1N10A

Crystal structure of phl p 1, a major timothy grass pollen allergen
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
238
structure length
228
Chain Sequence
PKVPPGPNITATYGDKWLDAKSTWYGGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray Crystal Structure of Phl p 1, a Major Timothy Grass Pollen Allergen
rcsb
source organism Phleum pratense
molecule tags Allergen
molecule keywords Pollen allergen Phl p 1
total genus 50
structure length 228
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
A PF03330 DPBB_1 Lytic transglycolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.10 Mainly Beta Beta Barrel Barwin-like endoglucanases RlpA-like domain 1n10A01
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 1n10A02
3SULA 3X2PA 5GM9A 4L48A 3X2IA 2PICA 3X2MA 3X2OA 4JCWA 3FT1A 5GLXA 3CZBA 3X2JA 3M3GA 3ENGA 4FG4A 4JS7A 2VXQA 3SUMA 1OA9A 2PJJA 2BH0A 2G5DA 3X2KA 1L8FA 4FG2A 1N10A 1OA7A 2AE0X 2KQAA 4JP7A 3SUJA 2PNWA 3X2GA 4AVRA 4JP6A 4ENGA 3D30A 3X2NA 5H4UA 2JNZA 1WHPA 2PI8A 4FERA 5GLYA 4JJOA 2ENGA 2G6GA 3SUKA 4FFTA 3X2HA 3X2LA 1BW4A 1BW3A 1WHOA 2GAEA 1HD5A 1WC2A 2HCZX 4ZM7A 3FT9A 1BMWA
chains in the Genus database with same CATH superfamily
4NO5A 1RIHH 3FQTA 2PYEA 3K6DA 3TO4C 2E2HA 2XY1A 4W9CC 3KYNA 1NCWL 2X6UA 2ZX9A 3D2TA 1FVCB 2YARA 4PJXB 2G3MA 1B3IA 4UV7L 1CL7L 2AZAA 1Q72L 4JK0D 2OMTB 2WVUA 2YN5A 3NJIA 5D7KE 2ZOTA 4RA0C 4AKQA 5DMKB 2VCOA 4NM4H 4UQ3A 5EN2A 1G9NH 3B3BA 4PVNA 2QVIA 1FVDA 2KI8A 2H0PA 3A4FA 3TWCL 2CHWA 4PEEA 2N59A 2EIEA 2HRGA 1JVLA 5AVTB 1DJXA 3BE1L 4NN6B 4D9RD 4E0RB 1H8SA 1MI5E 2FNWA 3PIQA 3QZOA 2VISB 3I50L 3DGDA 2IPUG 2Y7MA 5DK0B 5GPRA 1YAIA 4PJ7A 5J89A 2VT0A 3S36X 3CX2A 4E42A 1GIGL 5KTEH 3WTXA 4G1MA 4KKAC 4W1TA 1K6QL 2CGZA 2WVVB 1KUMA 2EXWD 4IRSC 3GT6A 4EO5A 1PVHA 4KTDH 4OJFH 3V0VB 1BPVA 3HPLA 1QHOA 3JTTB 2EYTB 5EBMA 2XFXB 3WJMB 1T03H 1T1WB 1O75A 5J0BA 3DUSA 4AZ8B 3LH9A 3S7GA 4EXPX 1KBBA 4EZMA 3W11C 1QSFD 1IM9B 4Z3JA 4N9OB 3VMPA 1SY6A 2H8PB 3D1MC 4XCCH 5C0AA 4HH9B 1UD4A 1MIML 5IBTH 3KPSA 3EFFB 2CJUL 3GTKA 1MHPH 1JGDA 4OZHB 4XCYB 2WPGA 3T0BA 5HD8C 1FL5A 3RA7H 4AIZA 1TEYA 2NYAA 4OCWH 4IQHA 3GI8L 2EYRB 4HCRA 1R3IL 3MXVH 4HZ1A 5I6XC 1N8ZB 4MAUH 4WEMB 1KEMH 2ITCB 2YD2A 3VXSB 1P5UC 4JKNA 5EIVA 1CQKA 2VDRB 1FFOB 2XWRA 3B2UC 5AAWC 4UIMA 2VXVL 1R7RA 3I9GL 2A9NH 3QQ9C 2TRHA 4S2SB 4MXVF 2NUPB 2YRLA 4HIJA 4L3CB 1X5KA 3LN4B 3FQUB 4DTGH 5T5NF 5JIIA 4L1HA 4G43A 1YC7A 5KYUA 1J18A 4J1UA 2WUCL 2WB7A 2ENGA 5E99L 2PYFB 4LCVA 2KLSA 3NJNA 5IREA 1FNGA 2ICES 5IUSA 2FO4A 4HBCH 2VDRH 5TD4A 5E2UH 4F7CB 4RBPH 5H37G 3HHSA 3ILQD 4NUJB 3C6LD 4MKTA 4C56A 3RFZC 4JO3H 5LNDA 3KLHD 3PFUA 4XVSH 2E27L 2RALA 3VTAA 1QRNE 1IGJA 2MQ0A 4JFFA 1O6TA 4N4YB 2P1YA 3B9AA 3TASA 4FL4C 4ZFOL 4R4NC 4NI3A 4OD2A 4GI9A 3WFZA 5IHLB 2EIZB 4J4PC 3UAJD 3MLSH 4UV4H 4PS3A 4B7LA 3CFDB 3T4YA 4ZI8A 4FFYA 5KSBB 5IMKB 2FWSA 2NY0B 3WBDA 1KTLA 2ISDA 4I0PC 4IRSB 4IU2A 2IBZY 1QFWH 4NQXB 3AAZB 2F7IA 4JANA 4D0BA 5IMLA 3LXBA 3C6LC 3B6SA 3M7OA 3UTQA 1MFMA 4DHLA 4N1CA 4G72B 1U8PA 3DNKA 2F8XC 5BVJA 1XCTA 2IGFL 1GMEA 1NFIB 2YUXA 1F5WA 1RY7B 1B0GA 2IV2X 1AH1A 4QRQB 3NJHA 1NCCL 4N0CC 5KVDE 1FA4A 5CJXA 4XBGA 5TE4H 3HKFA 3V4UL 2JA6A 1I4FB 4P2RB 4Y7MA 2ZCLL 1WH0A 3ARGD 5TQ2L 4MXWL 1V3MA 5AYUH 2JIXA 4TQEL 4NI6A 4TVSa 3VH8A 1CFVL 1ULVA 1S7RB 4U49A 4GW1A 4BA0A 1MIEH 1NBZA 4WTWA 2DWXA 3RJQB 1MXGA 1I1CA 5F72S 5HYSA 4LRIC 3CXDH 4QKXB 2AQQA 1XCXA 3BWSA 1TYJA 1S7VB 2P80D 5KVDL 5GS2D 1SVBA 3QG7H 3Q8CA 3O9WD 1WYJA 4JCMA 3K0YA 1FNSH 3VXRE 3B7YA 4P2YA 4BEIA 2AK4A 2CA4A 3U36B 1P6WA 4D3CL 4WK2B 3QDHA 3AS0A 1Q94B 4L8DB 3W82A 4OTXH 4QNPE 2PNDA 2WGNB 5IVXE 1Z66A 1SJMA 2RTTA 3HPJB 1QWNA 3EF7A 3U7AA 4YC2C 3U6XA 2VMDA 5JOPE 1FYTE 4K8RD 2E59A 3BZ5A 1UH3A 3STLB 