH 1YUHB 3BP5B 4NNYB 1EFQA 4XP1H 1MHHB 4S1DC 2EKJA 4OFYD 4KK8D 4R9HA 4HK0A 3AU1A 3KXFD 5D70H 3VXSD 3EYSL 5K9JH 4GMSH 1XMWA 1YYLL 1BZ9A 4LVOB 5E8PB 4PJBE 3PWUA 4L4TD 4DEPC 5J12C 5KG9A 2QHRL 2E27L 1UB5A 2OL3B 1JUFA 3NCCB 4DUXA 2NMSA 3SKUD 4R4ND 4QF1A 1CD1B 1CL7I 1I1FB 3L3KB 4S10A 4TTGA 3FQWB 4M6AA 4KH2A 5F9WB 1AKJD 4NUJA 3MLZL 2OXHA 1NFIA 1CL7H 3FB5A 3P9MB 4BSJA 4HPYH 3BKJL 1FVEA 1IC4H 1QFUL 3WN5A 2OSLB 4X4XB 4JM2F 2FX9H 5CJOL 2P8PA 2ZOKB 1FNHA 1QEWA 5CJBA 1RJCA 25C8L 3X17A 4KJQD 32C2A 2VXTL 2RGSA 4UT7L 5CZXC 1I7ZA 2WWKT 5CBEB 4Z7UE 5JDSA 1JYWA 2IPKA 4O58L 3C87A 1U91A 4PJDB 1HKFA 3STZA 1ONQB 1UENA 3RIAK 1AGEA 1WT5C 2YMXH 3PL6D 1IFHH 2XRAH 1RUMH 1DQJA 4OTXH 1K9TA 4R26L 4JDZA 1I8MA 1HINL 4RISL 3O2WH 1U8OB 5FYLL 1R0AH 4HS8L 4JJ5B 2X40A 3WXWH 5DJ6B 2OK0H 3AMKA 2FEDD 4K94C 4KKCD 1E0OB 3ESUF 2BSRB 2PYFB 1IZKA 3NCJL 1UZ6E 4YHML 2XG5A 4LHUD 1QSEB 4FRWA 5C0EA 2R29L 4YEFA 1MIML 3QJHA 1K4DB 1HEZB 1C5CL 4K3EH 4I77H 1LE9A 1Q9LA 1WVZA 1VENA 3X14A 5I8EB 5EU7E 3CSBA 3TCLB 3BQUA 1TJHL 3VW3H 4CN4A 3RTQA 1JL8A 5EPMB 4OLEA 4ZUSA 1P4BL 5DRZB 4NO0B 1BAFL 1WC7B 4Q9CA 1ZTXH 1PG7H 4WI4A 1VA9A 2WM0A 5CP7A 4D9LL 4GG6F 3QCVL 4MNGB 3ARDA 3SDXE 5F7HA 2WIIB 4PGCB 4PS4H 5HYJA 4RAUB 4M7ZC 1KEGL 4HH9B 5D2NC 4CJ1A 4I4WB 2B7DT 5FM5M 4ZODA 1D9KB 3WL9B 1JF6A 2WBWB 3KPMB 1A6TB 4BZ2L 3I6GA 2F8VA 1AXSB 3DV4B 3BPLB 3NGBC 3BJLA 2P46B 4WFHD 4KY1L 1RMFL 5EOTA 1IM9B 5GS3A 4F7MA 3T65A 3QQ9D 2DYPA 4PP2A 4KRPB 1ZGLP 4I2XB 3V6BR 5D5ME 4X9FA 4J23A 2NX5B 3QDAA 1G9NH 1S3KL 3QFJA 4DKFL 1YMMD 4NKOB 4P57A 3BT2H 5FDWA 1SM3L 5IFAH 1UM5L 1PJ9A 2V7NB 3IJSA 4HG4K 2K3TA 3O3DB 1FVDA 4LSSH 5H37H 3TT1H 4YDKL 3C09C 1HDMA 3BJ91 4JM2D 4CU7A 2Q20A 5IEHB 5L2KE 1JNHA 4ZO9A 1CU4H 3I50L 1JZ7A 1FCCA 4XPTL 4LLVA 1RK1A 3MLVH 4OQTA 2ICWJ 3GRWA 4XPHL 2X4SA 2CIKA 1PZUB 5GGTH 4GW1B 1MCFA 2XOTA 2C7UB 5FFLA 4FTVA 3PHSA 5AG8A 5FA4B 5IF0A 4PR5A 4ZUUA 4WIQA 1V8HA 4V2CB 5H2BB 2XZQL 2HRLA 3U4EA 2ZSVB 1MELA 3L3HB 2F15A 5EUOF 3MNWB 4GQPH 1IAKA 1MIEH 1WBZB 4IRZL 1MCQA 5IESH 3GMPB 1UH3A 4I18B 3VI4E 1AXTL 1KC5H 3MQIA 2GSGA 2X1PA 4D0DA 1HZHH 1U41A 5D1QB 4D0CA 3QUKA 3X11B 4AM0B 4ZFFA 1CD0A 5SV4A 4Z7WF 2G5BA 3ZSSA 5IB3A 4NSKB 2V5SA 3P30L 3E8UH 2P42B 1PVHA 2ZWLT 5HGAB 3WFBL 1TPXB 2H2PD 4NZUH 3ZO0A 1LO4L 1WT5A 1G7HB 1U58A 4R96B 4Z7NF 4H88H 3C8KA 1XFPA 4G42A 3HMXH 4NQXB 4YHNA 3UMTA 3ZLQC 4Y1AD 5B38B 1N3NB 5IR1B 1N64H 2Q7NA 5A3IC 1XH3B 1FZMA 5BJTA 3FO1A 4WW2C 2YOCA 1VFAA 5A2KH 4IRJB 4NRXB 3L9RB 2X42A 4Z76A 3ARUA 4G80A 3PWPD 4LSRL 5T3ZH 5ITBL 4LLDB 2R9HD 3D3VD 2NW2A 3ZE0F 2VITB 3VD3A 5DEGB 2NNAB 1GZPB 3ZHLA 5EZOH 4Z18A 2J12B 2JK5B 2YPLA 4L4VA 3GO1L 4YXLL 1EXUA 5SWSD 3V52H 2EDTA 1FG2A 3C8HA 4QGTA 2B5IB 4O4YL 1JV5A 5LVEA 5KVDL 5FK9B 4HV8A 3FTGA 1BVKA 2APFA 3O2DH 5DQDH 2FECL 3QBTB 2J8UA 3W5MA 5FYKL 4LF3B 1NFDE 4LBEB 1I1CA 3HN3A 4HIIB 4QTHB 3VXNA 3WDHA 2VL4A 2COQA 4P2OC 5FDYA 4EI5B 4GRMA 4NYLB 1N59B 5D2NA 5GJSL 5JIIA 2BZDA 3CZFB 6FABH 3PHOB 1I3GH 1YEDB 3V5HA 5E8OA 3B5TA 2A73B 4R7DB 4XH2B 2L0DA 2X4OB 4X5WA 1CFVH 3P0VL 4MXVF 1N2RA 4X4ZA 3CU1A 5DR5H 3TJHC 2UYLA 4MDIB 3QEUA 2IQAB 3CDGA 5HHMB 2DQDL 1MRFL 3W9DB 1B4JL 1J18A 4H0GA 1JMXA 3S96A 1F4XH 3G5XA 3O6FC 3VH8A 3ULUH 1S7QA 4KV5E 5KSVA 1UQSA 1KNOB 1XIWB 4P9HL 5JHDD 2A6DB 1DSFL 2ADJB 2DBJA 1ZLVK 5F7NC 4G9FB 2DIAA 3DTXB 3EO9L 3QCUL 3TFKC 2J8OA 3KPOB 1QNZH 4Z7VB 4Y5YB 3FT4B 4JO3L 3G08A 1NGXA 1CF8H 2XPGB 4XHQA 1N7ML 5F1OB 3TC9A 4ZS7H 2BSSB 2VDQH 3DGGB 3FQUB 2Q6WA 3SDAC 1A4JB 1G9MH 4HUMB 4O5LH 2MNUA 2C3GA 1CFQB 3MACH 5ID1B 1UJ3C 3NZ8B 4B41A 3D48R 4PJ8C 3S3JA 3A6CH 1VERA 3IFOB 1FZOA 3SE9H 3HG1A 1EVUA 5TDPB 1Q72H 3D85D 3PGDB 3BWAA 4K07A 4R3SB 5B8CC 1JK8B 4P2QB 4PJFA 4JPVL 4JLRB 3MRCB 4N0CD 1ZHLA 4LEOB 4F37F 5JZ7C 1S8DA 2UZXB 4JFPA 4ENED 3UYRL 4UI2A 2MHAA 3VFSA 1JPST 2PTVA 3O9WC 5DS8B 4IOIB 5J6HB 2BOCB 3T0XA 2E5EA 5TDOA 3LKNB 5T1MA 7FABL 2FO4B 2EXYC 3ARFB 4YGVB 3GK8L 5DMIH 3MV7B 5EWIL 3OJMB 