1N10A

Crystal structure of phl p 1, a major timothy grass pollen allergen
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
238
structure length
228
Chain Sequence
PKVPPGPNITATYGDKWLDAKSTWYGGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pollen allergen Phl p 1
publication title X-ray Crystal Structure of Phl p 1, a Major Timothy Grass Pollen Allergen
rcsb
source organism Phleum pratense
molecule tags Allergen
total genus 50
structure length 228
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 1n10A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 1n10A02
2VXQA 3SUMA 3ENGA 4FG4A 3X2MA 3X2JA 3X2OA 3SULA 3X2LA 1L8FA 4JCWA 4ENGA 5H4UA 4JP6A 3SUJA 1BMWA 2GAEA 3X2IA 2ENGA 3CZBA 2BH0A 4ZM7A 3M3GA 2AE0X 5GM9A 1WHOA 3D30A 4FERA 1OA7A 1HD5A 3X2HA 3X2GA 4JS7A 4FG2A 4JJOA 5GLYA 2G6GA 5GLXA 2KQAA 2HCZX 2PICA 1OA9A 3X2NA 3FT1A 3X2KA 4JP7A 3SUKA 1WC2A 2G5DA 3X2PA 4AVRA 1WHPA 1BW4A 1N10A 2PNWA 2PJJA 4FFTA 1BW3A 2JNZA 3FT9A 4L48A 2PI8A
chains in the Genus database with same CATH superfamily
4WEMB 5JXAL 3VD1A 4F33A 3FKUS 5IKCA 4LLUA 1NSNL 3O6ML 4WI8A 3LZRA 5LAXB 4OF5A 1FZJA 3QXTA 4UAOB 2I7OA 1AS8A 1RXLA 5DK2B 3KEHA 1IKNC 4XVUC 1Q9WB 1IQWH 1VPOL 4PAZA 5A2IH 4Y16B 1I7UB 3GRWL 1UB5B 3GXIA 1BZ9B 2GSIA 3UGUA 1KCSL 3NFPB 2NY0B 2BY2A 3MV8A 2WQUA 4RMVA 3JYCA 2D4FA 3GRWA 3IDYB 2FWOA 1JJUA 1MJUH 2ED6A 2V8LA 3LN4A 5F7DA 2PNDA 1LGVA 4FI6A 4J3XA 2Y7QA 3FO1B 4WSJA 3Q2VA 1V7ML 3GM0A 2CXGA 1A4BA 5TFSH 3VD5A 3MNZB 4N8VA 5T1DL 3TT1H 4M43H 4M93B 3DYPA 2OSWA 1F11B 4GP4B 2K6WA 4MZIA 1CICB 1UZ6E 2BVOA 4L4VB 3BJ91 2X3AA 4YO0A 1NBZB 2DYPA 2O6FA 3X1GA 3CHPA 1BAWA 1HVXA 4IIQA 1RP8A 2VMDA 2TRHA 1OP3K 4DAGH 1DJWA 2Z4QB 4J1UA 3ENGA 5E6IB 4HFUH 4D2NA 5DHEA 3KPMB 2EH8H 1FNEB 4PJGF 3DMMC 4FZ8L 2AEWA 3BE1H 3BUTA 2BOBB 1KFAL 1Z5HA 3BIKA 4OGYL 3L2LA 1X5JA 2FEDD 5AD0B 4LSQH 3OR6A 5SWZD 4O2CA 3F3HA 4KRPC 4G43B 3GSQA 4P2RD 4ZSOE 2EC8A 3RIAK 2H26A 4ZO6A 4WF7A 3KWWB 1A9BA 2DLTA 1JOIA 1KSRA 4B9YA 4ZQKB 2QSTA 2HKHH 5KJRL 5JIIA 7FABH 5HHOA 1A6TA 3O2WH 1DVQA 3VFTB 4FCHA 4EIBA 4M4PA 2JCCA 5C6WH 3VXRE 5A16A 2GTWB 1X9QA 4GQ9H 5ICXB 5EEWA 4R2GB 2NYAA 2AGJH 1CXLA 3PP4H 1LD9A 1NOAA 1BJMA 5D7SH 2ZICA 5EOQL 2YAQA 3PWNB 1MCFA 4KMTL 2Z0BA 3SY0A 2A2QT 4HDIA 1JHTA 4W9ZA 3QDMD 5CJOH 2FCBA 4YSDA 1P9MA 1MNUL 2YBRA 4XVUD 1AA6A 4TUKH 1KLFB 2IC2A 4FEMA 5D4IA 5ITBH 4P23C 4GRMA 4NM8L 2QQLH 1MCOH 1A0QL 3MREB 5GLYA 1F4YL 4ANXA 5E8EA 1JE6A 1TJIH 2Y1ZA 4BDVB 1NM4A 4M61B 2XG4B 1WP6A 4J6RH 5I24A 5HHVL 5JOEA 4JUTA 1J05B 1R34A 4WGWB 3MLXL 4NPYA 1A3LH 3DDGA 1JWSA 2P5WD 3ML9A 3Q43A 3D4GA 1H19A 1ZCRA 1QQDA 2GG1A 2HT3D 1Q94A 3U25A 1FHGA 1DANU 1ZHBB 3VDCA 4JN1H 3SOBH 1XSOA 3SQOH 1FPTH 3MRMA 4O9HH 3CFCL 5EC1B 3B9VA 3CFKB 4OCYH 3BZFA 2F8VA 3ARFA 4MBRA 3O0RL 4OFYA 3HI6L 2F7OA 1CGVA 4LHJB 2OMTB 4XNYL 5G5DB 1H15A 1D5XA 3RX8A 3QDJA 2B3RA 4HEME 3S97C 1AR2A 2HJKB 3NAAL 2KQNA 4BRVA 5HPMB 3LKOA 1I9IH 4NN5B 5DT1H 3DMMD 3E1ZA 3HAEH 2V9QA 4BQBA 4KKBC 1ONQA 2QGBA 1JFQL 1TTBA 3FF8A 4B9GA 2ZAGA 1KENL 1RUKL 4U3CA 2JI3A 2OJZH 3OD3A 1W0YT 2E3VA 2WWMC 2DQDL 5CSGA 5AW1B 1WBXB 3JQOB 3BO8A 3QIBC 3NK4A 2X05A 3M45A 4AVKA 5MEND 1Z5LB 4JFEA 2R29H 3LPPA 1VJSA 2GT9A 1GPOL 1PSKL 1MXGA 3L4WA 1KBKA 4P9HC 4PJCF 1KELH 3WSQH 5E5MB 1A2YA 1SYSA 2W9DH 4NWTL 4PJAF 3V8OA 2WLLB 3TTSA 1A4KB 5CCKL 2W60B 4P23D 3LIUA 4ZFOA 1C5CH 3DPBB 5JHDD 3PABB 5HI3D 1XCTA 1AQMA 4MLIA 1KBGL 4NIKB 3AAZA 2R2BA 1CB4A 4QXTA 4TLKA 3T8XB 4MX7B 3MBWA 3N40F 4HJIA 4AQ1C 4K7PY 1IIIA 2R51A 1N59B 1KQGA 2ARJA 3GMMB 2GJPA 2C3GA 1AGFA 3LSOB 1OB0A 4P46A 2PTTB 4IK7A 5JNYA 2F08A 4BCZA 4W4OC 3MV9B 2EVFA 4AJVA 5IQ9B 4G6JL 2BWQA 4MA7L 3GSUB 1ODUA 3CUPB 5H37A 2OSXA 1E9PA 4APXA 4KZEL 2TSAA 2ZCKH 3DKHA 3WUWG 3PGFL 3DJZA 2K7PA 4NRXA 2OL3H 1JGEA 4TSAH 4Y4HD 4FJZA 2BIQA 4WW2A 1RUQL 4GRWB 3O4LB 3BH4A 4JM4H 3LZFH 4DPCX 1CPUA 3BPNB 1X5YA 3IMRA 1IZKA 1OKEA 1GYVA 2NVYA 2ZX6A 4M1DH 1P53A 4O58L 2B15A 3OLIA 4TL5A 2XV3A 3KYKL 1TXKA 3U6XS 4AV0A 2LU4A 1YEFL 2QMJA 4Q7DA 1GC1C 4KKBD 4QKXB 2X38A 1U8HA 2HRPH 4FAAB 3L3HA 12E8H 4A2DA 2NXZC 3QXWA 4PJBB 4EOWL 5T3ZD 3LMJL 4N2GA 4E9TA 5DCCA 2YAFA 4MA3B 1PJ9A 3KLAB 3LTVA 4I1PA 5D71L 2FHFA 5CGMA 5ISZE 1WIPA 1XIWC 4O2FB 4H8WL 3B9EA 4UM9D 2GFBB 3CNKA 1TF4A 3KVDD 4G1EB 5DVOA 5B38G 2X3BA 4PJIE 5HVGB 1A7RL 5DJXA 4JQVC 5IW6A 3CBJB 4OAWB 1RJLA 3EAKA 4NXKA 4NERA 4XMLL 4A2GA 1BPLB 2FIKA 5EU6E 1RIHH 3GBMH 4TSCH 3HE7D 1KDIA 5EA0L 1UCTA 2K7QA 4M48L 2N1KA 4ONOA 1OGAE 3N43F 4LCYA 2BSSA 1E4KC 4F9LA 3P0YH 4D7PA 1EEYA 3EYUL 1EMTH 3TNNA 4X4YB 1PLBA 1OAXL 1RZIB 3QS2A 1YEKH 1I3GH 4AITA 4LRIC 3V6ZA 2C9RA 3N1FC 3FQWA 1U3HC 2A77H 3O2DA 2VXQH 2JI1A 4P9MH 4XP5L 2JA6A 2E56A 1U95B 2Z7UA 4LLMA 1G7LB 3GMOA 1F4XH 1RUPL 2YZ8A 4ZW6A 5BXFB 1YN7B 1N64H 3D52A 5SWZA 4P2RA 4JHAH 2ZX8A 1T80A 4I2XA 4XN5A 1KDJA 2DWYA 1OTTD 2GHWB 3W11C 2Z31B 3I02B 3OC5A 2G3NA 7CGTA 1WWAX 3RTLA 2J43A 4TVPE 4XNXH 4ZW8A 1UD4A 3MLRH 3HNTL 3BWSA 1DEEA 2IMNA 4W9EC 2VDKL 3GSNL 3LB6D 2BOLA 4KKAC 4CJ1A 4AMKH 3IXTA 1R24B 4HGKC 2X70A 5LGHH 1CC3A 5DRZA 3GSNA 3QDMA 5I5JA 4H8QA 1JUFB 1WCBB 1IKNA 2YAMA 2YZ1A 3CVHB 2CNZA 4J3WA 2W0FB 2VC2B 1VESA 