2R1WA 5E1QA 1MHHA 1YSOA 4P49A 3UADA 1PT0A 5T1MA 3ECBB 3DO3A 5I66A 5ESQB 1CI5A 3DVIA 4I3SH 1J0ZA 1Q9KB 3T3MB 3NCMA 4X5XB 1QCSA 1R24A 4JFTA 1UD8A 3BPNC 4EQ3A 1BHGA 4L1BA 3WTSA 1SDDA 2LU7A 2UY7B 3ULUC 2Z93B 3IETA 4E2OA 3WO4B 2YZ1A 2AXFA 1NAKH 4ORGA 3QDMB 4ZBJA 3O81A 2KYIA 3UBXB 3WJJC 5AVSB 5IVZB 1RLWA 4LSVL 2EH8H 2V8LA 2VE6B 1E3XA 4ALAL 4HFWB 2VKXA 1E32A 4HWEL 2R1XB 3IRZA 4IRJC 4QHKJ 1J5OL 3BZ4B 1E8YA 3RUGE 1IARB 2BXZA 3FOLA 3P9MA 1Y5IA 4GSQA 4YHKL 2VDMB 1A5FL 3DVGA 2XBDA 3JV6A 5CNHA 3TO4A 4M6MH 4APQD 1PTZA 4LDEB 1QO3A 3PXJA 2QLVB 2XTJB 1I8MA 2W9DH 3BZFA 4NENB 4WI9A 3UJIL 1OV8A 1JZGA 4RETB 5D1ZD 5DHYA 3ULSA 4AMXA 3BEWA 4MXQD 2C4XA 1J86A 3F62A 1NGZB 4YX2L 1KCUH 1TFHA 2BK8A 3GMNB 3L4XA 4NX0A 2ED6A 3LZOA 4AMWA 4PJ8C 1KCWA 3JV5A 4PJBE 5ICYA 3LX9A 3KXFE 3FCTA 3KYAA 4QNPF 1DN0A 3E8UH 4W9GC 1CFSB 1GAFL 2WIMA 1EXUA 3N91A 1OT1A 3BWUC 2FVNA 3IFOB 3T9WA 3EBHA 1F6FB 4YR6A 4H8WH 5JXED 4HKJB 1GSKA 3WNLA 1S2EA 1J05A 1CK0L 2Y1ZA 3MRRA 4DZ8B 1ES0B 4NQCA 1YNKL 1FNEA 1OTTD 3DX7A 1MHEA 5ICZA 3CHRA 1ZEAL 4TSCL 3A6OA 1P4IH 2WV3A 2HFGL 2OMXA 1QFOA 2Y36L 1QYGL 1HXMA 4OLUL 2GKIA 1YLBB 2QBWA 1NMCB 1T2QH 2YGOA 2B8OT 4H20H 4ZS6D 2ZWYA 5GRVL 3GDCA 1CE1L 4JRXE 4M5YL 3NSYA 3UAFA 3DX2A 3ZTEA 3HG1D 1A4JB 3OKMB 1YYLL 3PWPA 3QUXB 4P07A 3GSWA 3I3BA 4PRNA 5FOBA 2WJ5A 4MAYD 3X14A 3ZDYE 2IDTA 3MCLH 4G82A 2ERJC 4PUBL 2AJUL 4MAZA 2BY0A 3Q6FB 5D1ZC 1D9KD 4GRMB 1E67A 4OCMC 2VDQL 3NN8B 1L6PA 5JIDA 3MFGB 4MVBC 4ZX5A 4H26A 4WFEE 5F7NC 4MA8H 3AM8A 3V6FA 1LGVA 4FCHA 1OAQH 3QXVA 2VJ0A 2VZTA 3UOAB 2KQAA 1E4WL 1GGUA 2C26A 4G70B 3U30B 3ZKXB 2X6CA 5CHNA 1EJ8A 4HH8A 1LEKA 3CIQA 4YZWA 4ZMYA 2Q5BA 2VSKB 2X09A 3WS3B 3VRIB 3EBAA 4PJGF 3GB7B 1KOAA 4KXDA 4IHBA 3QUXD 4V1DD 1GOGA 3UCRA 3V9EA 5I1HL 2CM5A 3B9DA 1SYVA 1WA2X 1K85A 1LO0L 4HAGA 3AU1A 1J88A 4JUTA 1A7RL 1MWAH 1UVQA 4XCEB 5F71A 3EJZC 4C59B 1TJIH 4CADA 2KERA 3VXUE 1GC1H 2WXFA 2E9GA 3AMKA 3L3KB 2VM4A 4WCYL 5H4UA 4XAKE 4ZS6C 3RA7L 2Z35A 1SM3L 1N26A 3O2WL 5EU6B 1WPCA 4MS8C 2B5IB 3WOVA 1SEQL 2B4CH 1JCVA 3HHMA 4EDWL 3X2QB 1UQSA 1HXYA 2VXQL 3FB8B 1BZQK 1ZCRA 4GKSA 1RAMA 4DP5X 3IF1B 1BFVH 2ICEB 2EIBA 3N43F 1OCCB 2G5BB 3UG4A 3BPLB 1TTGA 1N2RA 5C0RH 3S96B 4AYSA 1U2YA 3US9A 2RD0A 1QLEL 4H44C 5IK3A 2ZXGA 4APQB 1NFDA 2JJWA 1R17A 4KXCA 3I6GB 2AVGA 5FKAA 5C7XL 3QYMA 5E2UL 1K4CA 3IPFA 3T2LA 2YKKA 3RP1A 3V7MA 2OMVA 5DJAB 2VLLB 3QGVA 4LCIH 4Z7VE 2WWKO 1CZ4A 4Z7IA 3WEBA 2P9RA 3HEIB 1F4YH 3RVTD 3ZN6A 3SULA 1PY4A 4LPVA 2XI9A 2HTKD 4R2GC 4X6BA 5EO0B 4H8PA 4AWJC 4AVKA 4PPTA 4IS6B 4E9WA 2O93L 1Z2KA 4IOFD 5T3XH 4UILH 2A9NL 2LE9A 4P5KB 1LP9F 5BO1L 1EDYA 2X3AA 4Y4HA 3RQ3A 3WIFA 1QSZA 5JXAH 1HYSC 5ACZB 4Y16D 4BELD 2FQFA 2H2PD 1BQHG 4RMWA 3KVDD 4RDQF 4P57B 1J8HB 3RY5A 4B9FA 3WFHB 3QULA 1Q72H 3L8QA 2JH2A 3CZFA 3IDYB 3GMOB 4L9LC 3SO3B 2WY3B 5BRZE 1MHPL 1YN7B 2Y3NA 3BZEA 4C4KO 2W5PA 2HFTA 1VGEH 3JWOH 3UIZA 3V6OE 1MW3A 2OL3B 1CLYH 1IGMH 1XGRA 1MFNA 5GRZA 2CCWA 4AVJA 2J8UB 3QIBB 2FJHA 2P42B 3R8QA 1A3QA 5L6YL 4OGYL 2PLTA 3LEYL 4PWKA 4X0KB 1XXDC 3T0EA 3HG1B 4GT0A 3WKQA 3LZNA 2J8UF 3F83A 1CC3A 1WZ1L 4PIRF 2YU9A 2E7CA 2NPLX 3VDAA 3A6CH 4DAGL 4M00A 4I1NB 3D4CA 3F7YB 2VDPB 2NTSP 1SPDA 2DM3A 1J11A 2GHWB 4KHTH 1JXGA 3Q43A 4PB9H 5TDNB 5HPOA 1X7SA 2NR6A 3QPQC 2UZIH 2MQGA 3KPSE 4P3DA 4WDIA 1NOLA 2MCPL 5C09B 3T8XA 2X2UA 2OCCB 5DZOA 4C56B 1MNUL 3LKNA 2V5MA 4WFGD 1I9EA 4KODA 1HT6A 4RGNE 2PTTB 3VWKD 1C1EL 1QSVA 4HIXH 4RA3A 1PSKH 2V9QA 2ARJQ 2VAAB 1JPFB 4OJCA 2CD0A 3NH7H 2J1YA 2HJFA 1SFOA 1LK2A 4A2MA 3N1GC 5TFSH 1CGSH 5GGQL 2AJVL 1AY1L 5FFOA 2XVKA 3MUY1 2A99A 4YDIL 4TPRH 1J5CA 2IJ0C 5CJXC 3FZUC 1G4RA 4X6CA 1CL7H 4KQ4L 1IUZA 1TETH 4UUJB 1PLGH 1PL3A 5CJQH 1TZHA 2JKXA 1MRCL 1I7RA 3X2NA 4NJ9H 3SCMD 1JPST 4XB7A 2APSA 4P4KD 2R93A 3TZVC 2N7AA 