1N10A

Crystal structure of phl p 1, a major timothy grass pollen allergen
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
238
structure length
228
Chain Sequence
PKVPPGPNITATYGDKWLDAKSTWYGGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pollen allergen Phl p 1
publication title X-ray Crystal Structure of Phl p 1, a Major Timothy Grass Pollen Allergen
rcsb
source organism Phleum pratense
molecule tags Allergen
total genus 50
structure length 228
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 1n10A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 1n10A02
4JP6A 4AVRA 3X2NA 4FG2A 1L8FA 1HD5A 4JCWA 2GAEA 1WHPA 2KQAA 1BW3A 3D30A 5GLYA 3X2LA 2G6GA 3FT1A 1BW4A 4FERA 3X2HA 1WHOA 1OA7A 5GLXA 3SUJA 4JJOA 2HCZX 3ENGA 3CZBA 2JNZA 3FT9A 3X2MA 2PICA 2ENGA 5GM9A 1BMWA 4ENGA 2AE0X 2BH0A 4FFTA 4JP7A 5H4UA 3X2KA 3SUMA 2G5DA 3X2GA 4FG4A 3SUKA 2PI8A 3M3GA 4ZM7A 1N10A 2PJJA 2VXQA 4JS7A 1WC2A 4L48A 3X2PA 3SULA 3X2OA 3X2JA 3X2IA 1OA9A 2PNWA
chains in the Genus database with same CATH superfamily
2A83B 1KGJA 3N85L 2N7AA 2AQ3A 1U4EA 3C8KB 3V6OA 4YHZH 3WHE1 1KLGA 1HI6B 2BSDA 5FGBA 3BSZA 3NACL 5E1AA 1Z5LA 1GTNA 4BZ2L 2YMOA 3T6XA 2PPAA 4C54A 1K72A 4NO2A 1MF2H 3DXAE 2K6YA 1W9XA 1DFXA 2D31B 3VXMB 1F02I 3ARVA 2KZBA 1HTYA 1KTRL 3TBTB 2WVUA 2P5PA 4YDVA 4QF1B 1KPUB 5SWZD 2EEDA 4OZGA 1SQ2N 4NWUH 1IAKA 3QCTH 3ZKXC 5D7HA 2A7BA 3QXAB 4CA4A 2OXHB 2WVSA 4L8BB 4EUPB 2Y25A 1K8DB 1SMOA 4ALAC 3CDZA 5BXFB 1JZ5A 2R0ZL 1XV8A 2VISB 1I7RB 4A04A 3QCVL 4OIFA 4V1DA 2DLTA 3GT6A 2BIPA 4OGXL 5LHDA 5DRNB 1XR8B 3IFPA 1CD8A 3A67H 4L23A 4XN2A 5EOCJ 5GS3A 1FVDB 4QXWA 2RQEA 2C9PA 3L3GA 2ATPB 4ZUTB 4Y1AB 3FSAA 4Y16C 4EBQH 2ZJSH 1GMIA 4MKTA 2XNAB 3MLRL 5HHOD 1A5FL 3EBHA 3K6FA 5D1ZB 1BEYH 1EXUA 1U91B 2VDRL 2F74B 2GTZB 4JCMA 2DS4A 3OXSA 5C1MB 1GZQB 2JJUA 5GSRB 4Q9BA 1MNUH 2DLFL 3BPOB 4JFHD 4PJDA 1MHHB 3OMNB 3EXLA 4BH7A 4NN6B 3QYNA 1AGEA 4KVNL 1VESA 3RWHB 4LPTA 3QFDB 4DVBB 4XMKL 3IS1X 1EAJA 3ARFC 3QWOA 4Z3FA 5HDBE 1AXSA 1P7QD 3CK0L 3HRZB 3U4BL 1NGWA 4HC1A 3S4SG 1SQMA 1QX1A 3GHBL 3HUJB 3BQUC 5TF0A 4IHOA 2XJKA 2HJKA 1WFIA 5D7LB 1SBBA 4NM8H 2DWTA 2XVGA 3CIQA 1PQZA 4NQXA 3E2HC 1B9ZA 1WC7A 5JIQA 2G2RA 5C0EA 2DH3A 1GAFH 1ASQA 5IT2H 3AG1B 5G4MA 2BS71 4FNUA 4NO3B 1P4IL 1JNLH 1YQVL 4F7CB 3FFCB 3KH4A 3IS0X 5DURB 2A4EA 2WZ5A 1Z5HA 3ARDA 4TULL 4CVZA 4HWEH 2J8HA 2EILB 4ECNA 1I7TB 2CR3A 3MJ9H 3FYEB 1AIFA 3M1OA 2IH8A 3CU7A 3H6JA 2Y7NA 4JN2A 4QHNA 3ROLB 4Z7VA 1P1ZA 3HTLX 4OCLC 4X4MA 2FQFA 2XHNA 3PDOB 3O3AA 2R8SH 2KHAA 1EDYA 4FQCH 4HZLA 1I85A 1AANA 1BYNA 4NP9A 1F90H 4P5KB 4LP4A 4K5MA 3E1F1 2IAMD 4L8SC 5IHUL 4OB5L 1UD5A 4QHMA 1SEBB 3WUZA 3D9AH 5CP7B 1PT0A 3FB6B 1ULVA 1ZT1B 3CPLB 2ZUTA 2GPZA 3LSOA 4O2EB 4XO8A 3C5JB 5HYJD 3DGGA 5CJOH 4X6CE 5EIIA 4DPAX 1MFMA 3TO4D 4OKVA 3WENA 2APXA 4OI9A 2D3VA 1UD6A 3QUKB 3IEAA 1YEGL 4AEHL 1QI3A 3WD5L 1ZIBA 4F7KA 5ENWA 2HN7A 3GKWL 5CHNA 2WXNA 2I60H 2W0PA 1KCKA 1UZ6E 3FULA 3PIQB 4PRHA 4UNTA 4WGKA 5KSVB 3MCG1 1HSAB 1YEHL 3IJYA 4F57H 1IBZA 4M5YL 1J8RA 5I71B 4K8RC 1TZAA 1RULH 4WY7H 1IU1A 3P0VH 2AV7A 1ZVYA 4LQ1A 5JW3L 1IVTA 4JJHA 2VDNH 2WXOA 4KAQH 4R2GB 2GHZA 4I13B 2HVBA 1H8NA 5E6IA 3V5HA 4L05A 3O2VH 5H94B 1SMYD 4BFEA 3EO1B 1KFAH 3FH7A 4N0UB 3U4AA 1R3JA 1YDPA 1X5XA 1G87A 1ZHNB 3SDCB 4IKLA 5F1NB 2F53A 7FABL 1J87A 5AVXB 5CS7A 4ANWA 5AENA 2XIBA 3VO0A 4LARL 4LDCA 7CGTA 1W0YT 4OFVA 3GIZH 3LHPL 4ENEC 4JE0A 5GS0D 1CLOH 2HUEA 4I77L 4U6HA 4G6ML 1UA7A 3QUXC 4Y8AA 3ZUNC 3ISRA 4V1DD 5BJTB 2H7WA 2CGZA 3W11D 1FZOA 1NDGB 3UP6A 3VU1A 1OA7A 4Y2OA 2WNGA 2VQTA 2C8NA 5E51A 1Q90A 1TJIH 4HXAL 5AB2A 4F7PB 3DA0A 2H0EA 1Z3GL 2R29L 5HPOA 1X5GA 5J3HD 1BIIB 5C3IA 3WTSA 5ETUA 1J1OH 1ZT4B 3AG3B 2JIPA 5CGBA 3W39A 5D5MF 3FT2B 3FTXA 1VZHA 5DD5L 5E6SB 1F4YH 1CE6A 4BUHA 3LKRA 1CXIA 4LGPB 1EAPA 3C9NB 1J5OL 4HX1A 1XMWA 1OV8A 2DY2A 5C70A 3JWNH 1RZ7L 1QO3A 1X4XA 3D7PA 3EJZC 4XMUA 4EIGB 4JX0A 3K81A 1A21A 4ZAKC 4XWGH 4DEUA 3BYYA 2EYRB 4MRBA 1A1NA 4WKXA 3KPRB 4ZD3H 1KIQA 3CHRA 4PJIA 2Q8AH 2PTVA 1A6ZB 1MW2A 2BWQA 3RGVA 3DVNB 3ESPA 3QIWC 3N9GL 3V7AG 1R27A 3WFDH 1QW8A 1N4XH 2WANA 4AGMA 1OTTD 5GHWL 4TVPH 4L0YA 3V4PH 1BW8A 2QKIB 4MYWB 2W0LA 4U6YA 3LPWA 4DO6A 1VSCA 3V4UH 3SQOL 2IO5A 1WHPA 2DQGH 3DX9B 2ED8A 1OTSD 2D0FA 4G11A 5FC9A 5B21A 2Q6WA 3RWEB 4WJG3 5F1KC 1GJIA 1KPVA 1DQLH 3VWJC 4XAWL 1JK9B 1G7QB 3K8KA 4G8EB 5F9DC 1X9RA 3OC5A 2B39A 5FKAB 4OCNC 3DVIA 1ZHKA 2ZSVA 4IIZA 4XNMB 4BWTA 4B97A 4W9FC 5AVZB 5A2JH 2X4PA 2APWA 1BZOA 2DEYX 4U4IA 5I1LB 1UWGL 2OMYA 3L3DA 3FN0H 3ARDD 3H1ZA 3H7BB 5BO1H 2K78A 4JZOA 2QSVA 3IPBA 5DA4A 4HSQA 5JXEA 3O3BB 2P5WB 4UBDC 3GDBA 2FNBA 3WHXA 2ENSA 4PV9B 4R5TA 4CN4A 2CGRL 2F1AA 2XCMC 3AWFA 4MB4A 3G5VA 4ZNEA 5IBLD 1YO4A 5BV7C 1IARB 1KCRH 1O75A 3DGDA 4PP1C 4K3DL 2PTTA 4FXKB 3CFJB 1TWFA 1JTTA 2NY2B 5BZWA 1X5HA 4LCYB 2R4SL 3FUEA 1TIUA 3C5ZC 4KGJA 4WI0B 5AOIA 3RZCD 1RUKH 1U8HA 2GEEA 2WBWB 3LKQA 3L16A 1M1XA 4GEIA 1CLVA 5DYFA 5HPMA 2GJZA 2H2SC 2NDFA 4G82A 4AEEA 4NOHA 2XWRA 1VZGA 4F9LC 2WWMC 3FQRB 2A9NH 5AYUH 1JGUL 5BZZA 3FB7A 2D0HA 4NZRH 4KC3B 4APQC 1KCUL 3VRJA 4Y5YA 1CDCA 5DJ2A 2FLBT 3E3QE 3KGUA 4PCYA 1A8ZA 