2XQ0A 5B3JF 4GSQA 2CJUH 2FO4B 3BD3A 5JR1L 1BPVA 4ZPVA 4AYGA 2NXZD 3HB3C 3ML8A 3FMGH 1I3RA 4Q74A 1E0OB 2EKSB 2G5UA 3ECWA 1BMZA 2AXFA 2VXVH 5IQMA 5DD0H 4DH2A 3FULA 3LKSB 4J4PC 3VD4A 3V0VA 4FLHA 4QDGA 2VDOH 2ZP0T 3CCHA 1AKJD 1FIGH 2P5WA 1DN0A 1JNNH 2E4FA 1FYTE 2BY0A 3K8MA 1XDTT 2EVHA 1NGQH 2OTUB 3HNSH 2X28A 5FYLD 1QFHA 3EO0B 3MRJB 3VJ6A 4Z7NB 2X4NA 1BIIA 1UADC 3IU4L 3ARUA 3INUL 1K2DA 4ATWA 4PLJC 5B7MA 5D7EA 1QSFE 3OZ9H 1BV8A 4OLZL 1U3HD 3CDZB 2F54E 1Q90A 2H4EA 1KTCA 3ILQC 4XOAA 1IGTB 1JVKA 3DMMA 4PWHA 5C0JA 5B1JA 3X2GA 1PYWB 2JK5B 4ICXA 4RQQB 1S6NA 1U3JA 3IGFA 4L37A 3CLEL 3ROLA 1JVLA 4TNFA 3PXHA 1CIDA 3SDCB 4DP5X 2PO6C 3SSGA 4R5TA 1UFUA 4Y4FC 3ZYOA 5A2CA 2R15A 4QF1B 3W11D 2X4TB 4FLSA 4IBLT 2KUTA 1XR9B 2P42B 2HTKC 3IDJA 4LCCC 4EN3B 3IGUA 4KGLA 5MENA 1AP2B 5E8OA 3EXJA 1FAKT 1S9YB 3O8XC 4KKAD 2Z9TA 1EHKB 1NCDL 4KY1L 4XMWA 5FW6A 4XP4H 4BHUI 1Q9KB 4DZ8A 3W39B 4YBHA 4UTCA 2R0ZH 1FLRH 3A5VA 3DROA 5LO7A 1UC6A 2BIMA 4KKPA 1AGDA 2AKRB 3OKDA 5IF0B 4P23A 4OCSL 1WZMA 3VTMA 5IJDC 5JHDA 5D7JB 3HB3D 1D9KC 3F7VB 1E8ZA 3C9NB 3W81A 1I8KB 3V7AG 2JWYA 4BYHA 3BH9B 4L5FH 3O3EA 4Z3HA 1X5MA 5EIIG 1HCVA 2BK8A 4PY8I 1TVHA 2IDFA 5ESAA 4KVNL 1EXUB 1SUHA 5SWQB 1N8OE 4ZK8A 2NX5B 2QHRH 4HAKA 3T09A 4DW2H 1CZ5A 1MF2H 5EU3A 3OM3B 2HG5B 3ASOB 5BVJB 3H0TA 2GC4C 5GXBB 4Y4HA 3BD4A 3DLQR 2XV0A 4X5RA 3CSBA 3RY6C 4N1EA 3I6LE 5FF6B 3JBG7 4NZUL 5EZLA 2FEEI 3KJ4C 3MODH 3SPVA 1TWFA 2XHNA 3U1QA 4PLJD 4PS3A 2WYIA 2CAKA 5FYKU 7PAZA 1W91A 1FFNA 1MVUA 4WI5A 3ILQD 5T3ZL 2H1LM 2CKBH 2SODB 3LDBB 1E60A 1ZGLB 2OR9L 4YXLH 5JHAA 1MCWW 4AYFA 4BXVA 4ZOEA 4AGLA 4Z5RB 4OD1L 2AJSL 5A7EA 5IMMA 1L7IH 2PO6D 4FQCL 5EULV 2R0KL 4ORGB 4UM9A 1M1XB 1G9MC 2A9AA 1HEZB 5LQBH 1QLRB 3T0XA 4BKSC 1U8PA 2Q7NA 4P9HL 1CG9A 3LEYH 3UBXB 4XPHL 4JG1L 3O8XD 2OMZB 4ZO9A 1IGCH 5BMFH 1JNLH 2PTUA 2UYLA 3KW8A 3M86A 4N28A 1AGBB 3WO4B 3RL1B 2WKGA 3BUBA 1KXHA 3RAJL 3BPOC 2GKIA 3CVDA 1DBBH 3Q9PA 3GXDA 4POUB 3VXOB 4B50A 3I9GL 1NCIA 4NBZB 4JUSA 4YAQB 3OJDB 1Z1WA 3SUKA 1FVDA 3P30H 2BLFA 1RIUH 1CFVL 4V1DE 1KLUB 4C56E 3QQ4B 3ZDXB 4DGVH 1X9UA 4P2QD 2YGNA 2HJFA 3AG2B 1T04A 4Y9CA 3CZFB 1X5IA 3HUJA 4M1CD 4Y5YC 2GBTA 3SDAC 5IQ7L 3ZTEA 4B60A 5ILTH 2CLZA 4YSUA 1Q0XL 2CDEA 4R26H 1HWHB 2NMSA 4OZGB 2DQTL 1NC2B 4HGWB 3NIGB 1CURA 3BJLA 2X2JA 1J9QA 4P07A 5AL8A 3VFUA 3MLPA 3LKPB 4CC0A 1BQLL 3N42B 4Q2ZA 1F8TH 1XD1A 2ATKB 2JTDA 1NM9A 1MI5D 2WXKA 3AMLA 5FOJA 1QSED 4OLVH 2NQDA 1KPRA 2OXGB 3GTGA 3ECUA 1NKGA 5JHLH 3I9AA 4ZUUB 4DTGH 4UMSA 4HWNA 1L8FA 1GC1L 4R90H 4UIMB 3S37X 4JCWA 1OARH 1ZJBA 2BVPB 3PNRB 4S1QL 3T3PB 4XE0A 3GD1C 2BH0A 4MJIE 4N90D 4U6HB 5E2UL 1DQIA 4K9EC 2C1OB 3TBTB 4AGMA 4A2EA 5EEVA 3VMPA 4GBXB 4HQQL 4Y5XA 1TR7A 1KTLA 3PAVA 4H88H 3ZDZE 4GYBA 4Y88A 3IDGB 4KNQA 2DMRA 1XIWA 4JB9H 1GW6A 1AKJA 2VN3A 2WLNA 2X4OA 1S7XB 4XI5C 4XPGH 4ZTOH 4JQVA 1IGJA 3DXAE 5JO5B 1RUML 4EAEA 2B0SL 1R0AH 1AC6A 2LU7A 5FYLL 2VL5B 4RNRA 2OMYA 2OQJB 1EHXA 1FI8C 3QUKA 4X8GA 2GAZA 4LVHB 4JDEA 5FO7B 4CRPA 4Z7IA 5JOPE 1TMOA 1W0VB 4F7EA 1S7UA 3G6JF 4K5OA 1E4KA 1KF9B 4HK0A 5EZOL 3H7BB 4KZDL 3N1QC 1Z66A 4LK4A 1NUDA 2IPUG 4LRIA 4KTEL 2CRMA 2VDQL 5GIRA 3ZVVA 1U3HA 1Y18A 1D5MA 3V0WL 3U0TB 2XTJC 2L8AA 3TH4T 2EICA 1GZPA 4CMHC 3SDAD 1BQHB 1DBKH 4A67A 5HPOA 1W6WA 2XFGB 1KCVL 2Z0UA 3LEVH 3ZDYF 1J88A 2VM4A 4K71B 3ZT7A 1FC1A 5CEZE 1A7OL 1FFPB 3PDOB 3GRGA 1KJ2B 1XH3A 2WXIA 1HHJA 3DECA 4QAMB 5FHAH 4S0TD 1MREL 1MQKH 3BT0A 1JPSL 2XWRA 3AS0A 4QTIH 2BO0A 5IMKA 4HK3J 1WEJL 1T22B 4YPJA 1NJ9A 1AY1L 3W5NA 4GAGH 3QQ7A 3CZGA 5DEJA 3ARGB 5CFAA 2OL3A 2BVYA 3S0PA 3ZTNH 1IRAY 1RJZA 2NY3B 4KUZL 2WBJB 2NNXA 3LH8A 4X6BB 2EKJA 3KPOA 1QBLH 4MA8L 4LL4A 1L6XA 1DO6A 1OCCB 1S7QA 2EJ1A 2WNGA 3LEXA 2C9AA 3CLWA 4FKKA 4X5LA 2J88H 1YQVL 2UWEB 2UY7A 5D5MB 4URKA 1OPGL 1PZ5B 5FA4B 2V5MA 5KVDE 5K9OA 1XB6A 2WUCH 4MXQD 2ICEC 1KYOK 4KQ4L 5GGQL 1IAII 2B1AH 1AQ8A 1KJ3L 1CFNB 1HOEA 1Q4NX 4E2OA 5KN5A 2R1WB 4OZHB 1BXVA 1NC4D 4I9XA 5EZIL 3KEDA 4U3HA 5BV7L 1OSYA 3W5MA 3T0DA 3E6FA 5FX3A 4N9OB 3VFGH 5C9KA 2B4CH 3HZMA 2WLHA 3QEHB 3EBHA 2P5EE 2X6CA 3ZBMA 5I75C 5KW9L 3VRIA 3PL6C 3JWOH 5DD1H 4UAHA 3U46B 2JELH 4OVVA 3JZ7A 4UBDD 1MHEB 5GZNC 2XTJD 3T77A 1J1XH 2F53B 3HC3L 2WTPA 2ZSWA 3F7KA 2VXSL 3D0LB 2KPNA 4U1HA 3H2PA 4L8SC 1UD5A 5B22A 2PO6A 4NZTH 3ZUNC 4AI7A 4Y4FA 5HGDB 4NKIL 3BESR 4C8XA 2WLKA 3QEGH 4NC0B 4GG6E 4ELMA 4U1SA 4LCCA 4PJXB 1YEGL 3WTVA 2EDTA 4KAQH 4ELDA 3LPGA 2WLIA 9CGTA 3HR5A 2MNUA 3Q9QA 3O8XA 5ECJE 4PG2C 3F7QA 3ZRFC 1TQBC 3VWKC 4U7SA 3QQ8A 4DGIL 3UEZA 1I1AC 5J1TC 3L4XA 4YXHL 3EJZC 4M4RA 3DVFA 3AACA 4TQEL 4AL8H 4U1KA 4LVOB 4L48A 1SBSL 1AD9A 4W9IC 1P7QB 4KK6D 3D4CA 4E0RA 3TCTA 5E94B 3S4SA 3WJLC 4Z3JA 1TZAA 2J7LA 1HK6A 4P2QA 1CE6B 3NJFA 4AXWA 2XKNA 4HFWA 5GS0C 3QAZB 2N59A 5E4AA 3DGCR 2IDCA 2VMJA 1C9SA 3N1PC 2E2HA 2D03L 5I8EB 3ROOB 1MJ8H 4O5LH 2ZYSA 1VADA 3BT2L 4GAJH 2VUOA 3RTQD 3VB8A 1JGVL 1WC2A 5GSRB 3NEXA 2APFA 3IJYA 3EBAA 4IJ3B 3CLFH 5EU4B 1K5NA 2QZQA 3MA7B 5JDSA 1MI5A 2YQ2A 1T6BX 1EFXD 4Q6IB 1QSEA 2BNUB 3GSRA 3DSNB 1VLXA 2HJLA 4LNVA 1A1OA 2F2HA 3RY6A 3CU1A 3UPRB 1KXTB 3ILDA 3PL6D 1AGCB 3Q5OA 1N0XH 1NGWA 5A1AA 3O3UN 3OAZK 4Y9FA 5I1JH 