2H45A 1IGFH 3ARGC 3R4RA 3D0LB 5EZJB 3LH8A 3L4CA 1TNNA 2R0KL 1Z9SA 1D7FA 1S5HB 2AJXH 1AY1H 2DLGA 3LZFH 4XN1A 3T04D 1DQJB 5JOFB 3VFRA 1QPKA 3BKCL 3N04A 1RU9L 3C6SB 3VM5A 5E03A 4KMTH 3FN3A 1AGCA 2DTML 3MRKB 4OZGE 1WBZB 4R7DB 4KKQA 1N4XL 3M46A 1KN4H 3A0OA 3FFCA 4H7VA 1ZHBA 4QF1B 4GH7B 5DJXB 4GBXA 1MAMH 3TC9A 43C9B 3PWLB 1S8DA 3E6HB 1ZPLA 4OLZL 1WBYB 4I77H 5DUPL 5FYLD 5FR3A 3SDYL 2DEWX 3DJTA 4WV1B 4DKDC 1VA9A 4R2GB 1JNLH 3F7RA 3A6CL 3KH4A 4JMNA 3HMWH 1WZ1H 1QLEH 1DZ0A 1QOKA 1BG9A 3CVHL 2MKLC 3BN9D 4HX1B 3MLWL 4PRAA 1MCPH 1S3RA 1EHKB 2WJ7A 1BM7A 3V5HA 5HJGA 5I9QB 4AGMA 3W9EA 5IFAL 3FN9A 3IMWA 5KYWB 1AYOA 2XWEA 2DJSA 1TT6A 3DO4A 1N7MH 2JKWA 1KEGH 2H1PL 1UWXH 4M48H 3TURA 4NB7A 4JO4L 3L2NA 3MREA 3ECWA 2R0ZH 2E6QA 1ZHNB 4B53A 4WW2A 2VAJA 4ZUUB 3R1GL 1GSMA 3VFWA 5I8EA 2MIZA 3HE6B 3DK0A 1QBAA 4R4BB 5J1TC 2CUAA 3TM7B 2IWEA 3MBEC 4XMTA 3TCLA 4Y5VC 4KROC 2I27N 4HUWA 5B22A 4CL7A 1A4CA 1KCVL 4WUKL 4DP7X 2Y2YA 4WI8A 3MBXH 3BKJH 4OH2A 3SJVB 4W9JC 1F2QA 4ORZC 3L45A 5IJVB 1XR8B 4QLRA 2PPDA 4JZOA 1W0VB 4CRPA 1CGXA 2BIPA 1ZLWH 3GM8A 3QJFA 2VR7A 3PL6B 4I3GA 1PZ5B 3REVA 3C2SA 3X1BA 3CLEH 4KTYA 2PO6A 3GTVA 4HJUA 3VWKB 3M17A 4E5XB 3NZ8B 1TTFA 5JHLA 5BPPA 2VDOH 4N86A 5T1LD 1XSJA 3VXTA 2AQNA 4JP6A 1IE5A 3JV6B 1XSKA 2XV6B 4PJ5B 3SY6A 3NACL 5F1KC 2A6JB 4KKAD 4GO9A 5KWYC 2CK0L 4WHTB 4I4WA 3EYUL 4NM8H 1I8MB 1TWFA 2GITA 2AJUH 1FGVL 1X5IA 1A3RH 3BZFB 4NENA 4UWQB 1Y07A 5FK9B 2CDGA 3KLDA 4TTGA 3L1FA 1MCFA 2G2NA 5MEPA 4GBXC 1VJSA 2IH3A 5EZLA 2A1WL 1YNLL 3BEWB 5C1MB 5ETUA 3CH1B 3OPZH 4AH2B 4L37B 5CU9A 4TUJB 5IOPB 1SEQH 4JRLA 2A2QT 1E2WA 1QI3A 4LIQE 1CDGA 5F7MC 4YHLL 4PH8A 4YE4H 4BINA 4RAVB 3V52L 4F2ME 4HK0B 1Q9WB 4F8LA 2XN9D 3EDKA 4OZIF 5H94B 3N43B 1DLHA 3QNFA 5JQ6L 5LWYH 1BMZA 4WJG3 4ODWB 2B20A 2X9XA 1XDTT 4HPOL 2Q6WB 2Y1YA 5FDWA 5CD5C 1T04B 2ZCKH 3FFCE 3KPPA 2GYSA 4D8PB 1QLFB 2YPLE 2P4AB 5IFJB 1V7NL 4Y1AE 4UAOC 5DWUH 4WEEA 3H9SE 2L04A 1BQKA 3TNNB 2R29H 3OR6A 4KLNA 2OMBA 1RK7A 3DX6A 5EFIB 4OT1H 3GXPA 4LRNL 4ZMZA 3UBFA 3ES6A 2VERN 4KO9A 1SIWA 5EOQL 3NJLA 4XOBA 5D72L 3ULVD 2Z8WC 2F8OA 3IVKB 3OKMA 3VW3L 2V2WB 3GI9L 2YEZB 4MWFA 1N6UA 4HSAC 4PMEA 4QHMB 1CCZA 2R2HB 3IGFA 2SODB 5J6HA 5LGJA 3WHE1 2IOIA 2G0KA 4ZX4A 3VG9B 2IMNA 3AROA 3MKKA 3BLBA 2QSTA 3IE4A 4L5FE 4WJ5A 4FQCH 4WWKC 3GMQB 5AOMA 4G9FE 4EI6A 1AO7B 2FHFA 2BERA 3GUTB 2PXYD 2AABH 3EGXB 1ODUA 3FFDB 2EEXA 1ND0B 2IAND 2SEBB 3BXNA 4GIAA 3T3PB 2XPGB 3MNVB 1EZLA 1C5CH 1IQDB 5GLYA 1FZKA 1PZ2A 4O58H 2DWEA 3EXJA 1DUZB 4G42A 1DQLH 4Z23A 3A4DA 1PG7X 2WXIA 4IOIB 3HE6D 5DD5H 2B14A 4DOHB 4LNRB 4X6EB 1VFAB 3F2LA 1I7TB 4BKLA 1KBVA 4L3ED 4Q6IB 3EGSA 3EDDA 4P9ML 5FCUL 3U9UB 5GS0C 3JVGA 1HHIB 5GSRA 4MNGA 5ILTH 4I0PB 4R4FH 2D7NA 5L88H 1YNND 4JZJA 2G30A 3ZDZB 3EYSL 2XIDA 3C5ZC 5GRYA 4APQC 3D34A 2FO1A 4KBPA 2CWRA 1Z5LB 2FD6H 2Y6SC 4XP4L 3D2UA 3FHQA 1CYWA 3UC0H 4U0QB 4TNWK 1HXYB 1QZ1A 3F6JA 5DJCA 4JFXB 2ICEA 3OKLB 2E86A 3GTJA 4ZRGA 4WUUE 3OXRB 1IW7D 4XMKL 3S96A 3G6JE 3MHZA 1LEGA 4NKQB 4HPYH 2DWTA 4BSVB 3BVVA 3BD3A 3HZYB 2D31B 5EV7A 3L54A 1WTLA 3S5LA 5HYSG 1BFSA 4KROB 1IGTB 3OSVA 4NC1C 2XHNA 1ZS2A 1QSEA 1F3DJ 2H26B 2ITDB 3GSNA 4FQXB 4M61B 1J7VR 4MNQA 4YBLC 4ZUVA 3FW6A 5JW4N 5TH2B 4KOBA 1CD8A 1G5GA 4PVMA 2Z31D 4MDIA 5LAPA 3B5GA 3N0PB 5GRUH 5GS2H 1JYNA 4RRPA 3GI9H 1DO5A 2APWA 2QVMA 3F7QA 1DO6A 4YIQB 2IIJA 4HJ0C 4QRBA 4JFDE 2XN9B 4NJAL 3LV3A 3QI9A 3HG2A 3CBRA 2WNKA 1PQHA 4JAMB 3TA3A 4I3SL 2KH2B 3PWVB 2Z0BA 3GIZL 5EUKA 2IGFH 3DSFL 1JZIA 2FBJH 3BIKA 3BT0A 4POUB 1NANI 5AZ2L 3PF2A 1YNJD 4PRIB 4BWTA 4GQ9L 5K1JA 2LOEA 1ZV9A 2WTOA 5GJSL 1NFDE 4X4ZA 5HDWA 2DDQH 2KQNA 4A1RA 5KSAC 1E5VA 1P0SE 4L5FH 2A69D 4BKSC 5CFHA 2FJHB 1UKSA 3IDNB 4F9LA 4PJ9C 2HT4C 1BREA 4X0KA 2VLJB 1DCLA 4L18A 3U4BL 3PUCA 2X4TB 3RKDC 2DWDB 