1X4YA 2BY2A 3P4NB 3QULB 5I74C 4HSQA 3WDJA 3RWDB 4EJ1C 5FHBH 4HC1H 15C8L 3AREC 1CGUA 3S34L 4P5MA 3QEQA 4WW2A 1K8DA 4L1HA 3F5WA 3GHBH 2QBWA 4TOYL 3MLTB 3IDUA 1M7IA 2RQ8A 3FONB 5I17A 3B6SA 4N9GA 4D3CH 1KB5A 5C9JA 5IVNA 5I1AB 3EYVA 3ZDYE 3T8XB 3CH8A 3DRTA 3QUMB 5CAYB 1QP1A 2ILLA 4MA3A 1LEKA 4JQVC 1ZOXA 4IS6B 5E00B 2X9XA 3O6ML 3GUTA 5L0QC 3O4LB 3UPCA 1MQ8A 1GC1L 2JB5L 4DKEH 2Y25A 1H3XA 2H2SC 5IMOA 5GS0H 2BNQA 3QHFH 1GIGH 4EQ2A 5F6HJ 3D6GA 2D3VA 1NJ9B 5EZLA 4JPKH 1WIOA 4P2OA 2ZCLH 4HWBL 3QNYB 1I3VA 4L3CA 5DURD 1A9BA 1JE6A 4N0UB 5FOBA 3QNXB 4KTEH 3UTPE 1DQDH 5E94B 3K7UA 2APTA 4PRHD 4KDWA 2BVUA 2EDYA 3OKOA 3TZVB 1A3LL 3MRNB 3O6FA 3ZE1E 4GG8A 3FQTB 3D39B 3S35H 1P4LA 4X98A 4XP9L 4P2CG 3CUPA 2JJTC 2QR0B 1JPGB 1GL4B 2KZ1B 3UO1H 4A6YL 3GJFA 5GRWA 1XGRA 4XPAL 4PJ5A 4RMRA 5C0DB 3SGDI 1BHGA 4Z0BH 1TQBC 3OKYA 1C5DA 4XCYA 4ZQKA 4OCYH 5IEKA 3STBA 3VXRB 4K3DL 5LQBH 3I9GH 4M1DH 3SGDH 4APQB 3L7FA 1ZVSA 5FV1L 1IRAY 3EOBB 3LKRA 4ZFOB 4OD2A 2CRYA 3SDAA 5D2LA 4OZIA 1QSFE 3V6OE 4N90D 1XCTA 2Q8AL 5MEND 2KKQA 2AJYL 4O51A 5JO5A 2CO6B 1UJ3A 2UUDK 4PJ8A 4P9ML 1WSST 2EDJA 4HMEA 3MBXL 2EZ0C 4QGYA 2BXYA 2FSEB 3LSOA 5HXMA 5ETUB 5L9DH 2ARJQ 4OI9A 1A7OH 3EO0B 2A6JA 1U8KB 1R3JA 2F54B 3MA9H 5LGHH 4HEPG 3RWCB 5FYKU 2D7TL 3F65A 2Y36L 5B8CA 3DV6A 1FH5L 2FB4H 1UACL 4PRPD 2OJEA 4MJIE 5CUSL 2OJZL 4EI6A 2HLAB 5E4IA 1DBAL 4DN3L 1TJIH 4KI5D 4J1UB 1UWXK 4YHLL 4LOUC 4XWOD 1CDGA 3O9WA 1X5IA 3PNWA 4OT1L 3B9KC 2VC2L 1AO7A 5DRWA 5E2VH 1CXHA 3GMOA 4PLKD 4PREA 4H8WC 2YA2A 1TJGH 1AE6L 3KXFB 2ESVD 1FIEA 3VXSB 1JNNL 4MJ4A 5KSBE 1BM3H 2VLKE 4UINH 3RPIB 5CMAA 5L88L 1KLGB 3AREA 5LGJB 3BXNB 1QRKA 4CVWA 2Q76A 1NBQA 5SWZE 3ZYOA 1F5WA 43CAA 4LARL 4S1QH 2DIBA 4MAUL 4PJEE 4YE4L 1MY5A 4EVNB 1A3RH 3NCYS 4XPGH 3RWJB 1GYAA 4U7SA 5CZVL 3KPSD 4K71C 1ZHKB 1OD7A 4OUUA 4AK1A 3L3DB 5I18H 4KKNA 1MRCL 1LO5A 4LCYB 1KCSH 1T80A 3WIFB 5IOPB 2P5EA 3ARBC 4Q9RH 4JQVA 2GSIB 4UV4L 3ZTNL 1HXMB 1OOAA 2FZ3A 3CGTA 3D9AL 2Y06H 4EDXB 3HNVH 4QOKA 4YWGL 4TN9A 3WEXA 2K7PA 2QQLH 4EUPH 4OD1H 1IGYA 1JWMA 1FVCA 4M4PA 3GM0A 1OWRM 4ERSH 1MAMH 3NMEA 1J5OH 4TNWK 3GMMB 5GRJH 3DYOA 4DOHB 5MEQA 4AL8H 4NZTL 5KVGH 1S7WB 3NFPA 3WKMH 1NUGA 2DLIA 3A6OA 3H3BC 4MX7B 1MFDH 3PL6B 4RAVA 3U0TA 4KMLB 1CLYL 5JA8B 1F02I 2ZUSA 1EGJA 4X6EB 4G3YH 1JIBA 5CJ5A 4NDMA 4OKVA 1CQYA 2NTFB 5HGHA 5E6IC 3O3AB 2V2TA 3NCBB 4JR9H 4QRTB 1TZIB 2YD4A 3DUUB 1ZGLA 3BQUD 4OZFB 5IMKB 4PJBA 2JJTA 4NJAL 1QYGL 1NCWH 2A83A 1BGXH 2CLZA 2H26A 3STLA 5KOVC 5C0JA 1F2XK 1W8OA 2EIBA 3I3DA 1YYMH 3BE1L 2H45A 2P48B 3RVXD 1JGUL 3MOAL 4JG1H 1RZ7L 2FO1A 3LEYL 4O2EA 2Y1VA 4QHUA 1UYWL 1OTTC 5IJKA 1T20B 2DQCL 3U7WH 4PJ7B 1RZKC 2X10A 4K9EL 2XWJA 2V5YA 2KH2B 2VLRD 3CVHH 5ALCH 3SDCC 4HBCH 5E2TL 2AK4D 4XBGB 5E8NB 4NUGH 3W0WE 1ZLSL 4KK6C 3UBXG 2WLYA 2VXVL 2P5WD 4AENA 4M8VA 1ZLUK 3LRGA 4Z0XB 4X99B 2NY5H 3G5YB 2B39A 4YXKL 5D7IF 4S1DD 3VWKC 1EEYB 4HQQL 1YJDC 1XGQB 3IFLH 4Z7UA 4DFIA 1ZT1A 5BOPA 4PJ9C 4UU9A 5FOJA 5JHLL 5HSFA 2F9BT 1MH5B 1MJJB 1JWSA 4FOMA 5DD0H 4E42A 4M6NL 5F7UA 1NCAL 2GITA 5D1XC 3LKSB 4PB0H 5DLML 1JHLH 3W81A 2OX5A 4Y8DC 2E7CA 4OQTL 3IYLW 3B9KA 3GRWL 4XPBL 5BQ7A 1KTDB 1YMMB 1FL3B 4DGIL 2OR8A 3JZ7A 4D9RD 5JIHA 1QRND 4NKDA 3TBVB 4UUJB 2J4WL 3EAKA 3VFVB 4YAQA 3VG9C 4FTVD 1BVLA 1VADA 1V7NL 1H15B 3E6FB 3O11B 3QXAB 4GRWB 1A2YA 3ZDZE 2I60H 4G8EA 3GHEL 4WHTB 1GJIA 2EDWA 1YN7B 1AD0B 2MQ0A 3UYPA 2IBGA 1QFPA 3SKMB 1A1NA 1QLFB 4LPXA 1WEJH 1YEHL 5IB2B 3QXTA 1G7MB 3SKOA 5IVXB 3FFCE 1NGWA 5F8QC 3ARBA 5CZXD 5E9DE 5JNYA 3RNQB 1P5VA 3V4UH 4YDIH 3SDXA 1KJ2H 4RGNB 4PJIE 5ABDE 4XAKE 5ID0B 2EH7H 4LCIH 2VXSL 1PY9A 4AQ1B 1A1OA 3EDDA 3CLFL 4J4PA 1C1EH 4BZ1L 1ORSB 4K94L 1RJZA 3TJEL 2MCPL 1NL0H 5FYJL 3RWHB 5ACMA 3FN3A 4JEGB 1NLBL 1XF1A 1G0YR 1DDHA 2H3NB 5FGSA 4X6DB 4X7FC 2FGWL 2W9EL 4U7MA 1QPXA 1ACYL 5D5MA 3PXJA 4Y4FA 4ODWB 3OX8B 3OL2A 5HHQA 5IMLA 2JJUA 3WHE1 4L3EB 3FHAA 3B2UC 1E28B 1HH9B 5E6IA 1JRHL 