1N0XH

Crystal structure of a broadly neutralizing anti-hiv-1 antibody in complex with a peptide mimotope
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
228
structure length
222
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCQASGYRFSNFVIHWVRQAPGQRFEWMGWINPYNGNKEFSAKFQDRVTFTADTSANTAYMELRSLRSADTAVYYCARVGPYSWDDSPQDNYYMDVWGKGTTVIVSSASTKGPSVFPLAPSSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN LIGHT CHAIN
publication title Crystal Structure of a Broadly Neutralizing Anti-HIV-1 Antibody in Complex with a Peptide Mimotope
rcsb
source organism Homo sapiens
total genus 38
structure length 222
sequence length 228
chains with identical sequence K
ec nomenclature
pdb deposition date 2002-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n0xH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n0xH01
5FUCC 3BP4A 4Z7UA 5I17A 4AIXA 3T3PF 3EJZD 3NTCH 3KPNB 3QXUA 2HT3C 1A1NA 4O2EB 4XI5D 4XMPH 1NGZB 3W9DA 2PYED 1Y18A 4U1SA 1JK8B 1YEIL 2A74B 3MNWA 1DQJA 2ICWJ 3QJHA 3QXAA 3OKEA 2DYPB 4Z7WB 4RMWA 3RHWF 3IS0X 3OL2A 4R4NC 4J3TA 3LZFL 5I30H 5KVGL 1CR9L 5FYLH 4I2XE 4K7FB 3RVXD 3IDNA 3QFDA 4DUXA 4G5ZL 5D8JL 1IZKA 2PUQT 1TTGA 5ALBH 1ERNA 1QVOA 1SJVA 2YEZB 4LNRB 2XN9D 3G6JF 3DETC 2YRPA 5EU3A 1EO8H 4NKIL 4LL9A 5DJXA 4GS7B 5FKPB 1C12A 5F21B 1T22B 1XF1A 2J8UE 2ICEA 4OZ4A 4OZHE 1JTOA 2YMXH 3C8KA 4FQXC 5B38B 3V7MA 4CVUA 2VWEE 1WAAF 4V2CB 4YWGH 1BOGA 3C6LD 2QQQA 1A9EA 3IFLL 2DQFA 5DA4A 4O5LH 5IJKA 4IRZL 2BY2A 4ODWA 2AXGA 4KI5D 5MI0C 43C9A 5H35B 3DVGA 3GMNB 4HZAA 4X7SL 2GSIB 5KJRH 3NFPB 3F7VA 4KWUA 2X4PB 3MXVL 5MERA 5BQ7A 5TE7H 4K3JL 4ONFL 4XVSL 5CGYC 1QSEA 3TCLA 4ELKA 4NN6B 1L6XA 1CDYA 4O2FB 4GG6B 3ARRA 3B8SA 3O2DH 5F9OH 1ZGLA 1SY6H 3FKUS 2EDNA 5DJCA 3HHRB 4HGMA 1BFVH 1KFAH 1KBGH 1VKXB 4YNYB 4ODVL 4NZTH 5L2JA 1CGTA 1MJ7H 1MREL 3VU2A 3OKNA 4YQXH 3Q1SH 5F7KC 1YEFL 3FQWA 2PO6B 1S7RB 2BCKB 5C0GA 4EIGB 1CZ8L 3MRBA 2DQTH 1OCWH 1UG9A 3DUSB 2ID5A 2WBKA 3RKDD 2QR0A 3DIFB 1FGNL 1T5XB 3D25B 1MHHB 2AJYL 3OKDB 3HI1B 2X4NA 3O3AA 3SDAA 1CL7L 5C0AD 1DN0A 3AXLA 4NKMB 1QFPA 1R3HA 1J8KA 1YEIH 4Q6IB 4HBQA 5L88H 4QRPA 4M8QA 4WW2F 5AYQA 4D8PA 4OGAC 1CFQB 4PY8I 4FQ1H 1XAUA 3ZYIA 4Y4KD 1FZKA 3P9MA 3VXRD 4PJCE 1JI1A 1MCCA 4JREC 3LZFH 4RGND 4LMQE 3LKQA 5IV2B 3QUKA 1HHGA 2GJ6E 2ADGA 4OGXH 4XNZC 5AG9A 3QAZB 1P84J 5C1MB 2DDQL 2EDLA 4GBXD 3QEUB 4OFDA 5M7QA 2FX9H 2FIKB 5IW1A 3V6ZB 4Y5VA 4OLZH 5BRZA 2UZXB 5IM7B 2NQCA 1CLOL 3QIUD 3ARGA 5L2KD 1XR9A 1FH5H 4NC0B 1QR4A 5INCA 1BFSA 1TZIA 4KKAD 3L5JA 2MNUA 1CGSH 3G6DL 1BF8A 3NA9H 5C0FA 2NW3B 4YIQB 4BQBA 3IFLH 1TJGH 2DQHL 3NCJH 4WFFE 4PYGA 2VKXA 3JV0A 3JZ7A 3WO4B 1BJ8A 1VGKB 4L3CB 1I85A 4W81A 1CDUA 4UDUB 1JZ6A 1XGUA 3PDGA 4RGMC 4JB9H 4ZUSB 3MGAA 3FONA 4BH8B 4CVZB 1S7VA 5A1AA 4X7TB 1PGRB 1JUFB 3BIKA 3MXVH 4X8JA 4XNYH 3ULUL 2VLJD 2DLFH 1U9KA 3TJHC 4OT1L 4FFZH 1SMOA 1OSZB 3TVMC 3L3IB 3H9SA 4XPTH 2DBLH 4RDQG 5C2BH 2AXHA 1IM3B 4K3EL 5D1QB 2DQIH 5CBAB 1G7MB 5GS2D 2FLBT 1MREH 3QUMH 4NFBA 4H20H 2NR6D 3QCTL 4KTYA 4C58B 4NQSB 4L4TE 1PKQE 5D1ZB 1G84A 3AROA 5SWQB 4GAJL 2BNUB 2D7PA 3H9ZA 1KXTB 4HUVA 2BJML 4PB0H 3CH1A 3CPLB 2BSSB 5JDSB 1MI5B 3KYKL 4LCWD 5HYJB 2F58H 3QEQB 1KN4L 2D31B 4HFWB 4PRHD 1GOHA 4Y8AA 5DHYA 2N56A 2GJJA 1BD2E 1FDLL 2VC2L 3AM8C 1B4JL 3H3PH 2BVTA 2P5ED 3RVUC 1CBVH 3V52H 4UV7L 3H7BB 2X41A 4WO4A 3MA7B 5GGSA 5E56A 5JPMB 2CLVA 1N3NA 4YEFA 1F4YL 4PJ9B 3KPLB 2DDQH 3B8YA 2CDGB 3M07A 4KK8C 4EUPB 5F7MC 4I0PA 5EU4A 5HHNA 2OP4L 3QWOA 3DX9A 2X42A 3GJFK 1S78C 3MOBL 5ITBL 5IVZB 2Q76A 3D18A 3QUZB 1CLOH 3ULVE 1DVFA 4TPRL 5E4EB 5CJQL 4ELME 2VDML 4OBSA 1W72A 3P73B 4HJ0D 1Z9OA 2V2WA 5TH2B 4DWHA 1U3HA 2XZAL 1G9ML 1MHPL 2DIJA 1KB9K 4C54A 5HD8C 3W9EA 4Y2DD 3QYCA 4DUVA 2XPGB 3AC0A 1IQWL 5D5ME 1HEZA 2MCPH 3D39B 2Z31A 1UQSB 1H5BC 4JKKA 3QUYA 1ITBB 2ZSWA 1M6OB 1QSFA 1XIWD 4B41A 3DVNA 4JRXA 1QG3A 4TNVF 3TBWA 4UNUA 3MRHA 4N9OB 3K46A 2LTQB 5GGRA 1C08B 3NFSH 8FABA 1P7KA 2ESVA 1LP9B 2VLKB 2X6MA 1VFBA 4NZJA 5DJYA 4PRIE 2KH2B 3VWKB 3TBYA 1HI6B 4C4KT 5FM5O 3NGBB 4P4RB 2JB6B 3QQ4A 3TZVB 3SHSA 5HDQL 3OGOE 1U42A 3MX0A 2CXGA 2YSSB 1R3KB 5DDHA 5KSBE 3P0YH 4DKFH 2LU4A 3WJLC 5C08E 4R8WH 3QZWA 5DGQA 3HCVA 4KJYB 3R8BB 4P57A 3VFOB 3ROOA 2BDNH 2CIIA 1JWMB 3ZHKA 5EU6E 3TN0B 5KBNC 4JFQA 1B4JH 2IPKB 2DWDB 2EDFA 1WBYB 1KPVB 5I8EA 2YZ8A 3IDMB 1JHTB 4XNUH 5C0EA 2XWBB 1JHLL 1LNUB 1AD0A 5IBTH 2Q7YA 1F3RB 5CJ5A 25C8H 1CFSB 3RVWC 2ZCLH 5FO9A 4WEBL 2VXTL 4ZAKB 5F7NC 4JDVB 1RUQH 1KCUL 4BZ1H 4QRSA 3RWHA 3H3KA 1J88A 1W0VA 4UV4H 3IKCB 5ITBH 5DQ9B 3IS1X 1MCKA 1VFAA 1AH1A 3O41B 3LD8C 2EXYD 5CJQH 3UC0L 2NY0C 2VDMH 3NCFB 4OLWL 2OR9L 4TUJA 1S7QA 3CMOH 1RJYA 4PJ5A 1OTUD 4NT6A 4HJGB 3PL6D 5EFIB 4OZFA 1P4IL 1RUAL 4WNQA 3T3ME 3U2SA 1IQWH 2YD4A 3ZYJA 1C5DB 4WUUE 3I75A 2NZ9C 4MXWL 4PRPB 5ACLA 2YN3A 4PP1C 2NYYC 4K9EL 1NC4D 5D7JD 3I6LE 5JIKA 5DUBA 4M5ZL 4GW5B 2X1PA 4KJQC 2R15A 2IAND 3OX8A 2K1MA 4QOKE 4HKJA 1MRDH 1E4WH 3L95A 3D5OF 4DEPC 2CIKB 5GPRA 5F89A 4Y4KA 3MV9B 4DOHB 1CLZL 5JHDE 3E0GA 4U3XA 2KUTA 4M7JH 4G6AC 4MNQA 1FNLA 4MVBD 4M1GL 4XBPB 4ETQB 1NCDH 1X5KA 5JLZB 1A64A 5IEHA 4JZJA 5FO8B 2AV7A 4HUNB 5FYKD 1QQDB 2XACC 4LLAA 