5FXCH 4R0LB 3V5KA 1WA0X 4LBEA 1NDTA 3Q1SL 4QHNB 3WD5H 4GUCA 4D0CA 2W65B 2ZYSA 3NUKA 1CF8L 1RZGB 3L5XH 2GY7B 2OQJA 3L13A 4L4VB 2FUTA 3D48R 4EN3A 3BDYL 4ZDHA 2Z64C 1N9PA 2LFGA 4GW5A 4LPTA 4LSRH 4GSDH 4LCWA 2ZX7A 5G55A 1MDAA 4TQEH 2EKSA 3UO1L 1J8SA 5CBAA 2O5NA 1XF3A 2ZJSH 1LO3L 1MG2C 4QYOA 1XB3A 1F56A 2V7NA 1KTDA 5BNXD 4AOFA 2WVSA 2V2TB 1JUFB 2E8YA 2V33A 3M45A 4X50A 5DUMH 3AZUA 1BGXL 2DQMA 4TLTA 5EOCH 5C07A 5D7IA 4K3JH 4XT1C 3QDMD 3VXQA 5DI8A 3NGBC 1T83A 2EE3A 5T5FA 1S9VB 4O2FB 4F37F 4FQIH 4DPAX 1IEHA 4P0DA 5GRWA 3DHMA 3OMAB 4Z5RB 1OAXL 5C9JB 5B21A 4FNRA 4XCFH 1BAGA 5I30L 1AHMA 4QXGH 4NNYB 4QHLA 4NFCA 1V3KA 3DRQA 1AGEA 3ZO9A 4E9RA 3KYNB 4GRLD 3BO8B 5I5RA 1NJ9A 3L1OL 4IRZH 4PV9B 2B9BA 3D0LA 3S37X 4Z3EA 2KC0A 2PWHA 4AIEA 3GMLA 5D1QE 2ZCHH 1DL7L 4UQ3B 4JRXA 3ECUA 3SDAB 1Y6KR 2EP6A 2R0LH 3OM3B 3NFSL 2PPAA 3UYPB 4PGCA 5HHPA 1J0KA 5K9KA 4JY4A 4TOYH 1FFQA 1M53A 5DJ2B 3CN1A 4I48A 4IU3B 3U6XS 2NSXA 2B1HL 3GQFA 4BA8A 2R0WH 2EEAA 4JFDA 3TNMA 2CRMA 4K5MA 4Q58C 3GJEB 4UB0L 3UJTL 1T5KA 1S8DB 5K33A 1I3QA 4UM9A 2Q86A 3TESA 3B56A 2LU4A 3ARFA 3QQ7A 4HMDA 3S5LG 5IB5A 1W6LA 2JIXD 4X8JB 3EJRA 5L2KB 1OAYL 2WVVA 1HHHA 3MNDA 1UA7A 4NLHA 4J3OH 3MZGB 4P8QA 1DBJL 4PJAB 1M6OB 4UTBH 4Y8AA 2NYYD 4JG5A 4TTDC 4ZXBD 2GTQA 3ARGB 1YUKB 2UY6B 2M8XA 4N9GA 3X3GL 1NEUA 3X13B 2GIMA 1RZFL 3Q5OA 1HYSD 2BMKB 1T1WA 1A7PH 1J0HA 2FGWL 3DTDA 2BVOA 1TQCC 4ZO6A 1CZ5A 4DFIA 3H56A 4YXKH 3V2AR 1P4BH 2GJJA 5C0AB 1G6VK 5F89A 5C0GB 4ZK8A 3AQZA 3H0TB 4XBEH 1E5YA 1GY2A 3HI6H 3GMRB 4AEEA 4DCQB 1LDSA 4A68A 2VMCA 1JNNH 1MCNA 4IMKA 4M3KB 2GTZA 1H0HA 1AO7E 4Q9RH 4G80B 4HDIB 1B4TA 4R4BA 2FL5B 1H9VA 2A68D 4JO1L 4BQCA 2Y25A 2JKTM 3AC0A 4HEPA 4O9HL 1MRCH 1NCHA 4JRYB 4ENZA 5FIEA 1OF2A 2XQ0A 4QOKA 3HC3H 2CO4A 2I5YH 2DM4A 4HK3N 2PXYC 3JUYA 3CXHK 4GLRH 4KK9C 3P3SA 1UC6A 1EO5A 2HB0A 2UV3A 3NSXA 4BZ2L 4CW1A 1PD6A 3G6AA 1U8LB 2ICEC 1HHGA 3QNZB 1F2XK 4RWYH 2PYFA 1ZA6A 1XFPA 4U05A 3FU7A 4PFEA 3VXNA 3KPRE 3OKYA 4XN4A 1AR1D 1DJSA 1FNHA 4FZ8H 4HKBA 3FQXA 4XWOD 1JE6A 3QR2A 1J0JA 4PJ5A 5D1QD 4V1DB 1FYTA 5DWPA 2WXKA 2GITB 3L2MA 3R19A 4U1MB 4PLJC 2Q2EB 4LHQB 3ZRFC 1F58H 1XGQB 4NPJA 1FORH 4NO2A 2Y7SA 2YA0A 3MRNA 4X7FC 1A9BB 2XWDA 4WI0B 3T09A 4HU2A 4ZSOE 1BECA 4WGWB 4F8QA 2O30A 5F3BB 3L5JA 1VAHA 3LRSA 2J5WA 1WIOA 1JWUA 4YSRA 3H3PL 2OR7A 3PQYA 4A6YL 3G6DL 3WHXB 3DJSA 5J6GB 5ANMB 5F1IA 4ZMLA 3OKEB 3OPUA 4FJZA 4AG4H 2G75B 3FULA 2VSMB 3GO1H 1AKJD 1NGXB 3ATDA 2IXQB 2OYKA 4CVWA 2V17L 3EYFB 3AAZA 4JANB 4D0BB 3POHA 4JJ5B 1PLGL 3H9SA 4N8VA 1X7QA 4BGLA 4WIQA 2DIEA 2YPLA 3GJFA 1E9OB 3I6KA 4IRZA 5KVFH 4IKNA 2CKBB 3E6FB 2WQXA 4MKMA 2IPTH 5HVGB 1WF5A 1B4LA 4JR9H 1MVUB 3LNEA 4ZX6A 5FEBA 1HHKB 1CFNA 1GR7A 4YSUA 2NX5D 5IVXF 1LK3H 3MXWH 4FQQA 3F7KA 1KDIA 25C8L 2DI9A 1JAEA 2QV2A 4XGZA 2IANE 2YQGA 4QXWA 2GJZA 4NQVA 4HIIA 5CEZL 1DVTA 2XBTA 5DJZB 2YSSB 2JIXB 5L2KD 1FIEA 3G04B 2FECI 3QZWB 5J6HB 4MJIE 3ZDXB 2GBUA 2H3KA 3F8UB 4GW1B 1WZAA 2BVQB 3VD1A 6TAAA 4MA3B 4Z7AA 1ACXA 1JPSH 1XHHA 3A4EA 1MQ8A 4BHUI 1G9EA 5KN5A 4K9EC 3HOGA 1YY9D 2VXSH 3MTRA 4EDXA 5DCCA 4FNTA 2DD8H 4Z76A 1R3HB 1BXAA 1E40A 1RZKH 1UT2A 2WNXA 4I89A 4A7TA 1SJHA 1A6WH 1I7UB 3TVMD 5C0BE 4OM0L 5E4EB 5DA4A 2Y1AA 1DSFL 4KHXH 4Z7VF 3CFIC 4PRPA 1E43A 4ES8A 2CIIB 2PWEA 2JF1A 3DMMA 3LKOA 3ZBMA 4KC3B 4LNRA 4X6EA 2EDHA 4YSTA 1E4HA 5J5EA 1I7TA 2Y2TA 4YHYC 4Q9QL 5GXBB 4FD0A 3KAAA 5CR1A 4P46C 2IH8A 3G5XB 3HU3A 2Y06L 2X4QB 3U2IA 4CU6A 1PZ3A 1AXSA 2XTJC 2WOYA 3I6SA 1OT4A 2J8OA 1L6ZA 1Q90A 2VDLL 1PG7L 4PW4A 1E6OH 1HFUA 3HR5B 3MV8E 2VL5A 2YD7A 1I1FB 4HHGA 1FDLH 2QPSA 4PV8A 2BRRL 3EO9H 1W0WB 5GGVL 5EZPA 4KXBA 2D4FA 3VXPB 5I6MA 1HESA 3OXRA 3X2KA 3C5XA 4KRNA 4XVTL 3ABLB 5CLYA 5I1DA 3GTQA 2J1KA 2NRDA 2J43A 3X17A 3QAQA 3GTLA 3FNKA 5EOCL 3WUWB 1TJXA 