1OAQH 2EDFA 2GJZA 3WDIA 5DEZA 5F1NB 1AGCB 3EOAA 3T77B 5IV2A 1TTGA 4DQOH 1S9YB 1YEGH 3L95A 4WW2F 3D3VB 2C1PB 2I24N 5E4EB 2Q87A 5L2KA 1BJ8A 2DQGL 3U82B 1FGNH 1I9JL 1NCTA 3KYKL 4OZHB 3KPTA 2GCYA 5DHVA 4X6BB 3ZKMC 5HYSG 5SWSB 4JZOA 1MI5E 3K46A 1AHWB 3PJSB 1CK0L 1Q9WB 1EJ6A 1OM3L 4G8FB 1U3HC 3SDCA 1A6VL 2ZNXA 3MFFA 2CSPA 2D0HA 4PP1C 4V2BA 3VCLA 3CFEA 1KENH 3UROR 2UZYB 1B6UA 4FQPA 3FFDA 1OW0C 4LHQB 3VWKA 4Y7MA 3C6SA 5IROC 3GNML 5H35B 5H37G 4PJ9A 1BZ7A 4MNHB 1F42A 3U9UA 4CMMA 1OAUL 4KU1A 4JY4B 4P99A 4N1HB 1RU9L 3C5SA 4GAJH 1RZJL 3BH9B 3IFNL 5IHZB 5C0CB 4JN1L 3RZCC 2EDNA 1AP2B 2GJ6E 2NXZC 1TCRB 3FQNA 3MRLA 3G5ZA 2CR6A 5JPMA 1CFSB 4XPFL 4DCQB 4CBPA 5JHDB 3OKDA 4NBXB 3ALPA 4U1KA 4LU5H 4NO5A 1PLGL 5DYOB 2ZNWA 5EUOB 4U3HA 1F4YH 3SHSA 1E6OH 3MNZA 2YS4A 2AJXL 2K7QA 4ZPTA 3V5DB 1CE6A 1J12A 2P8MB 4XP5H 2VLLA 1A9EA 3HG1D 2NW3B 4DVRL 1FZJA 4MDJB 4Z7WB 5TE7L 1L6XA 1UCBH 1FLTX 4YK4C 3WIHA 2AW2A 5D2LF 5ESQA 4OZIF 3FN0L 2JJVA 3P40A 3U0PA 5C8JA 1A0QH 1B0RB 12E8L 4JN2A 1NFDA 3ULSA 3D85B 1LE5A 5D7LD 1BQHB 1NCNA 5IFJB 3ELAT 1K85A 4LLWB 5CIPA 4NIKB 3VGEA 1OL0A 5GRUH 1MHPL 3X12B 4FQXC 4M5ZH 5BRZD 4ZXBB 1UXWB 2OMBA 1E4KC 5EN2A 4XXCC 4MNQB 1IAIL 4RMUA 5J6GA 3B2VL 4MD5A 5D6CB 3UJTL 1KB5L 5F21B 3B5HA 1DUYB 1F00I 3C2SA 3MO1A 3TO2B 5K59E 3UPRA 5J1TC 4I5BB 3VD9A 2A77L 5IG7A 1KIPA 4PY8I 1CTNA 2X4RB 1L0XA 5BVPL 4ZAKB 4ZYKA 5I30H 5GGRY 2V9TA 4YR6B 3DBXB 1JGLH 4OLZH 3EZ8A 1EEZB 2YPVL 1S9WA 2DJUA 3P77B 4MNGE 3BGFC 3S5LG 4U1MA 3O8XD 4ZDHB 5JXEC 4ESKA 2AXJA 2VH5H 1NMAH 3SKJL 4PBVC 4MJ6A 1I9IH 3LQZB 1IGIH 4LFHD 2IADA 1BOGB 3BN3B 1MHCB 3H2WA 4KVNL 5K33A 1WFTA 3RDTD 2QSCL 4WENB 1B6DA 5I8OH 1R24A 1X4XA 1NUDA 5F1KC 3V6OC 5MEPB 5ITFB 1XCQB 1HHKA 3BP4B 4GKSB 1AJ7L 2AXHA 2ERJB 1GXEA 5KOMC 3DXAE 2VWEC 4GKNB 3QO0A 2V17L 5CZKA 3UTOA 1W0VB 3A67L 2EDLA 4J8RB 4Y19E 4M93B 3ZT7A 2NLJA 4QHMA 5ENWA 3TIEB 1ZWIA 2XZCL 1G7JB 4LKXA 4U1LA 4LDLB 1HILA 4OIIH 4YPGA 5F89A 1QBMH 4GW5B 5KSAC 4BQ6A 2X4UA 5I1GH 2Y6SD 1KIUA 3GSQA 1OW0A 4CUCA 4R0LB 4JGMA 5DI8B 3ILQD 5C0IA 4OBRA 5FYJU 5AZ2H 1G0DA 1A21A 3C60D 5AUMB 4PJ5D 5B4MC 3LS4H 1DLHB 3ULUE 1YY8A 3QPXH 4O02L 3HUJE 2A38A 3RZCA 4EDWH 4TUJB 3VMPA 3ZE2E 1T83C 1T0MA 4HX1B 1AQDB 4OBSA 1ZANH 4HIJA 4JY6A 4XCEA 1I1YA 1B0GB 3O0RH 4KK9C 3SDAD 3VRJB 2BHUA 4HD9A 4HKZB 1U9KA 1MCKA 3E3QE 3DARA 1IT9L 4A6YB 2G2RA 2WANA 1FBIH 4PJ8D 4PTUB 4YIQB 3MLWH 5IJVA 4CVXB 3HZMB 3E2HC 3VFTB 4ZTOL 1RK0B 1ZA3B 4Q58C 3S35X 4BSWA 3BKYH 4C83A 1RIVL 1MREL 2B1AH 3HC3H 3NZHL 4LLMB 2A9MH 3CFBA 4UQ3B 1Y18A 1J0ZA 2AQ3A 2NR6C 3DX8A 4D0BA 1KPUA 3CCHA 1BJ1J 2WP3T 4BJLA 1A7PH 3TV3H 4DZBA 2VDLH 1RIHH 2Z35A 2X9WA 4M7KH 4K7PL 2VLJE 3HZYA 3DX6A 43C9B 1NSNH 1AR1C 3AU1B 1J8KA 4PRPB 4AY0A 3DYPA 2XWTA 2A1WL 5LWYL 1N6QL 3QIWC 4FQXA 1IBGL 4L9DA 4BK4A 2LTQB 3PQYE 4Z7UF 1BZ9B 2ZUQC 4YPJA 4XXCA 2XQYG 3PWUB 2XQBL 3ARED 4JO4L 2PW2B 4AMKL 4XBPB 1T2JA 1H0DA 3HRZA 1FE8H 1UB5B 5E08H 1HI6A 1QKZH 4EOWL 1NBVL 1CBVL 4QF1B 5KSUA 4TTDC 1KTKE 1MLCA 2WBJC 5EU3A 4NUJB 4WFEE 2ZPKL 1VGKA 2IWGA 3WHE0 3FB5B 1ZVYA 1OD9A 5I19H 2AP2A 4RGOH 1UZ6F 4YUEH 2XZZA 4MXQD 5F6IC 2R2CA 3VWJD 5JXEA 1A6WH 1J0KA 2QADC 3WN5B 4J2XA 3UTTD 4S1SL 3KPSB 3FAXA 3T3MF 3LDBB 5I71C 4XVTH 2P8PB 2B1HL 1LO3H 1IAOA 1QEWB 4OGZA 1UWEL 5CHNA 1JZ4A 4MA7L 1DTUA 3AC0A 2BNRD 2DF3A 4ZO6A 5EBLA 1T0NA 2Y5TB 5M95B 1QSFA 3V6OA 4X6CE 1PBYA 1WBYA 32C2B 1OVZA 3SOBH 5I8CA 3RA7L 3VFUA 1IC7H 1SMAA 5JDSB 2IPKB 4XNYL 1U91B 3STZB 5FUZH 3QUXC 1AGEB 1EGJL 5JLZB 4LDOB 5ADOH 1DQJB 4E5XA 3SEPA 4JDZB 5ICYB 3IDYC 1YEEH 4KWUA 1I8MB 1YEKL 3GSUA 4Y4KC 1RY7B 5KAQG 2AK1H 5AYUL 4BFBD 4RWHA 4U1GC 1MJUL 5KSAA 3T0AA 2YZ8A 1K6QH 2I5YL 4G9FE 4MJIA 1MJ7H 2H41A 3U9PL 3KR3L 1H5BA 4LQ1A 3CLEH 5D72L 4ZOCA 3HLAB 5C0EB 2WV3A 4YFLI 1MFAL 1WGOA 3QJHB 3QDGD 3IAGC 4PRAA 1LE9B 1KXQE 2NY1D 1A4KB 3X14B 2VE6A 3ECBA 4HFUH 4IRSC 4YHYC 1YNLL 3NIDE 5KSBA 3BQUB 4PY8J 3VXPA 3TIDA 4M62L 4L8DA 3BOVA 1T83A 2YRZA 