4LKCB 1WWAX 4M6NL 1A4KB 3ZE0E 3P4OB 2B4CL 3VXMD 3IF1A 3ISWA 4Z7VB 3WHXA 2AQ1A 3E2HC 5C0CB 3CC5A 3KYMB 4NZUH 4P2QE 5BV7H 1J1OH 1F02I 3JV4A 4E5XB 4HS8L 1INQA 4KPHH 4Q2ZA 1TJHL 1FG2A 4PJIA 3BWAA 5IQ9A 1YY8A 1S9WA 4MJIA 3UZEA 1DDHA 2NTFB 1U36A 1HYRC 2W9DH 4QHKI 2VXTH 5JQ6H 1U8NB 4GRLC 3BMVA 1IM9D 3SE3A 4DN4L 3IFOA 8CGTA 4D3CL 3TNMB 5DEZA 5C0BB 4GKSB 4Z0XB 4OZGF 4V1DA 3CSYA 4J3WA 3OKKA 2XV6B 1BJ1J 3V5HB 4MX7B 4NWTH 2Q3AA 4ZUVB 3C60C 1NJ9B 3DJ9A 1SVZA 4D0DB 2AEPL 3MSPA 5F93C 4GS7C 4TTDC 1FZOB 4JZOA 1RZJH 3CX5K 3EUUA 4FFVD 1Q38A 2OL3A 4LCYA 4HX1A 1WZMA 4S0SD 4N0FB 5IVOA 1I8KB 4L3ED 1G7PB 1U8HA 1MVFA 5DQJB 1HHHB 5DRWB 3EO1A 3I50H 4MXWH 2QEJA 2NLJB 3QQ9C 5FOJA 2HTKD 2VLRE 3CLEH 5T5FH 4JPKH 4LLQB 2OMNA 4PGEB 4NQCE 1S5HB 4NQTA 4ZSOA 1FNEA 4DZBA 1VPOL 4G8GB 1HINL 3ES6B 1GGYA 5E5MA 1DQLL 3L5HA 5GS1C 2UVEA 3DX8A 4QRTA 4IRSD 2QQKH 3STLA 3WXVL 4NN6C 5D96C 2VR9A 3AMKA 3OJDA 3WEXB 3HZKB 3OHXA 4ALAL 2J6EL 4GMTL 1A3LL 1KLGA 1INEH 4EDXB 1LEIB 2Y6SD 2R1XB 3QI9B 1I9JH 1NC2A 2X4OA 4M1GH 3HG1E 4XRCA 3MRKA 2EC8A 4NFDA 1MCIA 3T1FB 3NN8B 4F9PA 5I1KL 3U0WL 3U7WL 2PO6C 3CDCA 3GNML 3QT2A 3HE6D 5EOTB 4TVPL 4CUCA 1TNNA 4WI7A 5INDA 4PLKD 4YHML 5DRXA 1IEBA 3MV7D 5EB9A 5I1DA 3WLWC 2AEWA 4J3VA 4GKOA 2X4TB 4NM8L 4YFLF 3PGDB 2NY1D 2KQMA 3BIBX 3RIAF 4NO5B 4EJ1C 2G9HA 4FFWD 4B7LA 4OB5L 1BFOB 2O26U 4YH6A 5C09E 3DXAE 1N6VA 2O93L 3PWPE 4IDJL 4PJ8D 3ARBA 4Y2DA 2C1OB 5C71A 1NGYB 3BSZL 2WW8A 1I4FA 1KG0B 1K5NA 4JFHE 4Y4FD 1OT2A 5FYKU 4D3CH 1RIVH 4PJFE 1R24A 3QAZC 2EZ0D 3SGKA 3CH8A 2K3TA 4PG2A 3MLSH 3DV4A 3JVGA 4QYOA 3UTPE 4XPHH 4WFHD 5D2NC 2FX8H 3ZDYF 5DVNA 4XP9H 5DD5H 2AEPH 5IW6A 5IB2A 1EO7A 1ADQL 4I9WD 4PD4K 4N0CC 3EJYD 1NAKL 2FL5B 4AMKH 1CGWA 4P49A 3ZE2F 1G7IA 5MEOB 2JTDA 3BH9A 1RULH 3MBXH 5EZIL 2FLRT 3T4YA 2Y07L 2ZUYA 3WO4C 4N8PA 3HAEG 1VPOH 4GXUN 2B5IB 5J4MA 2RIKA 4M93C 1I3GH 4UQ2A 1DQLH 3UO1L 2XOTA 5SWZA 3HE7D 1KN2L 1QKZL 4ENEC 1T20A 3UZVB 5GGTH 4NHCH 1MRCH 3FO1A 1ZT1B 2FZ3A 4G7VL 5JIIA 5DUPH 2F54E 2HT3D 4XVTL 2X7LB 4N90D 4OUOA 5DT1L 4U7SA 3L3OB 5CWSA 4NQEE 3UBXI 4OZFG 4MB4A 5JPNA 4HG4J 2A6JB 4UT6H 5D1ZC 4QTIL 4HGKC 1FO0A 4CADA 3C09B 4TVPH 3FQRB 2E9IA 4N8VG 4YHMH 1X5GA 1DUZB 4EOWL 1U8OB 5CP3A 4R4ND 1GSMA 2C7UB 5K9KB 4Y4HC 2VH5H 4PJHF 4WWKD 5CEZD 4AEFA 2GTWA 2EKJA 1OAUL 4WI4A 4OZGB 5EPMB 5BJTB 3B6SA 3PGCA 1FSKB 2O5ZL 1OF2B 2E9JA 1UWXK 4OB5H 3S36X 5D7IB 2ORBL 4F33A 4JKMA 2IQ9H 3QCUL 3P4NA 3DETD 5L7XL 1OQXA 2MJWA 4LFHD 3SDDB 1GZQB 3MJ9L 1T7XA 5DJ2A 4WTZG 1L9NA 3BSZH 3F5WB 3FQTA 1L0XA 4P0DA 4PJGF 3VXOB 2FECL 3DRQA 4F9LA 4FQXD 3PWJB 1ZT7B 1FJ1A 1KB5L 4HKZB 1YJDL 5IIEB 1SJXA 4RGNE 1Q9WA 2CJUH 1KJVB 5DD0H 1R5VB 2M2DA 3LS4L 3MMEA 3U0PB 5D70H 3HLAB 3MRPB 3QRFM 1ADQH 1UB6B 5DRNB 5I8KH 4ZO6A 3OXSA 4M7KH 5C0RL 1QHOA 1FZJA 3BN9C 1ZSDB 4X6CB 3RTQA 1OVZA 1U92B 3CFBB 5CGYD 4I2XA 4QF1A 5L2KE 3S5LG 4HIIB 2FO1A 1EV2E 3FO0L 2H2PD 3PWVA 5E99L 4PGZA 4XXCC 3LKSA 2JJSA 4ODTL 5HI4C 3M17B 3HZYB 3OXRA 1GPOH 3OF6A 3DHMA 1IGYB 5H37G 2VJXA 2HTLC 1IARB 2HJLB 4JLRA 4D0CA 4I8DA 3BESR 1S9VA 4E0RA 1XCQA 2J8UA 3LN5B 3L3GA 5LBSL 5GQBA 4OZHA 1XGQB 4M4RA 3LIZH 5TQ2L 2VN4A 2BSRA 5D6DC 3VXPA 3VW3H 2CKBA 2VLJE 3EKCA 5BVPL 2V7HB 1G1CA 2LTQC 4PJXF 3B5HA 1YEHL 1X5XA 4F7TB 1GGBL 5DT1H 3QIWA 4GRWH 5DHVH 4KMLB 5TF0A 4U0RC 2VSDA 1RURH 3MUY1 2PW1B 3VWKC 5E7BA 3JTTB 3BKCL 4QTIH 4OGAD 3NGBC 3TZVC 1QFWM 1U91B 5FDWB 5HI5C 4ZDHB 1G0YR 2W60B 2YPLA 1OGAA 3P9WB 1CXEA 4ZTPH 4M9PA 4S1SH 4XB7A 3Q5YA 4UOW0 1NEUA 4NPYA 4BELD 1FNHA 4Z7OE 4K94H 1W0WA 1A7OH 1VFOA 4ZOCA 3QQNA 4O2CA 2JIXD 2R0LH 3MNZB 1U8MB 5I16B 5L7XH 4HIJB 1H3TA 3T8XB 3MJ9H 4JCLA 1LEGB 2R1WB 1UA6L 3KLSA 3MACH 1I8IA 3J8F7 2APTA 3OV6A 4QKXB 3BEWB 4Z7QE 1HHKA 4ZG1A 1J05B 2EDXA 5HVHB 3MJ7B 1CLCA 3I2CL 2GJZB 1BQSA 2IMNA 1IKFH 5CIPH 1CTNA 2EKSB 3BDYL 1XZ0B 4G80B 1A7NH 2E7MA 4U6XB 3LS4H 1T1WB 1C5BL 2D0HA 3LDBB 1A0QL 4NYLB 3MRLA 3E6FA 4MQSB 4PS4H 1IBGH 3ARDD 2X05A 1FYHB 2JLLA 3TIEB 4LDOB 3L3DB 5MEPA 4PJDE 4BM7A 4PJCA 5C0RH 5D7LE 3TJHD 2F53B 3KG5A 3U4BL 4PGDA 3VMOA 2GJ6A 3HPJA 4QXGL 2X9YA 2FJHA 2PW2B 3FO0H 2DMCA 4OKVA 2E5EA 5EO1B 4GKZA 2EDBA 3CFJA 3NACL 4NQDE 3EOAA 4EXPX 5F9AC 3MRNB 2C4FT 5IG7B 5C0NC 3OKLA 2QV2A 1FNFA 1AO7D 2FBJH 3RUGB 5I71B 5DMIL 4OF5A 5K9JL 4EI5A 2FHFA 1T7VA 2GAZB 2ZUTA 4GAGL 5TQ2H 4G42A 5HJ3A 4HZLA 5JO5A 5BVPH 3MODL 4PJBF 1YEHH 1KULA 4UUJA 3ILPB 4P99A 1RJLB 5ADPL 5JW4N 3HNTH 2ENSA 3DMMA 1TVBB 5E2UL 4LQ1A 4F57L 4OM1L 4GRWB 4OF0A 3O9WB 5DHVB 3BDBA 3L7FB 3BFOA 4G8FA 3BISA 5FA3B 5D9SB 5EG6C 4MQ7A 1HXMA 3IDGA 1OP5K 1D6EB 2YUZA 4R0LC 5F3BB 4PGCB 1HXYA 2ZNWA 3RVUD 3AS0A 3ULVF 3BZFB 1QEWA 4DQOL 4PRBA 1F58H 5FXCH 4DKDC 2Q86A 5C07D 4ELMF 3KYOB 5DA0B 4OD2A 3QO1A 5IQ7H 3BH8B 2AGJH 4MB3A 3FT3A 4KK8D 1YMME 3FRUA 1YNKH 2Q6WA 3V4PL 2QSVA 3D85B 1OTSC 5FB8B 3BD5A 5IVXB 4L4TA 5D5MF 2E7CA 1PKQA 3CU1A 3KR3L 3O3UN 1S78D 2CRZA 3FO2A 2Y7QB 4HFUL 1JV5A 3RZCB 3HR5B 4XCCL 3RWEB 1YUHA 4LHUG 5DURD 5HYSG 2AEIT 2FEDC 2HFEA 3KPPA 4LCCB 1W8OA 4K71B 3GRWA 2QSTA 3C2SA 3MOAH 1MOEA 3EYUL 1KB5B 1GIGH 5CIPB 2CK0H 2NPLX 1C5BH 5HD8D 4HWBH 1TPXB 5F1IB 3VGFA 1Q72L 1Q9LA 1EDQA 5ISZB 4ZS6C 3GSNA 2X4RB 1HH6B 3N85L 1NMAH 4NFCA 1AD9A 