2BO0A 3O4OC 2MTPA 4KTGA 4F1ZA 4HXAL 5F96L 3C8HA 4QJ3B 4IIQA 4XP6H 4MDJB 1H5NA 2WP3T 2HLAA 1FCCA 1J9QA 3SCMB 3ZL2A 3BMWA 3UO1H 1JDCA 4PRHD 3DPBA 4IGBA 4MQXD 3GRWA 3P11L 2OMYA 2GK0A 3WMQA 2Y7LA 2W60B 1HSAA 3GZOA 1LEIB 1L9PA 3T77A 1FLRH 5T33H 4CC1A 4CVXB 3IGLA 1ZE3H 1Z0MA 4H4NA 3LV3B 2DYPB 3CZUB 3CWGA 3FRPA 3U4EB 5LN8A 1A7QH 5DRNB 2HFGH 2YJQA 5D2NC 3OR7A 1N5YL 4ODXB 3ZRSA 5IHUH 3OX8B 3D3VE 4F9LC 3L1OH 4HSCX 4JL2A 1KYDA 2NT0A 3QJTB 4HWBH 4U7SA 3RGVC 1E9QB 2AJZB 2A6DA 3D85D 1QD0A 3GK8H 3QH3B 4H8WL 2NY3B 3LIZH 1J05B 5AW4B 1BXXA 2HWZH 1FL6B 43CAB 4RFNB 1B6UA 2NXZD 2YUWA 2NQDA 2RFXB 3GXTA 4PW9A 5CR8A 3VGAC 5IUCA 2DL2A 2DEYX 3CVIL 3VE0A 2JELH 4LGSB 5D2NE 5KZCB 2JK5A 3QYCA 5DUML 2YGVA 4NN7B 4DZBA 1AQMA 4PN6A 3ZKXC 3EOAB 1U0QA 3MUHL 4JHAL 3T6QC 5CP7A 3TIEA 3AWEA 1ZTXE 4O2EB 3LS5L 4A2DA 4QRRE 3MBEB 5CBAB 4DGVL 5KS9F 4BCYA 4F9PA 4EIBA 4GFXA 5DZLA 3WS6C 1IQWL 2VJXA 1U6AL 3FUHA 3KNBA 5B4MD 1T6VN 4Z3IA 3FTYA 4QO1A 4A2LA 2BNUB 1PYWA 4HIQA 3MJ7B 4G8GB 1E8WA 1LEKB 2X1PA 3PWUA 4M5TA 2JIPA 1MJUL 5C08A 4X4YB 3KDMB 1JFHA 1SLUA 3U4BH 3NSJA 4TMPA 1R9FA 1KGWA 4RWHA 4GRWB 1PDKB 2BJML 4K07A 3IRCA 3BH8A 3RG1C 1ET5A 1NAMH 4UDTB 3QXAA 2FIKB 4U1NA 5IOKA 4AVHA 1GYCA 4KKRA 1E4KA 3MA9H 5LQBH 4NIYE 2J2ZA 1EDHA 5KJ4A 3WLBB 3NIFE 5DHVB 4ZFQA 3EJUA 1CLVA 2EZ0C 2GB2A 5SWQA 5KYYB 4BH8A 3E2HB 3VFGH 4EI5A 2FBJL 1KZQA 2ALWA 1A9EB 4U6XA 3QWQB 1P5VB 1NPNA 3RX7A 2WMPA 3FQYA 1SJXA 1FCGA 4FQJH 5EU5B 5CGYD 4YX2H 3QDJD 3ZE0F 3LPWA 3NT0A 2VL4A 3FB6B 1M7IB 1UGKA 1UQSB 5JIPA 1Q9LA 4I3RH 4UZUA 1IO4C 4MJIB 3DOIA 1Y4ZA 1EAPB 2DQJH 5D4JA 2ZOLA 1ZHLB 2XVLA 1MZYA 1BBDH 3RWHB 4YXHH 1ZSHA 1JWSB 2N7BA 4WSGA 5ELIA 1JS4A 1UM4H 2HT4D 5FLVA 4DERA 5AVZB 2F5AH 4F1SA 4JFWA 4NKDA 5FO9A 4HEMA 1GTFA 3P30L 4DGYH 3RI5K 3QPQD 3EH3B 4KO6A 2HKFH 2B2XL 3U79A 2HH0L 2EIDA 1JYWA 5K93A 1UJ3C 3KWVA 4G7SB 3CFJA 3ZIMA 3QHZL 4JM0A 5FYKL 5C8JA 2X0UA 5B8CB 4AE0A 3SB3A 4GP8B 1EZUA 3CXHJ 1M3IA 5HY9B 4AT6B 4PJDA 1WWAX 4YDLB 2Q8BL 3UMTA 3L3GA 1AYRA 1NDGB 4HJTA 4LSSH 1ILSA 5TE4L 5CCGE 3CZBA 1SQMA 4V33A 3UTZB 2A9CA 3WY1A 3IWUA 4U31A 2R29L 1ZVSB 1QSFA 2MCAA 5T3ZD 2YHGA 3SDXB 2FL5A 1YVLA 3PAUA 1EFXB 2XX1A 4WW2F 3GMOA 1EWHA 1BZOA 2P8PA 2XTLA 2YD0A 1HNFA 3MRLA 5MHSE 2Y22A 1ZVYA 4H1LH 2ZG1A 5DSCA 3BZEB 1UEMA 3SYAA 5I2IB 4F15C 4UM8A 1P1ZB 1PU0A 4CSPA 3QRGH 4OIIH 4AX3A 2BDNL 2FEDD 4XB3A 5C08D 3QO1A 3RZCB 4U1JB 4Z0BL 4YDMA 4HCFA 5DFVC 2A73B 2L8AA 2CSPA 5H2BA 1T20B 4L8SC 4ZX3A 3X2JA 1RFDL 4JZNA 1U3YA 5AB9A 4AUYA 1XIWA 1YNTA 2WOBA 1H3WM 2ENJA 4AM0Q 1W2KT 2UX6A 4NQDB 2A77L 3FO0H 3HUJF 4XXDA 1OGPA 4DGIH 3IS1X 2K70A 1AZCA 3VXNB 5F7UA 1KTBA 3OLEA 4JCLA 2X2YA 4YNYB 4RDBA 2A1WH 5IROC 3MRGA 5D1XB 1LE5A 5F7YC 4F80A 3QHFH 4ZW7A 1DBML 4K7FA 5LVEA 1HE7A 5A7EA 2DBLL 2ZP0T 2PP9A 2R15A 1D6EA 3SBQA 4O02A 4PRIE 2CZNA 2BNQA 2FEJA 3GHEH 3T6XA 1O7DE 1KTCA 4M5SA 3W5NA 2VPXA 2JB5H 4HUKB 2VPZA 5KAQG 2FQEA 1PZDA 2XA8L 5T3ZL 5HI5C 4QOKD 1A9BA 2GHZA 4CVUA 4CJ1A 2P8LA 1OW0C 3MODL 1NCCH 1CJYA 1AA6A 3QXTA 1NDMA 4F8NA 1QABA 1G6RB 3QCUL 5AZUA 4P5RA 1DVFA 3SGDI 4PR5A 2NYYC 5AAMC 2E5EA 3BISA 2A83A 3RWEB 4HFUL 4Q56A 4GRWH 2ATAA 1DJZA 4R3SA 2PYEB 4IBLT 3AABA 2RQEA 4G6FD 5LCVL 5L8LB 2HRHA 2NY4B 2A6ED 2KUTA 1FVCA 2WTRA 3VD2A 1ZXKA 1MJ8H 3SE3C 5DMKA 4L3EB 1RZIB 1M2VB 3SE6A 2KKQA 1GRWA 3VB9A 3I9PA 1KC5H 1GMIA 2DICA 3WKMH 3HN5A 3G6JB 5JOFA 1J0YA 2LAGB 4Z6AT 5KVEE 4FQQB 3IB4A 2XWBB 1INEH 1SLVA 1OCZB 4XGZB 3CG8A 4PJBA 3HLKA 1E2VA 1AGCB 5I17A 4N26A 4KQ0A 1D5BA 4M93B 4UT6L 1BZ7B 3FN0H 3PIQB 3KYKH 5C0BD 3LRMA 1ZHBB 5CIPA 5DJXA 2XQYK 2XJLA 1AJ7L 3WFEH 3CZJA 4CN6A 3MV8A 1BEYH 4MA3A 2LLLA 2GJ6B 3ZR6A 4QRUB 3UZQA 1G7LB 4BFJA 4ZFFB 4LDCA 5HJ3B 5ICXB 4YL9A 1KGXA 3IGUA 3QDAA 1P4UA 1SXAA 2XRAH 1P4LB 4TSBL 4WSJA 1KCLA 2VLMD 3PDGA 1I7UA 1AD9A 