3WY4A 2E7CA 5JDJA 2YD0A 2V7NA 3X1EA 3TBVA 4BZ1H 3JWOC 5GZND 5I19H 2EDNA 5DQJA 2ZP8A 5KYXB 3KR3H 5HYEA 5I8OL 3FSAA 1E5AA 1G9ML 43CAB 2Q86A 1S3RA 1NQBA 2W9EH 3CJJA 4GSUA 4N2CA 3TX4A 4LP5A 4L8DB 4YEFA 1YG9A 2ZUYA 1NUFA 4QRUA 2A1WL 4XVTH 1ZD6A 4G7YH 3FU9A 3BSGA 1VDGA 4TSBH 4DVRL 2B20A 3HVDA 1D5BA 1U4EA 4JDVA 4WI0A 5CJ8A 4A7QA 2ZSVA 1KFGA 5D1QE 3VWKD 1KGJA 3HRZB 3N41B 1TJHH 1F90H 1ZT7A 1I1AD 3MRRA 3EJZD 1MUJA 5MEQA 2XA8H 3PHOB 3DETC 4TUJB 5CCHE 3V0HA 4A7UA 2JIMA 2IGFH 4BHUA 3WNJA 2CIIA 5FM8A 3O2VH 1INQA 2ZXQA 3D85D 4GKNB 3SO3C 3CFEA 1MFCH 1UHEA 5CMAB 5DFVC 4LE8A 2XRAL 3OKNB 1P1ZA 1I75A 1O6SA 3C09C 5GS0D 4G8FB 1IQDA 4Y5YA 1USQA 3SDAA 3CN0A 4GUQA 3V2AR 3RRQA 1KB3A 4NAQA 5ISZD 4WQOA 4GXVL 5AB1A 3NACH 4ODXA 2ENSA 3EXLA 5CBEB 4HJ0C 4NKMB 2HZHA 3QXAB 1DLHA 5EN3A 3W1ZA 3K2KA 1P0SE 3OG6B 3N91A 4JGUA 4WW1A 4ABWA 1CGSH 3V0EA 4BE5A 2IV9A 4LZKA 1IMHC 5EU6D 2ETWA 4AJWA 4HPOL 3L3OB 2H2SC 4LLQA 4RISL 2FEEL 1OGAD 3KBFA 3ZL1A 4F8NA 1FL6A 5JW3L 3HC0A 3ECBA 3NJIA 2WXMA 4J3BA 2BS71 3OKOB 5D7IE 4MD0A 3RGVD 4WZ9A 4DSYA 1U8CB 3S36X 1AG0A 3MUHL 4K9EL 3B6SB 1YEDB 5IBUG 1XCQA 1SEQH 1NDTA 3RFZC 2G2NA 5TGBA 4PJ7B 1M1SA 3NGBB 3WO3B 4PRNB 2PCFB 1ZS8A 4U4BA 5HJGA 4ZSOA 1KGUA 3OTTA 5JMRA 1O9WA 2CE6A 4N2DA 1MLBA 4PJ8B 4PSRA 4PREB 2NLJB 1UXSB 4FNRA 4NNPL 2WZ5A 4TVPD 2FL5A 3K2MC 3DIDA 2CBTA 4EXKA 5IY5B 4FNQA 1J8HB 4PRDA 4G1MB 4OJAA 1NC4A 3Q3GB 3JV5A 2DM2A 4N6RB 3BD5A 4PTUB 3DETD 4F57H 2GJ6D 4GPVA 1G7HA 3L3JB 5FW7A 1GYCA 3LJ3A 4R7NB 1SLUA 3S35L 3VFRB 4WUUB 3TZVB 3W37A 1Q16A 2Q9OA 2ORBL 3CXDH 2X9WA 4U1NA 3BWUC 4NQXB 5DFVD 3WHE0 1S9KC 2DH3A 4FG6C 4MMYA 1B0GA 2Q5BA 2WVSA 4RWYL 1M7DB 1OW0C 3CV5A 1RAMA 5I30H 2FJFA 2COQA 4PG9B 1S9WB 4RFEB 1E2WA 1V3MA 3H55A 2KI8A 3MR9B 5INCB 2XZQL 2VPYA 5J57B 2Y5QA 3BC9A 1GR7A 4ZNEE 2EDMA 4LSTL 2ADGA 4A7GF 4GFTB 5F7EH 1I4FA 4NQQA 4N0UE 5L4IA 3O3AB 4YPGA 2DM7A 1W72L 3NP4A 3WTTA 1I1YB 2N7AA 2H2SD 1A6ZB 1JTOA 2XPYA 2L7EA 3BIBX 2R4RH 1W72A 4MYWB 2NTFA 3S5YA 2X2YA 3QUML 4K7PL 2XQBH 5C7ZA 2NOYA 2VCOA 1UWFA 4HAFA 3VXSE 5D2LF 1ZHKA 1P2CB 2DMHA 3FO0H 4N2LA 2X4QB 1YECL 3C8KA 1QSFD 4S0SD 3QUMA 5AZ2L 4W4NA 3AY4C 5ADOL 3ETBJ 5E1IA 4EDWH 5FK9A 1OLZA 1TITA 2CIKB 1H3XA 5GRZA 2ESVE 1B0IA 2O5YH 5CBAA 1IFHL 2WSKA 3H9SD 2HN7B 5F2FA 5D4JA 3ALWA 4X6CB 5H8DA 1JPST 3VGHA 1PYQA 3FB7B 2OP4L 4BFGA 3RTQA 3A23A 1S7SB 2DBJA 1ZT4B 3TA3B 5DJDB 2JKRM 4WI3A 3VMOA 2WKOA 3QHTC 1DVZA 4LPUA 4W6XB 3RJOA 3PG2A 4D8PA 2HRLA 2A4EA 3I50H 5CR1A 3HHRB 1T1XB 5TTRA 4NQSB 5IB3B 2Q6WA 3GMPA 2IQ9H 3PL6A 1C5DB 1EEUA 1L9TA 1ZEAL 1DN2A 4H1LH 2F68X 1T03L 5LGJB 5B1AB 2WOBA 2O30A 5GZNA 3S34H 1ES0A 3MSPA 5IQLA 4TLTA 1Y1UA 1F6FB 1LYQA 3ARDB 2IWFA 5LGYA 3KZ8A 4FQIL 4DKDC 2VSDA 3ULAB 3BYTA 4OV5A 3K74B 1JD9A 3CZUB 4FLOA 4ZS7H 3BKMH 4MAYD 3L13A 3US1A 1R19A 1F3JA 4LNRA 1QLEH 4J2QA 5DLLA 1V3JA 1IBDA 4KNSA 4EDXA 1XGTA 1TIUA 3QJZA 4RGMC 2NRDA 2VN7A 3MJ8A 5F96L 1BBDL 1JPFB 2NTSP 3IJEB 4WUKL 1QDNA 2K45A 3MLYL 3KDPB 3DK0A 3LRKA 4PG2A 4X5QA 3VWKA 4QHKJ 4L4TE 3APMA 1FF5A 1I1AA 2DB8A 1PVHA 1GAFH 3E9TA 4HBQA 2VZOA 1S5IL 1FO0H 1ZPLA 4LEBA 3T3MF 1TEYA 1DYZA 3D85A 5GS0L 1H5BA 4U6TA 2IALA 4HUXA 1M6OB 2KH2B 4GKLA 4RIRB 2VR4A 3WJLA 2BDNH 2MQ0A 3CQQA 2BSDA 2KC0A 2WMPB 3CDCA 3QZWB 1OD9A 3ENEA 4PJEE 3VSVA 1Z9OA 5IHZA 4R0LC 1D2PA 5IGXH 3KPQB 4ADIA 1WBZA 3GNML 3K81A 3ZGHA 3CBKB 5ISZA 4GINA 1E28A 4ZUSA 3HW7A 2HYMA 4NQDD 3BLBA 1IAIL 1M9WA 4PJIA 3UTZA 4BFKA 1EUTA 3M7FB 2EIMB 1MRFH 1OCOB 1T0MA 3DGGA 1L6ZA 1MHPH 3DVIA 1QLFA 2C3VB 3QUZD 4HD5A 1OSPL 1R3IH 5EU6A 5C09E 4F3FB 4NO0B 1G8KA 4FQ2H 4FABH 1KBPA 6FABH 1HEJC 2FX9L 1SYVB 5C2BH 2D7QA 1BOGB 1BP3B 2A6ED 4I89A 4ZMXA 4F8LA 5DU7A 4C56D 1KIPA 3C87A 3B2XA 3GB7A 5ANHA 1MJJB 3DTUB 4PBWD 4D7ZB 4FTVE 2XQYK 1I7ZA 1S7TB 2QR0A 4QOKA 4F27A 1Y6NR 3AY2A 1DR9A 3QXVA 4HUWA 4EQ2A 5T3XE 3KPSE 4KHTH 1A6AA 4U0QB 1RERA 3SGEH 2VR6A 4CSPA 1H3UA 5D7KD 1XF4B 2VH5H 4TVPL 2WGNB 4BRJA 3PF2A 1A7PH 5MP6H 1YAIA 2HLFC 5AKSA 4F33B 4LLUB 1F3RB 4JPVL 1FZJB 4RAVA 4OZ4A 4IHBA 4YDLC 1T4KA 3BP6A 3RVUC 5H4UA 1PD0A 4K73A 5TQ2L 4JLRA 2D2CC 2GJ6A 5JZ7D 3QC6X 2Z3FA 4R7VA 3V95A 2CXKA 5DWPA 5KVEH 2GSIB 2HFTA 5AFAA 3MV8B 2EEAA 2W59A 4KKZA 3RVWC 2A83A 4P04A 4EVNA 1PPYA 1ZTMA 2FWOB 1JV5A 3BPLC 3LN4B 5F7DB 1ZLUH 1Z32X 4WLCA 1DBAL 3N3EA 2Y7QB 4Z7QE 5SWSE 1NBYA 1NUNB 4JVUA 5K1VA 4FG4A 1I53A 4M02A 4A55A 1JDAA 4N8VB 1OAKL 4KGJA 3BP7A 1ZTXE 2BVOB 1Q8MA 3T2LA 3T2OA 4NSKA 4YO0B 2DYPB 2LU5A 5CM1A 4P4KC 3LZLA 4HISA 4LCUA 4LSUH 2EUWA 3BDYL 3RLSA 4IIQB 5JOPD 5GISH 2VDMH 1Y1WA 3X1FA 4R7DA 3H9HA 4WO4D 4J1UB 5LXGL 2ICWI 2LTQB 4YDZA 4CN4A 2A9MH 1QVOA 3BIKB 4JFFD 1G0DA 1WWWX 3OR6B 3RNQA 2XWCA 3C5JA 3GSQB 3V7MA 3RFZA 4N87A 5DEFA 2H26B 4FF9A 5I1AB 1A9BB 4L0ZA 1SDDA 3RIFF 3H9SA 1CBJA 1E6OH 3QWQB 5CEZD 5HHOB 2OZ4L 2ZG2A 2AI0H 2JCCB 5A16B 4OGZA 3P0VH 3VWJC 4DERA 1LD9B 2UZPA 1SMAA 4XOBA 4Y9EA 2OZ4A 3A67L 2HLFD 3QWNA 1FAIL 4X9YA 1DDTA 3SY0B 4HDIB 4WHYH 1MAMH 1IT9H 4DQOH 3DV4B 3PP3H 4ZRGA 3WGVB 2Q87A 5CR8A 3WTUA 2YBRB 4JG9A 2QSCL 1RZ8A 2WJ7A 1L0PA 2Y22A 3GKZA 1P69B 4GRMB 5TE6L 3EOAA 1ETZA 4LQ1A 3QQ3A 5E8EB 3WEAA 3RVWD 3B7RL 4N25A 2PN5A 3ESMA 4JO4L 1OW0A 4PJHA 2AJUH 