2AZUA 5E5UB 4RRPM 4G70B 1EXGA 3T77A 4ZW7A 3CFDB 2DWSA 2DQUL 1QR1A 3DXAA 4PWFA 4K23H 1HDMB 3NPZB 4PRHD 4NNPH 1KJ2L 2HT3D 3V4VA 3RJDA 4B9CA 4M6NH 1YA5A 2MCPL 1YYMH 2C1OA 2CLRB 2R27A 1E9QA 2Z65C 3ZZLA 5F7UA 5I1DA 4WDIB 3VD7A 4MDJA 3JBG7 5E1GA 2C1PB 5E2WH 1RY7B 5L9DH 1A4KB 5HI4C 1ZE3H 5FGCE 1UM6H 5T1DH 2X41A 3BZ4A 1PSKL 4FQXA 1U36A 4HGWA 1NIDA 4KLNA 5E6ID 2DLEA 2VM3A 4WWKA 5DQDH 2DMGA 1AHWC 4R0LA 2ALWA 1C8QA 2F53D 1KNOB 3EDJA 2VDOB 2A9MH 5I74B 4B96A 3CLFL 3B2DC 3PAVA 4NIYE 1MJ8L 1GZHC 2CXKA 4G7RB 4GAGL 5EB9A 1VADB 5ADOH 1LQSR 5CFAA 1BFSA 4N2OA 1IC1A 4UV4H 2FDBP 3IGFA 2XQBH 1W0WB 5FK9A 5KBMA 1N2RA 3WFZA 3ULUD 2WYZA 5DO2D 2OZNA 3LVTA 3CFTA 1J9QA 3OAUH 1AGFB 3GTQA 2V7HB 2QADD 5JIIA 4FA6A 1LMIA 1OAXH 4DP5X 3K74B 4EMZA 5ITBL 5E4EB 2EUVA 3UTTE 2VR6A 5IOPA 4AMKH 3WN5C 1ICTA 2G5BB 3OPUA 5ECGA 1NJ9A 1T5XA 2XN9D 1IEHA 1Q9KA 2QGCA 3L1OH 2IJ0C 2Z6FA 2WKLA 5E9DE 3FQWA 4HP5A 2VM4A 4AH2B 5C0CB 3FRUA 3OHXC 3QA3B 5EFIA 3WV0A 1KB3A 4XOEA 3IGAB 2BRRH 1NBYA 2GBTA 4Y2DC 3ZRCC 2PYFA 3N43B 4NFBA 1CIUA 1NUNB 4GKLA 4F2ME 1WEJL 2A6KB 5J0BA 1MOEA 3RGVD 2X4QB 5C0RL 1DQQB 5ESAB 1DEDA 1EH9A 2BP8A 2OR8A 1MCFA 4RGNC 3SUMA 1P7KA 5EF1A 2B63A 4JVUA 5D72L 4AENB 2ZUWA 3E8UH 4I85A 4YDMA 3MUUA 3OBAA 1ZVSB 4C55A 4PV8A 1BPVA 1WS8A 2P8MA 5LQBL 2BINA 4FLQA 4DJMA 4HULB 5T3ZH 3PP3K 1BJ1H 2APTA 1BYPA 2N0KA 4XPTH 3P54A 4RA0C 1ND0B 2H6PB 1PJWA 4A37A 5ABAA 3W0WE 3IFOA 3AACA 3DMMB 1DVTA 3ARTA 5DUMH 1MWAL 2JVUA 5HD8D 4RMSA 2HFEA 3V52H 4AXWB 1OAZL 2ITEA 2OP4H 3Q9PA 5J6GB 2WN2A 3WY3A 1OB0A 3H9HB 3MJ7B 1K85A 1R3KB 1TJGL 5FGBC 4ZUWB 5JXED 4JO3L 4TNEA 2CBPA 1H9DA 3GNML 3QJTB 4Z0XA 3ORJA 1JDDA 2GSIA 5KSAA 1W91A 4DP1X 2PF6A 3EFDH 1H5BB 2MNUA 3DV4B 3HS8A 5A43C 3HFFA 4HLJA 4ZMLA 1NCCH 3BLPX 4WI5A 1MW3A 2NVXA 5EUOB 5GGRB 5KYYA 2X10A 5FTJA 4X6CA 1PGRB 4KNQA 2A77L 2NY0D 1FYHB 4L37B 3CZFA 1YUHB 4G5ZL 1BF5A 1XR9B 5AYQA 5CD3B 4OSUH 4OD1H 3VG9C 1A3QA 2EDDA 5C07E 4UM9B 1A2YA 5EUKB 5D2LF 1A6UH 2DQDL 3QHZL 4MJ6A 3UJTH 1TXKA 2E4FA 4LB8A 1QBMH 1QCSA 3MRIA 3VFUB 4L1BA 3VMOA 3IR7A 3ETBJ 3WG7B 4LOUD 4IRSC 4HWZA 1QRKA 7PCYA 2DQJL 4FCHA 3QARA 2MQCA 5AW1B 2NSXA 3UH8A 1BECA 1DCEA 3F7LA 4I0PA 4Z95L 3DXAD 4LL1A 5JPMC 5JA8B 2IOMA 4TRPL 3I75A 5D1QB 4UNIA 1X6NA 2WGXA 4K07A 1ZT7A 4M93C 1CT8A 1KIPB 1SYSB 5GGVH 1BOGA 4QEGA 4NHUA 4Q89A 4KKPA 3MYZA 4N8CH 3JWNC 4A6YA 3EDFA 1FDLL 1QFWH 4PR5B 3AREB 2ENPA 4TL5A 4B9YA 2OFQA 4FQXD 4J12A 2P8LA 1RJLB 2DMHA 2V9RA 1G1OA 4P8QA 1GZPB 1W16A 4WWKD 4H44C 4XMPH 4PMEA 2NY5H 2ZUUA 4IYKA 4IOIB 3KAAA 4U1JA 4OCYL 1GKEA 2GITB 3FCBA 1NPJA 1VF5C 3FT4A 1B4JH 1J0KA 3TVMB 4JFQB 3HZMB 1U3JA 4PTTA 4IW4C 5A2KH 5BUGA 3WYRA 2CK0L 5DHXB 4B0MB 5FHAH 1BD2B 2V33A 4OM0H 4FKKA 4PD4J 4TLUA 2FO4B 1ITCA 3RB7A 3U4EB 4QY8B 2DD8H 4FNTA 3WNNA 1IGYA 4HJGA 2VWEE 2W92A 1KYFA 3LX9A 5ANMB 4P57A 1R5IA 1LEIB 4P23A 4HKZB 1E3XA 5J6SA 1OOWA 2ZOTA 5BZDB 4Y5VA 4IMKA 1TLMA 3GM0A 1CLYH 4OQTH 5KVGE 3CX2A 5FUZL 5EBWB 5D2LB 4ZMWA 3CC5A 3AABA 3SUJA 4CW1A 4ZFFB 4LO9A 1YAZA 4DKEH 5CSZA 3QC5X 4FAAB 1IAOA 4IRJA 4YWGL 3V0DA 5BRZB 1U8MA 1BM3H 1DVSA 4JP7A 4LIQL 4ZTOH 3VRIB 2X12A 4FZEL 2E27H 4L1LA 4LQFL 4XOBA 2EDKA 4J28A 1EEZB 4MXWL 3GGWB 3GSXB 4LLAA 3TNMA 5K9KB 3SEPA 3BN3B 1T21B 4AOKB 5F6HJ 3MRFB 4A2HA 1BVLB 1GOGA 5H37H 4QRTB 3THML 3VSVA 4Z77A 1IQWH 3IK2A 4P3DA 3HN5A 2AQ2A 1EGJA 2CIIA 4JUSA 4Y19E 1DUYA 2LVCA 5DZVA 5HGAB 1E28B 1L3NA 2AEPL 4KUCF 4Z7NB 2EXSA 2EEXA 4YX2L 1QSEE 2FCBA 1OGTB 2GBVA 2HKFH 2BC4A 3L81A 3MUGB 4N22A 1UOKA 2HH0L 3MYJB 4JO1H 5K9OB 4G8GE 3CXDL 3O3EA 1OW0A 4DGYH 2NQDA 2Q3ZA 1OP3H 4IBZA 5IBUB 2LTQC 2H8PB 5KVFL 1MI5E 3T1WA 4XNZC 1VKXB 4NQDB 3GDCA 3BO8A 3NCYP 2KQAA 4KZEL 4QOKB 3QWQB 3Q3GA 1RLBA 3K6DA 1CLCA 1A02N 4A7GA 4KGLA 1IKFH 2YXMA 1TZ8A 2GSMB 2M2DA 4XPHL 1PL3A 5B6CA 4GO6B 1MCWM 2MWCA 3H0TB 4GRWH 4TLKA 1E8YA 5I1CL 1AC6A 2V6HA 2RHEA 3GTVA 3N40F 5GQBA 2ZXWB 2VGLM 1PNCA 2FGWL 1Q94B 2PPFA 4HXBH 1KWKA 4HIQA 1EZSA 3Q13A 4QHKI 2VR5A 2CJUH 1FWXA 4Q4EA 8PAZA 4O5LH 4UV7L 4XRCA 2G60H 1RUQL 1TCRB 1A7PL 4G6FB 4R4FL 3BWZA 1E6OL 3DDFA 1EERB 4ZW5A 4M3HA 2IWKA 4PBVC 4U6VL 3G04B 4FYRA 4JL2A 4OLVL 4XX5A 1T4KB 1IAIL 3GPEA 5SX5H 1JGLL 1WZAA 5EN2B 1UWEL 5EEXA 2ATKA 2K3HA 2W9DH 4OD3H 4PGCA 4WFHE 3VA2C 4DN4H 1TQCC 2VPXA 3WFCL 3JWOL 5D4QA 5C0FA 3GB7A 1INEL 3CUPA 1WP6A 3U7WL 4BZ1H 1LE5A 1NGQH 4QRQA 4I0PD 1MLCA 4X9FA 1U6AL 3QISA 3VGBA 3B3IA 5JQ6L 4YVUA 4AGNA 4X7CC 3IXAA 1SDAB 1VLXA 1XF4A 2X2UA 4HIPA 2YGQA 4M7KH 3Q1EA 3B9AA 2VMJA 4W9KC 3D69B 1HILB 4L9LC 5DMIH 4HWUA 5HDWA 1UOLA 1SN2A 3ZRFC 4AQ1C 3RL2A 3VNYA 1FORH 2IANB 3L4WA 4WHYH 5KTEL 1F11A 4XWOD 1UD8A 3VTAA 2F8OA 2BY2A 4J3XA 4HJ1A 2N59A 4LCVA 3RUGB 4DEPB 1HX0A 5DU7A 5EU3A 5KANI 5HDOA 3IU3B 3D85B 1WBZB 4LLUA 3WKML 2J88H 2PTUA 4K3HA 4K9EH 4NENA 1JPTL 4GS7C 43C9B 4HBCH 1U2YA 2ADIB 2YA1A 2H1XA 4WK2B 4CVXA 1A9BB 1NAKL 4PG9A 2HG0A 4DZBB 4IS6A 1B6DA 1FCCA 3V79C 1OLZA 3EJRA 4AMWA 2DEWX 4APXB 3UTTA 1CIDA 1QACA 2Z0BA 1AO7E 3MV9E 4WI3A 3ZSTA 1VEMA 4XVJL 3HPLA 1PZBA 3EJYD 4C56E 4MD4A 3EFOB 4LRIA 3MLYH 5E9DA 4HJTA 1SF3A 2SODB 5TQ2H 1Q9OB 1MZZA 4E9RA 3E7JA 5CJXC 3IDYB 5BRQA 1MUJB 1KZQA 4KJPC 4KUZL 1TQSA 3L3HB 4Q8BA 1J5HA 