2DL2A 5E2WL 4F7CB 2K7PA 4JFDE 4FQ2H 3U4BH 4XP5H 5JOPD 2IPUK 2VB5A 4QHUA 5HHME 3OPZH 4NCC1 2UWEB 2QADB 1V3JA 1E6JL 3NACH 1OM3H 1PSKH 2F5BL 1OD7A 2W07A 1TENA 4G7YL 4YPGA 4IOIA 5DMIH 4NRYB 2WLYA 4PRDB 5I1GL 2NY4B 2GW5A 3RGVA 5D71H 4PP2B 4GAFB 5D7KE 5HDLA 5CD3A 1KC5H 5A3IC 1I1AA 5CHNB 1LO2H 2P8MA 3QDJD 5BZDB 2E7BA 1AGFB 4JPIA 1VSCA 4MDIA 1BBDL 5FHBH 2VXVH 3ZT5A 5C7XH 4O00A 4AEHH 5IFAH 2LFGA 5DFVC 1S7WB 3H9YA 3MODH 2R4RH 4HBCH 4GW1B 5ADPH 5TQ0L 3PHQB 1BZ9B 3U7YH 5E2UH 4Y1AD 3OGCB 3JUZA 3V79C 3MCG1 3BXNA 4CU8A 4OCLC 3C9NA 3N9GL 4DGVL 2IADB 3O11A 3C2AH 1PW3A 1TTFA 2LVCA 4RFOL 4TUOA 3RBGA 3MGTA 1B0WA 4LASH 4N9GB 1IAOB 1RK0A 4HHAA 4P23B 2IMMA 2BFVL 2VZSA 2IC2A 1YMHA 3QWRA 4NOFA 4OZIB 3BJLA 4EQ2A 1MY5A 3WS3A 3RVWD 1A14H 1UCBL 3MRQB 4U1LB 5ID0A 5E9DA 4QHNA 3REWA 4AIZB 4BFIA 4MAYB 4YDVB 5F7EH 1JHKL 3CFEA 3IXTB 5IFJB 4HFUH 2WQ8A 3B2UC 2MQCA 2V5SA 3LKPB 1FYTD 4C55A 5BV7C 1LHZA 5B39A 4Y16B 4UILH 3KPOB 2NY0D 1GGIH 1P53A 2NXYB 1K4DA 5KSBA 4S11A 1RZ7L 4PRAB 5C08A 3MLTB 4LLDB 3F12A 3EYUH 4H1LG 1KT2A 3H0TB 1NAMA 3FN9A 4LVEA 4LSRH 1Q72H 5FYJH 4LIQE 3UTQA 4OFVA 2NZ9D 5I73B 5F9WB 4NN7B 4HLZG 1QR1A 2NYYD 4WGWB 4OGZA 3QNZB 1MWAH 4JFED 3DI3B 2AJUH 3O3EB 5J13B 1HDMB 4ZQKA 1BLNB 3TESA 1IL1A 3DSFL 3RWFA 3B3IB 1MFBL 2DICA 5DR5L 1M1SA 4RGOH 4KROC 2BX5A 2HJFA 1NGXB 4LCUB 2R39A 4G6AD 1V8HA 2KL6A 4XCEA 2DMKA 1FAIL 3EYVA 4WW1B 3VD5A 1JNLL 1JNHA 1L7TH 1PQZB 1BBDH 4MCZB 3T0EE 3BP4B 4Z7UB 4YHOH 3RWDB 4N0YL 1REIA 5IKCB 2NXZC 1X7QA 5TQ0H 1A1NB 2EDJA 4FQQA 4JPWL 3W9DB 1Y18B 4MS8C 4U1SB 1XT5A 4WUUA 3N1FC 1URLA 3IT8D 2LU7A 1J0YA 3DV6A 3N9GH 4DGVH 1DQJB 3MFGB 3QJHB 3QXAB 4P2OA 4UTBL 5SV3A 1A7PL 1CFBA 4M6ML 4RFOH 3HNVH 5LWYH 4OF8A 3WDHA 5HTSA 3NZHL 1IE5A 2DYPD 2EXWC 3IDNB 3QFDB 4QRUA 2ADIA 3LSOA 1E4KC 3CVIL 4QOKA 2EIZA 3RX5A 1FIEA 3QHFL 5HHPA 4XCNB 5C9KA 2HRPL 1QVOB 4GRLD 2WQRA 1A5FL 3GHBL 2B4CC 3ZMRA 3V0WL 4AZ8A 1UXWA 5EU3B 5JHDA 1GYAA 3N1PC 4PIRF 5DJXB 2R2EB 5FF6B 1A3RH 5IB5A 1FCGA 3TVMA 3DRTA 2VLLA 3TA3A 1DL7H 2NY6B 5BMFL 4OZ4B 3C8KB 5TDOA 2JCCF 4G6ML 4TTDD 1BOGB 3SQOL 2VDRL 5I15L 2E9BA 4WV1C 2PXYA 3FZUC 4X5LA 2AXGB 2LVEA 43C9B 4JCMA 4CRPA 3F7VB 4P2QA 3QQ9D 3L9RA 4Y19E 5MERB 1BEYH 2NX5E 1KXQE 4ZXBC 5JIPA 2ZPKL 1NCUA 3HUJF 3TCLB 1QSEB 3SO3B 4GXUM 1FN4B 3BP7A 3HI6L 1RZ8A 5DJCB 2O5XL 2D7TL 4GXVL 2EE3A 1OQOA 3AM8A 5A16A 3FHAA 3ILQD 3PWNA 3OKNB 5E8OA 3R1GH 2A38A 1YC7A 1QYGH 2A9NH 4U1MA 1FAIH 3MRBB 1JNLH 4P4KB 4P5MA 5CAYB 2M26A 1F6LL 1QPPA 4M02A 2PO6D 2X4NB 1TQCB 1YPZE 2MKLC 3RY5A 4G9FE 3O3AB 2VDOH 3SDAB 4ZNEE 1B2WL 1Y6NR 1DN0B 5IMOA 3AXLB 3TBTA 2E7LA 2AJXL 4JPWH 3SDXA 1EMTH 1GL4B 4R96A 5JHLL 4JM4L 4QRPB 4M8QB 4D8PB 3VI3E 3JXAA 4JDTL 4UTBH 2VLRA 4OCSH 4EI6A 1N0XL 4NQCA 5HI3C 2DJ4A 1FZKB 3P9MB 1YQVH 1FFOB 1TVHB 3T2NL 1MAMH 4KUCD 2IALA 2RHEA 2GITA 4MZ2A 5DS8A 5E03A 2ADJA 3QUKB 1E4XL 2DQCH 3WUWA 4D9LH 2ADGB 3CVIH 5B3NA 3SKJL 3QHFH 4GUPA 5I1JL 4TSAL 5DC0A 2OQJA 3GHBH 3VFMB 3C5JA 3GMOB 5IW1B 5FYLD 2BVEA 4D0BA 4NNXA 3BGFB 1QD0A 2VRAA 4Y5VB 4AEIL 1FNGA 5BRZB 5BXFA 4Y5XA 3CCHA 3ARGB 1XR9B 3EYSH 1W72H 4G6KH 4KQ4H 1U2CA 2C1PA 5INCB 1MCWW 1TZIB 3M8OL 4G6MH 4Y8DC 5H8DA 4FQJH 4UU9A 12E8L 1BQLL 4LNVA 5C0FB 2BOCA 5HVHC 4J8RB 4KI5F 3EGSA 6CGTA 1YECH 4S1QL 5KSAA 3QCVL 1S9KC 3DROA 1LWRA 1XGUB 2P48B 3FONB 1S7VB 3RX8A 1Y6MR 1P84K 4X8JB 3BIKB 4CVXB 3EHBC 3LDBC 4UIKH 3KLHC 2IAMC 1G6RA 5JW5B 2OXHA 4ODXA 1YZZA 2C5DC 5C09A 3DXAA 3PWPA 1VERA 3H9SB 5IOPA 1B6UA 3QH3A 5IWLA 3HI6H 2X10A 1GHFL 2VDPL 2XT1B 5GS0L 2D7TH 4G6FD 3RNQA 3PWLA 3PWUA 3VFGH 4ENED 5F7DA 3CFCH 4RMSA 2BNQE 5J0BA 2Z35A 3FB8B 4PJFA 5B39G 5JR1H 1UM4H 5FO7A 2Q7NA 3MA9L 2QSCH 5DXWA 5E94A 2PCPB 1XF3A 3AREA 5I71C 4ZPVA 1XR8B 2L7JA 5T1KB 4HUVB 3CH1B 4PLJC 5D1ZD 2GEEA 1YQ2A 5ESAB 1VA9A 5IB1A 1QBLL 1OAQH 2UUDK 4RX4A 3HB3D 1JYXA 4Y4HD 4TRPL 5JHLH 3HI5H 1FV1A 1MI5D 4YHIA 3SKNB 4K55A 4ZUWA 5DHYB 5HYJD 3RWIA 1EFXD 4M5YL 4D9QE 2FATL 5MENA 4L29B 2BMKA 4H8WL 3BPCA 1T04A 5GGSB 1YEGL 2IWGA 3HAEH 3LAFA 5E2TL 2CLVB 1N3NB 4JE4B 2Y1VA 3BKML 2XWTA 3S35L 1LD9B 5GS3A 4NJAL 2EH8L 5EU4B 5HHNB 4PV8A 4DK3A 1K85A 3QWOB 3DX9B 5B8CC 2F54A 5EUKA 4K94C 3BPNB 3UJIH 3WNNA 2OZ4A 1JGVH 1NEZB 3D18B 1ZS8A 2Q76B 4QTHA 3VXUE 3BPLB 4NQEA 1KACB 1U2HA 1DVFB 4Q9RH 4K7PH 4X7CC 4TNWK 1JPST 5F96L 4NO0D 4L8DA 4ODUA 2V2WB 1BQLH 2YPVH 3CFKA 2OL3L 3RZCC 3OKOA 1U3HB 2AJSH 2DQUL 3FCTA 3LEXB 4OZFH 1G0DA 2H8PB 4BA8A 1NFDB 2EIBA 3BN9D 4LCCC 5AWNL 3W9EB 4K71C 1WCBA 2F5AH 4OUUA 4QT5A 1HEZB 2ZCHL 1T21A 3QCVH 5GJSL 1GGTA 5I1EH 1SYSB 1YJDC 2P8LA 3I3DA 4PJAE 5D4QA 2Z31B 3PABB 1MELA 2Z92A 3QUYB 5EORH 4B0MM 4KJPC 5HI4D 3VA6A 2DJSA 2ZSWB 3VI4F 5KZCD 3VFPA 4XH2A 5KVMC 3DVNB 4MCYA 4JRXB 3BZEA 3TBWB 3GBNH 3MRHB 4JRYD 5GS0H 4LAQL 4URTB 2CGRH 3RIAK 2Y36L 2D03H 5I0ZA 5GGRB 1RFDH 3SKMA 3WN5B 4P3WA 8FABB 1P7KB 2ESVB 2LAGB 2BZDA 2QADC 1VFBB 4LSQH 5E8DL 5CFHA 5DJYB 3L3HA 3TBYB 1NMBL 3I9GL 1NPUA 3QQ4B 3BUYA 3TH3T 5JW4M 3BO8A 3TJEH 4HCRA 5KS9B 3BD4A 3VWKD 1OB1B 1CFVL 1UH4A 4GRLA 1ULVA 1WV7T 4ODHL 1LK3H 5L8LB 3V4UH 3TZVD 3QZWB 3KPSD 3HCVB 4U1HA 1V3MA 3BPOB 4OTXL 5I74B 1QTYT 4P57B 1CWVA 3GKWL 4Z7QF 1EHLH 2I27N 5HI5D 3WS6A 3SCMC 1MJ8H 3MGOA 4JHWL 