4NPYB 1GMEA 5ALBH 2BOCA 4UINH 1JWSB 3TBBA 5HDQL 5AVXB 1QQDB 3OF6A 1CR9H 1Q94B 1GGBL 3AQYA 1AYRA 4BBWA 1TUPA 3MFGB 3D69A 2P1YA 3EHBB 1HOCA 4KFMA 3R1GH 4MAYA 4XVJH 3MRMB 1OAQL 4OZFA 6PCYA 3QUXD 1PQZA 3BZFB 5JW4Q 3P3TA 3ARFB 4KX7A 4E9VA 5I1IL 5H35A 4JGMA 4P4KD 2JKXA 5EOCH 1VFBA 4K0OA 4PUBL 4AM0Q 1PLGH 4XWOC 1RHHA 1J7VR 5L4FA 1H15B 1D5XB 1KZYA 2AJXH 3QDJB 3HS9A 3CHQA 4UTBL 3QJTB 2P5ED 1NLDL 5A6LA 2YUVA 4Y5VC 3X2NA 1BJ1H 3LKOB 5HDOA 3WS3A 4PLKD 3RA7H 5IB4A 2VZUA 4OR1A 1ONQB 1UZ6F 1X44A 2QDVA 4UTBA 1XQ4A 2F5AH 1YUHA 1S7RA 5H2BA 3AY4A 1P5UA 4MA1B 4Y8AA 5LWYH 1ICTA 2VLKD 3NRPA 3LIZH 1TZGL 4B0MB 5C0NC 4BJLA 5AVWB 5CJXA 5EPPA 2ADIA 4X8XA 3POCA 4HIQA 1EPFA 4KKRA 2M1KA 4XPBH 2O5ZH 1K4CA 4LDCA 3BO8B 3P9MA 1TU2A 2IH1A 1Y5IA 4JFEB 4FYRA 4J12A 3N55A 4XZUA 1F2XK 3VWJD 2GT9B 1XFPA 3HIZA 2G6GA 3DVNA 4JM2C 4NQDA 2R0WL 2ZUQB 1AAJA 1N5YH 1ZLWH 1WAAE 3WFHA 5KVGH 1IEBA 2BHZA 5PAZA 5FUOL 4K3GA 1A2YB 1SYSB 3FT9A 3J07A 4JL1A 1Y6MR 3QUZA 2CLVB 3TF4A 5CS7A 5IOKA 3FO9A 1FGNL 4ZFOB 5I17A 1OGPA 1ZWIA 5I18L 3IR7A 3IWVA 4ZTPL 1XCTB 2VWEC 3BQVA 2CRZA 3AAZB 2R2BB 4QXTB 4PJDE 1A6WL 3GO1L 1OE3A 2Y6SC 3MBWB 1TYRA 5E2VH 2DJ4A 1SF5A 4E42A 5C08D 1DZBA 2ARJB 3WKPA 1G5AA 4WEBH 3RZCD 1AGFB 4P46B 4FJYA 5JNYB 1MCHA 3IGKA 1HDMA 3AGWA 1TWHA 2A73A 2ZWSA 4XPFL 1OAYL 1E9PB 4APXB 2YSSA 3TO2A 4CSZA 2PKDA 4NRXB 3QHFH 1JGEB 1II4E 1I9JL 4WW2B 5DYIA 5CHNA 4IMLA 3BFWA 5TDOA 4WEUD 5JPNB 1FG9C 1H3GA 3V6FA 4XWOD 1KB5L 4N0RA 5E6RB 3U7AA 3WAJA 5L2JA 1KB5A 3VH8G 1BEYH 3MBXH 5I74B 3PGDA 1U8HB 5I76A 3L3HB 3MPCA 1JZ8A 1BW8A 4L05A 2GHZA 4PV9A 2KHAA 5EOTA 5C0ND 4P5KA 4L4VE 3KLDA 3RWFA 4HALA 1H6TA 5DJXB 4LAQH 1S7WA 2ERJB 5IW6B 3TESA 1RJLB 3GM8A 2ZYHA 4DCQA 1VFOA 5KWYC 3V79C 1DCLA 2FIKB 2K0RA 5KYUA 1JZEA 1FNLA 1SFHA 4N86A 5F9AC 3TN0C 3FUNA 4LCYB 3DX7A 2BSSB 1JFHA 5IHUL 1EEYB 4PGEA 3TNNB 3BUQA 4LGPB 1UKSA 2ZJSL 3FRUA 5BO1L 4BFJA 4AG4H 2A74C 3V6ZB 2MQ3A 1J0IA 3FQWB 5EORH 4KXDA 4MJHA 2RR3A 1BD2E 1NCGA 3OHXA 2Y6SD 4NC1C 5EO9A 2E59A 4LLMB 4YHMH 3GMOB 1XZ0A 3CZLA 4JFFA 1IAIM 4UANA 1QFUH 1RURH 4Q9RH 2D2OA 5SWZB 4H1LA 1C08A 3GIZH 3KPNA 2ZKHH 4P2RB 5CEZL 5F7MC 3RY5A 1LMKA 3ELQA 4I2XB 4OFDA 2D3VA 4IBZA 3DBXA 3LNEA 2CGRL 4BGLA 4PQXA 3ZE2B 4MWFA 1EDHA 4A68A 2A9NL 4TS6A 4N4YB 1SGKA 1DEEB 3VG0H 1RZFH 3IXTB 2VXUL 1UFGA 4GRLC 2ZAHA 3B37A 2X70B 4JBSA 1P4IL 5DJAA 2QKSA 3HE6D 4HQQH 5DRZB 2FECI 2VDKB 3GSNB 3QDMB 1ORQA 4HXAL 5CINL 5FHBH 4BSWA 2G5RA 2ZWNA 3CSGA 1JVOA 4IBSA 2F58H 5IUSA 3OSKA 5IFHH 1RL1A 4M7LH 2XIBA 4ZPVB 3GFUA 3JVFC 1GSMA 5I6NA 1RZQA 2IPTL 4L1TA 1I3RB 4MAUH 3HI5L 2AXFB 2XOTA 2P45B 4XNUH 1R3KA 1JL8A 3RDJA 3V0VB 3GS4A 4OFKA 4XB7A 4P2CG 3CCHB 2P5WB 4MKTA 5DRNA 1DN0B 4RMTA 4JO8A 5KVDL 1AJ7H 5JOFB 4G2AA 2B16A 4UUJA 2J5WA 1WWBX 1TEFA 4D0BA 1XF5A 2EADA 4XO5A 3WNLA 3H85A 2RD0A 3UC2A 1MPAL 2J72A 3SE9H 4BZ2L 4G6KH 2L04A 4HKJA 3QUXA 1DHKA 3TN0D 3I6GA 3U4BL 1UXMA 3R0NA 4DT2A 1SHMA 4HJTA 5D4QA 3VJ6B 3X14A 4A2HA 4M29A 4P4KA 4PJIF 1BIIB 4XMXA 1K2DB 3VI3F 1QZ1A 4GUPA 3IMVA 2HKFL 1D6EA 2P5EA 4TOYL 3DMMB 1Z9PA 5FKPA 5C0JB 4KTDH 4GG8A 3K8KA 3T8MA 3WKNA 4B9PA 3IBEA 2E4TA 3EO9L 3HG3A 4JKPH 4L37B 3BUDA 5EC2B 3ROLB 3VD9A 4KRPB 3V52H 1E32A 3MCYA 2VLKA 4C4UA 1E8XA 3NCBB 4KZ0A 1BJ8A 4K23L 3FTYA 1C16A 3HN8A 1FP5A 1R6VA 3IDJB 5MENB 3S6CA 2BIIA 4WWPA 5E8OB 3X17A 3T8VA 3VWJA 4JDZA 2QL1A 1ULVA 2XNAA 2BY3A 2QFRA 4L1HA 4DZ8B 1F56A 2IADA 3EOTL 3PXLA 4IRZH 1A1MA 3DROB 2R56L 1AGDB 3OKDB 3R7RA 3VXSD 4P23B 3SDXA 1P4LA 2ZKWA 3MKGA 3B5HA 5JHDB 3MV9E 4D0DA 1X7QA 2VDPL 3NT0A 3HJ0A 4LFHD 2QQKH 2ZT9C 1DP0A 2VSKB 3JXAA 1I1FA 3O3EB 4OBRA 5F7BA 3MLSL 5C08A 2DI9A 2ESVD 3UO1H 1N0LA 4GRWE 3RZCA 1FH5L 3O4LE 2CMRL 1QYGL 3VI4A 1XAKA 2JKSA 1BF8A 2D0FA 2ENYA 2OTPA 4LSSH 2IH9A 1Z9SA 5EU3B 3P11H 2AERT 2YHGA 3H0TB 3LPOA 1DVXA 4H7VA 4X4ME 4Y4HB 4XMKL 4N9GA 4TNVF 1RZJH 1WK0A 3MLWL 4ODWA 4PJBE 5EZLB 3SPVB 5BO0D 3NZSA 4FC3E 3UC0L 5IFAL 2XLLA 4ONGL 3US9A 4Y5VA 1FFNB 1MVUB 2YRZA 4BELD 4PIRF 1QHPA 3K1DA 2UZXA 2ICWA 3OLEA 4GO8A 2XN1A 5EUOA 1TNMA 1G1OA 4AYFB 4RFOL 5CN2A 5IMMB 4FFWC 1Z9LA 5SX5H 2J55A 2DKUA 3B9DA 1JZJA 3QYCA 4G7RB 4UM9B 3N6YA 2APWA 4XBEH 3KH4A 5F89A 2NUPA 1CG9B 2FBJH 3U6RA 2LGNA 4LOUC 4MZ3A 1EDYA 4OLUH 4PB0H 5BOJA 2UYLB 3CXFA 4WY7L 2FJGA 2G30A 4LXFA 1F4AA 1H6FA 4JZJA 4L4TD 3VD7A 2ZCZA 2W92A 1NL0L 1AR1D 3EGSA 3GC3A 1IUZA 3NJXA 4JZOA 3L3GA 2QPSA 2GBAA 3MAWA 4HIIA 5CD3A 4XNZB 2HJFB 1B4RA 1FORH 1T04B 1MCPL 4PCSA 3ARRA 3NJLA 3HUJB 2VUMA 3H54A 4TQIA 4HP5A 2KS0A 3MOBH 3MLVH 4AEFA 2OAAA 1MFAL 2VRAA 2CLZB 5FYKD 2WD0A 3WIAA 2CDEB 3PS6A 2Z6FA 1LHZA 2BZ7A 3VFMA 2HLEB 4LCIL 2E6JA 2FH6A 5DS2A 4M5YH 5TPWH 4HX1A 4M5SA 3VFUB 3LD8C 3QZBA 4Q2ZB 4U7KA 4U33A 4OJFL 4U3XA 2FT8A 4OKVA 1KPRB 4X9BA 4YGVA 5ETUA 4PYHA 5A6MA 3MRDA 1B2YA 1NLBL 4U0RC 5C09D 5EDSA 3FN0H 3HE6A 3QVAA 1J11A 1CI5A 4Y9GA 1NA8A 1X5ZA 4BM7A 1CXFA 5DVNA 4MB1A 1CLZL 3G3LA 4OLYH 4CVWA 2EVIA 3PWVA 2XWXA 5D7IA 3QG7L 4OKDA 1FDOA 2NXZB 3OKMA 1SXNA 4Y5XB 3ZYZA 4TPRL 4NYLA 1KTLB 4QRPE 4FFWD 1SVCP 4R84A 3AC0A 1CF8L 3FOMA 4HS8L 2OMXA 3FUFA 1XIWB 1K3ZA 5T3XD 5CN3A 5AWNL 3BKJL 4RVBA 2OMUA 3GTKA 1HE7A 3KPSD 1AKJB 2X4OB 1HIML 2KDYA 5GGSA 