5F7BA 4K3EH 4AIEA 1N6VA 2CWRA 2JCCE 3BDYH 1ZMYA 3FOLB 3MRRA 2DM7A 3QYCA 4HGKC 5JHDE 3UGEA 5JQHC 2OKMA 3ME0B 4IRJD 5LO7A 1TDQA 4F2MA 3TN0A 2YFOA 4E68A 4A1RA 4FQLL 3EO0A 2PCYA 4JRFA 2YD0A 1J10A 3RKPA 3L7FB 1NGZA 3ZHLA 3ML9A 4XP4H 3U1PA 1HFUA 3M07A 2MNJB 4AGPA 1R24A 4R5XA 5LCVA 4PWKA 3HR5A 2E7HA 1Y1VA 3F7QA 2M83A 2OTUB 5INDA 3WJJA 3B2VH 3N06B 1GYWA 5I82A 2V0AA 1IEAB 2EC9T 3ZSSA 1RFDH 1KBPA 1ZVNA 3FSOA 3I84A 5EU4B 5AWNH 3IDXL 3MZGB 5CZXC 2APFA 2YEZB 3ZMRA 3W0WA 3OGOE 1TVHB 1X5LA 4L29B 4IOFC 2A0LD 4F80A 3LH2H 1RUML 4ABVA 4LEBA 2WIIB 3RDTA 2APBA 3IDJB 1GYVA 2PWDA 3IF1A 1OXYA 4XMVA 1SXAA 2VXQA 1UFUA 3CNKA 5B3NA 4PIRF 3P73B 2X42A 1S9XA 4GIAA 1HHHB 1KBVA 4CC4C 5IQ7H 1HQ4A 3O2DL 4HHAA 1FSKC 3WO4B 1G4MA 1FPTH 1F4XH 2Y7SA 3KYOA 1T4WA 5GGRY 3ARQA 3IKKA 4ONFH 3ILQD 3HBZA 1UH3A 2R0KL 3R19A 4H5SA 2VQ4A 5ICXB 4YDIH 2J4WL 1F4WH 3IU4H 4FFZL 1XF3A 5C07A 2NY5C 1HAWA 3WEXA 4C57C 1TR7A 1MH5B 3NCBB 4PMFA 1GYAA 2XOTA 5D5ME 2AAVA 4BSWB 1L7TL 4NRYA 2AJ3A 2X2IA 3SBWC 43CAB 2GBAA 3BHBB 4GSUA 1KB5A 3SYPA 4F58H 4HU2A 5BVJA 1T2QH 5AVTB 4ZI8A 1GA2A 4ZQKA 2QHRL 3NZSA 4BFIB 2H1PL 4F24A 1RIVL 2A38A 1DN2A 4M8RA 1PLBA 4KZDH 4NN5B 2HXAA 1M7IA 1JRHL 5CU5A 3WJMA 4B9FA 3SKNA 5KBLA 2EADA 4WW1A 1KLUA 1LO2L 2I85A 2MRYA 1DBJH 1HH6A 4HD9A 2YGPA 4ZTPH 1PT1A 3RWDA 3H4FA 5HHXL 3CFIC 1O5PA 3UGUA 2CR0A 3G08A 1BQSA 3KPMB 4Q74A 4QAMB 5C0ND 3RILA 1SDYA 4B7LA 1PG7H 3U48A 5HGBB 1JPGB 3VH8A 4KPHH 2IWFA 1XWVA 3EHBC 3QDHA 3TBCA 4MB5A 4UQ3A 5E95B 3EYSL 1SF5A 3MLSH 1XF2A 1CR9L 3ULVH 1A3LL 2AKRB 2L4OA 5TQ0H 4MGXA 1AOZA 4WI9A 4K3JH 3JZ7A 3ZJAA 2V5SA 1YVLA 1GTFA 1NIFA 4UIMB 2HLFC 3CE1A 3UTTD 3FU7B 4JDTL 2JXMB 2ZKHH 1S9WA 1MVUB 2X9YA 3MBEA 4WI6A 3UOAB 2Z7ZA 3VWKB 4ZSOB 3X12A 4FFYH 4LHUA 2ROYA 5E9DD 2O30A 5AKTA 3NIFB 4Z7QB 1FFQA 4AAYA 4GAYB 3AY4A 3BJ91 4XXWA 3RQ3A 3D0AA 1PYUB 2YBRA 3B7UX 5B39A 4KQ3L 5LJYH 2C5DC 4HPYL 3V55A 2FJFA 4BWUA 3S96B 1MFCH 1TTBA 4P5MA 1QLRA 5SWQA 4CL7A 1OCWL 4OJFL 4X7TA 1OK0A 4R8WH 3MV8B 3PHQA 3DRQB 6CGTA 2EJ1A 1A7NH 2BSSB 3X3GL 3FN9A 4Y19A 4R7LA 5D1XE 3U7YL 3ILPB 1G7JA 2EVGA 5KSAC 4RA3A 5KSBF 2X1WL 3G5YB 1QSEA 1NEPA 1OLLA 2AK1H 3PNWB 5EMYA 2DPKA 5F88B 3WJLA 4MAUH 2AFNA 4G8GA 5CLXA 1TO5A 2QTEA 3MCLH 3IFNH 2Q9OA 3C75A 1NOFA 2AF2A 5TPWL 1GH7A 3W0WD 5EO9B 1D5BA 1MI5A 5MENE 4JDZA 3QT2A 1JWSB 3SZKC 3S5ZA 1T5KA 2HTKC 2W95A 5DQ9B 3RVUD 2ZXCA 3QG7L 5DC9B 2GI0A 3RDTD 5I1HL 4E2OA 4WSKA 1NFKA 4TQ8A 1J0ZA 2HRHA 5KYUB 4OBRA 2AQPA 3EOTH 3ARBA 4XCEB 4U1MB 2VTFA 4ZO7A 2FUQA 4J3BA 3PAZA 4Z0BL 4ELKB 5ISZB 1PLCA 1XMEB 3KEDA 4HBQA 5D4IA 3ZW3A 1ZY9A 4NPYA 4QHUA 4ZUVA 4NUGH 5EORL 3HRPA 2IF7A 4XP9L 5E1HB 2VZOA 5C07D 4HLZG 1AS6A 1MWAB 3GJEA 2DMBA 3NSJA 4YHPB 4ANXA 2OL3L 4PRAA 3U7AA 1L9QA 4MMXB 1IGIL 1UUNA 4P07A 5BOJA 4OGZA 3FTZA 4L1HA 4M6OH 3M17B 3STZA 3NJLA 3GBNH 4QR7A 3PWNB 5I8KH 3LKPB 3P30L 1KIUB 2K4WA 1CGVA 4KTYA 3ABKB 2VXVH 2X4RA 1HKFA 2G9HB 3DHPA 2WGNB 1E9OA 4GG8A 4XNYH 4TVPE 1HL4A 5I6NA 4UT9H 5D2NE 3H4HA 1AGDA 4WTWA 5EPMA 4HPOH 4BFKA 4A2MA 2J1KA 5IUSA 3MRQB 5DHVB 1MFDH 1WAEA 4NXSA 3RNQA 3WFEL 3S3PA 5F7YC 5KVEL 2KPNA 4P23C 4YHLL 1E4XH 1T3FB 3QJHB 4K94L 2BWDA 2H45A 4IMKC 1DJWA 4PJEF 1XSIA 2GY7B 3BP6B 5EO0A 1HC1A 4H1LA 2OLDA 3VI3B 1KFGA 1W2KT 4RISL 3APNA 1FLRL 4PLJC 3ZL4H 1YEEL 5DCCA 1CR5A 2BOBB 2X0WA 1ZS2A 3QC8A 1WUNT 1F3DH 3CG8A 5SV4A 5J1AB 5AKSA 1RP8A 1S46A 3T1FA 1U8NB 4BQBA 1S7XB 3GPSA 1E67A 3NJIA 2XQYK 5LDUA 1AO7A 1WFOA 3MV9A 3I6KA 3DUUA 3EYUL 1A47A 3ZDZF 4N0CD 1DLFH 1Q1JL 3LAFA 4C56A 1PTZA 2H2PC 1OAYH 5DK2B 4EUPH 3B9KB 1SOXA 2KMWA 4EZLA 1LEGA 4L8CB 3HNVH 3RVVC 5JORA 2J5LB 3SPIA 3H9ZA 4N5EC 1M1SA 2WXJA 1FP5A 3N44F 4HT1H 4NRZB 4QWWC 2OK0L 4OLUL 1VPOL 3LKOA 4XGZA 4ZX3A 3QVAA 2JCCA 4G7YH 5JHDA 1FFTB 2ZXAA 3FN3A 3X2LA 4LHUD 1DQKA 3B9VA 5CGYD 2ARWA 1SLXA 2LV4A 3WY4A 1PZUB 1IUZA 3JTTA 2WNKA 1IAII 4NQSB 2CRIA 4GNKB 3P0YL 1AZUA 3A6BL 1RZGA 3PFUA 1NKOA 4AL8H 3EO9H 3DIFB 4ZG1A 3ZT6A 1YPZB 3U9PH 4XMZA 1L0XA 4IEFB 4YHIB 2VM9A 1YYLH 1HN1A 3NJMA 2KI6A 3TNNB 1AA6A 1UACH 4Y19D 5GISL 2NZIA 3MMEA 2F58H 4K3GA 3HAEB 4I3SH 1G9NC 1QSED 2P24A 3ERXA 3JV4A 3WFBH 4UTAL 3NA9H 3PGDB 2NYAA 4IJTA 1I3RA 4LKXA 1LO3H 3LS4H 4FXGC 1JFQH 3MRCB 1FH5H 2P28B 4G8GD 5IMKB 2QFRA 1QHOA 2NCMA 1XGTA 5DMKB 2M1KA 3BEWA 4J3OC 1MCJA 4FTVB 1MI5D 4PGDA 5F72S 4W9DC 2GI7A 3BH9B 4NO5A 2GJJA 2FD6H 3VFRB 2VQUA 4C58B 3P2DA 3MKKA 3PL6B 1TWGA 1PY4A 3ZDZB 4QJ5B 4L4VE 4NZFA 1ACZA 1OAKL 2BCMA 5CXPA 5I8CA 1S7VB 4KV5E 4OQ1A 3V7AE 3VG0L 1MCLA 2G6GA 3ARBD 1TZGH 4XNBA 1RURL 4UDTA 2NRDA 4XNDA 3NCFB 3ZX1A 2EICA 1J1XL 5IB3A 1BXAA 2BSTB 4PHZA 3Q2VA 2H26A 4HU8A 5DEGA 5DHEA 1JHTB 1XCTA 1GHFL 3C6SB 4GBXA 2X28A 2GVYA 3K2KA 1UVQB 3NCWA 1ONQA 5D5MA 1ED3A 3X2PA 4Z6AT 1YN6A 5B38G 2WVTA 4PGZA 2VLRB 1J8HB 5DJ0A 1KELL 1DUZA 1FGNH 4KQ0A 2YZ8A 5C7XL 4XC1H 4QXUH 3HFML 4M5ZL 2OV0A 1HEJC 4GW4A 3OR7A 4HK0A 4LNRA 4PWJA 4U3SB 3RKDD 2X3BA 2XWJB 4M4RB 4TPRH 4WFHD 3ZGIA 1ORQB 1T1WB 2W94A 3KJ6H 3EKCA 3UTZB 3ZIYA 3QDME 4DW2H 3MAWA 2ZOKA 4LCWB 2KI8A 2PW1A 1TCMA 2B1AH 1TOXA 2CLVA 4Y4FA 3M86A 4PJAB 3JYBA 2J3SA 5AVSB 4HIJA 2CR6A 4P9HC 3RPIB 1TQWA 3D0LB 1R6VA 4UZGA 1N59A 2B20A 4M7JL 3FQNB 3SO3C 