5TE6L 1QSVA 4NJ9L 4YHZL 5F7EL 2YBRA 3BIAX 5SWZA 2FDBP 4UIKL 4UB0L 4PRDA 4ODTL 4KI1A 3DI3B 4PJEA 3H0TA 5CP7B 2EC9T 4P2QE 3NH7H 4MB5A 3ARDB 3KS0H 2FWOA 1I75A 5TPWH 1FDLH 1NGQH 5HYJB 4NQED 2VIRA 3BN9C 3CMOH 5JW5A 1MQKL 1LO0H 4MWFA 4OCSL 1CIUA 3O41B 2R8SL 3C5ZA 3BZ4A 1V7MH 4FXKB 3O45A 2Y07L 1WZ1H 3QUYC 2Z31C 3I6GB 5J8OA 4N0FA 2MTPA 3OAYK 4M5YL 3W39A 4HJJH 3MXVH 5J0BA 4M48L 4WCYL 3MUHL 5BV7H 4F7MB 2XN9E 4NC0B 3T65B 1SMOA 3ZDXF 2DYPB 4PP2B 4PYGA 2YA1A 4U2ZA 4H8WL 5GS2D 2BK8A 1IC5L 3FB8A 3B9KD 3LEVL 3QFJB 4MCYA 2X7LA 4YC2C 3EJZC 4NC2B 3MV9D 3BP7A 1UM4L 1V5JA 2AJSH 4GAGH 4P57B 1RZIA 4K3HA 5FDWB 3X13B 5FECA 3QIWA 2CKBH 3QRGH 3BDBA 2RCSL 3IJSB 2W0KA 4OLYH 1FVDB 3SE8L 5IBTH 1T1YA 4WI9A 4DEPB 3IDXH 5J12B 1HDMB 3VFOA 1KEMH 1TENA 4R97C 2OP4H 4R4BA 3K4DA 1JNHB 5LAXA 4QHKJ 1HSBA 1L7TH 5CCKL 4TPRH 3SQOL 4LLVB 1RK1B 2YXMA 3DVNA 4LSQH 2X4SB 2CIKB 2OTUA 2ID5A 4M1GH 3EZJB 2WBJA 2IAMD 3QWOA 1IAMA 2FBOJ 3Q3GA 4FTVB 5J57B 3GBMH 2UUDH 5IF0B 4PR5B 4ZUUB 4M43L 4P46D 2WUCH 3U4EB 3QXVA 3T2PA 4YBQC 4EUPG 1MJ8L 5HDBF 1T6WA 1IAKB 3WO3B 1CFTA 4R6UA 4LVNC 3LCYA 4TSAH 4D0DB 3NBNA 4D0CB 3F58H 4ZFFB 1QTYT 4BKLA 4HK3N 2P8LA 1KN2L 2NY0C 2G5BB 5IQ7L 4QRRD 1CLZL 4LCUA 1EVTC 3ZKSD 4F9LA 4R90L 5D1ZD 1PKQE 3NIGE 3W0WA 4K3JL 5L7XH 1X5YA 1LK3H 2ATKA 5F1SA 2HT2D 2WWKO 3LB6C 1WBXA 1U58B 4ZTPH 3C8KB 4G42B 5L2JB 4Y4KA 1Q0YL 3RVVC 3CSPA 3WUWG 3BKCH 1WV7T 1JGDA 5FV2A 5AZEH 3GKWL 1QR1A 5TE4L 1D5MA 4Z6AT 2O5ZH 1FZMB 1GHFH 4N0YH 5E6ID 3FO1B 1YQVH 1S7SA 1QOKA 1HH6A 4Z76B 1ED3A 1G9NC 4C57C 4WRLA 2VISA 4WI8A 2PKDA 4N5ED 1MNUH 5B39G 2R1WA 2ADFL 1S7TA 3HPJA 4UDTA 2D9CA 4WV1C 2YPLB 5I1JL 1EXUB 3PG2A 1RZKL 1FG2B 1OTTD 1KELH 4ZS6C 8FABB 4LRNL 4WU5B 3FTGB 4D9QE 3MLUH 1BVKB 2IPTH 3TESA 2F54E 4RFEA 1FAIH 1RQ5A 1MVFA 5JTWA 4MD0A 3SDCD 4DN4L 3CK0H 4ONGL 4KQ3H 4P23C 3IJHA 4KTDH 2WNGA 1J8HE 4KK6D 3VXNB 4M7ZB 1YJDL 4GRMB 4MAYC 5D2NB 2W59A 3CDYA 2YR3A 3MRGA 3FFCA 3D18A 3FB6A 1NLDH 3QUYA 5E9DA 2Z31A 3V5HB 5E8OB 1EHXA 4WGWB 4X5WB 2HA1A 4PJIA 4PJ9D 2Q8BH 3NGBB 1RZGA 1N2RB 1C5BH 1FPTL 1MCNA 4WO4C 1SJHA 2UYLB 3QEUB 4BELD 2FR4A 3CDGB 5DQJA 1MHEA 4M7JH 5DJZB 3VXSE 2BC4A 2UWEE 3WXVL 1JZ6A 3N1MC 4E41E 2CLRA 3DURA 5D1XD 4XMLH 3U83A 5I1LA 4HIHA 2IG2H 3S96B 4L4TE 3G5XB 3VH8B 2Z8SA 2VDKH 1O7VA 1S7QB 3KPNA 4K23L 3QQ4A 4GSDL 5KSVB 3H7BA 2PR4L 1UQSB 4XAWL 2V5RA 1BIIA 5ADPL 4XWGL 5HPOA 5DZNA 1N5YH 4ELKB 3C09B 5HYQA 2AEPL 5E2UL 1CE1L 3FMGL 4OCWH 1JGVL 1NGXB 2EE6A 5EZIH 4F58L 3HFMH 3WIHL 3L5IA 4JVPA 4HH8A 1M7XA 4G7YL 1U92A 1OF2A 1PX4A 4PPTA 5KJRH 2E9BA 4NPYA 3W2DH 2R69L 4Y89A 5FGCB 3KYOA 1ZLUH 3OKEA 1FZOB 3P2TA 3HG1B 1CGXA 4J3XA 3QDME 4LHUG 4DVBB 4ELME 2XACC 3BWAB 1P7KA 1ULVA 1MI5A 1C08B 3DUHA 4PJFB 3OXSA 4M4RA 1ZHLB 1YUHA 1S8DB 4RGMC 5HGGS 4XI5C 5HI4D 4JFPB 2W92A 1BBDL 4GQ9H 1WWAX 1OAXH 4XT1C 2MHAB 1SY6L 3VFSB 5I6XC 5F44A 4O9HH 5TDOB 1CGVA 4XCNA 5T1MB 4HS6A 5HYSA 2CJUL 5IKCA 3LH2L 3UZEA 4JO2L 4G43A 1OCWH 5BRZB 4AEHH 1DQLH 1K2DA 1AQKH 2BY3A 2R56L 3B2UD 1LQSR 4P5MB 3QEQB 5JW3H 4WW2B 1CD1A 1I1FA 2BHZA 1K8DB 5INDA 4KUZL 1M7IB 4JFYA 4KJWD 5GRVL 5I17B 4KMTL 3ULUC 3B6SB 4ONFH 4N9GB 3ULVL 1KB5B 5C9JB 5JW4Q 2GJ6A 5I75C 1YEJL 5IW6A 1LVEA 4KHXL 5CWSB 3EYVB 2QSVA 2DQUL 5GSVB 3J8F7 1JPFB 5DFTA 3DRTB 1OAYL 4WV1A 1EO8H 3ZKMD 2NY4C 4MA3B 4X4XA 1WTLA 4GXUN 3ZE1F 4G7VL 4XVJL 3WUZA 1LEKB 5DFVC 5JR1L 3E3QC 4BSVA 3BD5A 3GUTB 3PDOA 4NZJA 2DQHH 4LCCC 5TFSH 3THML 3QUZC 1G9MC 1U3HD 3QWRA 5IMOB 2BNQB 5GGTA 4JCMA 4S2SA 4GKZA 4M6MH 4UT6H 4P23A 4HXAL 1CGWA 1HIMH 2N7BA 3FT3A 5KW9H 1MRDL 4F3FA 5C6TL 3GI8L 4P2OB 5LCVH 3X3FH 4MAYA 1WTGT 4UDUA 1ITBB 1IKNA 4F7TA 5EU5A 1U8OA 2AEIT 1A9BB 4OLUL 4CAGA 2NY3D 5FOBB 4WO4A 3KYAA 1N0LA 2DMKA 4XC3L 5DK0B 4IHOA 1ITCA 4ODSH 4JFEE 4LP5A 3OKOB 3RZCD 3DETD 3O6FB 2NXZD 3HZVA 1K4DA 4GG8B 4JFQA 3LKOA 4XNQB 2FATH 4JY5L 1P4LB 3CUPB 2F19H 3VJ6A 3F7PC 4CN1A 5GGVL 5T1KA 5F7DA 3GJFB 4HUVB 3JWOH 1XGRB 3TCLA 1Z3GH 4PJ5B 