4Z7NE 2F8OA 2WZAA 1IGJB 3KPPA 5D1XC 4J7RA 5E4EB 5AW7B 1QPXA 5A2FA 3P02A 5I1HL 2A4CA 2G3XA 3G5ZA 4RNRB 1E4WL 1NICA 2XVBA 2Y1YA 3QUKB 5HVHC 2GAZB 4IOSD 1T3FA 2Y2WA 1TLKA 2ZCLL 3LH2L 5F9OH 4HJUA 4UQEA 5HDBB 3DMRA 4K5PA 3TN0A 3L1OH 1IFGA 1NFAA 1S7UB 4F7EB 1B2WH 4HK0B 4XAWL 1ZDSA 3W2DL 5B4MC 4LARH 1MCEA 2A74A 3VSTA 3W9DA 5KVFL 1GZHC 5GIRB 1IX2A 1EQWA 1U3HB 1Y18B 1D5MB 3ZYJA 3WJMA 5IJCC 1UATA 4KJPD 5GGTH 2WLZA 1BFOA 1GZPB 4HKZA 5I1LA 2VDQB 3WXVL 1ZOXA 3QWOA 2LT9A 5ESVA 1E3ZA 1OK8A 5LN8A 2ZIDA 4FFZL 1XH3B 2DLEA 3B83A 4J23A 1HHJB 2EZ0C 5SWSD 3WLWC 4U1LA 3V4PL 4ZNEA 2X53A 3T2PA 1OO2A 2GABA 4FFZA 5B7EA 4ENED 3VTAA 1ET8A 1UT1A 5IMKB 1FN4A 1NJ9B 2VLME 3KG5A 3V4PA 2X1OA 4GRLA 3T3MB 3P3SA 4IIZA 4BKLA 2OL3B 4QXVA 4YQXH 1QATA 4P5TC 1RJZB 4OFIA 4WFED 1A6UL 4IKIA 2I9LA 4L0YA 5B39A 1J1PH 4QXUH 3UCRA 3VXSA 2E2IA 3KPOB 3D5OF 3HB3B 4OIIH 2A9CA 1AHWC 1S7QB 4IU2A 2UY7B 4UOZA 5EF1A 2ESVA 2ED8A 5AOLA 2EINB 4JFZL 3WENA 5K9OB 1EAPA 1I7TA 4UQDA 3VQMA 3IVKA 4YN3A 5F7HA 4QYOA 3ARVA 2X1XR 1Y6KR 3FTWA 3BRDA 4HKXA 1I8UA 5KN5B 5MI0C 3ZDZF 2W5PA 2FJUB 4D3CL 1B9KA 1U0QA 4JQIH 3E6FB 3PFQA 4DK5A 3HZMB 3CH1A 5C92A 1W0WA 2DLGA 2GAEA 2NCMA 3VRIB 5BV7B 2D7TL 4LOVA 4DK3A 5I8KH 3IFLL 5CP3H 1ADQH 4ZXBC 1A8JH 1S9VA 3MLZH 4X6FA 4UWQB 2L3BA 2IAND 3B9AA 4JAMA 4UIKH 3T77B 3RVTC 1XGQA 1YEJL 3HFFA 3EJUA 4NNXA 2CQVA 2ZSWB 2DY2A 4U1HB 3VD0A 5GJTH 3C6SA 2PO6B 4JPWL 4L1BA 4OH2A 4Y4FB 2WVVA 4HV8A 4TF4A 1D5IL 1UWYA 3U7WH 3RIAF 4ELMB 4U1SB 4EUPG 2UVFA 4LCCB 5HP5A 4U6VL 2OJEA 2WLIB 1MCBA 3HR5B 1T6VN 1PZDA 3O8XB 4PCYA 3ZDXE 2BHYA 2DD8H 2G3ZA 3L5XH 5CILL 3QE5A 6PAZA 3P1VA 4WWOA 2JJWA 3LS5H 3CE1A 5J13C 2FECL 4M4RB 4CC1A 4R97C 2EDEA 4U1KB 3JT2A 1AD9B 3HG5A 4M5ZL 5CJQH 3TWYA 4L4TA 4E0RB 4BFFA 5M95B 2DQGH 4EI5C 3S4SB 4NO3A 4P2QB 3MLTA 4AXWB 3MJGX 3B1UA 2XKNB 3HOGA 4HFWB 4CRYG 5FYKL 2ZPKH 5AYQA 4AKQA 2APSA 3LN9A 2JMRA 1WUZA 1IVLA 2YARA 3EYSH 1VADB 4K3EL 4U3SA 1XF2A 1S9XA 2WJ5A 4PJEA 5GHWL 3O4OC 2Y6TE 2Y7OA 3IJYB 4MS8C 5CLXA 1JNHA 2G2RA 1DANT 1EO7A 1K5NB 5JDSB 4HJJH 2GB2A 1MI5B 1R17A 1QSEB 1NFIA 5TQ0L 3GSRB 4JVPA 2PCYA 4GMSL 2HJLB 3I9IA 1A1OB 2DICA 2NDGA 1SLXA 3KJ4B 1NGWB 4TUUA 2ZOUA 4HIHA 4NZ8A 2HMIC 3SBWA 3T2NL 1CXHA 4X7FC 1TDQA 2IAMC 4YS4A 5B1KA 4PLNC 2V7NB 4XAKE 5JQIB 3TBVB 1JPGA 1U8QA 1ML0A 4ZFGH 5TE7H 3R18A 5CLTA 2ROXA 5DQJB 2DDQH 3HMXL 4NWUL 2X3CA 1C1EL 2CJSA 4OCWL 5E8DL 5T3XL 2GTZA 4J3OF 1BFTA 2XY2A 1BBDH 1BECA 1K83A 3ISYA 1ET7A 3OXRA 4L4JA 2Q86B 3UZVA 4JR9L 4EIUA 3HMXA 1FNSL 5BW7C 1EHLL 2OW6A 3Q0HA 1MIML 5LBSL 1MRCL 3KPSA 4QRUB 3Q8EA 2HAZA 5J1AA 1ZLSH 1NIAA 4KRMB 1DBJH 3U79A 1MCQA 4WI0B 1D5BB 5LBSA 4JDVB 3BCDA 4GSRA 2ZSVB 5FCUL 4GSDH 4F2FA 3STZA 4Z3EA 1MCLA 1ZT7B 4G70B 3EZ8A 3PPSA 4IOSA 2OFQA 3MRRB 1MUJB 5MEQB 1MOEA 4GEJA 2H2PC 3BPOB 3FHQA 2XQYG 3VX0A 4GG6F 2CIIB 5D6CA 1VEPA 5L4JA 1GYWA 1INQB 1U8JB 2G4EA 3CFEB 3HS8A 4EI5D 4WJG3 2BP8A 4JFHE 1X4XA 2DTMH 1P1ZB 5B1BB 2E9GA 2R92A 1F1AA 1O6SB 4M6ML 2BP5M 4Z7OE 1UM5L 2FQEA 2IQAA 1IQDB 4Y5YB 3C60C 1W2KT 1H3PL 4X0NA 3SDAB 3WFDH 3HPJA 4P59L 1YYML 1U2HA 4OGAC 4WTZG 5BRQA 3UTTA 5JORA 1HTYA 1AXTH 4L4VD 4ODXB 2WUBH 1WAEA 3MCLL 4MNGA 5FAAA 1X5AA 3F65A 3WTWA 3FTSA 1DLHB 4MS8D 5SWSA 3WY3A 2E27L 2BIOA 2FQGA 4JQXC 4DWHA 4WW1B 2E47A 3B7SA 2NSMA 1QBBA 4FQ1H 4JFUA 4IMKC 1NMAL 5MHSD 1OPOA 3DYMA 4LLQB 3V0DA 4ZNCD 5I15H 4ZO7A 1JZ2A 3QIUC 1A7QH 1TCRA 2EE6A 3PJNA 4OBSA 5JIDA 3X2LA 4XC3L 5IVNA 4LQFH 4NUQA 1FL6B 2ZNXA 4U1IA 5C0BD 3HC0B 2DMCA 3ECBB 2UWEE 3ULUH 2IAMD 4MD0B 4Z77A 4XPTL 3L1FA 5C8JA 5E0QA 4HIXL 3GMLA 1XCQB 1BD2D 4DO5A 1JYNA 3S8GB 1XSIA 1T20A 3IDIA 2P43B 1AVAA 2WYHA 5TGBB 2AJYH 1JHKH 3O41A 4FN0A 4OZHE 1HE8A 2OR8A 1KGCE 2DL2A 1LM8V 1ZS8B 3K80A 5EPMB 5GZOD 4ZSOB 1J9RA 2NSQA 1PX3A 3SPCA 1DUZA 1MLBB 4U2YA 3WUWA 5AG9A 1S5HA 2FL5B 4PW3A 5GGVL 4Q0XH 4PRDB 5HTSA 1KIUA 3SYPA 1NC4B 1FQ9C 3H3PL 4FYSA 2F53E 4I3GA 4PGBA 3LAFA 3KYNA 4AZDA 1G7HB 4HPYL 4M7JH 3ZW3A 2ZKXA 1OEZW 3DIVA 1ZHLA 4PRPD 3LNFA 3QPXH 2J57A 3GINA 2Q3AA 3U9PH 4U1NB 3B43A 3HAEG 1SQ2N 3AXIA 4MMYB 1B0GB 1GZHA 2OBGA 4AENA 4C57C 3HU3A 2IANA 1RULH 5D8JH 2XTJB 2QLVB 2FJFB 4YDNA 3C60D 4PJXE 4AYID 1QABA 2YAPA 4Y4KC 4CMHB 1CU4H 4IRJC 5B38A 2QDWA 4AJYV 4WWKC 3L6FA 2VITA 3KXFE 2ADGB 4G6ML 4XP1H 1P4BH 2ICES 5FGBC 1G7MA 1I4FB 3KWUA 3ZT6A 5I9QC 4YDKL 1FA4A 2PYED 4YPGB 4YHZH 4Y8DC 3QEQD 1NEPA 1Q1JH 2ATPA 1QSVA 1HCZA 3NA4A 1KTJA 3UO8B 2P47B 1NH6A 3IF1A 1W72B 3QIUD 1AE6H 5EBGA 2OPCA 4ZJ9A 4DP8X 5ID0A 3PJSA 4GNKB 2XZCH 2LV4A 4S1RL 1ZHKB 4HKBA 2DYSB 3C8KB 5BZDA 1O7SA 3QUMB 4I8DA 2YXMA 5DHDA 1PX8A 1LTXA 2AP2A 2BP3A 2ZXEB 3UMTA 4GH7B 3ULUC 1SM3L 5F7YC 1JPTL 1N5AA 5FK9B 4YHKH 3L5WA 4KJWC 3ZIMA 3AZUA 5CBAB 3HBGA 4ZZFA 1QPPA 2G75A 5D7IF 1IC5L 3FBKA 3I85A 3QCTH 4KX8A 4F8TA 2HKAA 1OOAA 3RTQB 4LIQE 3FQRA 1JZDC 1Z6JT 4X42A 4EQ3A 4X0KA 2BRRH 1ZLDA 3EH3B 4U1JA 3SKUD 1R3LA 4HYTB 5F7KC 2Q76A 4DFHA 3N0PB 1UASA 4O02H 1KCUL 4Z8FH 4KKQA 2HH0L 4D8PB 1GCYA 1WAAA 5E00A 2ZOKA 1O6TA 5I75B 4ZUVA 3GMPB 2Q6WB 4CA4A 3I84A 3PL6B 1XMWA 2CGYA 1KIRA 3RHWK 1S3KH 4MJJA 2HX7A 3DYOA 3K2UL 2FUQA 1C8PA 2BZCA 1LO0H 4HC1H 4O4YL 4KMQA 3T0WA 1OLLA 2YXVA 5FECA 1M2VA 4JY5H 