1XIWC 5ERWB 2YARA 5T3ZE 3HNSH 3MJ9A 1HINH 5I6MA 2MTPA 1DFBH 1DQMH 1RZ8B 4JFPB 2OMTA 3CLEH 3PCYA 4XNXH 3QWZA 2NX5E 2VXUH 3L9RA 3SY0A 1S9KC 1R0AL 2PN5A 3EH1A 5C9JB 4DESA 3PWLA 4S0SD 4FI7A 3TN0C 4QYOB 5T1MB 3ZBMA 5ESVB 4XX1G 5DFAA 3HHMA 1G9MH 2R2EA 3RTQA 2FSEA 5AZ2L 3VXPA 1FAIH 1ZV5A 3MRLA 2NXYC 1JDCA 1AO7D 1USZA 4OV5B 3MV9D 1ZLDA 3JYCA 1JYNA 4N9GA 1IBFA 4GFTB 3SDDA 3M8OL 4C56D 3MOAH 2JA6A 3N0AA 5EC2A 4KHXL 4ERSL 1HYSC 1HK6A 5FA3B 4RMVA 2IVFC 1UKQA 5E08H 1DBKH 1UG9A 1PD0A 1BQHB 1SHSA 3P4NA 3U0PA 1S8DA 3LZFH 5DDHA 5CJ8A 2GFBA 2YAMA 3MRGA 4RFOL 3S5LG 2V4LA 3DO7B 1RUPH 3TIEA 4JS7A 5JHDD 2R2BA 4ZBJA 1DHKA 5AKRA 2X3AA 5GZNC 4IRZL 3L9YA 3LN9A 3Q8EA 4JCLA 4KKCC 5I0WA 4JQXA 2ZZUT 1ZSDA 4HH9A 3TU6A 3P69A 1TNNA 2B3IA 2DRUA 2LVEA 1E43A 1CGSH 2GK0B 1UZ8A 5JMOC 5D1XA 3LEYH 1E61A 3AROA 3GWJA 3UMTA 1A6AA 2WXLA 1T0OA 4UT6H 4BGLA 1FV1B 5D55A 3HBQA 3OHMB 3R4RA 1IQDA 2OS7A 3QIUC 4XC3L 4FFWD 4MDRA 3GMLA 4GW1A 3LHAA 3LH8A 4X9YA 4YXLH 3T0VA 5CZVL 5MEPA 4MNHA 3BAYA 5CP3H 2JLPA 4Z78A 1BDYA 1XGPA 2XRAL 3TCLB 3QEQE 2GTQA 5MENA 5E56A 4HIHB 5CCHE 1S6NA 1NBZB 5EU7E 4C4UA 2D3JA 1QBBA 2ZCLL 3DRTB 1RU9H 3QUZA 3MA9H 2VLJB 5E0FA 5DEFB 1CXKA 3FDWA 5B1BB 3S4SA 1JZFA 4ODVL 3HZYA 5C0GB 3B7RL 3BAEH 4IBQA 3ISYA 3LXAA 1IM9A 5AOLA 1VFMA 5DJ6B 3TIWA 4X5WA 1AGCB 3S2AA 1ETA1 3MR9B 5D6CA 4YBLB 1KYAA 2E74C 4N0FA 5KEZA 1FN4B 2A74B 2ZSWB 4KH2A 5DI8A 1KTKE 2W60B 2FX9L 2N7SA 1XEDA 4LSTL 3ROOA 1ROWA 2G5RA 4GBXD 1ILSA 5MP6L 1GGIL 3SDYL 1HH9A 1M7XA 4DAGH 2TRHA 4BQ9A 4TUOB 5CBAB 1BREA 3N91A 1F4HA 1KXQE 2H0JA 4HIIA 4UIKH 2EO9A 4R4ND 3L5IA 3V4PA 1QNZH 3UEQA 1X9LA 5D2NA 4EQ3A 1URLA 3AS0A 3QJFB 4G9FB 4UTBL 4X4KA 3OQRA 4B9PA 2Z92B 4QIRA 3L3KA 2PWEA 4NFCA 2WAQA 3CU1A 4DGVH 1RJZB 3D51A 4Y4FD 5E23A 5HYIA 4KK9C 4HWBL 4C4KO 3DVGB 1FGVH 5FDWB 1BX2A 2MNWA 2AJSH 4NKOA 1I82A 1D5IH 1ES0B 2YD1A 3H3BC 3OAZK 2BDNH 2Q2LA 2GJ6B 1Z2KA 2OTWB 3MBEC 4TS6A 5CKGA 3T71A 1UHDA 1EV2E 5I66B 1N7MH 3MFFA 4PJ7F 5D1ZC 2ZX7A 4YS4A 4DNLA 2FE0A 4IBYA 4O9HL 3LRKA 2GJRA 3U30C 1YEWA 3GZQA 4DKFH 4X5XB 1CPUA 4U7KA 3DSFL 3GSQB 3IGLA 1DVZA 3QHFH 4MCYB 1CXEA 2Y22A 4XZ4A 3TX4A 1RCYA 3GHEL 3U0TB 4Y4HB 4NN6C 5FWQA 4KRMB 2Z31A 1CK0H 2Y1ZA 4AW4A 5C2UB 1UUSA 3MV11 1X3DA 2G0LA 4KK5D 4N1HB 3HZKB 2MOGA 3O4OB 2AJZA 3HRZC 5ADPH 3VD0A 3QQ9C 4NJAL 3H42H 4WU5A 2B5IB 4Q0XH 5DEJA 4JFXA 5HJGA 3GSUB 2RQ8A 4TTGA 4G42B 1RD6A 3SDDD 1MHCB 2A3TA 2AXJA 3BP4A 3KLHC 1F6AB 2X1PA 1OQXA 4FQ2L 4JLRB 2WC7A 5H2BB 5E2UH 4D0BB 2TSAA 4M7LL 4M6ML 2OSWA 5C09B 3VD5A 4Z18A 1SY6H 1KEGL 5CJQL 2Z35B 3GTJA 1L9PA 1NLBH 3HE6A 2KT6A 5INCA 2WBJA 1PDKB 3WIIH 4NM4L 1SJEA 4L0ZA 2R69L 5FA4B 4UB0H 1OD9A 4LCCA 2DIEA 3BZEA 1YEIL 3V6ZB 2ENQA 3TV3H 1KBKA 4G80A 3WXVL 4NOBA 2LAAA 5D1XD 4JFEB 3IWVA 1RPKA 4X6EA 1TLKA 4M29A 5IB2B 1LGVA 1QRNB 2BIIA 2WD0A 3D0VB 1I7UA 3HNTH 1NL0L 2QTVA 2UZXA 3MXVH 4IK6A 4LFHD 5E2VH 2YMXH 3DX1A 4YNYB 3EADA 1SXNA 1WCBA 2XWEA 4XXCC 4ZDHA 1I4FB 1NCOA 3CFEA 4WO4B 3W57A 4AYMC 4EAEA 3STBA 3BT2H 3WLWD 1PY9A 4B60A 3BGMB 4F8PA 5GSVB 4DH2A 3A22A 3UDWC 3DX4A 2MTAA 5MEND 1NC2A 1LE9A 3FCTB 3V0WL 1I8MB 3IR5A 4YXKH 4JR9H 3NJJA 2D7PA 4OTXL 4HHWA 5LWYL 2P7TB 4L4VA 2JELL 4TQEH 2EEAA 3QUZD 2XICA 4WTXA 4BFRA 1CG9B 3GTLA 2QVTA 3PP4H 2JF1A 1KT2A 4U1SB 1PCSA 4PJ5D 2VABA 1U92A 3A3YB 3F64A 1IM9D 4FS0A 3H0GA 2B59B 1KBGL 3I9GL 2QQNL 5A2CA 3BKCH 5GRVL 2XVBA 2ZG2A 1UXLA 2OR9L 1AYRA 4X6DB 4A2GA 2N56A 1O6SA 3OKKA 1HHGA 5CIPH 2OA9A 2WLIB 4OZ4A 1N3NB 4NGHL 3GLEA 4RZCA 2Y36L 5TGBA 5DJZB 2CBMA 1IMHC 2ZKWA 1XGQB 4OCWH 1HQRA 5IQ9A 4QCIB 1D5ZA 6PAZA 3D34A 2E46A 2YMTA 4R2GC 1G9MC 1TSRA 3QDMA 3GMQA 3C2AL 1NBVH 1TTGA 4LDLB 1M2OA 1PJ9A 4MZ3A 4YSRA 2FEDD 1GOHA 5JHAA 2NY3D 5FKPB 3SDCC 3BP5B 4Z3GA 5K9JH 1TWHA 4TVPD 3G6AB 1RPQA 2BS8A 2X6MA 2MPAH 3RG1C 3GSNH 4L5FL 4GT0A 4CMHC 1ZEAH 3O9WB 4H40A 4IKKA 4WI2A 3HI1A 4JFOB 5HDRA 3TEUA 1TZHB 1JCVA 4FNLH 2O5YL 3B7TA 4JO4H 4DVRH 5EG6C 4K8RL 5I23A 4A38A 3DPBA 5DUPL 3GRBA 1A4BA 1SBSH 1PKOA 4GW5A 2A1WH 2WN3A 2IALB 2NX5A 4I0KA 4XBMA 4P4KA 4DGIL 5KSBE 3N50A 1YNLH 2OL3B 4YR6A 1CL7L 4U1NB 4FCAA 1E5BA 3MACH 2VN5A 1R9TA 2OSLB 3KPQB 2ESVB 3RY5A 3SE8H 1UWFA 4F27A 4KFZC 5JIPA 1F13A 1O9VA 2BSBA 1C16B 5JPNB 4R3SB 3JV5A 4U33A 2VSMB 5LGJB 2Y06L 4JREC 3WTWA 1Y1UA 1HJBC 2Z31D 5ID1B 1C5DA 3QBTB 5EO1B 4AJ0A 4XZUB 5KVDL 2LABA 3NCEB 5E8NA 4GI6A 5LBSH 3N85H 4TSAL 5EBMB 1F18A 4ODUA 1MREL 3QXDB 5FB8A 4OUUB 3C6LA 2VR8A 1XSJA 3IJEA 2ZX5A 5IG7B 2XZZA 1H8LA 4XCFL 4BZ2H 2BNRD 3OKNA 3RIFK 3QS3A 4YIQA 1OCZB 5EV7A 3BPNB 1K9TA 1P4LB 3REWB 2H6OA 4PB9H 4R7DB 3DTXB 3D48R 4PRNA 4G43B 1IJNA 3TBWA 3ZIMA 1VGEH 1WFTA 3HE6D 1V3KA 2Q7AA 1OEZW 2WBJD 2WQ8A 1XGYL 1FL6A 2R2HA 3FRPA 3X2HA 3ZE2F 5E5MA 4PJXB 1JV5B 2KDGA 2DJ4A 1RHHA 2YSSA 3PF2A 2YRZA 1BEXA 4PHXA 3SGKA 4DHLA 5EBLB 1UHEA 4XN5A 5JDSB 1GS6X 4MS8C 1D5RA 3AXLB 4Y4KA 2DOCA 3IWUA 4NAMA 4DOHB 2R0ZH 1CXFA 2EDBA 2BHFA 1H6EA 2HYMA 3VYNA 4L48A 3UXFA 4HYTB 1JL8A 5AFAA 1RK7A 4UOZA 3QEQA 1R33A 2PPDA 2YKLL 3O3DB 1QFHA 1T0NA 5T3XL 4GIPD 2D7NA 2XXGA 4Q58C 4NS0A 2YN3A 5HGHB 4FXKC 1B6UA 4UNVA 3L1EA 3KPPB 4JG0H 3MLRH 4CADB 4H8WL 1A5FH 2Y5QA 4U0QB 4U0RB 3EYFB 4ZS7H 2VDRH 2AJUL 3OGCA 