2OI9C 3V7AG 3BX7C 3HMXA 4RWYH 3RNKB 1C5DB 4XCYB 4ZQKB 1U8PA 4N68A 5IEKB 1U2CA 4NN7C 1TMCB 5A2JH 5DRZA 4NO0A 3H3PL 5BO1H 3BISA 3UTSD 1ZVSB 3MUJA 4MCZA 1NGPH 1O0VA 3LKRB 2V5MA 4OD2B 4MNGA 3J7HA 3SDAB 5D2LB 1PGRB 4OZIB 1RVFH 1QFHA 4G5ZH 1XCTB 3PP4H 3OMZA 2JCCE 4LMQI 4RAUA 5F7WC 4O51B 2D03L 5JO5B 4E0RA 1UJ3B 4I4WA 4PJ8B 3SE3C 3V7AE 5L8KB 3C2AL 3LSOB 5EUKA 3CH1A 4M9OA 1R3JB 4P4KC 4WI3A 5B8CB 3DV6B 1J1PH 1MFCH 3DXAA 3O2DA 1UADC 3RGVD 3EKCA 4OLXH 2OJEB 4EI6B 5GS0C 4OCLC 4Y19A 4Y1AE 3LQAH 3ME0A 4PLOB 3O9WB 4P2RE 3UTPD 3PNWB 1RZFL 2EC9U 4PRIE 3TWCL 5DRWB 1AO7B 4WUKH 3RVTC 5HI3D 4JQIH 4LLAA 5I1HL 3FRPG 1QSZA 3GMOB 4PREB 3FAWA 3PWPE 3H6JA 4GG6E 3OJVC 1SHMA 2AI0L 5I74B 5GZOC 1ADQH 1IGML 5CMAB 3AREB 2Q76B 2Z4QA 3GMLA 43CAB 5JXED 1URLA 1MF2H 4JRXE 3MV01 3HUJA 1VDGA 4JM4L 4OUUB 1A6AA 3MBED 4DAGL 5AAMA 1HWHB 2YK1L 5C0BE 3L3HA 2IMNA 1DN2A 4QWWD 1LO5B 3DNKA 4QXTA 4QLRA 3HNSH 3L3IA 1KCUH 1N0XL 1QSFD 1MFEH 1AFVH 3V9FA 2FZ3B 5L0QB 1DLFL 4U1NA 5D1QA 4QOKB 4JPIA 4JRWA 3WEXB 5AD0A 1EUTA 2LU3A 1JWMB 2WBKA 1FVCB 3QUZA 1U8JA 3QIUC 2DN7A 4OIBA 4ZPVB 1KACB 5DD1L 2FHBA 5JQ6L 2XI9A 5DT1L 5JXAH 5MEQB 3RBSA 3DSFL 5DJYA 3NFPB 4M61A 3MJ7A 4QEGA 3TH4T 3DMMD 4RAVB 1KB9J 5B38A 5L6YL 3U0TB 2E27H 1INQA 3F7QA 5KS9E 2VLJA 5HDQH 3MCKA 1UXSA 4Y16C 4G6KL 5B4MD 4OKVB 5HGHB 3T08A 2V2TB 4MMXC 5EUOE 5JOEA 1DQMH 3MYJA 4KVCH 4LLDA 5EBMA 4IJ3C 3IRZA 3PQYA 1K3IA 3NTCL 3L1OL 4PJBB 2X89A 4GFTB 4XMPL 4UTAH 2PETA 1HHHA 3ARGC 3INUL 4H1LH 2A83B 2CLZB 4KK9D 2H26B 3STLB 5TDNB 5C0JB 2CUIA 5BMFH 4Z8FL 1TQBB 2F5BL 1S7XB 1DL7L 4F80A 2FYYA 3KPRD 4HC1A 2IQ9L 3C9NA 4O2EB 3FOLA 4UT7H 1GGIH 4Z7NE 2XWJB 4NFCA 4O58H 3QI9C 1SEQL 2R4SL 4RDQG 1L6ZA 4S1RL 3DOSA 3SE3A 2NR6D 1KGCD 1HINH 4GXUM 3BZEA 5FYLH 4HS8H 4WTXA 1CLOH 5GISL 4X6CA 3WO4C 4Y5XC 2JELL 3RWEA 2XTJE 4TYUA 5E99H 4Z7UB 3GMNA 5IGXL 4KZEL 1ZT1B 3BP6B 3NCJH 3QEHA 3QDHA 2DQTL 3QIWD 4G6MH 1JWSB 4E42B 1QD0A 2GITB 5J13C 2HH0H 1KNOA 3QCTH 4GRLC 3B9KB 5BQ7B 5E2WL 5D71L 5MHSE 4JHZA 3K8KA 3MV9B 3WFEH 2NZIA 4FQQA 4WHYH 2H8PA 4NKDB 3QQ3B 2WBJD 5J1AA 1WIPA 3OGCA 1GCFA 4JHWH 1BAFH 2XPGA 1BVLB 1VADB 3LPWA 2KQNA 3SBWC 2A9NL 5EU4A 4DFHA 2HKHH 3CSGA 5HGDA 3QO1A 4D9LH 4NFDA 1A2YB 3RIFK 4Y4HC 1BD2D 4G8EB 4OCRH 4XHJD 1KEGH 3B9AA 3GIVA 3NZ8A 3GBNH 1A1NB 4K71B 4MXVE 1NMBL 4HF5L 5F71A 4G8IA 4NOFA 3VXQA 2VLMD 3SKOB 1RZ8A 3KJ6L 5BZWA 1NGWB 3ARBB 2AJZA 3DPBA 5JNYB 1X5XA 4FQCL 3SDXB 4P3CL 3MXWH 4JO1L 3QUXD 4K7FA 5HI5D 3QDJE 1A1OB 3SDYL 3QIUA 3LHPL 2ZCHL 4DKFH 4L1DA 3VG0H 1KT2A 4KK8C 4WTWA 4LCWD 2FL5A 4IDJL 1SM3H 1UM5H 4XP1L 3MRJA 4PRHE 3MV11 2XN9A 1DDHB 3MREA 3S3PA 4OGXL 3RWDA 2NY5C 4I9WD 1VCAA 5D5MB 5D70L 2BVOA 2ARJA 5MI0C 5K9JL 4GMSL 1WFNA 4XPTH 5HHQB 5IMLB 2P1YA 5F7YC 2EDBA 5GXBB 4Y16A 4ETYA 3KPLA 5E6IB 3DECA 2GJZB 4IRSD 4XX1G 1N5AA 1NAMH 1OAZH 5E1AA 4F33A 1QVOA 3EOAB 4BQ8A 3ARGA 3L95B 4JG0L 1E4WH 5DD5H 3R06A 5L2KB 4N90E 1GZQB 3WFDH 1CL7L 1EV2E 5MENE 4HPYL 4P3DA 3B9EA 2GCYB 5DHVB 1CYGA 5DVLA 2D7OA 2W0FA 3BN9D 2EDQA 4JZOB 4EXPX 1MCJA 4TRPL 3IKKA 1T2QH 4XX1E 2FX9L 3MCLH 3QUYD 1NJ9A 2Z31D 5E9DD 3KLHD 5A40E 3SDCB 1SJXA 3MFFB 3QI9A 4YX2H 4UNVA 3MRKB 4XAKD 3VCLB 4PRPE 1J1OL 3QNYA 2NXYC 3CFEB 5C92A 5FA3A 5GIRA 4C56D 4KI5E 2CDFB 1F58H 3I3BA 4AJ0A 4XNMA 3U30B 3EYOA 3FFDB 3N0PB 2XWBA 1IFHL 4Y5XA 2XRAL 5KZCD 3VWKB 3C6SB 4FQJH 1RUML 4OTXL 1JZ5A 1NEUA 5F9JA 4JANA 2DQIH 1PKQA 2FEDC 3BKMH 4PJ9B 2AJUH 1BZ7B 1NCUA 4EUPA 4OSUH 2ESVE 2Z9TA 2OK0L 4LSRH 3U9UB 4CMMB 3L7EA 1DE4B 3FQTA 4MB4A 4LNRA 3C5SB 4RZCA 5I1CL 5D1XB 1FNEA 3BD3A 3BVNA 3IS0X 3AS3A 4GRLA 3FQNB 3MRLB 4P5TC 3GO1H 5JPMB 2FECI 1EHAA 3OKDB 4K3EL 3KPSE 4I77L 4U1KB 3VG9B 4NO5B 3EOBA 1XGPA 2C1OA 2I9TA 3SBWA 4Q9QH 3MNZB 3AROA 4PG2A 4ZPTB 3VW3L 1CE6B 4Y4HA 5K59F 3CX5J 2VLLB 3FQRA 3WUWA 2HFFA 1A9EB 4N8CL 4XNXH 3OKMB 1FZJB 3CX5K 1GGTA 3DWTA 5GJSH 1LK2B 1PG7L 1ZTXL 2IGFH 1AR2A 2NY7H 5CEYB 2UV3A 1HNFA 4PS4L 4QRSA 4RFNC 5ESQB 2P47B 