4K3JL 1ES0B 3KS0J 5IVZA 4Y4KD 2VJ0A 3FU8A 5F6IC 5FCSH 1IV8A 5DRXA 5DSCA 1K8DA 1I7RA 1KPVA 1QBAA 4WWKD 4OV5B 4YX2H 5JPMC 5IVXA 1A14H 3WBDA 5BOZG 1F3JB 1SNRA 3IWUA 2FNWA 1G9HA 2WPGA 4LNRB 5DMIH 5AUMA 3KLLA 2RAMA 3SEPA 4POZC 4EDXB 2ZZUT 1MEXH 1XGTB 3MHZA 2FYYA 1BHGA 1MCJA 3MJ8B 3WEXA 1RLWA 1KCBA 1OANA 2SEBA 1UD3A 1JRHI 1P6AB 2W94A 1TQBB 3VWKB 1P84K 1NGPH 3ZRSA 3F00A 5K1JA 1I1AB 3IMSA 4DN4H 4LF3A 4OI8A 2CBOA 3ARQA 2OMVA 4ZTEA 2JQMA 4MKMA 4F2MA 3D85B 5J6HA 1H5BB 4UT6L 3FH8A 2DLHA 2JFCA 3UJIL 3GI9L 2RJMA 2IALB 4EI5A 4HUXB 1QPKA 5CGYC 2CO2A 4KJWD 5KSUA 2R8SL 4UT6A 1U6AL 4S1DD 2JCWA 4N3UA 4HWEH 1FRGL 1VZGA 3BN9C 5IHZB 1CDYA 5DK0A 4RSYA 3TONA 1WBZB 3KL5A 1YLBB 5ISZB 1BQ5A 1E28B 3QI9C 4ZUSB 4BK5C 3A21A 3DTXA 3UTZB 4PJIB 1HZHL 3FDWA 4X8CA 4N0FA 5I6OA 1T0MB 3Q13A 1H8SA 4JGJA 3UG5A 3DGGB 5C3LD 1KEGL 5EU6B 1QLFB 5D1ZI 1YNTF 5HSFA 2EH7H 5LUMA 2XT1B 1BFVL 4PJ7E 5DGRA 4QRBA 4HG4J 4FQXD 3NABH 4M7LT 2YLKA 4JQIA 1UYWH 4NQCB 5C0BA 2DLFH 4OD2A 4ZUWB 2QVFB 5CWSA 4JNXA 3ZLQC 2FHBA 5I71B 4I9WD 1AIZA 2IAMA 4IBUA 1KIPB 1MFEH 4OCRL 5AZEH 1E27A 3D87B 3ET9F 3GB7B 5T1MA 1BD2A 2Q0ZX 1L4IA 2G5BA 3MJ9H 3QUYC 1JF1A 5F1OB 5CP3A 1ADQA 1I7ZB 2YRBA 1DVFC 2QR0B 4QOKB 1MXDA 1PGRB 2DQIL 2N7BA 5GRUH 1QNZH 1U91A 3A4DA 4HUWB 4EPSA 3X2QB 3DPDA 1A6AB 1T7WA 5GZOA 1IM3A 4M62H 2OMBA 3JWDL 4WFGE 4AM0A 3O6LL 4G7QB 5KBDA 3OVUB 2V5SA 5FDWA 4FTDA 5JIPA 1TQWA 3P9LA 1U36A 2HLAA 2Z7WA 4POZD 4WUUE 1W9XA 1QBML 2BFVL 4RAVB 4OZ4B 4PB9H 3QRFM 3QZNA 1T4KB 1JSYA 3BP6B 1PT1A 3C2AL 2JJSC 3RURA 3FQ1A 2CH8A 3DURA 2P48B 4JLRB 2GJ6B 3Q44A 1XO8A 1DJYA 3Q2WA 3SO3B 5G2NA 2OLDA 4PRPA 4OF8A 3UDWC 2C4FU 4DOHE 1YRKA 1TLMA 2A83B 3AABA 4DJMA 2Y36H 4EVNB 5EN2A 1QWUA 1JV5B 4UV4L 1ZHBA 4OD3H 1QR1A 3C60A 3PAZA 2AQ2A 4QRPD 5KBMA 1ZS2A 3TYFA 1NBYB 4HH8A 4QTFA 3TYGH 1IILE 4GS7C 1OCRB 1FL5A 2QTEA 2VQTA 4HOXA 2GCYA 1KG0A 1TZIA 1MW1A 2MFNA 3BP7B 3SO5A 3KH3A 1OT2A 4JQXA 1BQSA 2PYEA 4KJQD 1YNJD 3HHMA 3QEQA 4NSKB 2H32A 4PJEF 4HJSA 1IGFH 2JKLA 4LCUB 3TT3H 4PVBA 1IIKA 1WE5A 3GJFA 1HHKA 2AK1L 1RZKC 3ZRCC 3TJEH 4R7DB 3QIUA 2RALA 5D1ZC 3H9HB 1N6QL 3K6OA 4LPXA 1QFWI 3TH2T 4HWBL 1CXIA 4E68A 1DMSA 4X6CE 2X6UA 1QVOB 4PP1C 4HWBA 3S8WA 4E9RA 4LSRL 3QUYD 1JTTA 3RNQB 3C5JB 1X7SA 5KSAD 5DZNA 4CRZA 1ITCA 5DEFB 3D0VA 3RP1A 3RFZB 4XN8A 4YZFE 5G4NA 3V6OC 1SDDB 2DJSA 5DDHA 3KL0A 3H9SB 4XX1E 4AH2A 2E8ZA 4K4KA 1KN2H 5L6YH 1BG1A 2NZIA 1OZTG 2OMNA 2A5UA 2R9HC 4GI9A 1ZA3A 5BVPL 4AWJC 1CLOL 1OA7A 1AZCA 3L7EA 1ACYL 5DO8A 3AM8C 3V0GA 3C8DA 1E65A 3PUCA 2CPUA 4UB0L 5HYJD 4J39A 3A4FA 1RZ8B 1OOWA 2PMZA 1ZE3H 3BUIA 4RGOH 4Z0BL 1LVEA 2D7NA 4F8PA 1GSKA 1M3IA 1IC4L 3E2HC 4NFCA 3EOAB 1FJ1A 1ETZB 2Y7NA 3SKNA 4HUNB 1CUOA 1ROWA 4OLWH 4ZD3L 5FYJU 3T0EC 3QQ3B 1M42A 2C7UA 3LYRA 4CBZA 1D3CA 1NCBL 4N8CL 3DHMA 2NT0A 1L9NA 3LZNA 4KXBA 1J5HA 4UDTA 4IOFC 4P3CL 3QPQD 4H8VA 1DBML 3GLZA 4LOEA 4PJHB 5CU9A 1L6PA 3NDZE 1BVLA 2BOCB 4Y4KA 1WO2A 3V9CA 3VYPA 1SXAA 2J73A 1H3VA 2QMKA 3FFCE 3CH8A 4GW1A 4WWKA 3D69B 4J3OH 1HOCB 2WP3O 4MAYB 4NOBA 5FGBA 4KDVA 3KJ6H 4OZFB 1BZ8A 1PQZB 3FOLA 2D7PA 3ARZA 5H35B 3OR7A 4QT5A 3SQBA 3NJGA 1VFBB 1XL4A 4WU5A 4Z7QF 4EIGB 3H6JA 5IJBC 1RHHB 4AVJA 1J18A 4UNTA 2FX8L 1KV7A 3IS1X 4G8GE 1WLFA 2BNQD 2Z8WC 4R4FH 3CFIC 2DLIA 2OM5A 3EO1A 3WS3B 4FNUA 4I7ZC 3MOAH 5IB4B 4FYQA 4LVNC 1E5CA 5DK3A 3PAYA 5L7XH 1YUHB 1S7RB 5H2BB 1AI1H 1HYSD 2X1QA 5HHXH 1U42A 1AZRA 1P5UB 1QRNE 2M26A 3X13A 4LSPH 4L3CA 1NBVL 2ADIB 4TYUA 2QQNH 1KCRH 3F04A 2Y06H 4IJTA 3KD4A 2KI6A 4OLEA 5AEAA 3EDDA 3RPKA 5DVLA 4F20A 1K4CB 1OAUH 3P9MB 4XPAL 3FN3A 1TU2B 1I8AA 2IH1B 1IO4C 3MYJA 4Z76A 1SXSA 35C8L 4XZUB 1A1NA 4JN2A 2R9HD 5FFGA 2JKIS 3BKYH 3DVNB 3F05A 5DUBA 2ZKMX 4NQDB 4YVUA 2HB0A 2KMWA 1UTDA 3QR2A 3WFHB 3CVCA 5L88H 1IEBB 2AXJA 3NEEA 1N12A 2YD9A 4FQLL 3QUZB 4HHAA 2BFGA 3FO9B 5I17B 1ZWIB 1DSFH 1HINH 4FQXA 4XX5A 3U7YL 1BYPA 4ODTH 4LPTA 2Z7YA 1OM3H 2H47C 5BOPA 1N7ML 4IOFD 4XGZA 1UJTA 4E42B 3RKPA 3GBNL 4FMVA 1AGEA 1WBYB 4QNPE 3P4OA 4XP9L 3WS6A 4FERA 4DFIA 3OV6A 1HDMB 3PLYA 5F0JB 2A73B 2K70A 2QHLA 3BPCA 3Q1EA 2K9FB 2FE0A 3NK3A 2HCZX 5JPMA 2YK1H 5KEZA 4OSUH 3QCUL 2YSSB 3TO2B 2I7SA 4KKLC 1NMBH 1PL3A 4HJEA 2VC2L 2EIBA 1D6VH 1E7UA 1HHIA 1TEGA 4BH8A 3TIWA 1GIGH 2JVUA 4R6UA 5CHNB 1WCBA 4IMLB 5TDOB 4L18A 2IH3A 3V6FB 2VO8A 2APBA 2ZCHL 3OSVA 3AREC 1V10A 3SOTA 3WTXA 1OWRM 1TZHA 3LVTA 4R4NC 4Q9QL 2DQHH 5FWQA 1KB5B 5L2JB 3BKCL 4KJYA 2X89D 4OFQA 3PGDB 1SY6H 2EIZA 1CFMA 2H1PH 2N3JA 5E5LA 3APNA 4XAKD 4YHLH 3REVA 5I76B 2ZAIA 3F58H 3V6BR 3Q6GH 2FH8A 3EGDA 5KBLA 3CD4A 3JUZA 5IQOA 5AOJA 5EOTB 5I1EL 3OPZL 2WNWA 3TNMA 3OL2A 15C8L 4F15C 2VOTA 3GHEL 4P5KB 2J44A 3VG9C 3K0YA 1CF1A 1XD0A 4QRPA 4MB5A 2D3NA 4M6NH 4XWGL 3RWFB 3VRLE 5C0RL 2I9TA 1S7WB 1NWPA 2M8XA 2W9LA 4CN6A 2ED9A 3Q8CA 4DCQB 5C97A 3ULVH 5AKVA 3ARTA 5KYUB 4GXUM 2EXSA 4OF6A 4Z95L 3MV01 4GJTB 2XU9A 1T7YA 3DX7B 2F5BH 4PGEB 1M7IA 5JMOC 4PVNA 3FRUB 3U83A 5K5YA 1RKRA 3LHPH 1B4JL 2OXHA 4O02A 1ID5I 3CMOH 3X3FH 5HHOE 3OHXB 1KACB 5EO9B 1WAAF 1XX9C 4ZYKA 2JCCE 1XZ0B 1FNGA 4JFFB 2UXVA 3WHE1 1F97A 2FR4A 1TOXA 1EAOA 5IFJA 3QUYA 3H56A 4H1LB 1C08B 2AEOA 3KPNB 5KSAA 1YO4A 5EO0A 3RJQB 3DBXB 1RZPA 