3P77A 1ZT4A 2PF6A 3S88H 1CGVA 3C60A 2PETA 5KSVA 4M5YH 4RMTA 2FATH 5AZ2L 4J3XA 4F58H 4E41A 5FKAA 3HTLX 5I8EB 2WNGA 3VH8G 5C0EB 4MWFB 3C6LB 2AVGA 1I8LA 5E2TH 2Q7YB 3E3QE 5H37H 5JIHA 5DSCA 3BKMH 1EX0A 2HVKB 4R9HA 4CW1B 1QRKA 1ORSA 4TUKL 5FO9B 2VLMD 3NCYP 4F8QA 4J7RA 4P23C 4EBQL 3AS1A 1ROWA 3RWHB 3EO0A 5ERWB 3THML 1X5HA 1YEEL 3AAZA 2OI9B 4N1EA 4WIQA 4ZAKD 4YDJB 3E1F1 1VFAB 5C07E 5T3XH 3U36B 3WE6B 5F96H 1SJEA 1IJ9A 1V5JA 1J1XL 1AKJA 4TUJB 4L8CA 1S7QB 4WGVB 3RWCA 3PQYD 1NCWH 3C5ZA 5IK3B 1DEEA 4WCYH 3O6FC 5AWNH 4WNQB 4HIEA 3NIGE 2W0KA 1X4YA 3QBTB 5EN2A 3UDWC 5T3ZL 5JOFA 2JK5A 5JXEC 5F72S 5C0ND 5DUBB 3HFML 3TFKC 5C0AB 4BSVB 5F9WC 2I9TB 4NN7C 4A2MA 3UPRA 3BEVB 5DMKA 2O5YL 4PGBA 4HKJB 3CFIC 1EO5A 3L95B 4OF7A 4U4BA 3U0TA 1WFOA 4Y4KB 2IGFH 4MQXC 3RRQA 4KHTH 3KLDA 4MNQB 3TBVB 1LVEA 5CINH 2H9GB 3MV9D 4O9HL 1MQKH 1SHMA 3VXTA 3DNKA 4D2NA 1HKLL 3MRDA 5EZJA 5L9DL 4M48L 5IEHB 4JZJB 4GBXB 2AV7B 4PJDA 3RVVC 1KEML 4OTXH 4X4ZA 5D7SH 3ARXA 3OJVC 2DF3A 4OGYH 2MOVA 3MCLH 4L8BA 1ZHKA 4MXQC 1U58B 4LVHB 3WHXB 5T5NF 4AL8H 3CC5B 3CU7A 5IW3A 2VUYA 5GGRY 4NQDA 5A2JH 4LRNH 5AZ2H 3IJHB 5EOQL 2GK0A 3JV4B 5K33A 4YFDB 5GGQL 4Q2ZB 2ENYA 1OTSD 2SEBB 4LVOB 3PDDA 3WIIL 1FG2B 1TQBB 2BP3A 4PJIB 5IQ9B 2M8XA 1YY8B 1S9WB 4Y1AE 4YC2B 4CJ0A 1OHQA 1T1XA 1DDHB 2JJVA 3PV6A 1ZLVK 5CZVL 2I24N 2CDEA 4JN1L 3GHEL 3BE1L 1IGTA 2OK0L 4OCMC 1X9QA 3HPLA 2FEDD 4EBQH 3RQ3A 1OT1A 1D6VH 4KVCH 3Q6GL 5HGAB 3HA0A 1WZLA 3D3VE 4V1DB 3CSYB 5L8JB 1OLLA 1WK0A 3OKKB 4QHLA 4X6DE 4P9HL 3BP5A 1U95A 1W0YT 5C0BD 3QHZH 3GSRA 2UY6A 4JZOB 1TIUA 1BM3L 2W0FA 3QP3A 1KCVH 2FYYA 2OL3B 1ZXQA 4HX1B 2GIYA 3OJMB 2F15A 1JGEA 3VXQA 1AXSA 3O2DA 1EJ6A 1RAMA 1SY6A 1U8HB 1P1ZA 1CYGA 1P4LA 1DFBL 2LABA 1E6OL 4N8CH 4U2YA 3EO1B 4WU5A 5IJKC 1PVHA 3LRSA 5FYKL 5GGVL 3BZ4B 5T3ZH 4XGZA 1YMMA 2P7TB 4ZSOB 4MNGE 3HFMH 4DZBB 4JO1H 1ACZA 1XCTA 4LCWB 3VGBA 4HC1L 1K8IA 1ZHNA 2B8OT 5E1AA 1U8IA 1SMAA 5A3ID 1O7SA 4G8GD 3STLB 4DTGH 1H3UA 3S37X 3SO3C 1FNSH 4K7PY 2CKBL 4AG4H 3OHXB 1ZTXL 5DFVD 1BX2A 1KLGB 2R0ZL 2V5MA 3RY6A 1NCCL 1NC2B 2XZCL 2WUCH 3PUCA 4HWEL 5EIVA 3AUVA 3MRKB 1LE9A 4O9HH 1KJ3L 1R6VA 2VZOA 3KPQA 3OR6A 4JFEE 3U9UA 4NJ9H 4Z7NE 5L9DH 1FO0H 4FQCH 2D4FA 3WFEL 3QISA 5C6WH 1C1EH 3O6LL 1KEMH 2XFXB 5CP3H 3RU8H 5INDB 1FORL 1GRWA 5DRXB 3W0WD 4JFDA 5DK0A 5J6HA 3D87B 3SDAC 4EIZC 1JPSH 3MRJA 1OAKL 3Q3GA 3NIDE 1YNLH 5ITFA 2G9HB 4G6JH 4TQEH 3S37H 2CUHA 5E6IC 3U46A 2FB4L 4XT1C 5DLMH 2VZTA 3ARBB 4Y2DB 3B2UD 4YX2L 3GHEH 3QPXL 3BE1H 5EIIA 1XF4A 4OFYD 2JJWA 5GRVL 1I4FB 3OR7A 5D2LA 2OK0H 3K7UA 1K5NB 4IJ3C 2CRIA 4Q0XH 3ZSTA 3RPKA 4LSUH 3QG6A 5JQHC 1K8DA 1R24B 5J1AA 3MLVL 3EYFA 3PE9A 1TJIL 1XIWB 1PY4A 1IEAA 3QFJD 4QYOB 2BVPA 1NL0L 4Z7WE 2I60L 2V5RA 1GZPA 1AP2A 4UT7H 4P2YA 5DMGC 2QQLL 5KN5B 3HZMA 3IYLW 4FZ8L 1Q1JH 4Y5VC 5IB2B 5IW6B 4HUUB 4QLRA 5CJ8A 4CMMB 3ARGC 4X5WA 5MP6L 1XFPA 2E7HA 5D6DA 1UJ3A 1CVSC 2BY1A 1T7ZA 4KU1A 3UTSA 5F6IB 3QDGD 1E6OH 5GRUH 2HFFA 4XWGH 1ACYL 1G7IB 4UQ3B 1U8JA 2XRAL 3BH9B 4MHHG 4JPVL 1MFNA 1BQHA 5CZXC 2Q3ZA 5CJOL 3QUMA 5J11C 3IXAB 1FFQA 3OAZH 3SGJA 1I85C 4XCYB 2B0SH 3SJVE 1NUNB 1UKQA 4JY5L 3OZ9H 3W81A 2AI0H 4KV5E 5KOMC 4HIHA 1NGPL 5HYQA 3BW9B 3FQUA 3LHPL 3FO1B 2P1YA 2FZ3B 1QO3B 2GFBA 1UWGH 4YE4L 2NXZD 4LRIC 1CE6A 3QXDA 1MQ8A 2EYSB 3KGRA 3PGFH 4MS8D 4NRZA 2J4WL 2RJMA 5JPNB 3O6LH 4CADB 1MHCA 2X2YA 3GJEA 5L0QC 1ZHBA 2VO5A 1JPGB 2DM7A 3D0VA 3LQZA 4U6VL 2IFGA 1R3JA 4HLZH 1NDMB 2EICA 2GTWB 4GLRH 3MOQA 3H3BC 4U7KA 2EXWD 3B6SB 1LQSR 3PGCB 3MLYL 4XPBH 4PREA 1T03H 2HRLA 4O4YL 4YHPA 4OCNC 4F33B 4GKNA 3JWOL 3HC0A 4RISL 1BWMA 2FB4H 1DLFH 3P4NB 3CZFA 3PF2A 1JTPA 3L1OL 5DJ2B 4YX2H 5GHWL 1MCNA 2DQEL 3FQTB 3ZDXF 4ZOAA 4WO4C 2XTJE 3T0EA 3GRWL 3DRQB 3SDDD 5SX5H 3GIZL 3VRIB 3MLVH 1TJIH 2ARJQ 1ZEAL 2Z8VC 1BECA 4ZUUB 1QFHA 4KY1L 1SBBA 4XZUA 2R2HA 3FZUD 4L8SB 4I0PC 5DJ8B 3MMEB 1CGYA 5EUOF 4Y89A 1HHJB 2IANB 3LPGA 4GAYA 1EEQA 3GSNL 5HHVL 2ATPA 4LU5H 3VXSA 3SE8H 3BPLC 3U79A 3OXSB 1DVFC 4GLRI 1P4BL 1FZJB 5LXGL 4ZXBD 4R4BA 5K9OA 2RB8A 2BRQA 2AQ3A 3RTQB 1EXUB 3SKOB 4I2XB 4DGYL 4LQFL 1ACYH 4QF1B 1M05A 4AM0A 2XRAH 5C6TH 5F7UA 3PWVB 4LBEA 3VG0L 5F7FA 5CJOH 3LKSB 4W68A 3LH2L 2G2RA 3GB7A 3F7PC 3X13A 3OXRB 1UJTA 4M61A 1JBJA 1G7JA 4UAOB 5FGCB 1UH3A 4JLRB 5CP7B 4D0CB 1IZJA 2Z31C 1S9VB 4E0RB 1NGPH 2J8UB 2R1YA 5F9JB 3L3GB 1T2XA 4OZHB 3B9AA 4MNHA 3CLFL 4TULL 1CD9B 1AHWA 3MLWL 3PG2A 4ZOEA 2CKBB 3NFNB 2G60L 4YE4H 4QEGA 4W6XB 2NY2C 2MKWA 2L7UA 2P24A 3QIWB 4HV8A 5E2VL 1MF2L 1D9KA 3SOBL 4LMQI 2UYLA 1EEYA 1A2YB 3T3PE 1CXLA 1PG7X 1ZMYA 1IM9B 5CSZB 5SX4H 4Y19A 5HI3D 1X44A 2NX5A 2V17L 1BBJA 1AR2A 4UIMA 4OFKA 4OLUL 2WBJA 3WL9A 2YPLB 1I7ZA 1OGAB 4YHNA 4IIQB 2EECA 3OB0H 3BPOC 4FTVE 4Z6AT 1W0WB 4TVPD 1CLYH 2X89D 2FNBA 5GSVA 2VL5A 3JWOH 4RISH 1KSRA 4HH9A 5GGUA 3IVKA 2NY3C 4FZEH 4JFPA 1WZ1H 5T5NG 3WUZA 4L3EB 4ZFOL 3SEPA 4XAKE 1D5BA 4UMGA 4OD3L 1I8IB 5CS7A 1YEDA 1HHKB 4YHLL 5I8OH 3GRWH 3H8NA 2NW2A 5HYJE 1JE6A 3G6JE 3QEHA 3GIZH 2VXUH 3QEQE 1YPZA 2NY7H 3EZ8A 4G9FA 4LCIL 1PG7H 1I3RB 1AGBA 4KY1H 1NAML 5L8KB 1TCRB 5SX4I 3QHTC 2DS4A 3DARA 4NZRL 1KIPA 2OI9C 4WTWA 3E6FB 4RQQB 1SJHA 3GSNH 4Z76B 5HHVH 1J8HE 1CD8A 1WAAE 35C8L 5MEPB 