2F54A 3E0GA 1AXIB 3RWCA 1KTRL 3U0PB 4ODUA 5C8JB 4DWHA 3NABH 3O3BA 4Q7DA 2X4TA 3T0ED 3QG7L 5GGSA 2QQKL 3EW3B 4L9LC 1NFDB 3ULSB 1LE5B 1J8HA 2XNAA 5C6WH 4HWUA 5EO1A 1VFOA 3LB6D 2ED9A 5C0RH 4GKOA 5IFHH 5CIPB 4MYWB 2OL3L 3CVHA 2Q1EA 3DRQA 3QAZC 1BWMA 1YECH 3SGKC 5EN2B 1DSFH 1RUAH 1CXKA 5J6GB 3CFJA 1QG3A 4MD5B 1G9NL 2X4QA 4LHJB 3VXSA 1BQSA 2UWEA 3MO1B 4HZAA 4LQFH 4E41A 3UPRB 5IG7B 1JHKH 3BT2L 4L4TA 1N7MH 1KIPB 5IFAL 2GJ6D 5HHOE 3L3JB 5CSGA 3IDIA 1HK6A 3TT1L 4ZUWA 2JLLA 4MJ5A 1S9WB 5CLWA 4EN3D 4NRYA 1CU4L 3DSNA 1A22B 3P11H 3WS3B 4U1MB 1AKJA 2VDNH 3MLVL 1K4CA 2D7NA 4ZS6D 3NAAL 4JHAH 4Y8AA 3ARYA 4MJ6B 4WI6A 2IADB 4ZUVA 1J7VR 4CDGC 1TVHA 2VN4A 5C86A 3TYGH 3CFDA 1IMHC 1SBSH 1E6JH 2VLRE 2NY6D 2DLGA 1EPFA 2GSIA 3ULUF 4PV9A 1KXTB 1R24B 3HUJF 2AK4E 1HHKB 3EJYD 4IMLA 2XA8L 3P4OA 4G8GD 1X44A 2DWDA 4JFHD 2P5WE 5FIEA 4MAYD 1MIEL 3U4BH 3BYTA 3V8OA 3QO0B 5CILH 5IESL 1BF2A 3UZQA 1PQZA 3GMMA 1KC5L 4PJGE 5DZLA 5LG1A 1HZHL 1U3HB 4FFZH 1QPPA 2NLJB 4QHMB 5D6DC 5ENWB 5J1SC 1ZWIB 3RI5F 3DX9A 4LKXB 3QDMA 4U1LB 2H2PC 4ELMA 1NGZB 1HILB 5F89B 3E8UL 3SGEI 3WS6C 2CDEA 3D87B 2X4UB 4BZYA 4NZUL 3V0AC 2JF1A 3BZFA 4OM1H 3GSQB 3SGEH 2J5LC 4YDVA 1KJ2A 1JI1A 3ZKXC 1NMCC 3K81A 4H88L 3HMXL 5C0IB 3SKNB 4D9RE 5T1KD 1H3TA 4HMCA 1QRNE 3VFMA 1N64L 4LHUA 3TH3T 3LRSA 4L8BA 1YY8B 4UZGA 1CR9H 2R9HC 4LPCA 3RZCB 2NXZB 4P5TA 1FCGA 3MLYH 3K3QA 3RUGF 1YNKL 3H9ZA 3O6MH 4HIJB 1I1YB 3G5VA 1VFMA 4JY6B 4QO1A 4XCEB 3S37H 4R8WH 4KK5C 3SO5A 1Q1JH 2AGJL 1GC1H 1MCBA 5EZOL 5T3ZD 1JI2A 2D7PA 4LSPH 2G2RB 3QEGH 3V52L 2R39A 5FUCE 5IJVB 3UTSB 4F2MA 1IEBA 4LGPB 3BWUC 4FNLH 1PAMA 3PDGA 1U42A 3O2DL 5DQDL 1G7IB 4BSWB 4G6FD 4C83B 2QSQA 1R3IH 3RP1A 3CFBB 1Y18B 1QFWH 4YK4B 4ORZC 2J88H 4X99A 3DX8B 4XI5D 1R3KA 2N56A 1BFSA 5DSCA 2C5DC 4PD4J 3E6HA 4D0BB 1XGQA 1XR8A 2HVKB 3HC0B 4W6YB 4CKVX 4TSCH 4DZBB 3EYFA 2AEQH 6FABL 4L9LA 1I3GL 2Z35B 1IQWL 1MCEA 1MH5A 3HZYB 4D8PA 3DX6B 2DQEH 2CRZA 4U6VH 5DR5L 4XP9H 2XWTB 4QHLA 5J3HC 1X5AA 1V3LA 3RX5A 2YRPA 4FQXB 5A1AA 5EG6C 4M8QA 1HHIB 4NZRL 5CGMA 1F4XL 1JNLL 3K80A 5IP4A 1H0DB 3HRZB 3P9LA 4I0PD 4Z78A 2VMFA 4K3DH 1HI6B 4RIRA 3FZUD 4JFEA 2VABA 3ULUD 3REWA 5KSUB 1KN4H 3CNKA 5KTEH 5HBBA 1MLCB 4X7TA 4JM2A 3GEWB 5EU3B 1KTLB 4U1JA 4TUKH 5CINH 1QNZL 3NN8A 2W60B 1ZMYA 1JTTA 4POYA 2M1KA 2NY4D 5HVWA 3AY4C 3BGFB 1CF8L 3K0WA 5D7IE 5DFVD 3HI5H 4ZS7L 3H9YA 1F6LL 2VDQL 3K4AA 1G7MA 1MAKA 1IAOB 2IBZX 5CHNB 3MACL 5KAQF 1X5FA 2D7TH 2Y36H 1JYVA 4WWKC 3U48A 3A6CL 1Q9OB 5EBLB 1N8ZA 1T0NB 5DUMH 1FH5H 1QSFB 1XR9A 3U36A 2JCCA 3WHXA 3VFUB 1P6FA 4YHKH 4H0IA 1Q72L 1IZJA 1NCDL 1ORSA 2BP3A 3KLSA 4AEEA 4E5XB 4FN0A 5D6DA 3GSUB 1F4HA 1LEGA 1M71B 4I0KA 2GK0A 2XTJC 1YDPA 3QJFA 1AE6H 5EO0B 3IU4H 1IQDA 5KSAB 3WS6A 3KG5A 1BPVA 4MJIB 3OX8A 4ZOEA 1H5BB 1NDMA 3T0BA 1CVRA 4Y1AA 4BYHA 3A6BH 4KC3B 1NCCH 2X89D 5DMIL 3N85H 2CK0H 2Q7YA 4P2RA 1J88A 3IVKA 5D8JH 2DBLL 4PRIA 4U2YA 5EB9A 4LASL 4PRAB 3V0VA 2CD0A 1N6VA 4DKDC 3PWPA 4GG6A 2VE6B 3ECBB 4LSDA 1KJ3H 4MQ7A 3GHBL 4JFDD 3EBAA 1LMKA 3O2VH 1ZHBA 3TIDB 3VXPB 1CD8A 4L8DB 1LD9A 3S36X 4OAWA 4D3CL 2MKLC 1MCRA 4DKAA 2YBRB 3ZTNH 5TQ0H 2O61A 1A64A 4Y5VC 1HHGA 4PJEB 1GGUA 3H0TB 1TXKA 4JRXA 4QCIA 2FWOB 1NC2A 1TZGH 4FQ2L 3FRPA 3KPRB 2VIRB 1VACB 3F8UB 5C0BA 4NN5C 3JV4A 1JZ2A 4YNYA 5JW5B 1GAFL 3E2HB 4MWFB 5EIIB 5C08E 2EH8H 1AC6A 3BZ4B 4P4KD 4FMFA 3O45B 5HDLA 5D7LE 5GS0L 3QHFL 4KRLB 1GIGL 4I3SH 2BDNH 4HJGA 4LMQE 1LP9E 3SDDC 3W39B 1KULA 1JNJA 4JPKL 5GS0D 1P7QA 1RJYB 2UZIH 5DA4A 5J9PA 2ZCLL 1IGFH 4R2GD 5BRZE 3OV6A 1BFOA 1S9VA 3VMOA 1OTSC 2CLVA 3BRGC 2HLFD 4M02A 4MNHA 3FB8B 5T5NG 1RV6X 3WJLC 3RVTD 1J87A 4MCYB 2WP3O 4JY4A 2X7LB 3WFHA 1DQDL 1RZIB 2N4IA 5FECB 3QIWB 5C71A 4HPOL 2ZUQB 1T1YB 4ZD3L 4M00A 5KS9A 1S7VA 5E8DH 5FGBC 3V4VH 3KHQA 3VFOB 3S35L 3QH3B 4AH2A 3VFWA 4R4BB 1B2WH 2I26N 1JGUH 5LAXB 4V1DE 4P59H 1HSBB 1NC4D 5EUOA 3DHMA 3TPUA 2OTUB 2WBJB 2DQCH 1MCCA 4Z0BL 4K9EH 5HVHC 3Q3GB 1RURH 