4U1HA 5FF6A 1SUJA 1F8TH 3JTTA 1KYAA 4HEME 2WANA 5DD1H 2HSIA 1M1XB 3L81A 3O4LA 1IIKA 4IMKC 5K9OB 3II2A 3FCBA 1C9SA 4JPKH 2FR4B 1OP5K 4BSJA 2GSIA 2VITA 5DEFA 1Z1WA 2UXTA 1R1CA 1F6AA 2X4OB 1N3NB 4TUOB 3HG3A 3IDIB 1QUPA 4XO9A 3GBEA 4DP1X 1I75A 4N2AA 5H35B 3VFWB 2DQ6A 2ZOUA 3EGDA 5FUOH 4OFPA 3PPSA 3PHQA 4G9FB 1HWWA 1R4XA 4MMXB 1DVUA 2LHAA 3I3DA 3VXRD 5L0QC 1CG9A 4NFDA 1KQGA 4UDUA 4TLSA 2OX5B 2VN5A 1E2ZA 4RSVA 3O9WC 4MJ5A 5LBVA 5AOKA 4MB4A 5HD8D 4Q9CA 1BYNA 1MREL 4OZ4A 4HJIA 4KQ4H 2I85A 4RGOL 3IK2A 4XP1L 4JB9H 5D1XE 1XX9C 3FQRB 4KHXL 1ZJAA 3TBYB 4XPAL 5JR1H 3QRBA 4BQ6A 3REVB 4J1UB 1IZKA 4Y2LA 1P53A 1F3JB 1H6TA 4ZFGL 3KPMB 1YYML 2BVPB 4NP4L 2CM6A 2ZSVB 1AXTL 3BGFC 3M17B 4E5XA 3C9NA 3RNKA 1T5WB 1QR1B 1U8HA 1RK0B 3LSOB 3RWFA 4JGNA 1M7DA 5IW1B 5G4MA 5E9DE 2K0RA 5I6OA 4OGAC 3U9PL 2J5LC 1JZ2A 2A4CA 2VN6A 4R5XA 1CLOH 2VLKE 2WCGA 4CC4C 1LDPH 4RAUA 4PLNC 1T5XA 3ZT5A 5IBUG 5JZ7C 1I8UA 3BFWA 5KSVB 1P7HL 2W60A 3SE3A 4AQAA 2V2XA 2WZPA 5JNYB 4O02H 5AYTA 1VFMA 5MEPB 2BCKA 2Y72A 4BFIA 5A2FA 1DSYA 3IRPX 3SGKC 1JRHL 3V4PB 1PEWA 1HH9A 3CSYB 3M86A 3MNMA 3DMRA 1SHXA 4LIQH 4QIRA 5BV7C 4UAOB 1LD9A 4DNLA 1HCYA 3ULUD 4IBWA 4UZSA 4NM4L 3FT3A 3N41F 5BZDA 2Z8SA 1NICA 4PBWD 1KIQB 5HGAB 3VX0A 4PY7B 1KTLB 1SOSA 3CFEB 3KBPA 4YHNA 3C8KA 5FYJH 5H94A 4LLMB 3MLUL 1IGML 2WC7A 4NQXA 4LSSL 2V17H 3KE0A 4LRIA 1S3SA 5IG7A 1DJGA 2UZYB 3VCLB 3MLVH 3KPRA 3IU4H 1HILB 5BZZA 1U8PB 1JGUH 1G1CA 1PZCA 5INDB 2YAHA 3TNNA 2NQ3A 3SY0B 3VQ1C 1M9SA 1D9KC 1BIIB 4LSQL 4FMFA 1MCOL 3QJHA 2G5UA 4E41B 4FQLH 3GZQA 4M43L 2JJSC 5IHZB 4FFWC 3BH4A 4FHKA 3NCEB 2ATKB 2YC1B 4NCC1 1S7WA 4RFOL 4YLQT 5ADPL 2UWEA 5FTLA 3HUJA 2AK1L 4KV5F 3H7BA 4LVOC 5I8OL 1UJ3B 2WKGA 5AW1B 3GBDA 4BH7B 1CLOL 1EJOH 4R5VA 3LN5A 4JFFE 4HWUA 1QRNA 4FJ6A 4MMYB 1O6SB 2ZUYA 3QIBC 5D7SL 1M71A 3DETC 3RVVC 2CHZA 5DLLA 1FZOB 3MRIB 4ISVB 1HDMB 4LCWD 5BS0E 4I2XA 2ENQA 2HUEA 2XPGA 3MNVA 4N2CA 4OZHE 5SV4A 1PQFA 1FZKB 2NY5C 1TIUA 4PQXA 5CWSA 3PWUB 3KJ6L 3ZTNL 3THML 4W68A 2WZ0A 1FFNB 3K7UA 3WTVA 4JB9L 4FLOA 2OYMA 4XMPH 4UDTA 2A9DA 2GTWA 1Q0XH 1YEDB 4MX7B 4DVRH 3R18A 2HG0A 4WFGE 3SGJC 4UZGA 3LDBC 5LNGA 5MEOA 3S8GB 4WUUA 4CRYG 5DMIL 1FWXA 4TSAH 3RZCC 2DYSB 3REWB 5TF1L 1G7IA 1XF4B 2R7EA 1HINH 4LLYA 1P5VA 4FI6A 4DK6A 3Q5YA 5D70H 1KTJA 4JQVA 1TJIL 4CKVX 4J2QA 3JYBA 5C0IA 1H5BC 4NQCD 1N10A 2ZF9A 3TONA 1M42A 4GUPB 4K94L 4L2LA 3LQZB 4OU3A 1X5AA 2ZOLB 2W0LA 4OCNC 1MXDA 4FG6C 4UINL 4ELDA 2AJSL 2AXGA 2ZAGA 1A6UH 3U1SH 3A24A 1SQ2N 4QRPB 3MYZA 5E8NA 4FTVA 1UB5A 3MNZA 1XBRA 2X7LB 5HHNA 2G3ZA 2R4RH 5L2JA 1LVEA 4LLUA 2FJFA 2VQ1A 4N2LA 3RB7A 2D31A 2AQ1A 4RAHA 3AACA 4LCIL 2WXNA 3D0AA 1EV2E 2X87A 5D2LF 1TTAA 4FQXA 4MNQB 4OD1H 4ZUVB 3TFBA 4AYID 5JA8B 1T89A 3VD9A 4ONFH 5JO5A 4PIBA 4WO4B 3UC2A 3L7FA 4XAWH 4KVCH 4K3GA 2A38A 1JNHA 2EKJA 1ORSB 5IV2A 3SGJA 2R8SL 4HD9A 5EBGA 1YRKA 4AL8L 4KZDH 2CO6B 1KNOB 1XF5B 3MRPB 5LBSH 4AYFB 3M6DA 3ATBA 4FF9A 2IAMA 3PP3H 5EC2A 3RIKA 2AKRA 5D7LB 4BFGA 4ZXBA 4Y0GA 3RZCD 2R39A 2VTFA 4FNLH 3VSUA 4JAMA 4IHOB 4U1SA 1DQVA 2MFNA 3FCTB 1GZQA 2P7TA 4IOSA 4J6RH 5BVPL 5IB3B 1I9RL 5BVPH 1A6VH 1CICC 4EOWH 1TJHH 1RZJC 3OBAA 4MB3A 1OPGH 2IG2H 3A67H 3JWDL 2VNCA 5DURB 2VYRE 4AUJA 5SWSE 4HHWA 1IC4H 3O6LH 2P5EA 4JG1L 5AW8B 2ICWA 5JOEA 5SX5K 5T33L 3HRZA 1OEZW 2C9UA 2G0LA 3D0VA 3KCPB 2ILLA 4G8GD 3LIZA 3HG5A 5LBSL 1AQDA 3O9WA 4L48A 1WCBB 3VD5A 2W94A 3P3UA 4CSTA 3F7PC 5D1ZB 4PP2A 4WFHE 2DWDA 4XOEA 4BHUA 5F7DB 1JI1A 2APTA 1QBBA 1XIWB 2ZKYA 5EEVA 4M8QB 3B8SA 5F9DC 4N0RA 4XXDB 3IFPA 4HUCA 1HH6B 3ZIYA 1KCSL 3DI3B 3NTCH 4MD0B 3TCXA 1OL0A 4NDMB 5JHBA 3DRTB 3MGAA 3N2JA 5DC9B 1K8IA 2PKDA 1JF5A 1WFTA 1OAQL 5F7FA 3HHRB 3ISRA 3O3BB 4NOFA 1ZLUH 2LFEA 4WUUD 3CDCA 3EYVB 1A7BA 3CZKA 4X0NA 4AQ1A 2YR3A 4TUKL 1BFTA 5D5ME 4K23H 