1P4BH 3WFBL 3EHBD 3KLHD 3TBSA 2IAMD 3JWDH 1QA9A 4CL7A 1CXHA 4LVNB 4LQFH 4PGDB 2GJ6B 3HPJB 1RUML 4ETYA 3ZDZE 2FJHB 5ENWA 5HVGB 4OKVB 1HZHH 1B9ZA 4K8RL 4GKZB 3VWJA 3UMTA 3NOIA 4OCWL 3CFJB 3LH2H 1Q0XL 1INDH 3EOAB 4XVJL 2Z91B 4JR9L 1JPTL 4W4OA 3OKLB 3BHBB 3ULVH 3MRFA 3RNKA 3RI5K 3MV7B 4M7LL 4OCYL 3FT2A 4EZMA 2NY1B 3T09A 3O6KH 5SWSE 5J7CC 4G43B 4O58H 3HC4L 2PNDA 4PLJD 4XBEH 4Z95H 4HZLB 5JO5B 4HQQH 1P7QA 1QLRA 2VDNL 4PD4J 5GS0C 4CMHC 3VE0A 5IBLC 4N68A 3D39E 2X1QA 4PJ8B 4YHKH 4JKPL 3EFDH 3U48A 4G8FB 2MTPA 3C5SA 4Y4FB 4MQ7B 3IDGB 1W8NA 1EHNA 4JY6B 3HZVB 3O9WD 4JZJC 1QEWB 4NKQB 5IHUL 2Q86B 1VCAA 2RR3A 5TE6L 3G9VA 43CAB 1DQDL 2VLKE 4QWWD 4PJEF 1VFMA 4OD2B 3QO1B 1JN6A 2BK8A 1BPVA 5EUOB 2BNQA 3FT3B 4RFNC 5E08L 2CLZB 4LVHC 3FRUB 2FO4A 1ES0A 4WDIA 4YDIL 4NRXB 3WD5H 3FO2B 4XAWL 3X17A 1Q9KB 1QRNE 1AJ7L 4K07A 4LPUA 4PJAF 3D85D 4LVOC 4H8WC 4A6YH 1TQBC 5FA4A 3KPPB 1CQYA 3RZCD 2ICCA 3MRRA 3NCCB 3SE3C 1NAMH 1C7TA 2F19H 3B9VA 2B39A 2FHCA 3I84A 3B5GA 4KUZH 2DWEA 4NZRH 1PY9A 1LE5A 4PBVC 5EC1A 2P4AB 3RFZC 3GSNB 3NMEA 3WFBH 5FCUL 1AD9B 3N06B 4R97B 2ZOLB 5I8CA 5E8EA 5ISZD 2AJVL 4LKXA 5AZEH 4QHUB 3HMWH 4K8RH 5ETUA 4NGHL 3MNVA 1Q0XH 2JELH 3QSKB 1DQQB 2A73B 1MVUA 4YBLC 1JPTH 2ZUSA 2J12B 4YPGB 1NUFA 4IOIB 2QADD 3LN4A 1FC2D 4M7LH 5JORB 2D7MA 5T33H 3PJSA 3RGVB 5CD3B 3VXUA 5DD1L 1I1AB 2E3VA 3IJSA 4JPIB 4MDIB 3V6FA 1YYML 1TZHB 1UM5L 1HSAA 3DTXA 4LLYA 3CZJA 1IKNC 1CI5A 4YFEA 4PRPE 1IILE 2B2XH 1F3DH 4EDWL 1CU4L 4U6YB 3SCMD 1MEXH 1KCLA 2MQ3A 3ULUE 3BXNB 4NUGL 3C9NB 1G7QB 5DI8A 4L4VD 4PJAA 3UEZA 3O11B 1DBML 1RIHL 3VFRA 4F9PC 2R0KH 4PJ7F 2IPTL 4TUOB 3MGTB 5IHUH 4ZTOL 5TE6H 4WV1A 2X1WL 1RK0B 1UWEH 4HHAB 1ZANL 5IHBA 5MI0B 3MV9E 5TF1L 1P2CA 1YMHB 3FN0H 1ED3A 5MHSD 2PTTA 3GUTA 3WS3B 3E6HA 1D5IH 2Z0BA 5ID0B 5E9DB 3WNOA 4P23D 4JZNA 4QHNB 2EDEA 4YZFF 3J7HA 4BFIB 3HRPA 4ZXBA 3A6CH 4XNMA 2EC9T 4QO1A 4PR5B 3WIFA 4F15B 3GMPA 4ZFOB 4YHYB 1LDSA 5B39B 4N5EC 2W0LA 1L9MA 4OI9A 4ONOA 3ARBC 3UBXA 5DYOA 4XMLL 4CN1A 5KSBB 2VZVA 5M94B 1JZ4A 1FAKT 5C08B 1DBAL 1Q94A 1SVCP 3F12B 2FEEL 1KT2B 4WFED 5C0CE 5HVFB 5L6YL 1NCAL 3LKNB 2OBGA 1MIEL 2NXYD 5BVJA 3WKML 1B90A 5HHXL 1NAMB 1ORQA 5FGBA 4F7EA 1KGCD 4YDKL 3SGKC 2EYRA 2VAJA 1I7RA 3LEYH 3UTQB 1AGEA 4OI8A 3V4VL 3CFDA 3RDTA 1G6RL 1QR1B 3KXFA 3TIDA 4L1DA 1U41A 1LDPH 4LP5A 5JXED 2VERN 3TFKD 1OAYL 2ARWA 4YXLL 4MD0B 5GGTA 3WHE0 3GO1H 4NO3A 5JW3L 5C0BE 3FQXA 4ZQKB 5F6IC 3R0NA 1DQML 4OCXL 1OW0A 3GMRA 2HFGL 2HJFB 4X6EB 5HXMA 5JW4R 4GH7B 4XCEB 1T5WB 3EYVB 5ICZA 4JDZA 4KXZH 5ALCL 4XNZB 4DGIL 5F1SA 5I76B 4PJEB 1H3XA 2BHYA 3RVVD 3M1BA 1NBVH 5LCVL 2PR4L 4X5XA 3MJ8A 4PY8J 4BK4A 4FQQB 1IAIM 4LPWA 5GRJL 4JG1L 5LQBL 1CK0L 4NUGH 4G9DA 3DV6B 4Z5RA 4AYFA 3SDCA 1Y6KR 4X6FB 4P2OB 1DBMH 1I7UA 1FLRL 2FSEA 1PDKA 1GAFH 2VDLL 1WLHA 3ULSB 5F1KC 5E2JA 2HN7B 2ITDB 3D48R 4QRUB 5TF1H 3O0RH 4X7EC 3LSOB 4QOKB 4BQ9A 2EIZB 3U1SH 3IDXH 4PV9A 5HHPB 1A47A 1OLZA 4HJJH 4JHBA 3G04A 1KYOK 1UXWB 3MZTA 2OZ4L 1FRGH 3IB4A 4KXZI 2NTSP 1F2QA 5IB5B 3MBEC 1RI8A 1NDGA 3TVMB 2FR4A 2VLLB 3AS2A 4RNRA 3UJTH 2LV4A 3MR9B 4LFHG 3BVNA 2ZG1A 4R7NA 5TDOB 4XMLH 3T65A 2BNRA 3P0VH 1LO4L 1DBAH 4HDIA 3SBWA 3WNKA 1YN6B 4ZODA 2VQ1A 3TNNA 1N59A 1LO3H 5L6YH 1MIEH 3HS0A 4F9LC 4ZFFB 3Q6FA 4UBDC 5IFHH 3KPRE 4GSDL 3MLZL 1LO5A 3A6BH 1G7LA 4UOW1 6FABL 1KV3A 3NIFF 4HUXB 4P2QB 3VFVA 4DVRH 4PG9A 3PDOA 2BC4B 1OAYH 1B0RB 2HYMA 2HAZA 1HSBA 1JGLL 4OKDA 4DKEH 3BP7B 3EOYG 1RZ8B 2AK4A 3F65A 3RTQC 5BCAA 1B3JA 3TV3L 1QSED 4KTEL 4UDTB 5A16B 5EA0L 3PWNB 3S96A 15C8H 4DJMA 1OAXL 3D3VA 2JJSC 4U1MB 1HYSD 3SGEH 4X6DA 1HK6A 4MSWA 4P5MB 4UAOC 4HF5H 3ZKXC 5ALCH 4XWOD 3KYAA 4H5SA 1RVFL 3BN3B 4OSUH 4U6TA 2AQ2A 1F11B 3BRFA 1Z3GL 1UFUA 3EYQC 1LMKA 4Z77A 3OKMA 3ARYA 2DB8A 3TBTB 1BAFL 5B8CA 3SDXB 2VWEC 4NM4L 1I9IL 4R96B 4X7FC 5EBWA 4XNQA 3SDAD 5EBLA 4JM2A 3EJJX 1JWSB 3AY4C 3QIWC 3D2UA 4IRJA 2VLRB 3HC3L 4EI6B 1FLRH 4JO3L 4NQCB 1JPFA 4MNGA 1EAJA 4KRPB 5DWUL 1P7HL 2GT9B 4E42A 2BY0A 2IALB 4Z7WF 4KQ3L 2GITB 5DD3H 4IHOA 1GC1L 2ADJB 3RL1A 3WUWB 4YJZL 1NBQA 3BKYL 1D5XA 2EDKA 1AXTH 1KLUB 1OD9A 4CNIB 5IEKA 2OQJB 1H15A 1HHIA 3W39A 3SGEI 2OZ4H 2XTLA 1KTKE 5EO9A 3LB6C 3WIHA 4D0BB 4NNXB 2E27L 3MJGX 4S10A 4H0HB 1FNGB 5BXFB 4Y5XB 4LDLB 1ND0A 5EZOL 1GGUA 1MAKA 3VD3A 2XWJA 2YKLL 3TEUA 5DMGD 4CN6A 4FQIH 4UU9B 2XQYK 1E27B 5BRZD 1IGML 4U05A 4OZGE 3ARGD 2BOCB 3MLXH 4U1KB 1XEDA 2CMRL 3MO1A 5TE4H 4NHUA 2CR6A 2Z4QA 1DANT 2W65A 5KSAB 3WFCH 5DJ6A 3LS5H 5D7IE 2WIIA 1JF5A 4GSDH 4MAUL 1PYWA 3DROB 3QDJB 1MCOH 2WWMC 6FABH 4U1GC 5CZXD 4ZFGL 4MMZC 4WFGE 3KYNA 3RKPA 1G6RB 3LEVL 2BSTA 1K2DA 4P2RE 4ODXB 3EOBA 1JGLH 4B50A 3PWPB 3K81A 3QH3B 2UY7A 3RJQB 3RNQB 3NTCL 3GBMH 5AYUH 3PWUB 4GG6F 4LVNC 5F7DB 2IH1A 2Y5EA 4O2EA 4RZCA 5F97E 5JMOC 5EA0H 3H9SD 2Z35B 1WSST 4I13B 4XMPL 4PJFB 3I02A 1OAXH 1JK8A 1Z5LA 4GMSL 3DBXA 3AB0B 1AC6A 1YDPA 1HIMH 4HCRH 5E94B 5TDNA 1XF3B 3AREB 4KC3B 1WWWX 3V6OE 4EI5C 4JFYA 3MUHL 2Q8BL 5FYLL 1AE6L 3QNYA 1A6AA 4KAQH 4AK1A 5IB1B 2CSPA 5DJDA 3O4OC 1WBXA 3SKUD 5FYJU 4NM4H 4MA3A 3EAKA 2ZOKB 1FYTB 1FV1B 4YHIB 4ZUWB 4F37K 3U83A 1EO8L 2BY3A 3DMMC 4JO3H 3RWIB 4KUCF 2DQGH 1KJ2A 3IU4H 1T22A 5MENB 5DWUH 2GCYA 