4HJ0D 1CXLA 3GDBA 5LQBL 3I9GL 4M1DL 3AY4A 1XF2A 1ACZA 5EZJA 1A14H 5F6IB 3VU2A 5K9KA 2CR3A 3G6JF 1TCMA 2VXVH 2QADB 5LXGH 1VGEH 2NY2C 1CFTB 4WDIA 1G7QA 3MLXH 4K8RD 2IFFH 4HQQH 3QIUD 3AS0A 5C0AD 1I85C 4AEIL 3L3OB 4BKLB 1LDPH 4NGHH 2P8LB 4MS8C 1OSPH 5L9DL 4LCUB 2VL5A 1A7OL 1KOAA 2O5YH 4PLJC 4M6NH 3MA9L 3U2SA 3MRDA 3JV6A 4YXHH 1TVBA 3X12A 3QUXB 2XN9D 2ATKB 4KI5C 1WBXB 1CCZA 4XPBH 1G1CA 2CUMA 3IDYB 1TJIL 4Y4KB 2ADIA 2FX7H 1JGDB 4U1GB 5HPMA 4MQXD 1D5MB 4KTYA 5BV7C 4H1LG 4DW2L 5E2VL 1S7SB 3T2QA 2X4RA 1R5IB 5ALBL 1HH6B 7CGTA 5JMRA 4L29A 3IDGB 1TJGL 3UBXB 3P3YA 5GRYA 1ED3B 1M4KA 2DD8H 3ARGD 1BM3L 2VISB 2UWEF 3MJ8A 2R1WB 1S7TB 2OLDA 3HPJB 4UDTB 3OB8A 4QHNA 4UNUA 2M8XA 4YHYB 2EEDA 1IKFH 2IH1A 4JPWH 2XKSA 3L6FA 3NVQA 4IBLT 4OZGF 4S1QL 1Q0XL 2V7HA 1A3RL 4XPGL 1JYNA 2OBGA 4P4RA 3WNOA 5CGYC 3AVEA 3U0WH 3HAEH 4GKSA 4RFEB 4WY7H 4YZFE 4Y5VA 4MD0B 1Q94A 3W82A 2AXFA 1NH6A 1F6AA 1JWUA 1LO2H 1YPZF 4QYOA 1B4RA 4TSBH 4TUOB 2EYRA 4Q9RL 4TNVK 2GY7B 3CLFH 1YMHA 1W72H 2MCPH 3HNVL 3V4PH 4IOFC 2JIXD 3AAZA 3MRGB 5I66A 4WHCA 2QQLL 1GGBH 3FFCB 4OD1L 4Q2ZB 4PGEB 2X1OA 3QUYB 2Z31B 5E9DB 3DX7A 2HTLC 1G7PA 5DC4B 1NKOA 3HCVA 1MAML 4KHTH 4M1CD 4MZ2A 4CVZA 4PJIB 3OXRA 1RZGB 1QA9A 5GRJL 1SJHB 1YEIH 5FCUL 2FR4B 5DQJB 1MHEB 1I9RH 3Q6GH 2CLRB 3WKML 3QDJA 3DURB 3ROLA 5I1LB 5DI8A 4HIHB 1HNGA 4WHYG 1MFDL 5KZCB 2OTPA 1F3DJ 3WJLA 3KPNB 5AUMA 3QQ4B 1D5IH 4YC2B 3H7BB 2VXUH 5DVMA 2YD9A 4PRHA 1HQ4B 4UTBH 4ZFOL 1SJVA 3H42H 4HKXA 2NPLX 3NA9L 4U6XA 1QO3A 1RUKH 3SN6N 4JR9L 3KYKH 2GHWB 5HYQB 5IK3A 2LAGB 1EHLH 3VRJA 4R97B 4Y4HD 3R1GH 2J6EL 2DTMH 2FJHB 1NCWL 3OGOE 3RVXC 3UTTE 4OFDA 4NM8H 3RY5A 4JKPH 1YYML 1OM3H 1HXYA 1U92B 1OF2B 1ZVHA 4ZMAT 3QXDA 3GMRA 2BNRE 4N9OB 4NPYB 4D9QD 2EDHA 3BRFA 2EXWC 4UQ2A 3KYOB 5MENA 3OKEB 2W65A 1Z9LA 5HHVH 4OKDA 1L9NA 1SVZA 5ALCL 3CVHL 1P7KB 1MI5B 4HBCL 4LVNB 3OXSB 3Q5TA 4NUGL 2NTSP 2KPNA 1I85A 4KGJA 3ORJA 1IL1B 1HCVA 2NY0B 5K9QG 4KRNA 4L3AA 4LKCA 2X2YA 43C9A 5MERB 5SX5K 2GT9A 2NZ9D 4PRPA 5E2JA 4MB3A 1RZJH 4OD3H 3IFLL 3IFNH 2PYEE 4XCNB 4E41D 2HFEA 4HS6B 5HYSB 5IKCB 4TQEH 2PW2A 4G43B 1I8LC 5DD0L 4XBPA 2OTWA 3FRUA 3QDGE 1DUZB 5E95B 3N9GH 1K2DB 3HC4L 4PB0L 3FO9B 1JHLL 3RIAF 4NP4H 4DGVH 2VZVA 1X4ZA 1PLGH 3MGTB 2W07A 2ESVA 35C8H 1CWVA 5INDB 4QRPD 4HUKB 5BS0D 3WFCH 4JFYB 3VGHA 5DMGD 2R0ZH 4JGJA 2GJ6B 2UVFA 5IW6B 1MCPL 1TETL 3BHBA 4AG4H 1GH7A 2BRRL 1EZVX 2CKBA 3U7AA 4MHHI 4JCLA 4WV1B 3KPSA 2OZ4H 2I60L 1CT8A 4XCCL 4NQEE 5C0GB 1AGDA 4BSVB 4UT9H 4FFVC 1T1XA 3DIFB 3PDOB 4S0TD 1Q8MA 2Y5TA 5FUCC 3BSZH 1CDYA 1YEFH 1WEJL 2PW1A 3QP3A 5E7FA 3SE4C 3HS0B 1KCRH 2CRMA 4WI2A 4S2SB 4GKZB 3QDMD 4P23B 3FT3B 2NXYD 2MCG1 4F3FB 3DVFA 1KJ2L 5JLZA 5DA0B 4MAYB 2BSED 3MODH 1UKSA 5ICYA 5FKAA 2EH7L 4UDUB 4LCIL 4F7TB 3I2CH 5EU5B 1OP5H 2JCCF 2BSTA 5I76A 5DVNA 3DHJA 4URTB 2DDQH 4P49A 3VXUE 1C1EL 3MV9E 4WGVB 1U8IA 4WO4B 4FFYL 5TQ2H 1NL0L 2IBBA 4UV7H 4ZSOA 2EE9A 2N1KA 1BREA 4IHOB 3HLAA 1NBZA 4O2FA 2D2OA 5I2IA 3I6KA 4U3XA 5GGQH 3HZVB 3T3ME 4JFQB 3LKOB 1MCOH 4MLSA 4P5TD 5E56A 1P84J 2VJXA 1MPAH 2R0WH 3VJ6B 3UXFA 1A4KA 4TULH 3UJIH 5T1KB 5F7DB 1DN0A 3HE7D 4H20H 2MJWA 2XKUA 2C4FT 1U8PB 4XC1L 1ZGLM 5HHOA 1A7NL 4RMTA 3NIFE 1AH1A 2RFXA 4MCZB 5E70A 2L7UA 1AJ7H 4DQOL 1YEGL 3I85A 1FGNL 4NKIH 3ILPA 2AV7A 4E0RB 2EIZA 3O41A 4DK6A 4X7EC 5ELIA 3T2OA 5EULV 4KJPD 3HPLB 4FXKA 4F57H 2XZCH 1I8IB 1S9XA 4XCFH 2VLRA 4QRRE 5EUKB 3VFPA 2MFNA 4HCRH 3CH1B 1UZ8A 3MUGA 1JVKA 5GHWL 2AK4A 3CZJA 4G6FB 5HHXH 4CVUA 2P5WA 5B21A 4FZ8L 3DXAB 1Y0LA 3S37X 3S5LB 4RGMB 2WK2A 2WW8A 3RZWA 3SCMD 2L4OA 4PJGA 4OQ1A 5M7QA 4Y19B 3V2AR 4C4KO 5EC2B 4WI5A 3X13A 3PV7A 5I6XB 4O02H 3T1WA 4JFED 4JRYD 5E5MA 1I8LA 5E0QA 4LVHC 4GAJL 4XXDA 2Z0BA 2MKWA 1K3ZA 3LZFL 4N0RA 3D5OF 2Z4QB 1QRNA 3GMLB 2RAMA 1OY3B 4I3RH 4RMWA 5KS9F 5CBAA 3HUJB 2EDKA 5FM4A 3K4ZA 1A6AB 5I75B 2YD6A 3BI9X 4LU5L 3ZDXE 1F4YL 1E6OL 1MREH 3JWOC 4L4JA 4QXTB 5GPRA 3I75A 3L3IB 4AIOA 2EKSA 