1NC2D 4OF7A 4HFWA 4KI1A 2IMMA 2YJLA 3ZE0B 4YDLB 4QJ3B 1IM3B 3BVNB 3QULB 4FQ1H 2DLFH 4KI5F 4L4VD 1CFTA 3ULVE 2CZNA 3ZDYF 5F3HB 1WCMA 4KVNH 4R96A 4HIEB 4LLMA 4JRXB 1G0XA 5I76A 3KWVA 4HUUA 4RMBA 1AZVA 1N5AB 3FO1A 4XMKH 3Q01A 3QQ4B 2GIYA 4KKAD 3CK0H 1X5AA 3U4BH 4OF3A 5DJXA 5ACZA 2CSPA 4YE4L 2F9BT 2G4EA 1C5BL 3GHBH 5BV7L 3SCMA 9CGTA 4OQTA 4PSPA 3G5ZA 1OGAE 5CCKL 2YOCA 5DF0A 5F9OL 4F7MA 5AL8A 4MCNA 3AWGA 1KYDA 1JIBA 2GHWB 1WLFA 4WEBL 5SWSB 2VSDA 3S0PA 3MTRA 5DK0B 2GT9A 2Y5TA 3U79A 2ZP0T 1KXQA 3OB0K 1C8PA 5HJ3B 2OCFD 1PZDA 1F3JA 1TEFA 2AXFA 2AXHA 3UPRA 4UU9B 4QRPE 1B0GA 4YGVA 1S7SB 1J9SA 3QDMD 1MCKA 3ZR5A 4ZXBA 5IEKB 5H37A 5F6IB 1SDDB 4QTHA 3DUSB 2NYYC 4AJWA 3T0EC 1OPGL 3ZQXA 4XH2A 1BAWA 2XZCL 4S1DD 4TULH 3RTQC 1IC4L 5BOPA 2NTFB 1FH2A 4HDIA 4NC2B 5I74C 3KBFA 4NAJA 1DSYA 3HKFA 1S7RB 1M56B 1ZS8A 2VL5B 3X2KA 2FJSA 2VDLB 3BIKA 2HFFA 2E75C 2CO7A 4F92B 3I02A 2PW2A 3IBOA 2MJWA 2BFVL 5IEHA 2CIKA 4NLAA 3LXCA 3CCHA 5AUMA 5T3ZD 3HB3C 4HSAC 4Y9CA 1CDIA 1U21A 4LEOA 3GTPA 3LZQA 1XEUA 2X9ZA 2A6IA 5AB0A 4PGEB 4P4KD 1EO8L 3FT1A 1P2CA 5E4EC 3VRLE 1E60A 4S1QL 4BA0A 3POCA 1MCQA 4CRPA 5DJDB 5IHUH 4OB5H 1SXCA 4YSAA 5D8JL 1ZA6B 5ICZA 5CD5C 4P2QB 3D5OF 2EIZB 2R15A 3OSKA 4QNPE 2VUMA 5D93B 5DMJB 1YEGH 2X2YA 2XZAL 2JI3A 5K9QG 1RZFL 3WD5H 2ARJB 3GKWH 1WBXA 1Z9OA 4X8XA 3MNWB 4A55A 1YEHH 5FYKE 4G1MA 1JGDA 3C6LD 4M5YH 1NOLA 4TNVK 3WLWC 1QPXA 4FFVD 1QP1A 3V9CA 4YO0A 4MZRA 1JUFB 2NY4D 5J9PB 3D3VB 1JN6A 5JW3H 1M9WA 1G4RA 1TQUA 2CO6A 4W4OC 4PJBB 5IW6B 4M62L 3TJHC 4ZFZA 3OB8A 1B0RB 1T04A 1V10A 1OZUA 4UQ2B 4CGUB 4BZ1A 1I8KB 3VFNA 1NCGA 3FH5A 2PO6B 3ETBF 3GRWA 4Q6IA 4M61B 7FABH 5KYXA 4E41E 2K0RA 3BESR 3DMMC 4PQXA 4RH4A 1E40A 2V2XA 4LARH 5I1KL 1MCSA 3WY1A 4UDUB 4Y4KD 5D7IB 4G72B 3LHPH 3W9EB 1I50A 4I77H 2CO4A 3KCPB 4G6MH 3QI9B 5KYWA 2B8OT 3OKDA 4TVUA 4FHJA 1WDAA 3QEQD 5C9KA 4XOCA 4GKSA 3AQDA 2F18A 1H3UA 3LZOA 1YG9A 1VFUA 2NY6B 1JHKH 4HXAH 1AJ7H 5GRZA 1N6QL 1Z3GH 3NCJL 3UJIL 1U8CA 3HPJB 5EOTB 5HHME 4RNRA 3OX8B 1W72H 3PUUA 5L8LB 4TMPA 2JKXA 5I16B 4Y7OC 4TQPA 4I48B 1G7IB 3MJ8A 4H13C 4ODWA 5A2BA 5DD5H 2QPSA 4WV1B 5GJTL 4YDKL 2ZXGA 3VTTA 4UF7C 3OWRA 4P3CL 1J5OH 3I9PA 3E6HA 4XOAA 4FHBD 3QO1A 1RZ7H 2VR7A 1DZBA 2IGFL 3EGDB 5DR5L 3RE0A 2E8YA 3N6YA 5C08B 2E7ZA 4JRYD 4ZODA 3WIAA 2DI8A 3HJEA 4UUJA 3PU7A 5I1EL 1BYOA 1PAMA 4JKMA 3D25A 4E36A 3G6JF 1C12A 1SYVA 3FOMB 3WKNA 3N9GH 4IGBA 4EZJA 3T4AC 5GHWH 4YL9A 2F7QA 5D1QC 2JSFA 3N1PC 4CDHA 2QVFB 1MVYA 3KMDA 4RWYL 3ATBA 3OKLA 3QFJB 3SQOH 5JW4R 2X70A 1HVXA 4X5RA 1Q9WB 2I24N 1Q9LA 4OR1A 4POYA 4ODSL 3VSQA 3AREC 2LE9A 4GUCA 5F7EL 3VUAA 5DWPA 1CFQB 4KTDL 2IWEA 1JZDC 1EO5A 2C9UA 4ZXBD 2BIOA 3QUYD 2Q86B 3MHZA 1PEZA 5IROA 1P9MC 2EIJB 2H32H 1UWGH 4JNXA 1ZLWH 5C92A 4FXLA 1ZANL 4CMMA 2UZIL 4P2OA 3TVMC 4BSJA 1E5YA 2X1OA 5HY9A 5KSBA 1TT6A 1SGKA 2CGRH 5AW6B 4EO5A 5FTMA 3HUJE 1ML0A 1RH8A 1FCGA 4BXSV 3FQTB 4DEWA 4K3DH 4ZFGL 3G3LA 1OAJA 3MRJB 2W9LA 2Y07L 2VMEA 4NKIL 3DX7B 2R4SH 3RPBA 3SDAA 2OYKA 5I26A 4X99B 3LV3A 3WTVA 1WFMA 3GF8A 4PV1C 3IN0A 4PW9A 4U1HB 4Y9FA 4CSSA 3CFUA 2B14A 4YC2B 3UPCA 35C8L 3IT8D 4OKDA 3MO1A 3B9EA 1QUPA 2OMVA 3VI4B 3O6ML 2R83A 3FFCE 1BVKB 1KCUH 4GKZB 4QRRE 1N67A 3M88A 3LKSA 1T1YA 2BVEA 3OZKA 2HAZA 4KKBC 2DQUH 1ET7A 3U1QA 3QG6B 1KJ2H 3KWWA 2UZYA 2R2CA 1OA9A 2ITDA 2DEXX 2MCPH 2HJFB 5EZJB 1JNNL 4TNGA 4EI5A 4MQ7B 3RWIA 5E99L 4AG4L 4PJGE 3FK3A 4WJ5A 5IM7B 3UROR 4DP2X 1PZSA 2Z91A 5M94B 2VCOA 4JY5H 1PSKH 5T1KD 4CVUA 4F37K 4MDIA 2VDPL 3Q9QA 4JGNA 3AU1A 1TTRA 1YSOA 1OP5H 4LLQB 2E59A 5DVKA 3UFIA 2B7DT 3CLFH 3WE6B 3TJPA 2MPVA 2EO7A 4HKXA 1V55B 1MJ8H 2LLLA 4GAGH 4A67A 4F7EB 2C3XA 4KXBA 1OOAA 3ZZQA 1OF2A 5GZOC 1A4JB 2E9JA 1Z5YD 4NQCD 4PY7A 3Q2NA 1U3HB 2D2OA 4HEME 1FVEA 3HKZA 5LN8A 5HYSG 2BVTA 3GKZA 4KZ0A 5ITBH 2FJGB 1A6PA 4M1DL 4NO0A 1RAMA 1EU1A 1MRDL 3UGXA 1T1XA 1I8IB 3VSUA 4D8PA 1G94A 2KQNA 1S9YA 4PJ7E 4L3EB 4X4XA 1T7YA 5E6ZA 2FATL 4R26L 3D52A 4DIXA 1YHPA 3L6FA 4W9IC 4PJFF 3VU2A 4AEIL 4P5TA 4AZUA 5K9QI 1A1MA 2CA3A 4R7XA 1S7TA 3LN4A 2XQYG 1QQDA 3PWVA 3P9WB 1XGUA 2UVEA 1OGAA 1FDIA 5IUCA 4NSKA 5J11B 5DRZA 2JK5A 3IBEA 3LEVL 2WMPA 3VACA 3KDMA 4FFYA 5TE4L 3VFWB 2BIMA 4JQVC 4FTDA 4H7VA 1JXDA 1WEJH 2X9WA 4LLDB 1OB1A 1AR1B 3KL5A 4IGBD 5MEQB 2YD3A 4NKDB 1RI8A 4QRPA 4WW2F 2XWTB 3V8CA 2D7TH 5IMLA 1P4UA 5D72H 4WWOA 2XV2A 3RAJH 3RVTC 3S88L 1X9UA 3IDUA 1F45A 3O8XA 3E6FB 5LQBH 3AS2A 1ZTMA 1QW9A 4ELMF 1D7FA 4HJSA 5EU5B 4BFBD 1YY9C 3OAYK 4LBEA 2IH1A 2VXSL 4GXVH 1E3FA 1SVCP 4Q6YA 1WIOA 3HG4A 1UXSA 3NZ8B 4LSQL 3DETC 1OKEA 4MWFB 1BFOB 3KLAA 4HJ0D 4PAZA 3P1VA 4YAQA 2OBGA 3P4OA 3FBKA 1MWAH 1RK1B 1ZVHA 5GS2H 1OAZH 1TVDA 2PNWA 2FO1A 1I1FA 3ULUL 3SPVB 4P2OD 3NDYE 3KPRE 1TJGH 1AQHA 1KEML 4N85A 4JO3H 4CSPA 2Z93B 3P3TA 4WK4B 2HX9A 1M42A 4NERA 4LVOB 5DTFB 3MDJA 4JPKL 2WXIA 2VE6A 3FYIB 3EGSA 4XBPB 4AVIA 2HLAA 3WEMA 3BISA 3X11B 1NAML 5C0BB 2FSDA 1U58A 2EVHA 3SDAD 2X3CA 1VAHA 1UB6B 2NY1D 3RDJA 3TT1L 3TJEL 2A77H 5DHVH 2E2HA 4UQCA 1LWHA 3C09B 1S5IL 4G5ZH 2E7CA 5DJ8B 3CZGA 3F62A 2DQDH 2E9BA 3X1NA 4B41A 3G7TA 4PTUB 4JDVB 4LEEA 4NCDA 3MJWA 4R7NB 3BD4A 3D4CA 4KFMA 1I1AB 3WUWG 2DQJH 3BN9C 3EDDA 1TMOA 