1IBYA 1X5HA 4K8RC 4X80H 4PJDF 2GPZA 2A0LC 3MGTA 3EKCA 4MWFB 4XC1L 1T2QH 3UYOD 3N1MC 4HS6A 5AVYB 4X9IA 4DP1X 1HAUA 4H5SA 4YDJA 2V9UA 1JRHL 4H0LC 5DJAB 4QRQA 4K3DL 4YDLB 1ORQB 1BM3L 2X44D 5HYJA 4BSWB 4R4ND 1J5OL 4QI3A 1F2QA 3E3QE 2FX7L 3B2MA 3V4UL 4XMPH 3CN2A 1CK0H 2Z93A 4M1GH 1VKXA 1LEGA 2FB4L 2BVQA 3D2TA 1WIOA 4PYGA 1R3KB 3FB6A 4L23A 2EYSA 4DN3L 5HVFB 3BPLB 3EFDH 1HJCA 3QR1A 5KJ4A 1JXKA 1KGCD 5DRNB 5GGRA 2P9RA 5E2TL 3NCXA 3Q8FA 4UUJB 3ARPA 5DZ9A 3WFCH 4KHXL 4D0BB 1XF5B 4CADA 1E4XI 4ZO8A 2PYFA 1G0YR 3U0WH 1HWGB 2DJMA 2ZOTA 2XYCA 4P2OC 4EKJA 5JHMA 2B1HH 5CZKA 4HKJB 1WA0X 3QUXB 1CD8A 2DQFA 3I6GB 1RZKL 1G8JA 5J06A 3ULVC 1OVZA 2CJTA 2FLRT 4P4KB 5AAMA 2VPWA 1Q9LA 1RI8A 1DE4A 2F53D 4NJAH 4NPJA 4WCYL 4Y1SA 4GUPB 2BNQA 5D1ZA 1EU1A 1D6EB 2P5EB 1FV1A 4UT7H 3PU7A 1OSZA 2NAPA 1NIFA 4MQTB 1J0YA 5BRZD 1Z9NA 5FKPB 3TM7B 1E50A 3BP5A 4GG8B 3ARBC 1XCXA 4NP9A 4JFEE 4XVOA 3K5SA 4UTAL 3VGFA 4BA8A 2BVEA 1UOVA 3DIFA 2K3TA 5CEYA 3ZGIA 2IDUA 2VLKB 1BZOA 4UTAA 5D72L 3D3VE 5CAYB 4HUUA 4X5XA 4QKTA 3LQAH 2FIRT 3GI8L 4K8RD 1C16B 5KYYA 1KOAA 1P5VA 3KXFD 2KQAA 1TTAA 1OWWA 3NJVA 4NZRL 3RL1A 3S35X 4JG5A 2OKMA 3VWJB 2IBBA 5LHDA 2VZ3A 2O5XH 4KK8C 1C5BH 3FCGA 4RRPA 1GKEA 1U8IA 1RU9H 2YPLA 4JO3H 4OQTL 3RWIA 2XNAB 3AM8A 4YSOA 2LU3A 4L2YA 1F5WA 2IADB 3PWPA 2PR4H 2XICA 2VXTH 2XWTA 1A1MB 1Q38A 4Y1AD 1JZGA 4OQTA 2EDFA 4HAGA 1QG3A 3SDXB 1P4LB 1BVNP 2VZTA 4OU3A 3VSQA 1E90A 4I0PC 4YDIL 4D0DB 4LASH 1T0OA 1X7QB 3DJ9A 1F1GA 4XB8A 1G9NH 4TQPA 4FADA 3J27A 5CUSL 5I1DA 2VKXA 3WE6B 3TVMC 1I1FB 3H1ZA 5C08B 2VDPB 1INDL 1N0LB 3RZCB 1H6UA 2AAVA 4ODSH 5ESQA 5BUPA 2NY6D 3VI4B 1TNNA 5CZRA 1ADWA 5DLMH 5E6SB 4BFIA 4HSQA 1XH1A 4AEHL 3BVNA 1Z9SB 4QRRD 5SX4H 4XNQA 5E9NA 5KAQF 4H8HA 1XBRA 1AW8B 2BMKA 3RB5A 1R3HA 1R33A 4OLXH 3TASA 1UOLA 4N9GB 2G60H 4ODWB 4M03A 5IB1A 2AJ3A 1PQHA 1K6QH 1QFWL 3IE4A 3AU1A 4X7DC 4Y5VB 2F19H 4DKEH 2Y4SA 3P2DA 2JI2A 2ZUVA 5E8PA 4GQRA 3ARBD 1DQDH 5GS2H 2FT6A 2UZXB 2ICWB 1PG7L 25C8L 3GMNA 1Q1PA 3ETSA 4GFXA 5EUOB 2XC8A 2QADC 4KDTA 5JO5A 5DC0A 2ED7A 3GKWL 2EO9A 3SCMC 1FZOA 2C7FA 2X2HA 3MRQA 3IR6A 4X7CC 1TKWA 1SXBA 5F89B 2NUPB 5HHNA 4B7LA 3TURA 4HMEA 3U6RB 5DQDL 3VW3L 3ESUF 4APQC 2NNAA 2MKWA 2XDHA 2FJGB 3L9RA 2VUYA 1MCIA 2LW3A 4JZJB 3O6KH 5SWZE 2Y5TA 2M2DA 3PHQA 4NM4L 5F7LB 4P2RE 4ATTA 4LRNL 5IREA 1PNCA 4MDIA 3EGSB 1QEXA 4JPKH 1KJ2L 3BVDB 2D0GA 3L3GB 4JZOB 5I23A 4HIIB 5CD3B 1OTUD 1X5XA 1A21A 3ZE2E 5TE4L 4MLSA 1ZXQA 1V55B 3MUUA 5T5FH 4YOKA 1YJDH 3W9EA 1T89C 1WPCA 2YGPA 5TJWK 3OB0K 1G9NC 2BSBA 2TSBA 3Q8AA 3B9KC 1YMHA 3VFMB 5HVWA 3BAEH 4JDTL 1YA5A 4HX1B 3QDME 3P77A 4IOIA 3R8QA 3NRFA 3U1SH 2H8PA 5FO9A 3P69A 3K6SA 4B53A 4F24A 1EX0A 4OKVB 4NGHL 2HFGL 4YGVB 5ETUB 5D96C 4YSTA 4GRWF 1R5IA 4OJDH 2AE0X 3MRDB 2GSGA 2R0LL 3ABLB 3CN4A 3HE6B 4GA6A 4AGPA 2GK2A 4BFEA 3CZJA 4N8VG 4F58L 4TULL 4V33A 2Q3XA 2IWKA 2P5WE 1GOGA 3PWVB 4KQ3L 1I8IA 5D7IB 4YDMA 2J4WH 1PMYA 5I1CL 3OKMB 4PJBF 3O6FD 1MFNA 4PJ8D 5C18A 4NYLB 3D9AH 5IHWA 4DEWA 4QHUA 5F0PB 4PRHE 1B4LA 2EEBA 3FOMB 3FO2A 2OMXB 2WXGA 1BGXL 5I5IA 3KDMA 1SJXA 2KYIA 3SCMD 4HXBL 4BD4A 2UV3A 2OMUB 4UYPA 1RMFL 5GGSB 3W3BA 4DKFL 1TTUA 3NCCB 3L5JA 3KPPB 1HSAA 4PS7A 1M56B 4WFGD 4XCFL 1AD0A 5EWIL 3G5ZB 1OGTA 5IEHA 3QFDA 1G4RA 5E6UB 4RAHA 4E5XG 1CDGA 1ZJAA 5I28A 5I0DA 1T3FB 4PJ9D 4ANWA 2LR4A 4APQD 3TN0B 2IDSA 4LCVA 2HP4A 3HZVA 1CZ8L 2QFPA 5AVRB 1XCWA 2A74B 4RMWA 5FTNA 2L4OA 3H6AA 3W9DB 1GCFA 2BHUA 3GDCA 1LK3H 2GJZB 3WJMB 2VZSA 1NCNA 5BRZA 1BFOB 2G0LA 1ZTXH 4HKZB 5I1LB 2PJHB 5MENE 1YNKL 3FFOA 3QWOB 3BISA 1PX4A 5ESVB 3I3BA 1PQFA 2NDFA 4K8RL 1TQSA 2CRYA 3VXPA 1CDHA 2VDRH 1WC7A 4GSXA 3B9KD 2OX5A 4ACTA 5BCAA 3CK0H 4FFTA 4XC3H 4I1NB 4U1LB 2ZYIA 2EDBA 4UQIM 3FPYA 3KXFA 3ZMNA 4NCDA 1FN4B 2XZAL 3V4PB 2AQRA 1SBBA 2WIIA 1VC3B 5F7WC 1QP1A 2O5NA 4GRLB 1K4DA 4KDWA 5E03A 4BKLB 5LG6A 4JRXD 3OMNB 1X5FA 2G9HA 4PV1C 5DUML 3MLUH 4NP4H 5H4ZA 4FG2A 2VUKA 4Y1AA 2I9LB 5B39B 1E4JA 3KWVA 4GAFB 5DJ6A 5F1KC 1YCSA 3VXSB 3H42H 5HY9A 2G5DA 3F2LA 4ZOBA 4ZW3A 3BQUC 1G0XA 1REIA 1A47A 1HI6A 3V4VH 2H0PA 3A3YB 4YL4A 3D1MC 5GS2D 1W16A 4IU2B 5B1CA 3HFML 3RWEA 3VFWA 5HXMA 4YDVA 2YKLH 2J1ZA 2ESVB 4MQ7A 4HUVA 4D9LH 2XN2A 3S48A 2IXQA 4MB4A 2O6CA 4HT1H 1EAPB 1I7TB 4D9RE 3IVKB 2X0WA 4QYOB 5T1KD 1CFTA 2OSYA 1Z3GL 2NR6C 4HKXB 1DL7L 1LJMA 1YEIH 1OF2A 4QRRA 1BLNA 1VACA 4G3YL 2J6EH 4P2OA 4X83A 5C7XH 2V8MA 4KI5C 4KFZC 5J11C 1KT2A 2RCSH 3CH1B 2R2CA 1TETH 3KPRD 1W0WB 1N10A 2OULB 5DFWH 5K9JL 4YGAB 4Z7NF 4PI0A 5T3ZE 3HVNA 2YMOA 5KANG 5F3HA 2LABA 1GGIH 1IFRA 1S9VB 3B1TA 3H4FA 4WHDA 4X6FB 5KOMC 2QGCA 1MCCA 4AC2A 4JAMB 2WXOA 5D2NC 5CZVH 1XGQB 2IWGA 3ARBA 2DQCL 4PGDA 1OP4A 4NNXB 3ABGA 3VQLA 1GXEA 1HHHA 3HMWL 4KROC 4K2UH 3I3DA 1BXAA 2VDLL 3C6SB 1B90A 2WVVB 4HV8B 3FFCD 3RYMA 1RIVL 2EE9A 3P0GB 2X12A 2AQNA 2OJEB 3MOQA 4NENA 1ZK5A 1TZ8A 4I77L 4OT1L 3BDXA 2WKLA 3S37H 5D6DC 4CDGC 3D39E 5AOZA 4BWUA 5IROD 3KVPA 2EDYA 1N4XL 3FT0A 3U4KA 5E1QA 3HUJE 2BHFA 4H20L 1AG6A 4LVEA 5ADPH 3UTPD 4Q6KA 1T4WA 4BWTA 4G8GD 1KCWA 3IRZA 5BS0D 3ATBA 2XPGA 4L4TB 3R19A 4YHPA 2V3VA 2DWDA 1S78C 1S7VA 3OMIB 1AR1B 3BQUD 4NO3B 1A3RL 1WICA 1FL3A 1ZXKA 1ZLEA 2ADFL 