4XP4H 1SYVB 2NY4B 4XP5L 3W9EA 4YQXH 1DQQA 3MOBL 1A6ZB 3G9VA 5C2BL 5IW1A 2DWEA 1LWRA 3MGAA 4OFPA 4U1NB 4JPIB 1JHTA 1BQLL 1UCBL 5AD0B 4LCCB 3LN4A 2GEEA 3QUZB 4K7PH 1U8JB 3SE4A 3UAJC 1RSFA 4OCNC 2A1WH 2AERT 3PIQA 2W91A 5DJYB 1ZXQA 3OJ2C 1TNNA 4M61B 3VXTA 3MJ7B 4OV6F 5L2JA 5GGUA 3WKNA 1HN1A 4HUUA 3EYQD 2R23A 5GRUL 1INQB 4P2RD 2B8OT 1T22A 4PRID 4M5ZL 2VLJB 3VRIA 3MCKB 5C0NC 1UXSB 1HKLH 1FAKT 1QBBA 3RUGB 1A7RH 5HGBA 3MYJB 5HDBE 3LQAC 5EBMB 3O6LH 3PQYB 1RFDL 3B83A 2AQ2A 5IUSA 1HHHB 3VFRA 5HYFA 5IHUH 5DVKA 2F5AL 3TT3L 4KK5D 4RDQF 2OI9B 1FLRH 3O8XC 2MQCA 1VPOL 1RULH 2IC2A 1JPTH 2OR9H 2YD5A 4KPHH 4O2CB 4JRXD 3TN0C 8FABA 1R5WA 3CFCL 4NN7B 1NC2D 2FYYB 4WU5A 1KJMA 3C9NB 1VSCA 1E4JA 3L5XH 3FOLB 5C0BD 3DO7A 2VH5L 1NMAL 3RDTC 4Q0XL 1I9IL 5JOPE 1IGIL 3P0YL 4ONHA 3AB0C 2E6PA 5D7IA 3MZTA 3KPPA 5M94B 4ZNEA 4LGSB 3BESR 5I8OL 1YC7A 2FJFA 3ZZ1A 3ARSA 4MA1C 2VQUA 1P7QD 1F90L 3BZEB 3NFNA 2BY1A 4P4KB 4X6CB 3RWEB 5DJZA 3GMNB 1NBYA 4JDTH 3KLAA 4GBXC 5TF1H 2VO5A 4AIZA 1AI1L 4NHCH 4OIIL 1QBML 3QEHB 5J3HD 2Y6SC 3OWEA 1WJ3A 1IGTA 2BOBA 3ILQC 5JDJA 3TEUA 4XTRD 3C60C 1J10A 4WTZG 4D94A 5AZ2L 1EA9C 1YN6A 4M62H 4FQQB 4ELKA 3RGHA 2H8PB 4NJ9H 4HHAA 4YHZH 5J1AB 2HYMA 3EJJX 3IJYA 3OGCB 3LS4L 5BZDA 1FV1A 2WMPA 4ODTH 3QPXL 5EU4B 2I25N 3EFFA 4EDWL 4R7NA 3FOMA 5HGDB 3QO1B 1CDIA 3RL2A 2LE9A 3OG6B 4NQCD 3RVWC 5ILTL 3O0RL 4FQ1H 3GIVB 1MQKH 3BW9A 1I1AD 1U3ZA 1CDCA 1KUMA 2LU4A 3P4LA 1PD6A 2VR5A 3HTLX 1I4FA 4G8IB 4PY7A 3MFGB 1T4KB 3VXQB 3QNZA 4WWKD 1RZ8B 3MLWL 2MWCA 5BZWB 1U8LA 1WK0A 4DVBA 2H32H 4GO6B 4KQ4H 4N1CA 2AJZB 2HAZA 3AMLA 1C08A 4ETQA 2J8HA 1MFBL 4OJFH 4AZ8A 2KL6A 2HWZL 4KXZI 1BF8A 1U2HA 3MV8D 2Z8WC 3BKYL 4L5FH 4YFLF 2B1AL 1QACA 4QY8A 1ZEAH 4K7FB 2A9ML 4N8VG 3CC5A 4KXZH 5C08A 5FO8B 3LEVH 3QRFM 3QIUB 5C0AB 1U36A 3WE6A 3P73A 1KT2B 2ICCA 5D7LA 2XTJD 3WNPA 2FL5B 4DTGH 1A7PL 3TV3L 2VDLL 1RIHL 3MRJB 1LP9A 5CD3B 2AAVA 3RHWF 2W1NA 4ZO7A 4XB7A 4M7KL 4YHIA 5A16A 5DMJB 2YPKA 2XN9B 1BZQK 3MREB 3EDJA 5EOCH 4BFEA 5BRZA 3S7GA 1KBGL 4OCXH 1D6VH 3ES6B 2BVOB 2ARJB 4KKLD 3SQOH 4X4ME 1T21A 4KI5F 1BX2B 4AEFA 5MHSD 5F3HA 4Y16B 3HMWH 3KPLB 4Y2DC 3K2UL 2E3VA 3S4SB 1FE8L 4L8CB 2Y72A 1N5AB 5E08L 4IJ3B 5E1AB 1QKZL 2Y9RT 3ISWA 1QVOB 5CWSA 4LSVH 5GRZA 1AIFA 3UTSE 4F33B 5ACZA 4KJYB 5GSVA 3PGCB 1JPFA 3Q5OA 3ARGB 4FQHA 5J4MA 1MJ8H 1X3DA 4JKMA 3R06B 4V1DA 4MXQC 5T3XD 4LIQH 3O8XA 3VWJC 4P3DB 2CKNA 5I19L 1ADQA 4RGOL 3FB7A 2W0FB 1UC6A 3RHWK 3N06B 3RDTA 2FX8H 4XVTL 2C4XA 1LO3L 3S98A 5AWNH 4R90H 2XY1A 2CRIA 1OQOA 2GTWA 3HNTH 1YNTA 3QI9B 3SDDD 3SOBL 5FA3B 5GIRB 3O3EA 2QQNL 2NCMA 3QDJD 4HIEA 5JA9A 2HFTA 5FUZL 4XNMB 1OTSD 3EYOB 2XWBB 3WO4B 4Y5XB 1KIQB 3OKKA 3V0WH 3GI9H 5ADOL 3OAZH 1HYRC 2XYCA 5IM7A 5DK0A 5F9JB 4JANB 1WIUA 1PKQB 4GBXA 1H3WM 2AK1L 4EUPB 4NC1E 2DLFH 3L7EB 4OFKA 1PW3A 4XNQA 4WEBH 4LNRB 4RZCB 5J13B 1FNEB 4J6RH 3BVNB 3CLEL 1I7TA 4GRLB 4LSUH 3C60A 4HUVA 2DKUA 5DMKA 3RNKA 2NY1C 1WCQA 2B4CH 1IILE 4LRNH 3OG4B 5D7JC 3OSKA 4PGDA 5C7XL 1XGPB 3G6JB 2C1OB 2YD1A 2I9TB 1E4XI 4K8RH 4ZFZB 2DM3A 4Y4HB 2C3XA 2KDGA 4UIMA 3FQRB 3WUWB 2HFFB 1E4XH 2P24A 4ONOA 1AGBA 4XMKH 2Z8VC 2VWEE 2NY2D 2RBLA 1BWWA 3C08H 5F72S 4H1LA 1S5IH 1D3CA 5GJTL 4Z9KB 5TPWL 1FDLL 1AY1H 1NGQL 4QRSB 1H3PH 3CMOL 2JE8A 3IFPA 4HT1L 1N4XL 4MS8D 1FPTH 1LO0L 2CO7B 4ODUB 2VNCA 3QIBC 3O3BB 2X4TB 1V7ML 5B39B 1Z9MA 4PLJD 3P4MA 5GGSB 5HD8C 1II4E 1WZ1L 1T3FA 1J8HB 2K9UA 4JREC 2XNAB 5EA0H 5EO1B 4HJJL 3MXVL 2HJFB 1QSED 3ALXA 3CVHB 2AABL 3DRQB 5BV7L 2VDPH 2O5XH 4X7SH 5DUPH 3B8YA 2WUBH 5KVEH 5T1LA 4NQTA 5ADPH 4OGYH 3CFJB 3VDCA 3B5GA 1OSZA 2X4QB 1B9ZA 2UWEB 5JUEH 4PJGF 5HJ3A 4TNWF 1R6VA 4E41B 3Q48A 2AJSL 4YJZL 1JPSL 5MI0B 4L4TB 1UA6H 2CKBL 4F58H 3SQBA 4OLYL 4XGZA 5IBTL 3IDIB 3WIHH 5F1IA 4ZUWB 3MRFA 3UEZA 1T2XA 4Y2DA 5GS1C 1F2QA 1KEML 4MJ5B 4G7YH 2OP4L 2HKFL 1IARB 3ZL4H 4I3GA 4NRYB 3KPRE 1L7TL 3HAEG 2IAMC 4TPRL 4YBLB 1AKJB 2R69H 1CFNA 1K4CB 3HE6C 4LSQL 1O5DT