4BV1A 2LHAA 4Z95H 2P5WE 1CVSC 5EU7C 4GKNB 5IJVA 4XMTA 5A2FA 2Y7QB 3TH4T 4TRPH 1RZKL 3P77B 3BPLB 2QDWA 4JFZL 3ZYIA 1JPFB 2A9DA 2CCVA 3HVNA 3EDEA 3MQIA 3H85A 4ODBD 5FO7B 3LB6C 3WNIA 4ELMB 2R7EA 2W65B 2O61B 3ZU8A 1LLAA 1Z0NA 1FDLH 4E41A 1GW6A 4UT9A 4WU7A 5CR8A 2NW2A 3QUXB 2YPKB 1UXWB 5F3BA 4BH8B 4MAYA 3TEWA 2WB1A 1I1YB 4L1DA 4ENZA 1AC0A 2A83A 2ARJQ 3U83A 3QEHB 2ICWJ 2QLYA 2XA8L 1WZLA 2E9GA 1W6LA 3RX9A 5K39A 4OCYH 4F9PA 3DI2B 1GOFA 3SCMC 5IK3B 4FYSA 2CK0H 4NOFA 5TTRA 5DC4B 4KU1A 1ZOXA 5D6DC 4H0IA 2APVA 2Q7YB 4ABWA 4XBGA 3O45A 1JZHA 5I2IA 1PLGL 3UP1A 5FECA 1D9KC 1EJ6A 1FL5B 1Z9LA 5AOJA 2C9RA 4FC3E 2MEJB 1MJJB 4CU6A 1T22B 4GUOA 4QF1A 3DJ9A 1KPUA 3ULAB 3ES6B 4M8QB 3ULVD 5DVLA 1AXTL 3HAEH 5FUZH 3QXAA 3W37A 3QIWB 4PLKC 3MLWL 1QFWM 1UD4A 2NNXA 4P5TD 2Y9RT 4GAJL 4LIQH 2BVOA 2PYEB 3DJRA 3X2NA 2NQCA 2P4AB 4FZEH 5DRNA 1XR8A 4LXFA 1OGAD 3FB5B 3ZZSA 4ANUA 5DMGC 4AQEB 4MXWH 4AYGA 4LRNL 4ZUTA 1TWAA 3UTPE 4MSWB 3VXTB 1E4KA 2FBOJ 3VWJB 3KGSA 1TU2B 4NUJB 2OSYA 4OLZL 1UCTA 3THMH 2J5WA 1IGJA 4HUVB 4NN5C 1D7CA 4AIZB 1WTLA 1I9JL 5LG6A 4YDJB 4L3CA 1EPFA 4QRPD 2F74A 4XHJC 2XG5B 3VXSE 3NEOA 1N8ZB 1KCBA 3CFCL 5JDJA 3OR6B 2VZ3A 3HI5L 3O8XD 3RU8L 4HSCX 1WAAF 5KVMC 2HH0H 4GFXA 5C6WH 1TTCA 3QFDA 4DVBA 3CXDH 3QZLA 1VFAB 5BV7B 1O6TA 3ZE2E 1PZ3A 2VPYA 2QQLL 3MX0B 2YGOA 2FQDA 3OJDB 5KVFH 3QSKB 3IJHB 3HUJA 4DQAA 1BXXA 4KZEH 5B8CA 4NC1E 1U8JB 3C5ZB 1NFIB 1OE3A 4HS6B 4NRXA 5SWZB 3QRBA 4FDWA 4XPHH 2UYLB 5B3JF 2CKBB 3L3OA 3QEUB 4U6XA 1FVCA 4TQHA 4XBEL 4PREA 4H8QA 4KK8D 5I1CH 4JFFE 5C6TL 1GJWA 2PCPA 1AS8A 1SVZA 2FGWH 2XTJE 4JPWL 1T83A 4PJ8A 3QWNA 1FE8L 4KJWC 4NO3A 1LEKA 1I75A 1V3MA 4FLHA 4CC1A 2X4OB 3FFCA 1DVXA 2BOCB 4QRRA 4UV7H 1BZQK 2X38A 1RUQH 3D2UD 4QRSB 1A7PH 1KC5L 1E6OH 2EIEA 4U6VH 1K5NB 3TO2B 4OLVH 3ZDYE 3CHQA 1IAIH 2NOYA 3EOYG 1JGLH 1VFOA 5HHOB 6FABH 5IKCA 3MTXA 3MU3A 3QORA 4N2DA 3ZE1E 3WFCH 1WS7A 3JWOH 1INEH 3U7WH 1YLEA 2IFFH 5T33L 4PJGA 5DVNA 2ISDA 5EF0A 1A6WL 3I50L 2WYTA 1GGCL 1Y18B 5F9AC 1B4RA 1Q38A 3VFTB 1AQ8A 4P5KA 4NFDA 1H3GA 5E2JA 1AHWB 5F0JB 2OXGB 2YBGA 1P5UA 3O6KL 4RFEB 1SEBA 4JKLA 2CDGB 3FB6A 3P9LB 4RDQG 5L7XL 2EUWA 4O2EA 1CMOA 2E7MA 4J6IA 4E41D 3ZO9A 5KTEH 4GMTL 4S11A 5JNYB 5PAZA 4U3CA 2ZXQA 3K46A 4MAYD 4NKQB 4RAUB 1INDL 1T1ZB 3LQAC 1BZ8A 3EYQD 1BG1A 5B7MA 4MCZB 3RY6A 3N04A 1NBQA 4PRDB 4MA8L 1JPTH 4RIRA 3RVWC 4F7TA 4OIIL 2AEWA 2HTLC 4YHOL 1SRDA 5HI3C 3HLAA 2EH7L 4HEMA 2XV6B 5I8OL 4H26B 1WG3A 1J9CT 2ZOWA 3HJ0A 4ODTH 2WZAA 3BI9X 3WN5B 1GGUA 3L4XA 4AZ8B 1MHPL 5HHMD 4A2EA 2EKJA 2X4SA 2P48B 4YE0A 4XVJH 2IPKB 4GH7B 4PJ7A 1YUKB 1MIEL 1MCEA 4OCRL 3NJVA 1M6UA 2FH6A 4G83A 4YPJA 4AV5A 4OZGF 5EIQA 4ZUSA 1NFDB 1JWMA 5E5LA 5F1OB 3IVKA 2ICES 4Y2DB 1LP9B 1S7UA 4UT7L 3F7YB 4KUZH 3IFLL 3QEGL 5K5YA 1RZPA 3QO0A 3QS2A 2YPVL 1HXMB 4LK4A 1IC0A 5IROC 3UBXG 4YSCA 4DZ8B 4LU5L 3L48A 4FQLH 3FZUD 4CS0A 2B15A 4P2YA 1WA1X 1NDGA 2IAMB 1EHLL 4KTEL 5J4MA 2IMNA 4XMXA 3DHUA 2NW3B 4Y1AD 5FF6A 5HYJB 5CLYA 3AM8A 3TYFA 1JF1A 3WXWL 5C0DB 1TKWA 2WLZA 4A6YL 2DWEA 5KJ7E 1ODAA 2AMUA 1ZT4A 5D7JA 2BZDA 2R1YA 2WXHA 4PJDF 3MLPA 2RJMA 3SKUD 4ZNCD 2VSCA 3IDXH 3CVHL 1CD0A 5ANME 3Q5TA 1OP4A 3OJMB 3V0HA 4OD2A 1FJ1A 3KPLA 4DUWA 3DWTA 5E1AB 1Z5LB 3T9WA 1RUMH 1E18A 3LIUA 1WFJA 1YC8A 5MEOA 3KPRA 4NO2B 2GSGA 4GT7A 2QGBA 5GRWA 4HCRA 3WMSA 1SOSA 1QFPA 3MLVL 1YNKL 2KZWA 2FH8A 2DJMA 1HWGB 3O2DH 5B38A 3B37A 3NAAL 3QZMA 4NZUL 2ODHA 2QKIA 3WLBB 1KF9B 4YDVB 3B9KC 1E90A 1NC4B 4OZGB 4EI5C 5LXVA 1H0HA 4M00A 4AYSA 2J5LC 1JP5A 3LRHA 3ESUF 1BWWA 3JUYA 2R0KH 4LF3B 3VG9B 1TUPA 1ZGLM 2BP3A 3CDZB 4JZJA 5JXAL 4EDXA 1WWBX 3PE9A 3DDGA 5FKAA 4OLWL 2J4WH 3FC8A 4FFZH 4PJ8D 4V1DB 4Z7NE 2NNFA 3IFPB 2Q5BA 3FFCD 1VEPA 4QRRD 3L3GB 1ZAGA 3H7BA 3PJNA 1CF8H 1J88A 4N3TA 4N2MA 1L7TH 3IE4A 1NSNL 4JM2F 3GS4A 4Z7VF 3NVQA 2P5WA 4M93B 4MJJA 4KKZA 3QZNA 2HMID 4WAFA 2F19L 2PP9A 2WLYA 4OGQC 1EXUB 5CLZA 1PD6A 5GGSA 4WLCA 1HNFA 1KACB 3QDAA 4QOKE 4YHML 2NR6A 4HOMA 3OXSB 2BE5D 2QHRH 2WSPA 2H1PH 1JD9A 3DBXA 1HEHC 3KBPA 2FX8L 3G6JE 3GK8L 1LWJA 5C86A 4BH7B 1JRHH 4RWHA 1AGEB 1AHKA 1X5ZA 4RAHA 1OZTG 5D4HA 1LO2H 3RBGA 2YHGA 1I3UA 4Z7AA 5CINL 2W81C 4YSOA 2CJSA 5HHXH 3QWOB 1AP2A 1GPOL 3CSTA 3T8VA 3P4LA 1GYUA 1NGWB 4XPFL 1MEXL 5CBEA 2HB0A 4IHOB 2IGLA 1CXLA 1LVEA 4WZ9A 3D33A 4BSVA 1MFAL 1X5MA 3PL6C 3PNRB 3VXNA 2F5BL 3EYSH 1CR9H 1PQZB 3CH1A 4NQXB 2A6ED 4P48A 1A3LH 1WC7B 1WWWX 4QPEA 4XPBL 5B22A 8FABA 5C0EB 1WUZA 5DZOA 4X9HA 2CLRA 3S5LA 4HMEA 1MFUA 1RUAL 1MWOA 1U93A 2BXYA 3PABB 5C0JA 2N3JA 2YA0A 5D70L 1OM3L 5L2KE 5H4YA 3LNGA 4R90L 4JDTH 2UUDH 4ONGH 4X7DC 4ZK8A 1COBA 4CVZB 2VDPB 4JG1H 4X7EC 1HL9A 1KIRB 3TA4D 2ID5A 1AIFB 2E3VA 4XTRD 2FAUA 1HT6A 2H6UA 2YD5A 4JN2B 2PWFA 3VM5A 2FYYA 1P1ZB 3QRGL 5IBTL 3UACA 4HPYH 2VC2B 4ZW6A 2HT2D 4CN1A 1B4LA 1OCWH 4OJFH 5MERA 4WGVB 1Q0YH 1SY6A 5E24E 5HHNA 2MCAA 1WWAX 2UWEF 4QT5A 3WE1A 1CURA 2ZWKA 3FO0L 2EDNA 3QQDA 1W0WA 2VIRB 4KOBA 4QHMB 1T03L 3X3GH 4FMKA 3U7YH 3F12B 3VXSA 3VFPB 4L9DA 2CUHA 2FEEL 3WS3A 3LSOB 4NX0A 3C60C 1WVZA 3DGGB 1E8XA 1KBBA 1F1AA 2BIHA 5EIIB 5EEZA 1M6OA 2AQTA 4MBRA 4OKVB 4E0RA 4CVWA 5D7JD 1V5JA 2V17H 1CD1B 3TTSA 3MLXL 3FONB 4DCQB 5K59F 