2BMKB 4I3GA 4MMXC 3BPCB 2WBWB 3SJVA 1RHHA 4K3HA 4MDJA 5A2IH 1GC1H 2YMXL 3O6FA 3BKYH 1U6AH 2XWTB 4MB5A 4YWGL 5I1HL 3RP1A 3WSQL 1E28B 1DBBL 4WO4D 1MAJA 4M8VA 4O5LL 3PP3H 3WFDL 4PV8B 3O4LE 1FIGL 2GSIA 2WINA 3P4MA 4HWBA 3T0WA 5LKNA 2E27H 3ETBF 5EUKB 3NFPA 5KJRL 1ZS8B 4QTHB 4I0PD 4NQEB 1EZVX 2VDKL 3KWWB 3JWOC 1EUTA 1V3KA 5CBEA 3I6GB 4L8DB 1IGMH 4ODUB 1OPGH 3CFKB 3OKOB 3FCTB 3GKZA 3JSSA 1DVFD 3O2DL 4NOBA 5F9OL 1HN1A 1SY6L 1UKTA 3REVA 3CUPA 2F74A 1WCBB 1KFAL 4S1DC 2H3NA 2JB5H 4OUUB 3LKRB 4QT5B 1U3HD 3S4SG 4MAUH 1MUJA 1I1FB 3ZE1F 1T1YA 4YQXL 4AT6B 2DTML 3OAZK 4X8XA 2Z92B 4BZ2L 4CDGC 3Q0HA 2ARJA 4PTUA 2AK1H 2DQTL 3CDFA 1OCWL 4I3RH 3U82B 2FJGA 3ZE2E 1T5XA 3D25A 1MHHA 4MCYB 2Z31D 3BZEB 1UEMA 3HI1A 2P5WE 3QUYD 3KHOA 5BW7C 2BXZA 1QSFD 4R97C 3E2HB 3UCRA 3AS3A 1MJUH 3JWDC 3SKMB 2FDBP 4NKMA 2DD8H 4JRXD 1AI1L 5E4IA 1Z2KA 4OFPA 5A43C 5CLWA 4GMSH 4Q6IA 1CGXA 2ZUQB 5L88L 2NY2D 3L3HB 5CJBA 4JANA 4FQ1L 4HPYL 2ESVD 3HR6A 5CSBA 2C4FU 3BUYB 1F5WA 4DKAA 3BO8B 1KPRA 3RGVC 1WF5A 2F53E 5IMMB 3ULVC 4GRLB 2Q8BH 5IV2A 4HEME 5GISH 1AE6H 1FVDA 1H0DA 1I1AC 1ZVSB 2X4UA 3B5TA 3OG4B 4OGXL 4ONHB 5IB3A 3MGOB 4YPJA 3P77B 3GGWA 2FX9L 3D9AL 3OAYK 3C60B 3RUGE 5KSVB 3TM6A 5JW4Q 1JFQL 3ARPA 5HHOE 4E41B 4OLZL 2DL9A 3U6RB 4PJHE 3D69A 2NY3D 3NAAH 1FH5L 1QNZH 4QHKJ 4BZYA 3QNXA 4QRRA 4ZOBA 5DSCB 1CGSL 2W1NA 3HMXA 5GRVK 3NA9L 4JQIH 5I1HH 1WC7A 3WSQH 1ORSB 1G9NL 1DBBH 3JUYA 3R06B 1TJGL 3NCJL 4RA3A 5CILH 3VMPA 3WFDH 1MCQA 1FIGH 4U1NA 3EO0B 1ZHLA 5LVEA 2Y06L 3AAZB 1VESA 3ZDZF 4BH8A 1PJ9A 4JB9L 2HKHH 3DURA 1JUFA 2VDKH 4PJGE 4XNYL 5GS1B 2DLFL 1SJEB 4WJ5A 4F15C 5C70A 4FFZL 4YHYC 1AKJB 4L8CB 2YPKA 5D96B 2WAHA 1YEJH 4XPTL 3C5ZB 1JL8A 2DBLL 1DEEB 4TSCL 1XGPA 3MUZ1 1MWAA 5C2BL 4HIEB 5D1QA 5CBAA 4JFFE 2DQIL 4PJ5D 2HVJA 4FTVA 3QUML 4JQXA 2DTMH 4H20L 2IQAA 4BZ2H 1M4KA 4PY7A 1U93A 3DO3A 2JK5B 1MH5B 3QDME 2BNUA 1OP3H 4OQ1A 3UPRB 4LEXH 2FX7L 4I18A 4PB0L 4NN5C 4PGBB 3ARTA 1QUNA 1CICC 4HIXH 3G6JA 1AI1H 3U0TB 2F58L 3QEQA 3N1QC 3VFWB 1VEPA 5ID1A 3VFNA 5E6IA 4K8RC 5GS0D 1LP9F 5IBLD 1QHPA 4HPYH 3O2VH 3TP4A 3H3PL 4Y2OA 4LIQL 1U8PA 2FGWL 4Z78A 2FJFA 2V9QA 3VXTB 3MRDB 2D0GA 1CBVL 1J8HA 3V52L 1WAAA 1QLEL 4WHTA 4MNQD 1J0ZA 4PJXE 1C16A 4PJ9A 4FG6C 1T0NA 4WI6A 5D2NB 3D9AH 4N0RA 4XP1L 1O7VA 2VZ1A 5CD5C 1JFQH 3IDIB 3G5XA 3QUZA 4M62H 2GK0B 4JVPA 3SO5A 2OX5A 4TYUA 1C8PA 2WP3T 4FXGA 4JG0H 5DJ0A 4P2OC 1BIHA 4YUEH 2CDFB 5DZLA 5HYIA 3PV6B 3SE9L 1G9NH 2CDEB 3BX7C 1WIPA 1IGTB 5SWSA 3BGAA 1PFCA 1B88A 1VDGA 3HPLB 3UPCA 4MJID 2XPGA 1H8SA 1ZGLP 2DKSA 2Y06H 4M93B 2MCPL 3D39A 3UTZB 4QHLB 3BP5B 1JYVA 3ZTNH 3OAUH 4NWUH 4QXTB 1M6OA 5MHSE 4G6FB 5DVKA 2RAMA 4M1DH 5GRXG 4V1DD 3GSRB 5CLTA 4N0UA 1KIRA 3X3GH 2W0FB 3TA3C 5DRZB 2FYYB 2WMPA 4TSCH 4KK6C 1J1PH 1JGEB 5T3XD 3VXQB 1C08A 4LRIA 4G8EA 1P1ZB 3WXWH 1HILB 4IMLA 4WW2A 2VLKA 3NFSL 4X9GA 5DK2A 4WU5B 4X9HA 2PXYC 1JYNA 5LAXA 5B38G 2YD2A 1JZ8A 1MFCH 5EO0A 4XGZB 5JUEH 4GOSA 1TZGL 3FQNA 2EIEA 4I48A 5H2BA 1XCTB 4Z8FL 2YSSA 2FX7H 4M43H 3ULUF 1QRNA 4Y4HB 5E1AB 1U8IB 1GH7A 3P0YL 4DKFL 3F6IA 4R8WL 4KJYA 2AEQH 2CR3A 2GI7A 4FABH 1EFXB 1EGJH 2BDNL 1BX2B 2H41A 4LLUB 1M7IB 3NZ8A 4R26H 1JRHH 4JGUA 3B2VL 2DWDA 1LE9B 4LIQH 1N2RA 2FGWH 2DI9A 3IFNL 3OR6B 1A1MA 3KPQB 1KPVA 4LEOB 3U9UB 1JHTA 1KNOA 1QLEH 4XNUL 1DTUA 3MRMA 1ZVYA 1NC2D 4PJBE 5D72H 5IBTL 4X80H 3L5XL 4JY4A 25C8L 1CFSA 2YC1A 2EIDA 4KKLC 1CTOA 3ZKNC 1SEQH 2W9EH 5TDPA 2ZCLL 5J6HB 5KAQF 2H45A 4FMKA 4L9DA 4XP1H 1RUQL 4U1JA 4OLYL 1A1OB 4YGVA 4BZ1L 1JYWA 2RGSA 3AU1A 3Q3GB 2E7LC 1RZGA 2VIRA 4UV4L 4NO0B 5ITFB 4Z7VF 3TGXA 2BSED 4FP8L 4X4XA 3CK0L 1DSFH 3GSQB 3U46B 4ERSH 1J9CT 2GTZA 1KCKA 1GGCH 3DO7A 4G3YL 3TPKA 4KZEH 4KRPC 3SE9H 1L7IH 2GKIA 3CMOL 4O51A 5EIIB 3X3FH 4EN3A 1XF4B 4N5ED 1MJJB 3OR7B 5D2LB 2XI9A 2VITA 4XPGL 4HJGA 5EFIA 1IGCH 5BOPA 2DQJL 1A6UH 4ORZC 3ARBD 2ZUWA 1O0VA 2G5BA 2ADFH 2WWKO 1C5DA 2V2TA 3EYFB 1IEAB 5KZCB 4PRPA 2LU3A 2A83A 1AIFA 1NLBH 1IGIL 2DQDL 4JRYB 5FUOH 2XZQL 3VXNB 1GZPB 3GM0A 4MD5A 3HZMB 1CE1H 2R29H 3MLRH 4Y5XC 5DJAA 1RMFL 1MFAH 2R69H 1UC6A 4PRNA 2MCG1 3UTSB 3GSXA 1MRDL 1E4WL 5F3HA 1VACA 1QFOA 4PUBH 1AGDB 1U8JB 2PKDA 3EFFA 1BQHB 4U0RB 3MROA 3QUMB 5KSAC 4M7JL 5KANG 1AQKH 3JTSB 4ZO8A 1TZGH 1MSPA 1CDGA 4XBPA 3KPSB 2KZWA 4Z8FH 4Z9KB 1NCDL 1M7DA 4GRMA 3Q5TA 1EFQA 4GG8A 4HIHB 5HYQB 5T3ZD 3CXDL 4LKCA 2DN7A 3FQUB 1JF1A 4XI5C 3CD4A 4LSSL 5IWLC 5SWZD 2GFBB 5EOCL 1N6QH 5C0CA 2BERA 2VABB 5FECA 3QXDB 3B2VH 4NZUL 1KCSH 5BV7L 1J1OL 3IFNH 4NRZB 3AB0C 4KPHL 3UTTD 4OLVH 5GIRA 3WDJA 4OAWA 4ZD3H 5IESL 2XG5A 3DI2B 3V5KB 4XPFH 3L5XH 1MHCB 3AREC 3MQIA 1ZHBB 4JFZH 3HAEA 2XNAB 3D0VB 3LQZB 1R3JB 5D1XA 2W9DL 5JQ6L 1E4JA 4RIRB 1EUUA 1KEGL 4OLYH 5J89A 2Q1EA 2B20A 4PREB 1WT5A 4C56E 1B4RA 3FAWA 4J3SA 4YHPB 4FP8H 2RFXA 4IDLA 3CK0H 3HC0B 4ZUVA 4NWTL 3PQYB 3CZFB 4OCRH 4D0DA 3QJFB 1CFNA 4LPTA 4G3YH 4BUHA 1SM3H 4F7MB 3V8OA 1RZJL 3O3DB 1RZIB 3ECBA 4XP6L 4XPGH 4N0FA 2P47B 3T0EB 1G7PA 2DQJH 2J5LC 2ICWA 1MPAH 4TSBH 3LRHA 4MXVE 3LVEA 2APVA 4WEMB 3TC9A 1JTTA 1T2QL 3I50L 4QRPE 4N8VA 4LSPL 4XZUB 3O3BA 3ALPA 2R2HB 1FFNA 4OM0H 4DN3L 1IGIH 2DQDH 3CLEL 5T5FL 2XZQH 4JPKL 4NKDA 4UBDD 1H3PH 3FJTA 2DRUA 3BQUA 