1XZWA 3LKRB 4MQ7A 1I53A 5E2TL 2QFRA 5FYKD 1XF3B 2R4SL 3MV9D 1GZHC 4N22A 3C60C 5F3HB 3GNML 4YHMH 3S3JA 1FZMB 3KBHE 2BHZA 4I7ZC 4UTAL 3C5JA 2A4ZA 2E46A 5MEQB 3MA7A 4A2FA 4F7TB 2Y24A 3FT2B 4QJ5B 2UXVA 1Z32X 4Q52A 4UT9A 2QVFB 3VRIA 3JTSB 4NCDA 3GB7A 3NFNA 2HTLC 5HHXH 1M9WA 2MNJB 3H55A 3OKDB 2CGRL 4R97B 4U6VH 4HJGB 1UT9A 3ZYZA 1HK6A 3HAEA 1NAMA 5I18H 2MCMA 5DRWA 5IW3A 3DRQB 4XPHH 2W92A 3D9AH 3MU3A 4CKQA 2YOAA 2OXGB 4X5LA 5LKNA 1CUOA 5K9QG 1CU4H 4XCNB 3CVHA 3DX1A 4MLSA 1OE2A 1RJCA 4LKXB 4ONOA 1CDCA 2VDNH 1MJJA 1G1YA 1ZGLA 3DDGA 5E6IA 3ATAA 1WWBX 2NXYD 3WNPA 4XP5H 5IFHH 1RJLB 2GAEA 4OLYL 5D7HA 1E4KC 2KPWA 1YEHL 5AB1A 1RVFL 1OT2A 3P2TA 4JREC 2XXFA 4Y9CA 4AJ0A 1GJIA 1P7QA 3BKML 3WL9B 2W9DL 4AEIL 3LZRA 5ENWB 2EO9A 3FDWA 1NC2B 4FCAA 3QEQE 5J8OA 4G5ZH 2DM7A 4LVEA 1ETB1 4YUEL 1J1XL 1OSZA 1X5GA 4ZTEA 3VFUB 4S1QH 2BFVH 2GIYA 4X8JA 4L9LA 1BOGA 2HTKC 1SVZA 1ZS8A 1I1RA 4R2GD 5JHAA 1JFQL 3FTUA 3RGVD 4PWIA 4XMUA 4HPYL 3TV3L 1WAAA 3DROB 3W9DB 1HQRA 3TIWA 5BS0A 5J6SA 2FGZA 2Z8VC 4YXHL 4BYHA 1GY1A 1F90H 2ZNWA 3MN8A 4NQDD 5A7BA 5KSUA 1B2WL 5TQ0L 4P5KA 3IEAA 3WEMA 3MMEA 1CR5A 1PLBA 3CNKA 5F89B 5C0GA 3VM7A 4KI5C 4LLQA 3U6RB 1YC8A 4R7LA 4DCQA 3V0JA 5IB2A 4B9IA 1I8KB 2GJRA 3DA0A 5FUCE 5DT1H 3SYOA 4DW2H 5B6CA 4JVPA 2EO7A 3Q9QA 4G9FA 3RVWC 3VYOA 2FCBA 4OKVB 5D5MA 3I6LD 5TK4A 4X7TA 5H4YA 4UIKH 4GRLB 3ZE1B 3UDWA 3M1BB 2FHBA 3L9RB 1A7OH 1QBLL 4QOKB 4L29B 4RGNB 1FORL 2BVEA 2FX9L 3AREB 2J8UA 3QIBA 3ECVA 2I7OA 5DR5L 2NXYC 3CE1A 3KG5A 3VA2C 4JM2F 4KMQA 2A9ML 2F53E 4BCZA 4MLIA 5T1LB 1T1XB 3OC5A 4H0GA 3FF7A 3D50A 1FNSL 4N85A 4I87A 4ODTL 5GGRA 2E4FA 3KPMA 4ELMA 2D7TL 1NGPL 2VRQA 3L6FB 3NIFF 4AJWA 3OQ3B 1NANH 4YHOH 3LSOA 3FQXB 4YN3A 3RWFB 2ENYA 4LK4A 4KX7A 4QRRD 1ADQH 3ENEA 3GXFA 3JQOB 2QVKA 4NKOA 3N55A 4XVSL 1FDIA 4OF8A 4BGDA 3K71B 1IMHC 4PJBF 4TYUA 2IPKB 2PTTA 2VDNB 2V2XB 3H3BC 3NZSA 2MRYA 3R4DA 4FXGB 5FB8A 1DR9A 5CUSH 3SGDH 4ILDA 3QQ3B 5DRZA 1TG8A 1XGQA 5AOIA 3VXSD 3ZKMD 1SXBA 4X6DF 4XNMB 4F3FB 3EFDH 1TVBB 3UAEA 2VLKA 1LD9B 3U46A 2V9TA 2XTSA 2PUQT 1J5DA 2BNRD 3KHQA 2ZOOA 4LL9A 3VFVA 1QWHA 1PF3A 2DQEL 3FO2B 1Y1DA 4Y5YA 1WAEA 1P84J 1T0OA 3L4VA 5E5MB 2L4OA 1ZHKB 5AOJA 2QDWA 1E18A 1CLCA 1DQML 4BK8A 1M2OA 5C6PB 1WGOA 3SUJA 3RNQA 2NVYA 1C5DA 4X4KA 1RP9A 3GJFB 1TVHB 1IT9L 4EBQL 4URTB 1M1SA 1EEZB 4L0ZA 2OMTA 5INDA 4YDVA 3RFRA 2BP0A 2XOTA 3QJHB 3TF7C 3G5ZA 3NJGA 1E50A 3G6JF 3CQPA 3ZE1E 1E28A 3J07A 1Y1WA 3AY4A 3OPZL 4UYQA 3PV6B 1WFNA 1ZANH 3UAJA 1TZOA 1CXIA 4O4YH 4FRWA 4XO3A 1E30A 4IBZA 2AGJH 4J39A 1JGIA 2EDYA 5DJZA 1UENA 2BINA 1QP1A 3V4VA 1L7TH 4M62L 4PJIF 1A21A 2X5PA 1E27B 4M7JH 5SWZA 3QZLA 4N8CH 2VSCA 1FJ1B 5DYFA 4KDTA 1S3KH 3MO1B 1CBJA 5D1QB 3MX0B 1EHLL 3SEPA 4JREB 3TYFB 4LPCA 1JF6A 5CZKA 2QGDA 1D6VH 1AZBA 5B7FA 1UADC 2ZXBA 4MNQE 5HI3C 4C2MA 4PTTA 1IM3B 2WWNA 3UEZA 2R29A 1U95A 3FO9A 3U7YH 4Z7VA 3DJZA 3GEFA 3L3DA 4DQOH 5KBNC 3Q2CA 4P2CG 5TDOB 1RZ8A 1TZ8A 3LVEA 3QC8A 4PYGA 5GGVH 2H8PA 4AVIA 1EAJA 4HU8A 4PGBA 3OHMB 3CHQA 1JGDB 1IFHH 1NCBL 4XPBL 3HE6A 5D7JC 1K4DA 3ILPB 3REWA 2HUHA 2V37A 3TTSA 2XV0A 1PEZA 3UTOA 3L4TA 3DDFA 1HU8A 5DLML 5I1IH 2VL5B 4PY8J 5FX3A 3H53A 4IJTA 1PG7W 5JORB 3VXSA 1GYAA 3GINA 2CALA 2EH7L 2CLZA 1FFOA 3KHOA 3KWWA 4XBMA 4J3OG 1TKWA 2H1PH 3WO3B 4AMKH 4XN7A 2B3RA 3EJPA 2B5IC 1W0VA 2XICA 2ZPKH 4L3CA 3VXUA 4CMMA 5F6IB 1IU1A 5KVGE 3RFZB 1AZZC 1Q1JH 5E8NB 3EG9A 4GT7A 2OTWA 1W6WA 3FKIA 4M1CC 3FT1A 4L8SA 4Z7QF 1HEHC 3ZHDA 4FXKA 1IVLA 3L3JA 3VH8G 3LH2L 4OJAA 1TZIB 2WINB 3Q8AA 5LG6A 5EPMA 4OZFB 4W9IC 3SCMA 1YEEH 4PJ6A 5GSVB 5T5ID 1R19A 4L3FA 1KPUB 4L3AA 4MJID 4NEHB 3L2LA 3Q6GH 2DLEA 5DS1A 3UP1A 1VEMA 1XB8A 1JHLH 3VFMA 4DMRA 1BZ8A 2QVTA 5FK9A 1DFBL 7FABH 4XTRC 4Z78A 1VHPA 3BVTA 5KOMC 1R3LA 1A2YB 2R1YB 5GGSY 2E3VA 1E4XI 2VUKA 