2ORBL 4MMZA 5ENWB 2HN7B 5CHNB 3APMA 1DBAL 4PRHB 1A25A 1M4KA 2BVQA 5IREA 3IJYB 4Y7MA 1GY2A 1KY7A 5CEZL 3QG7H 5J56B 2BNQE 5I1HH 3HCVA 2BY3A 5FYJU 3KPRD 4ZM7A 3O0RL 2AV7B 3ML8A 3NCXA 3VM7A 3UAJA 5HSFA 2GJPA 5ESAA 4JFFA 4LP8A 3VQLA 1XO8A 4DETA 4XCNA 1ANUA 3QUMH 5E6IB 2BNUA 4Z0BH 3RVXC 5ALBL 3EBGA 2JKTM 2L3BA 1OTUD 4HETA 1R3JB 1WBYA 1YDPB 2X0UA 4RDQF 7PAZA 1QLFA 3FCSB 4OLYL 1W8OA 3BMVA 3P40A 1F42A 1ZXQA 1BLIA 3M7FB 5IHBA 2OMUA 3P4MA 2Q3XA 1YMHB 2DM3A 5EORH 4U6HB 4XP9H 4TTDD 2QKSA 3W2DL 1ND0A 2H6PA 5C71A 3Q6FA 4GRLA 2OL3H 4YFLI 2X05A 2IOOA 2MQGA 5CIPA 1IGIH 1AY1L 2C9QA 1EVUA 2VOTA 3ZTJG 4BRVA 5CCGE 3H7LA 5J6GA 2JIMA 3WIFA 2XKSA 3VD2A 3MJ7A 3OPZL 3P30H 5I9QB 3D4ZA 1VRSA 1A8JH 2P5WD 5ETUB 5ABZA 3HE7A 1IBGH 3MJ6A 2KKQA 2BHZA 4LPCA 4FEIA 2WLLA 4L9LB 1NAMB 3L95A 3LNDA 1H5BA 2NR6D 3GZPA 3KH3A 5ALCL 5ILTL 1W80A 3UMNA 1CE6B 3GINA 2EUXA 3LKRB 4Q52A 2Y7MA 1EAPB 2NY2D 3LTVA 4XP1L 2JKJA 3MKGA 4HX1B 4JKPL 4WUUE 3KLKA 3QK0A 3WFEH 3HC0A 5KVEH 1IVLA 3FT9A 4YHLH 4K94H 3GSNA 2H3KA 4OZIF 1A1NB 4WHTA 1KIQB 4C4KT 4PJIB 1JZ3A 3OKEA 4ONOA 2EEBA 4RISH 5EF2A 3WIHA 5AD0A 1ETZA 1FLRH 3X1GA 1YEEH 2F8VA 4IOSA 3ULSA 2PMZA 3DOSB 4OF5A 2EECA 2FJHB 1DMSA 3MVSA 4U6YB 1PF3A 2MFNA 5DD3L 1MW1A 4KRPC 2Q6WB 4YBLC 5I8EA 1KPVB 3EYUH 4OT1L 3ETTA 5CN2A 5IP4A 2YPLE 1Q1JH 5B7FA 1PCXA 5HVHB 1KXVA 1ZHKB 5HI5C 4J2QA 1T66C 1JYXA 1Y0LA 1JI1A 5GRXG 4FP8L 2X4PB 2OK0H 2J55A 3I74A 4OLUH 3Q05A 4B9JA 2OMYB 4DN3L 3MLUH 2E8ZA 2EDYA 4UILL 4MASA 2AJXL 5LBSA 3LRSA 1ZHLA 1CS6A 1TTFA 3FQUA 1J7VR 2V5MA 3WHXB 5HHQB 1A0QL 2V2WA 3G5VB 3SGJC 3M1BB 1PPYA 4BZ2A 4RBPH 3LEXA 4ZMVA 2PTTB 4QTIH 4B9KC 2VPZA 3UJJL 3HG2A 5BZWB 4KDLA 4B53A 3EG9A 1YQ2A 3P0YH 1L8FA 5AVYB 3UTPD 5A16A 1GS8A 1OSZB 3A4FA 1U8HB 2JIXA 3O0LA 2FHCA 3LKQB 2NY0B 3RA7L 4P46A 3GUTB 4X6FB 3NCYS 4BXVA 2GJZB 3ARGA 2VN6A 3AXIA 3VXSD 3ZR6A 2HX7A 5ANMA 1DYZA 1MHEA 3CDCA 4HKZA 4UTAH 3QHTC 4NBZB 4Y5YB 1WLHA 1XXFC 3AJ7A 5DJ2B 3NSYA 4BKSC 5HDBF 3WKPA 3EJSA 1EHXA 3GXFA 2AABL 3ZO0A 3T77B 3BVUA 3F83A 1QR1B 4PCTA 1VFBB 3DXAB 2CE6A 3K6SA 2OTPA 3NIFE 3ECBA 4Z7QE 3V4VB 3HN3A 3SOBL 3EYOA 3RURA 5DUJA 2EQDA 3BH8A 4OCSL 2C1OB 4LSSL 4S1SL 1E9QB 1F56A 1E30A 2WTRA 4F5CE 1EEZA 3CBRA 1A7RL 5BMFL 2F7PA 5ANHA 3BP7B 3IRPX 2JJSA 3QNFA 3GGWA 3QORC 4MDJB 3TZVA 3DX8A 4G6AD 4YVNA 1OAKH 2JJTC 1YN7A 3II1A 4G3YL 4U1LB 1CFBA 4ENGA 3O4OC 4PRPB 2Z1PA 3VG0H 4QRTA 3UAJD 5J1SC 5BVPL 3NIDB 4FQXB 4HGWB 5KVGL 2E7LA 3CZEA 5DMYA 5HVWA 4UM8B 4WWKB 2XTJD 1E28A 5HGAA 4R0LB 3OB0H 4B7IA 1GHFH 2NZ9C 3FSVA 1ZLUK 4HUNB 3C12A 4DP4X 3ZKMC 4MA3A 3F5WB 5EC1B 2V9TA 3FTUA 1ET5A 5K9OA 2N1KA 2WW8A 5J13B 5FGRA 2I26N 5C97A 3EYVA 5C7XH 2ZE0A 4LGSB 2FB4H 4GRLD 2ZXBA 4M5ZH 3ZDXF 5B1JC 1FLTX 4QKXB 1K2DA 4P9ML 5FK9B 1N2RB 4QOKA 2CBOA 1O7DE 1ZV9A 4KROC 4NQEB 3T65A 1BQKA 2HFTA 4JGMA 2VDKH 5DFVC 3G6JA 4H0GA 3HMXL 3ZTDC 5I0ZA 3HE7D 4OGAC 4G1EA 5IOPB 2JV6A 2Z8RA 1NJ9B 1T5XB 3SBPA 2VYRE 1QFUL 1EQWA 4X6CF 3KGTA 5HDBB 3FQWB 4P4RB 3HS0A 3T4YA 1CI3M 4Y5XA 3KLQA 4WEUD 3FU6A 3CDGA 3EBAA 2DBLL 1L0QA 2UY7A 1EUUA 1NPNA 3WI9A 4EEEA 1E7VA 1AH1A 3T04D 4KK6D 1I31A 4KO5A 2BWIA 1A6VH 1NBYB 1OP3K 4LAQL 3ZMNA 1HIMH 4JFTA 1R0AH 4AQ8A 2CDFA 3C08L 4WUKL 3V4LA 1U4FA 3NFNB 2JMRA 3PLXB 3PPEA 2EC8A 5EN2A 4FNPA 1E4JA 1XSOA 3BX7C 1WAAE 3GYRA 2BP8B 3RIFF 2ADYA 4H25A 2VW6A 2CCWA 2ZPKH 4IOSD 2X1QA 5JW5A 4KVCL 1K83A 5AZ2H 4PYHA 1BHGA 3F84A 4PV8B 5L2KA 1X5JA 2J6EL 5I18L 2O72A 3RHWK 4ZW8A 4X6BB 4Z7OE 2E76C 3D07A 5B3JE 4BUGA 3AW5A 3IFOB 5DFTA 1KXHA 2L0DA 3CN1A 2KDYA 5D96B 1GSMA 4RFOH 5GRJL 1R46A 1X4ZA 2LW3A 2NNAA 4LPYA 1OANA 5IFHL 1HHJA 5SX5K 2CM6A 1J8KA 5A6IA 5KS9F 5LDSA 4IRZH 1N64H 4H2CA 3STLB 3B34A 4Z0XB 4OJAA 5EA0L 2GSIB 3WS6A 5KSAB 1H0DA 4KH9A 1R3HA 2NMSA 1H9VA 2NUTA 3ZKNC 1XCQA 4F2FA 1Z32X 3BAKA 2LQRA 4GMSL 3O9WC 1PS3A 4BEIA 4WRLA 5KYYB 3EBIA 3F6JA 2JIXD 4XC3H 1U2CA 2PCXA 3CSGA 3GSOA 4P46D 1DJSA 3CXHJ 1OCOB 5F1SA 3LYRA 4GA5A 3OAWA 4NNYB 3EFOA 5CZVH 3KM1A 4GPVA 3RFZA 4TLTA 1A2YB 4AYDC 4MJ6B 2XRAH 4W6XB 3U36A 3GMPB 3BDBA 3CDFA 3L5XL 3MRIB 4PI0A 3MUHL 1PX8A 3L3HA 4RDBA 4HWZB 5F7LB 2ZCLH 5FM5O 2BNQA 1JXGA 1L7IL 4XI5D 2EDRA 4I0PB 4OFQA 2ZNWA 5JPNC 4AVJA 4U2YA 1BGXL 1CDJA 2OMZA 2ZIDA 3GTMA 1SMAA 5AVRB 5IVXF 1AOHA 5B7EA 1UHVA 3L7FA 4ODVH 1ZT7B 5IESH 1CT8B 1BOGB 2DV6A 3INOA 4NHUB 3TZVD 1AQDB 5LXGH 1W72A 2PWGA 3CSPA 4A6YB 2EXWD 1FFOB 2G30A 2OTUA 4I9WE 2JIRA 1SLWA 5EZIL 4E42B 3TL5A 2FX9H 2YOAA 2ZAHA 4BE6A 1SFOA 2XXCB 3FUJA 4LSTH 1JZJA 3CXHK 4U1JB 1YEDA 2K9UA 1GGIH 5MP6H 3SDYH 4LHUG 2AGJL 4PTTB 1MCPL 3V0FA 4FKEA 5I1GL 2WIIA 4LIQE 5A2AA 2CRZA 2AJYH 3A21A 3EXJA 3D4GA 3FQ1A 5B39G 3J2PA 2DKUA 4GY4A 4LLYA 2A6DA 1ERNA 4QOKD 1XT5A 4HJGB 3MNDA 3KYNA 1EAQA 4N20A 2ED6A 1R5IB 4P23B 4N2GA 1ID5I 4JY4A 4WUUA 2BP0A 1WZ1L 4Y5VB 4FADA 4JM4H 3PWJA 1A1OA 1LO4H 2O6CA 3QNZA 4HWBH 2R23A 4BCZA 4WW2A 3PJSA 4CW1B 1FQ9C 1JE6A 4GQPH 4IRJB 1U8MB 4IBSA 1CGYA 1RERA 4PP2A 2H32A 32C2B 5CILL 5E6YA 3A67L 4U0RC 3VFPA 1LDSA 4FG6C 4IDLA 4O9HH 4AGOA 4J5VA 2KZKA 3KG5A 3TNMB 2WQUA 4WNQA 3UC0L 2V5YA 4YDLC 1J1PL 5KVFE 4IKIA 3DYOA 1EX0A 4TNVF 4Z77B 4WIQA 3FT3A 3SB3A 3GHEH 4M1CC 3BHBA 4P3DB 5DYOA 1Y1WA 1BEYL 