4GAYB 4S1RH 4ZO9A 4Q6YA 4EUPG 3VXSB 1RMFH 1ZA6A 5D93C 2NZIA 1KTLA 5C9JB 3CVHH 5BS0E 2OTWA 5K9OB 2QQKL 3WEXA 5JA8B 2X44D 4JVUA 4AM0B 4LOUC 4WTZA 2XQBL 4YXKL 4LBEB 1INEL 1UACH 1LEIA 3RTQD 5E7FA 3QI9A 1H8NA 1YA5A 2G2RB 2XIDA 3MREA 3GB7B 1I9JL 4P5KA 1PZ5A 4PLNC 3GMLA 5IBUB 2R56H 4KJWD 1BZQK 5IR1A 4M61B 1M71B 1G7JB 4R0LB 2VXQH 5CEZH 4OF6A 4TN9A 1SEBB 1BGXH 2R1YB 1BJMA 3OF6D 5EOTA 3CXDH 1TLKA 1BVKA 4MJ5A 3V7AE 2D3VA 5FV1L 4LSSH 1AHWB 1J86A 4BFGA 3PGDA 5EOCH 3EYQD 3L5WA 1A7RL 2NY5H 2P24B 4DZ8A 4X6BB 1JGUL 4HPOH 4HV8B 1NCBH 2AS5M 1O5DT 3KPRA 1BFOA 4RGNC 1EEYB 2ZUQC 3G08B 3S5LA 5IESH 3FB5A 3QIWD 1Q0YH 4Y19B 4BUGA 3H9SE 1JWUA 2CXKA 4JO2L 4R4FL 4HUMB 1NGYA 4XC3H 1BBJB 4UIMB 2AV1A 2WBJB 3VD9A 1KEGH 2A6IA 5JNYB 4DW2H 1HCVA 1CF8L 1RIVL 2APXA 4HS6A 1A4JA 3KLAB 3WS6C 3GJFH 2YPLD 3MLSL 1OGAD 4TOYL 5GSVB 2HLAB 4XPHL 4HH9B 5GZOC 2FX8L 3IVKB 4XP9L 3QIBA 4JFPB 1Y0LA 1MHEA 5DD5L 3LB6D 5D7IF 2OJZH 2DIBA 1IRAY 3N1MC 1YEDB 4XP6H 5BZWA 1I8LC 1WBZB 1OAZH 4R2GC 1CXKA 2NW2B 3QEHB 4XCFH 1YPZB 1GC1C 2ED9A 1AGBB 4AMKL 4QNPE 1T2QH 5MEOA 1BHGA 2A9MH 4LSPH 4DN3H 1EK3A 5GRWA 1RULL 3MBXL 1F4WL 1KOAA 2JCCE 1KIPB 4ODBD 5C8JA 1SJHB 7FABL 4JAMA 2WWMD 1I3GL 4HLJA 1QA9B 1IKNA 3QXVA 4TNWF 5GGTL 4NHCL 3VFTA 1MRCL 3P3YA 2XQBH 4WI8A 4X6CF 3C5ZC 5ENWB 4J4PA 2W59A 4YXKH 3VWJB 2ZP0T 4IOFC 5DUPL 4PB9L 2X7LA 2GJ6D 3W11D 3HUJE 2D7NA 3MRFB 1FGVH 3W0WB 4UT6L 5A40E 2OJEA 2X40A 1N5AA 1A9BB 3FFCE 2EDQA 3MV8E 1A6WL 1NFDE 4NBZB 2XY2A 4L4JA 2VH5L 4YR6A 4EI5D 4OZGA 4HKBA 1A7RH 4NNPH 3G5ZA 3VE0B 1JGUH 4X83A 4O02H 4RMRA 5EU5A 4V2BA 3S6CA 2X70A 1XGYL 3N0PB 1RJZA 5BV7B 1MLCA 3EOTH 4WFFD 2IQ9L 4LAJH 5E70A 3MC0A 3C5SB 2V5TA 3DMMD 4JO2H 4R4FH 2PYEE 2ZUVA 2HT4C 3B9KA 3F5WA 4NCDA 4P2RA 3QFJB 4YK4C 2DKMA 3BOVA 5K59F 3KHQA 3PWJA 1ZT7A 1CF8H 1JN6B 5IIEA 3FOMA 4TOYH 4JKWA 2BNQB 1LO0H 2CJUL 5DD0L 1ES0B 5KAQG 2BRRL 2Y72A 3T0DA 4X4YB 3T0BA 3HLAA 5KS9E 5D70L 1ZLUH 4NDMA 1FHGA 3QDGB 5DRNA 4YEEA 1CT8A 2XN9E 5I8KL 4M7KL 2XKNA 2CO6B 3OQ3B 1H8OA 1ZSDA 4L4TD 4M6OL 5FA4B 5T1LA 3S36L 1U92A 2VR5A 3V6OA 3QUXA 3QQ3B 2R8SH 5DD6A 3MRRB 4WUKL 1IGFH 1RZFH 4KROB 1F4WH 4XHJC 4PLOB 4S1DD 2RCSL 4X4ME 1GPOL 7FABH 3T0XA 5B21A 2Z9TA 3VD4A 4KI5E 4LSVL 4BFBD 1L6ZA 2NXZB 2ZUUA 5I8CB 1XGQA 5E8EB 3ZLQC 3IAGC 3LIZL 4MD4A 4JGMA 5ETUB 2DM4A 1J0HA 3EO9H 3VW3L 1K9TA 2V7HA 3MNVB 3EDKA 3S9DB 4LHUA 3UTTA 3BYTA 4PB9H 5HYSA 3CAFA 4HMDA 3VGHA 4HS3A 4L9LA 4NBYB 2YD9A 3O4LA 3LN4B 1RURL 3PJSB 1FNAA 1I7TB 3TT3H 3RUGF 4F3FA 1A6WH 3IJSB 2VAAA 3FB6B 4ZDHA 1U8LA 3KJ4C 3RGVD 4MA8H 3OBAA 3ULVD 1NFKA 3DTXB 4ZTPL 4LLYB 4S1SL 1T89C 1I1AD 4K94L 2I5YL 5I1LA 1A7OL 3RIFK 1FPTL 1XGYH 5KVFL 3MBEA 1N7ML 1R3LA 1XGRB 2R0LL 1CCZA 1QOKA 4HIJA 3RY6C 5C0AE 1MFDL 1YY9C 5DI8B 1SBSH 3U30B 1F4XH 4GRWF 3DHJA 3MACL 1J05A 3ROLA 1CXIA 3MJ7A 1NSNL 4DAGH 4WV1B 2P5WA 2VTFA 2ZG2A 1EJOH 3VXRE 1P2CB 1ED3B 1IKFL 4G80A 1I3VA 3GUTB 3OMZA 1A7NL 3PP3K 4MNQE 3UP1A 2E6QA 4EVNA 1T1WA 4H25A 4JZNB 1EVTC 2BRRH 3QWRD 4ZXBB 2WP3O 2P46B 4PS4L 1IBGL 3WIFB 1CVRA 1YYLH 5AEAA 3GMPB 3L3DA 1D7FA 5E9DD 5IVXF 4NQXA 3TO4A 4M6OH 3UPAA 3I6KA 3S36H 1NLDL 2F53A 3UBXB 5DYOB 1X5ZA 3FT4A 1Q94B 4WUKH 1F2XK 2B7DT 5HDBF 4FNLH 4U1IA 1G9NC 1I1YB 5BVJB 5EU7E 3MYJA 2RCSH 1ORQB 5C08D 2EYRB 2X5PA 1AGEB 2FBJL 3CFDB 4OQTH 3OJ2C 3RDTB 3OB8A 4PJIE 4LSVH 3KXFB 3TIDB 2YD5A 5HHOA 4LSTL 4PJHA 3QO0A 1BF2A 1F3JA 2KQNA 1IT9H 3MZGB 5FM5M 3RWGA 1HE7A 2CUMA 4MLSA 2EYTA 3TYFA 4NO3B 1UJ3C 5HGBA 4OLXL 3V9FA 1S3KL 4D94A 1CICD 2RQ8A 4V1DE 5IJVA 3GMRB 5LGKA 4X9FA 3VI4E 3AY4A 2UWEF 4S0TD 3HNTL 1WQVT 2A1WH 3CSGA 4H1LA 4K8RD 5D9SA 4I3SH 3SGJC 3ALXA 1CS6A 1D6EA 4PJGA 1UZ6F 4AY0A 5ICZB 4QCIB 3BZFA 4F2MA 4OV5A 1F58L 1DLHB 4X99A 2C3GA 3M1BB 2ILLA 2VR4A 5F70A 5C0JA 4X5XB 2I5YH 3O8XA 4FQHA 3T77A 5IQ7L 4OIBA 4FG6D 4QRQA 1FPTH 5KVFH 1G9EA 2AGJL 1N7MH 4JFFA 2P42B 2XG4A 1YNKL 5FB8A 4Z5RB 3SDCB 1MFDH 4LCWE 1KJ2L 1ONQA 4LGPB 1G6VK 5CD5D 2FSEB 3ET9F 4PRHE 3QDMA 4WUUD 3DX6B 2JKXA 1IGJB 1NSNH 3WFHB 3TF7C 2W38A 4P2OD 1X6LA 2P5EE 1YEKH 2VISA 3MOAL 3I6LD 3AVEA 4PV9B 3E8UH 2D2OA 1KB5A 3VFSA 5HGGS 1GIGL 2CK0L 5E6YA 2BXYA 3G04B 3WIHH 4OZIF 4HWBL 5FIEA 4QOKD 3MUGB 5I1IH 2IAMB 4WEUD 5DVOA 1NDGB 3W2DL 4FFVC 2FR4B 3A0OA 1NKRA 5EC2A 4UTAH 3MFFA 5JHDD 1NMAL 5FUZH 4HEPG 1NLDH 4GFTB 4LPYA 1NUDA 2BNRB 4I4WB 1S8DA 4P5TA 4FQ2L 4HDIB 4PJXA 3TVMD 4XP5L 3P40A 5J9PB 2VQ1B 3TNNB 1N59B 1XF5A 2QHLA 3TA3D 4BKLB 3OPZL 1KCRH 3T0EC 1ZAGA 2KDGA 4ODSL 3HS0B 2HTKC 1JZ5A 1OM3L 3Q6FB 2JF1A 1PSKL 4P46A 1OARL 4RAUA 1LO5B 3GI9L 2PXYD 1G7LB 2ZNXA 2CPCA 3RA7H 4XC1H 5E6ZA 1P9MA 4PP2A 5D71L 4LSTH 5JOEA 1Q9OA 1UH2A 3VFVB 3PDOB 1KC5L 2VE6B 5BZDA 1LO2L 1OP3K 4MLIA 5FHBL 4LDEB 4P2QD 3S3PA 2VXVL 5C7XL 1HNGA 4AEHL 5IFAL 4M4PA 2QKIA 4OLXH 1EAPB 1S3KH 2AK4B 4HD9A 5JMRA 1RHFA 1T1ZA 3ZKMC 1HNFA 2R4RL 4HBCL 1CG9A 3PHQA 1BZ9A 4W6YB 3U7YL 4C4KO 4LPVA 2DM3A 3OGCA 3S96B 4NIKB 5F1NB 2EE9A 3D3VB 1RK1A 4ZYKA 3PP4L 1GCFA 3GMQB 4X6DB 4KGLA 4MSWB 1YN7A 3IJYB 4IEFB 3C2AL 4H5SB 2HMIC 5B3JF 2AXFA 4KKBC 4LASL 4NC1E 4Z77B 4Z7UF 5DMYA 4KKLD 3ZKND 1AHWC 5B8CB 1N4XH 2QQNH 3MRQA 5EBWB 1A14L 1UWXH 4JM2B 3GK8L 3QRGL 4MAYA 1KJ2H 1WWBX 5F7EL 3IXTA 4UB0L 4OD1H 1MIMH 