3HRPA 4UILL 4DUVA 3HA0A 5ICYA 1QRND 5C86A 1L0YA 1MFDH 2P24B 2ZP9A 3D18A 3OAZH 4M6OH 3QULA 4MXWL 3EYVA 4U3SB 2CK2A 2NY5H 4G72B 1S9XB 1XF2B 4PJEB 3ZKSD 1DEDA 1JGLL 4NO0D 1JNHB 2G2RB 1E4XL 2NR6D 3KAAA 3TO4C 3AXLA 5AYUL 1JXFA 3GTMA 1AZZC 1KYDA 4YFDB 1NFIB 5DJZB 2J8UA 1F4WL 4FP8H 1RJCA 1TJGL 4LKCA 4JFXA 3VMNA 4AVIA 3GK8H 5LBGA 5HHPA 1M9SA 4R5VA 4HIHB 1MCKA 3WU1A 3E8UH 3VM5A 5C0CD 3MC0A 4NXSA 3JWNG 3MRGA 3SJVD 3BAXA 1RVFH 1OQXA 1JPGB 4N1HB 1U8QB 1FE8H 1ILSA 3MXVL 2FVNA 5AL0A 4MSWA 4LOFA 5DHVA 1LO3L 2YD2A 5J3HC 4NIYE 3HC2A 4ALAL 3CU7A 4KROD 3O6FA 2OMWA 2P44B 1O7VA 3UFIA 2GTZB 5BPPA 3UZVB 2ITFA 3OXRB 4G8EA 5D93B 5GLXA 5EU5A 1YYLH 5FYLE 5HDBE 3SCMA 2YLHA 5PCYA 4G1MA 4N5ED 5AVSB 4AVRA 3KPSB 4KRLB 5J1AB 4XN7A 2WTRA 1R47A 1CZ4A 2PP9A 5DEGA 5CXPA 4AOFA 1UOKA 5C3IA 3THMH 3WI9A 2DQ6A 1HKLH 3STZB 4YSSA 2NXYC 5KZCD 2E6QA 1G7PA 4PJ9A 4APQA 4FXKA 1AS6A 4XXCC 3SGDH 5TF1L 1UWGL 2Z1KA 5LCVL 1GRWA 3LRLA 3T6VA 5D6CB 1RY7B 2FYVA 1S78D 2QVKA 5LCVA 2Y1AA 2BP8B 3LS4H 3ZDXF 5DXWA 2IQAB 4G6AC 3QCVL 1KGWA 5AZUA 5ACMA 3HPJB 5JORB 1T89A 3UTTB 3GGWA 4X7SL 3VGBA 3V5DA 2AJVH 1LE5A 3CN3A 4B9CA 4MNGB 4XCNA 3B9KA 1DCEA 1NAKL 4LDEB 5SWSB 3H2WA 3TO4D 3LD8B 4G7VH 3N42F 2JB5L 3QA3A 4Y2DC 4Z3TA 4OIFA 1JHLL 5IHBA 3OG4B 2IG2H 3STBA 1TCRB 1BSIA 4WV1C 5J12C 4U1IB 1HZKA 3QJSB 4U0RB 4JRXA 1DLFH 4JMXA 1SJEA 2AQTA 1GHFH 4NB7A 3ESVF 3K3QA 5CD5D 4Z77B 5C8JB 3LZQA 2YPVH 2XJKA 1BXUA 4ODHL 3GMLB 3CHOA 5HHOD 5IB2A 1T20B 3N85L 3IDIB 1YY9C 4MHHI 4YL9A 2B3IA 1CLYH 1B88A 4KTYA 1URLA 3OAUH 4BH7A 1MWAL 3FONA 2WO3B 1G84A 4X50A 4MDJA 2O93L 3BUYA 1DUZB 1NANH 1MWAA 4DKAA 4FE9A 3WUWB 4QXGL 3KVQA 2KT6A 1S5HB 4LT7A 3RUGE 2PXYC 4IW4C 1JGUL 5T1KA 4JHBA 4YWGH 3EG9A 1GGTA 1BAFH 4NHCL 2CGZA 1KC5H 1W80A 1CCZA 1KIUB 2UZIL 5I26A 1Z3RA 3L17A 2X9XA 2MTAA 4J2XA 3FYEB 1EGJH 1UM6L 3KYNB 4PGBB 2EEXA 3SE4C 3KPRA 4CW1A 2DMKA 4MFHA 1RZ7H 3X3GH 1ZHLB 5FGCB 3U9UA 1PZCA 3IDXH 4R8WL 4G5ZH 4S1SL 2FO1A 1CICC 2YA1A 3CHXA 4AENB 2BRQA 3QIWC 2KLRA 2QGDA 2PICA 2IANB 4KDIA 1WZ1L 3CZSA 4NN7C 4ELME 4G6AD 3BVWA 2W81C 1NCCH 4HD9A 4YXKL 5J0BA 2W38A 1NBQA 1WH0A 1R1CA 5B38B 4YE4H 5E6IC 1N3NA 3A6CH 3L6FB 3S88L 2VITB 1UM4H 2OCCB 1BMWA 1SJVA 1G7MB 2ITCA 5K1NA 3FFCA 1HN1A 1UQSA 1PY4A 4Z7OF 3OKKA 3NPSC 1WD8A 4Y2DD 2ATPB 4OM0L 4NT6A 2DEWX 2Q7YA 3P54A 1N18A 1IGML 4QRFA 5IROA 3IF1B 5ID0B 1A7NH 3PJSB 2NNRA 4TV3A 3T1WA 5KBKA 3MACL 3FSVA 4HKBB 2WC7A 5F3BA 4FHKA 5E23A 4G8GA 5BZDB 1HQRA 4HCRH 5BS0A 3TIDA 2WN2A 1A9VA 2VLRE 4L0PB 1N5AB 3EF4A 3EYOA 1YY9D 2AF2A 2QSQA 3BQUA 3BWAA 3KPQA 3L16A 1P7BA 2R59A 3LNIA 3L5WB 4LL9A 3HJEA 4JO1H 3QZOA 2G75B 3DHJA 1MI5E 3OMZA 5J6SA 1QRNA 2UWEF 3BEWA 2BJML 1MJ7L 3OWEA 3D3VD 3MUGA 2E46A 3N44F 3FQRB 1UACH 4PJFA 1UJ3C 4JE0A 4X0KB 4XE5B 5I5RA 2PXYD 4U1JB 3FC8A 2NR6A 1LLAA 1R3LB 1WD9A 4ODVL 5MI0B 2WW8A 2Q76B 4OZHF 3BUPA 1LQSR 4N90E 4V11A 3KPLA 3ZIYA 3TEXA 1RH8A 1EJ8A 5A3IC 4U1MA 3S3BB 3TJPA 1MZZA 1ZANL 2ZOKB 5E00B 2YA0A 4ZUVB 4GRWH 1KIRB 1RSFA 3DOSA 4OCXL 4Y19D 3TIEA 1QUPA 5C0CA 2DBLH 1M2OA 1RUAL 3QIWD 4LBAA 1E3FA 5FECB 3SJVA 3UPCA 1C7TA 1LXMA 2RMNA 3OAYK 1M2VB 2NY7H 3DUHA 2D4DA 2BSTA 2VM9A 5IVZB 1TSHA 2P52A 2QVTA 4L3ED 3HR6A 5DRXB 1E7VA 5DSCB 1K8DB 1I7RB 1MFBH 2XXFA 1KPVB 1V5JA 4ONFH 2UUDK 5GRJL 1YNND 4FQJH 4JFOA 5IVXB 3M1BA 5EDXA 3DX6A 3C5XA 4M3KB 4NOHA 5TH2A 2VR3A 4CVUA 2GY5A 3GXPA 3VXUE 3CZBA 5AUMB 5KTEL 4PJXF 4JHWL 2H1XA 2FYYB 1UA6L 3GJEA 3WEXB 1X4ZA 3QUHA 4CVZA 5D6DA 2SEBB 3QXDA 1RPUA 4HULB 3S36H 1KEML 5J13B 5DGQA 3FUEA 3PIQA 4LF3B 4R97B 2OMVB 4AEIL 4LLVA 1XGRA 2EDDA 2OCFD 4F2MB 5J6HB 4EI5B 4XO3A 1IL1A 1IBFA 3FRPA 3MXWH 4ZZKA 2IGTA 2VYRE 2PW1A 5KSUB 1E67A 2C8NA 3QB7C 3WXWH 5K9KA 5AW9B 5DK0B 3HLKA 4IQHA 4XP6H 5D70H 3PPEA 2VO5A 3UEQA 4EI6A 5F7AA 3WIIH 2VJXA 3F8UB 2QPEB 5DWUL 1KXVA 5F9WB 3DTXB 3O4OB 4N0FB 2HWZL 1XGPA 3C5ZC 2WANA 2DW5A 3TO4A 4LU5H 1O5PA 2PPDA 3V0IA 1N6VA 4YBLB 2I60H 1UENA 4P99A 1UWEL 2P26A 5EZPA 5FLUA 4G42A 2J6EA 2QQQA 3H8NA 4P3WA 5F7NC 4WVRA 1GYUA 2FSEA 5C0BB 4OD2B 5CWSB 1MZYA 5IESH 1VZIA 1LDPL 1TVBA 2IAMB 5JW4N 1JI2A 1NBCA 3D33A 1E27B 5I1AA 1W15A 3CVHH 4FXTA 3BPNC 1BWMA 5T1MB 1SOQA 1BD2B 1ITBB 2G5BB 2UY6A 2YU9A 1JF1B 5FYJH 1QKZH 5T33L 1RZGA 1LO2H 1U91B 4X2UA 3GLEA 1IM3B 4CC4C 2NUTA 5DUPL 2DJUA 1TT6A 3UYPA 4N0YL 4AM0B 4HUKB 1AFVH 2D9QB 4UQ2A 4FZEL 5FDWB 3DV4A 3P9LB 2HLAB 1V7NH 2JE8A 3GBDA 3DK2A 3QJVB 4LEXL 4C2MA 4QTHA 4FXLA 5JQ6L 2JIOA 4GKOA 3TEYA 2R4SH 1IC1A 1UEYA 3I9PA 3N41F 4NOFA 5DMKA 4OJCA 4IU3A 2XTJE 3WD5H 4CGUB 1TZOA 3DURB 5E2WL 1BX2A 1GS6X 3BI9X 4JJ5A 4XXCA 4J27A 1TYJA 1BVNT 4BUGA 1BZEA 1JCVA 2EILB 3NTCL 3VRJA 1HWWA 4JG0L 4PRPB 4BQ8A 1KN4H 3EJCA 4KVCH 3TV3H 4H25A 2A9DA 3IKKA 4QO1A 5EN2B 1HXMA 3HU1A 3EW3B 2X0UA 3CXHJ 1QR1B 3C60B 4U1GB 1TO4A 4PRHD 1P6FA 4Q4IA 3TYFB 2XV2A 1NGZA 1I82A 4OFPA 1FL5B 3WY2A 2GCYB 1KG0B 1A6VH 1TZIB 3LNDA 5ANMA 2CNYA 2PYEB 3OJ2C 1UHVA 4Q6YA 3QEQB 1SDAB 5GJSL 2H32B 3T65A 4Y2DA 3IAPA 5L9DL 4YHOH 4RLDA 3GJFB 4RZKA 1HHKB 3QIUB 5KBNC 4KMLB 3F85A 4WV1A 2FWUA 4KRPD 1XF3A 3FUIA 3QRGH 4NZDA 4X6EA 4ZMNA 5BUAA 2O61A 2DAVA 3B7UX 1PY9A 3WFEL 3D0VB 4FJ6A 4QJ3B 4PJ7F 4PY8J 1FUNA 2XFXA 5DDHB 3C08H