1CGWA 1WD8A 2CIIB 2O6DA 3GSWA 3GJFH 2YPLA 2F61A 4MQXD 4BFIA 2Y2YA 2H5UA 5DRXB 1CFMA 4G9DA 1P7HL 5TDPA 4NJAH 4URKA 5L2KD 2BC4B 4PJAE 2YQ2A 5A3ID 4ZT1A 3L2MA 3G6DL 4XHQA 4BA8A 3O3EB 4AONB 1FAKT 4PS7A 4FQ2H 2ZOUA 4M7LH 3DROA 4ZZFA 4HALA 3LPFA 3BAIA 1KEGH 4MMZC 1C7SA 5CJQH 1PFOA 3BO8B 3MNZA 2E47A 1AZNA 2WUBL 1MLBA 3VFMB 2I9TA 1A3RL 3Q3GB 1K3IA 3D09A 2DQTL 4NM4H 1F6FB 2R69H 4MFHA 1KJ2A 4HA1A 4JY6A 5F6IC 4NCC2 2LU3A 1YEIH 1YMMB 2AKRA 1G0DA 3GHPA 4HMDA 2DYPA 3IDMA 3WXVH 5IT2L 3BUPA 4KX8A 1JNLL 4UIMA 2IGTA 4M7LT 1NL0H 1IAMA 1M2VA 2HVKA 3QFGA 3K80A 4XRCB 1MVUA 4XODA 1NEZB 3DMRA 4J6RL 4OH2A 3I6SA 5AOZA 5LGKA 2WLMA 3S3DB 3AQYA 4K5OA 3VWKA 1BXVA 3ELQA 3WGUB 4DKAA 4J8RA 1MCNA 5IWLA 4R6UA 2CAKA 1K8IA 2A99A 4CU8A 2P1YA 1E27A 2ATKB 4PGCB 4E5XG 1JZIA 3D4YA 4KI5C 5IB1A 4F5CA 5T5MD 2A2QT 5C0FB 3GB7B 4NWTL 4H1LG 3REVA 3CUPB 4OTXH 2BNQD 5LWYH 2DTML 1L5GA 2JELH 1LE5B 2GCYA 3CLWA 3AFLA 5FGCB 4JK0D 3IXAB 1KLFA 3DYMA 4JB9H 1XF4B 3CH8A 3E9TA 3VGDA 3I9GH 4D7ZB 3UEZA 2QQNH 5ITFA 1IEBA 2W88A 3ZYJA 1GS7A 4NQTA 1XGRB 3PNWA 2VDQL 1E3ZA 4NJ9L 5F88A 2JKWA 1F11B 3T2PA 4NGHH 1TFHA 4YOKA 5HHVL 5ID0A 3NEEA 2Y36H 3VVVA 3Q2CA 5EU3B 2R51A 3QQ3B 4JFDE 4U4BA 2GIMA 4Q7DA 3ARYA 4LLUB 4NENB 5L8KB 4YJZL 4A7TA 4KY1H 5DQ9A 2CD0A 4PG9B 1VEOA 4CVXB 3NK4A 4X0KB 1RULL 4IS6B 5G4NA 1EMTL 5DVPA 3C2AH 3IDGA 4RV0A 4CRYG 3FTWA 3FT0A 1EXHA 3BEVA 2PO6C 3GC3A 3WMQA 4ZMZA 4FJ6A 4KO6A 1FC2D 3HPLB 4L5FH 4MD4B 1XIWB 4XVUD 4NP4L 5E9DB 3O2VL 5IVOA 1G7HB 4GQRA 1D6EA 2VZTA 4MQTB 3CSYA 2O5YH 2R59A 3QI9C 5TH2A 2UWEE 4CU7A 4I18A 1KXVC 4K8RH 5DUPH 1L0PA 3TASA 1UD3A 1HZHL 3X2GA 1ACCA 3GIZL 5EZOL 2NY6C 3ATFA 5EZLA 4OVUA 4DGIH 1CLOL 3TN0B 4F2MB 5JR1L 1IC7H 2XN9E 1CL7H 3EO0B 5CF3A 2E7DA 3BH4A 1MWAA 1NGZB 3QXUA 2OCJA 1WAAA 3U2SA 5CAYB 3MNMA 4MMXA 4OJEH 5H35A 2NXYB 4FL4C 1TJIL 3M17A 5DD0L 1R24B 2HPOA 3GMNA 3PV6B 2X6AA 3PWNA 3HR5B 2J2ZA 1KN4L 4URTB 5E8OA 1PQFA 3VGGA 5INDB 2D7OA 3IJ8A 2LLGA 4LMQE 3TT3H 2WCSA 2YPLD 5DWUH 3MN8A 1MCBA 3OF6A 4TSAH 1BZ7B 1MREH 2EZ0C 3W0WB 3ARGC 1YAIA 4QRUA 5DD1H 5DYIA 1QR4A 3EH5B 3R06A 2IDTA 2W0KA 4F37F 4YBQC 2I7OA 5D1ZI 3C5SA 3RDTB 3KHOA 4MKMA 3PDDA 1F3DJ 1DDHA 4D9LL 3HR6A 3IF1B 1E5CA 2LT9A 1SJXA 2R1XB 1S9XB 3WFDL 4AQ1B 3BGFB 1N4XL 2VNCA 1HQ4B 5CWSA 4JPQA 4TVPL 3KPTA 1MY7A 4HHAB 4KJQC 3IDNA 2IDCA 1KMGA 1XGYH 2WY3B 1OQOA 3QIUB 1CLZL 3KYOB 3TBVA 1M3IA 3WDJA 4XO3A 5IB4A 5CEYA 3ZL1A 2ZP8A 1YJDL 5IJKA 3QJOA 3MV7B 5C8JA 2DYPD 4HGMA 2X4UA 5DK2A 5HYSA 4AK2A 1XX9C 1XF3B 4NZTH 5C07B 3WEXB 5A2IH 4GG6B 2VMFA 4NRZA 5T3XH 3RNKA 1MQKH 4HF5L 3K6NA 3BKYL 4MLIA 3Q48A 4NRYB 3FUDA 3ESMA 3TO4A 1R9FA 3VWKD 5CN3A 1XXDC 3DNKA 4H8WH 3PXJA 1QMUA 2A73A 3MBXL 4HZ1A 4EN3A 3F05A 5M7QA 5HGGS 1FL3A 4TQIA 2AJUH 2BZCA 4XPGL 4U1IA 5BVJB 5IHHA 4ZQKB 1NBCA 2I5YL 2JI2A 4GA6A 4OZIE 5KOVC 1U8KA 4YC2C 4WI7A 3CFQA 3R1GL 3VW3L 1M7IB 1LQBC 3WJMB 1RUKL 1SEQL 3SKNB 2ZWNA 4FQIL 1JG9A 2BVYA 4KJYA 2DLIA 1HH6B 5LGHL 4ZS6C 3RWDB 4O4YL 2FYVA 3TNNA 5GJSL 2HWZL 1TQTA 4YE4H 3G08B 3DX0A 1FNEA 5AYUL 5BV7H 4PU2A 2VITA 2O5JD 4QLWA 5CCKH 4OZHF 1A4AA 4NBXB 4Y5XC 1SHWA 4M9PA 3VH8B 4U05A 3EGXA 3CXFA 4UQ3B 4WEBH 3BLBA 3NFPB 1G6VK 1XF2B 1E7UA 1AKJB 1NMBL 5DMKA 2AV1A 3SKOA 1W0VB 4OI7A 2VR4A 4GQ9H 3DURA 1UA6H 2QSQA 3K6OA 5DSCA 5AW4B 4ACTA 2FBJL 2G3XA 1OPGH 4QAWA 3GI9L 1TWCA 1MXGA 2XZCH 1S9WB 1IC4H 2B2XL 3X3FH 3MBEB 4ABUA 3ZTNL 4JMNA 4LSDA 3HHSA 4WFFE 2MCMA 3X12B 3ARXA 4LHUB 4MB3A 2BSTA 4LFHG 5E0QA 5B4MD 4YFEA 5JW4N 5DQDL 3U30B 3IJSA 1L9TA 4BQCA 2YBRB 4X6DE 3C6SA 1XF5A 5GGTH 4EIUA 1ASPA 4JFYA 1S5HA 5AOMA 4MAZA 2CQVA 2FJFB 5IIEA 3O4LE 4QLRA 1U3HC 4P5MB 3VFOA 1QLRB 5SWQB 4N6QA 3QJSB 4X7TB 4MD5A 4ZPTA 1EO8H 4R4BA 1IBHA 3PHQB 3QPQC 2P8PA 1F97A 2C3WA 5GS2D 3LNFA 5HYFA 4IU2A 4U3SA 2ICEA 4PS3A 4KVPA 4M4RA 1OHQA 3WUWA 4NI6A 4Y19B 1UCBL 2HT4D 1G7JB 1MAJA 5D8JH 3F58L 3ZPDA 4IQHA 3AITA 3K4DA 1QSEB 1I3GL 3LMJH 1OAXL 3V6FA 3UTSE 5FOJA 4M5SA 4RSYA 5DT1L 3TBSA 4GP8B 2WO4A 5GGQH 2XZAH 1KTCA 4AMKL 4PJAA 3DPDA 5J11C 3D39E 2LAGB 1RZFH 4X5PA 2PXYA 3OKOA 4G8GB 4IDJL 3Q1SL 3OF6D 3L1OL 4V33A 3AQZA 3RPIA 2EDTA 4DGUA 1TQBB 1P53A 3QXWA 2IBGA 1D5BB 2IV9A 2KPWA 2UXTA 4JJ5A 4OLEA 2BJML 4JDZB 1AR1C 5G4OA 5BQ7A 3Q2WA 4MX7A 1ZTXE 2Y7LA 3JWNG 1HOCA 1SMDA 2BRRL 3H2QA 1RZ8A 1QHPA 1AZCA 3X13A 3QJXA 1H5NA 2VW4A 3EH2A 3BDXA 3ARBB 1R34A 4P2RB 4BCYA 4M62H 4DQOL 5C9JA 2CNZA 4XVTL 3UZEC 2X1XR 4QYOA 3TS8A 1IBBA 1MELA 3MGOA 4GO9A 4KMTL 4JM2A 1EAOA 3E8UL 3APCA 1IO4C 1KGIA 4PEEA 3DJSA 3UG5A 3V0VA 4H20L 2WPGA 4H88L 3ZDXE 2QGEA 3SZ6A 4NPYB 4K71C 1E9PA 2P42B 5I1KH 1LO5A 4ZUVB 3RZCA 5T3ZL 4L0PB 1CDBA 2WNXA 1PU0A 3NFSL 4D7PA 3ZRSA 2BVPB 2JKIS 3C8HA 1LK2A 3GJEB 1BQHA 5E8PA 4YHYB 2JCCF 4PRAB 4LVOC 1SUJA 5FCSH 5DUML 4DMRA 4PBWD 4FQQA 2EACA 1N6QH 3NPSB 3UJIH 3W81A 3QQ7A 2AAAA 3BPCA 1NKRA 4POZD 2X4RB 4NC0B 3S98A 4WFEE 1E9OB 5I73B 2QPFA 4GG8B 4EN3D 4I1PA 4PRBA 1TYRA 1V3LA 3GSVA 3SKJL 3CPUA 2EXYC 3NJNA 1NEUA 5TFSL 4KTGA 1AGDB 1ZCRA 3C09C 4ZOBA 5EPMB 5GJTH 3B83A 3FF8A 2LU5A 4YDKH 4P3CH 5JZ7C 5DQJA 4PJXE 4I4WA 2KUTA 1C5CL 1C7TA 2IGFH 4IKNA 3RNQB 4I9WD 4BUQA 4JVPA 2VN4A 1I1AC 2VT0A 1OGSA 5I1EH 1QPKA 5EO0B 4JFDA 4WW2C