3KJ6H 3L6FA 1C5CH 1D9KC 1EEZA 3LKPA 4APQA 2AKRA 4I0CC 4J6RH 1DR9A 2X4QB 3MRCA 3QG7L 3KS0H 4E42B 4Y16A 1V7NH 1NQBA 1QLFA 4IHOB 2VLRD 3HMXL 4UILL 1GGIL 1WEJH 4NQCD 2EZ0C 1EIBA 1N64L 4PRAA 2QL1A 1S7TA 4P9MH 1D5XB 1PLGH 1D3CA 1AFVH 4KRPD 1UVQB 3MLTA 5TGBA 5CCKL 2WBJC 5IEKB 2Q8AH 1H15B 3MLUH 1HHIB 2P45B 3W39B 4MA1C 3LQAL 5EO9B 3FL7A 1BD2A 4LSRL 4IBLT 1UB5B 1UXSA 5FYJL 1OTTC 4UOJA 3W2DH 4WRLA 1ND0B 1P6AB 1ZWIA 5BW7A 4CDHA 4HUWB 4PJBA 5IT2L 2Y4SA 2R0WH 4XNXL 4KHXL 5LJYH 1MWAL 2YUXA 3DUUA 3MO1B 4ODSH 2AJUL 5T1DH 2Z4QB 1C7SA 5ANME 2W65B 3H9HA 4QY8A 2IH3A 1OARH 3WNPA 3QA3A 3GI9H 5EWIH 4RGOL 2IFFL 5C3TA 3W5MA 5KSAD 3KYNB 4NKOA 3DOSA 4WW1A 2BSTB 1K2DB 1D5ZA 2N1KA 4ELMA 3P30H 1L7TL 5I1CH 4RRPA 2ZKHL 4YHOL 3RWDA 3SCMB 1V3LA 5IKCA 2Y5TA 5C09D 3DXAD 1CIDA 2IH1B 4L4VB 1CGUA 4RZCB 3PWPD 2FD6L 5E8PA 1BMGA 1JNNH 3I02B 5D5MA 2CLRA 5IGXL 1Z5LB 2IANE 3ZT6A 3VWJC 2VQTA 3DBXB 2C3WA 1RSFA 2ZCKH 3PP4H 4JFHD 3B4NA 1YDPB 3LV3A 4W4OC 4QHMA 5TDNB 4ISVB 3HNVL 4KDWA 4WWKC 5LWYL 1TTUA 1F6FB 3UTPD 4JFYB 3QNYB 5IHZA 1A6AB 5DJDB 3ARED 1WBXB 5KG9A 4XCNA 4JVWA 2R2CA 3KNBA 4MA3B 4C83B 5FYKE 2GSGA 2R2BA 3GK8H 3QRGH 1EHAA 5FGCE 2ERJB 3BP6A 4RX4D 1E0OB 4MXVF 4KTDL 4UB0H 4PRIA 2R2EA 2NY5C 3STZA 5DC4B 5FF6A 4D9RD 5KVDL 3ARUA 1KJ2B 1A3RL 3VXME 2V9TA 1RUPH 5ADOH 1U0QA 2GCYB 3IKKA 3QG7H 3SJVB 3UTOA 1RHHB 4MDJB 3WJJA 1DL7L 3HMXH 3O6FB 5E8NA 1N64H 2V6HA 4A6YA 5MEND 3UAJC 3NH7H 5CCKH 4XPAH 3NABH 1ITCA 5JXAL 3KPMA 4CAGA 3T4AA 5EU6A 5I75C 3LQAH 4K3DH 4M3KB 4KRLB 2XXCB 2WINB 3P4MB 5K9QG 5J57B 4PP1D 1BEYL 5I18H 2F54D 2UZIL 1CICA 5CBEB 2DBJA 4GW4A 5I66A 2YPLE 1OGAE 1FN4A 5IT2H 3UX9B 3GZKA 1QFWH 3ELAT 4NQED 4KHXH 4XNXH 1RZJC 2J2ZA 4KJQD 4YHZH 2H2PC 5F44A 5JA9A 1X5IA 1KELH 3G5VA 3REVB 2F74B 3CUPB 4ACPA 4HT1L 1RUKL 3NA4A 2H3NB 2KBGA 1MUJB 4LOUD 2IFFH 4ZPTA 4C56A 5F7HA 1T1YB 3R1GL 4XP4H 4L3EE 5KANI 1QYGL 1HCFX 5J3HC 2A9NL 1UM6H 4P4KA 3VD7A 4NQVB 2ARJB 1UEYA 4PTUB 5CEXB 3K8KA 3RWCB 1KYOJ 2FJGB 3HRZA 2MFNA 3IDJA 3TO2A 1I8MA 1PEZA 5I17B 2ZKHH 4QXWA 4WVRA 1LILA 2R4SL 2VDOL 2XTJB 2H26A 3I3EA 2FD6H 3FRPA 2YXFA 1EMTL 3I85A 5IGXH 4KKCC 5ACZA 2J1KA 4NQUA 2VSCA 3MNWB 4JANB 3OKEB 2AABL 4OCSL 4GJTB 1A8JH 1FFOA 2WLZA 1QFWI 1TVHA 1OP5H 2EO9A 1YQVL 2Y23A 1MAML 1KPRB 5KVGH 3AGVA 5CEYA 1CR9H 3RI5F 1QBAA 4NUJA 1FVDB 1H0DB 2X4UB 2JJTA 2DQCL 4D9LL 4G5ZH 3BDXA 5D8JH 4EUPH 5BS0A 5IB3B 4J12A 5FK9A 1K3ZA 4LSDA 3VFMA 3GGWB 3GMOA 3X12A 2MQ0A 4NKIH 4KTDH 1FZMA 3WHE1 3MV7E 5KVDH 4QNPF 2NNAA 1P6FA 1C12B 3TCXA 3PIQA 5J06A 4FA8A 5GZOD 3D69B 3EYSL 3C60D 2ICEB 1W72L 4G6KL 3D0LA 4KQ4L 3U30C 4CVWA 3QNXB 4I0KA 4QRRB 4FQJL 4E41D 1JI2A 4WTXA 1WC7B 2ATKA 4J8RA 1A9EB 2A6KA 4IRZH 2DQFB 5JXAH 4R2GD 3DPBA 3CGTA 4ODWB 3DVGB 1YECL 4X7SH 3ZO0A 4U1NB 1ZHLB 3ARDC 4JQVA 3ZDXE 1NGWA 3DURB 4BFEA 4CVXA 5JW5A 1TETL 4UIKL 4W6WB 2QHRL 5AUMA 3IRPX 4K3JH 5BQ7B 2UZIH 4ONFH 4FS0A 4XVSH 4WJ5B 4Q74A 4ELKB 2EO1A 2YPKB 4WFHE 1FL5A 5IF0A 2HKFL 2W91A 1ZGLB 4HT1H 1XGPB 1RUKH 3VH8A 1MWAB 4C57C 3BT2L 4OIIL 5EUOE 3VFGL 2WSKA 1T0PB 4ODVH 1AKJD 3CFCL 3B43A 1NFDF 3GSVA 4I9WE 4QGTA 3FB8A 4LLMA 5L2JB 2HVJB 3GBLA 4FTVB 3C5ZD 5JR1L 1YEFH 1BZ7A 3MRIA 1FFPA 1UM4L 3FQWB 2IQAB 5FGBC 4IOFD 4PY7B 1U93B 4RWHA 1CZ8H 1MCLA 2YA1A 5C0GB 2PCPA 2QSCL 5IB4A 1KIQA 1FGNH 2QR0B 3RDTC 2AJYH 3UXFA 1XR8A 5T1KA 3ARSA 4I18B 4M7ZC 1UENA 2BVQA 2R4SH 1CL7H 5ESAA 4BSJA 4DCQA 1OAQL 1R5WA 3E3QC 5J12C 3G6JB 5HPMA 1R3HB 5ID1B 3WLWD 5HGHA 3VFNB 3RBSA 3LY6A 3SKNA 3HI5L 4RMQA 3L5IA 5E6IB 3GMMA 1T3FA 1OW0C 2KKQA 2AABH 5FUCE 1U8PB 4L29A 3DGGA 2JCCA 4Z78B 2FJFB 4FRWA 1J8HB 4WHTB 3LKQB 4IJ3B 4N90E 1HHGB 5KS9F 1C16B 2HT4D 1LD9A 1T0NB 1WFUA 4LLWA 1UYWL 5D7LD 5HPOA 1OGTA 1NEZA 4RRPG 2HWZL 3G5XB 3RL2A 3UJIL 5CEZE 5J8OA 1JGVL 3HG1A 3HUJA 5C0IA 1LEKA 1CL7I 3SDCC 2L0DA 4FXGB 5DJ0B 4K7PL 4Q9RL 3GEWB 4NQDD 4JJ5A 3X14A 3G6DH 2YPVL 3LEXA 1GOGA 3FFCA 1GOFA 2AJSL 2H8PA 1EERB 3MV8A 4N0CD 5SWSB 1NFDA 2DQHH 3QXTA 2OSLA 3V5DA 2ITCA 3FAXA 5J11B 3N1GC 2F5AL 2H32A 4IMKA 4MJ6A 3P9LA 1SYSA 5I1EL 1J11A 5TJWK 3ULUH 3PABA 2GY7B 4BYHA 4XHJD 1TETH 2QHRH 5EORL 2IG2L 4OT1H 5GSRA 2YOCA 2EC9U 5AAMA 1JP5A 3WV0A 4N0UB 5ECJE 1KIRB 3IRZA 2PYEA 2HKFH 2I9LA 3GBNL 2CGRL 2D03L 3BT2H 4K3EH 1DE4A 4OIIH 4J1UA 5F6HI 3SBWC 3WN5A 1RFDL 1W2KT 4G8EB 4IMLB 4WW2B 4UNVA 5E9DE 5DK2B 1BOYA 3QCTH 4R6UA 5J1SC 5LAXB 4PYHA 4LSQL 4NBXB 1A3QA 4JRWA 5EO0B 2C3XA 5J6GA 4GAJH 3FQNB 4UI2A 5D6CA 5L0QB 4I48B 5H2BB 5BOZG 5KS9A 3TJEL 2BJMH 1OP9A 2AXJA 1OB1A 1QRNB 2WIMA 1YMMD 4FQPA 1T83A 1EA9C 2XN9A 3KYKH 1LK3L 3V4UL 3ARFC 1DBJL 1KN4H 1EHLL 2DKUA 3DX7A 1MJ8L 1P69B 3S88L 3NZ8B 1FDLH 2VC2H 4RAVA 3BMWA 1N2RB 4X4MA 2IBBA 1BP3B 4F58L 1A1MB 1P5VA 4UV7H 1KNOB 4MWFA 3C6LA 4WO4B 4G8IA 3MRMB 1KTRL 1YY9D 2CO7B 3GI8L 1F4YH 1NBZA 4DFIA 2HVKA 4JY4B 4CW1A 5HDOA 4IS6A 2YC1B 1J10A 1HQ4A 4GQPH 3DYOA 5TDPB 4NO2A 2APWA 2OP4H 4I0PB 3VGGA 4U1JB 1Z9SA 1UYWH 4YGVB 2GHWB 5ERWA 3SE4A 3AU1B 3MOBH 1R0AL 3NPSB 1RZGB 2VIRB 4JFDD 4RA0C 4AEEA 2HWZH 4YDJA 4YXHL 4Z0BL 5HHMD 2HG5A 4JM2C 3U36A 4TPRH 4X4XB 5T3XL 3WE6A 2COQA 4KDVA 2GTZB 1ZLUK 4IRJC 3DO7B 2C3VA 3FRPG 4PJEE 1W72B 2XZAH 1G9MH 2VZUA 1MHPH 4O51B 4EN3B 1F90L 4PJIF 5IVNA