4LMQI 2BNQE 1I8IB 2P48B 3C75A 1ZTMA 4F7PA 2V3FA 1DQMH 2W81C 4M7ZB 5IHHA 4BZ2A 3CDGB 2VLRB 3RLSA 3DSFH 3OX8A 5AZ2H 5K9QI 4RMSA 2WLLA 5CAYB 3DGGB 5GGUA 4FNSA 2NNAA 3K74B 1YO4A 4KXZI 5CFAA 2F6AA 2BP3A 1CXFA 1EGJH 2GY5A 2WLZA 4F57L 1IVTA 1GGIH 2QJDA 4ODWA 1EFQA 4I9WD 1QLEB 3SDAC 4F9PC 2NUTB 2MTAA 3BWAA 4Y1AA 1UH2A 1T04A 3KPPB 1EVTC 4ZQKA 2OJ1A 3MTXA 2PYED 5EF3A 4Y4FD 4XR8C 2HRPH 3KBFA 1NFIA 2XTJD 5E6ZA 4WU7A 5LN4A 3WLWD 3EJYC 4PJIE 3TV3H 3VE0B 3RUGB 3U48A 3W39A 3NP4A 4ABQA 5LXGH 1KPRB 4JFYA 4RNRA 3BQUA 3P77A 3HFMH 1U8OA 2Q8AL 4FJYA 4HUUB 3SKJL 2BFVL 2O5ZL 3C60B 4BFNA 2QV4A 1OAUH 1QSFE 4KJYB 2HT3D 2F7RA 3WXVH 3V6OA 3ZDZF 3TIEB 4IKIA 2NY2C 3X2PA 5EEWA 1R6VA 4F37K 4JM4H 2FQDA 3GSRB 1PZUB 1CFQA 2MCPH 4HBQA 3IJHA 4J3TA 2N01B 4NZFA 4XZUA 5DC4B 2UZIL 3IKCB 4WAFA 3CFCH 4NHCL 3ZLQC 4CMHC 5TJWK 3T3ME 4Y5XB 5CCJA 1G7MB 1U8CB 2EDXA 4HKZA 4HK3J 1ND0A 1EO8H 1M7UA 2IOOA 1NIEA 2W59A 4QO1B 3CMOL 1BX2A 4LOEA 4NT6B 4KKBD 5E4AA 5ISZA 2V4LA 1HOEA 3BW9A 4DKFH 4TS6A 3OL2A 3KPQA 1RJZA 4WHYG 3DLQR 1HHJA 2D7QA 2FAUA 4L8DA 3MRFB 1TWAA 4LCUB 3U0WH 5DQDL 5LBGA 2TSBA 4MMZB 3QUML 1OOWA 4C4KT 1R5VB 1S5IL 2IBZX 1X9RA 3ARQA 3QUKB 1DLFL 4MTMA 2W9EH 1PY9A 3TFKD 3FUEA 3WNNA 3Q01A 5C0BA 4C55A 3OJDB 1B2WH 5DHVA 2JV6A 4NQTA 1G9NC 4U6VL 5HDQH 5B39B 1CDYA 1OGAE 3MV7A 3ABGA 1CXLA 4GLRI 4JHWL 4ZUSA 2OSLA 1DP0A 4NZRH 3EXLA 4WSKA 5I66B 4EUPG 4ENED 1T2JA 1Z5LA 1Q9KA 1RQ5A 4JPIB 1R3KA 3LZLA 4BKTC 1LL1A 1BJ8A 3FB6A 2AMGA 3QR1A 4LVNC 3E3QE 1IKFH 2YD9A 1FF5A 4MA1C 3B9EA 4XTRD 2JIQA 4Y2DD 3IETB 4I13B 4PWJA 2NY0D 4JO8A 4YFLF 5D7JB 5FO2A 4JFXA 4ORGB 4UAHA 3LRKA 4FQHB 1OGAB 4FQCL 3MR9A 3RKPA 4HG4J 4MB1A 2VE6A 2W1NA 3FOMA 3QUZB 1QQDB 1V3LA 2WO4A 3CFTA 1EVUA 5ID0B 3HZYA 1S7UB 3CU1A 3VW3H 3VI3E 3C2AH 5DDHB 1M7XA 3QVAA 2GT9B 3P2DA 4HGKC 1ZS8B 1LLAA 3UTTE 3ARYA 2BW5A 1L4IA 1DVQA 4LRNH 4M1DL 5LGYA 2CCLA 2VDNL 3OAZH 5C8JB 2OTUB 2W80C 4DN4L 3PL6D 3T1WA 4V2CB 1X5HA 1FAKT 1BPLB 4LO9A 4S1RL 1LE9A 1HZHL 2XWJB 1IEBB 2VH5H 2PN5A 1MEXH 2YBRA 4M7ZC 1P7KA 2HX9A 3I6LE 2XZZA 3GMPB 3MMEB 1TQVA 2AQTA 2QPUA 5GRJL 5J9PA 1YECH 4RQQB 5I18L 4FFYL 4Z7NF 1FO0H 4OZGA 4NXSA 8PAZA 2JQMA 3ARDA 5HVFB 5D5MF 5IB2B 4OCSH 1I8KA 5CP3A 5BZWB 3PU7A 2CO7A 3SD2A 5BOZG 3FQWB 5I1EH 4PLOB 2X2HA 3M8OH 5DJDA 5GZND 2RR3A 3QPXL 2Z34A 3ZQWA 3PP4L 5I6XB 1OSPL 4PJIB 3CN2A 4FQXC 4OLVL 3AREA 1BM3H 1FYTD 4KDWA 5F44A 2H0JA 3DHPA 4YAQB 4X98B 2VRAA 3B2DC 1YQVH 3ML9A 1SRDA 3CVDA 1T20A 1URIA 5EDSA 4N5EC 3KW8A 2OMXB 2CK0H 1IAII 2BRQA 3APFA 4NQDA 5EF0A 5F1OB 3L6FA 3I3EA 4LFHD 4MXVE 2KT6A 2WTPA 2IQ9H 4YHZH 1A4JA 3PWPB 4P9HC 3X12B 1LE5B 4Z7WF 2ZJSL 2FSEB 1RZ7H 2HLFD 1SJVA 1JGLL 2YQ2A 4L1SA 4XMLH 4X7DC 4YZFE 4GW5B 3FCUB 3SKOB 1AS6A 1QI5A 3C09B 4OFDA 5AVVB 4O00A 3LXAA 1DBAL 1QVOA 3HE7B 5FDYA 3H2QA 3LZQA 3QDGE 2BNQB 4FZEL 2OZNA 1KTDB 2PABA 3F04A 4AV4A 1CXHA 1XVSA 2DJ4A 4XNMA 4NZUH 1QBML 1RIVL 2XWZA 3HCVB 5KSAB 3CUPB 1YJDL 4J3VA 5EF2A 1TVBA 3VA6A 1T66C 3P73A 5KVMC 1CYXA 1TJHL 4BFFA 4G5AA 1WJ3A 1HINL 2WHVA 1MJ7H 3QT2A 1DEDA 1S9YB 4OIBA 1LQSR 2X0VA 3NCWA 4KH9A 4XPFH 4F33B 5C2UB 1INQB 3ML1A 2I60L 2QQKL 4KRPD 1TQBB 3STZA 2ADFL 1MWAA 3QAZB 1DJIA 2Z0UA 3RNQB 4WU5A 1SMDA 1NIBA 1VFBB 2VLJE 3O8XA 2EEBA 4FGMA 1LQBC 4R7XA 1TVHA 4EIUA 2YMOA 3K72A 5LGKA 3V5DB 3V0AC 1QPXA 3AU0A 4XB8A 1W91A 4JQXC 3DARA 4HMEA 5JUEL 5IQMA 2Y07L 2ZP9A 2AMUA 2APVA 1NGQH 3V9CA 1MLBA 2NAPA 3ZZQA 1UA6H 2GAZA 1EO8L 1NIAA 3CQFA 4PGCB 4Y19A 5HHPB 3VD3A 1MI5B 1F0LA 1ZK9A 4LVHC 2JCCF 3N0AA 5I17B 2TAAA 2OYPA 3ARDD 4L4TB 1JERA 2YD4A 3BEVB 1ZT4A 2VDKL 3CCHA 3AG2B 2QQLH 3TNMB 1MAML 1SY6H 4N2GA 2LTQB 4QTHB 5KBDA 3LHPH 3ZHFA 4GKLA 4F7KA 3SDCB 4UM9B 2B39A 2BZCA 4AM0B 2Y7QB 4XC1H 5I6LA 5L2KA 4P4KA 3BAWA 3HC0A 1YMMB 4FEIA 4M5ZH 5F7LB 1L5GB 5DVPA 4HUVB 2N4IA 4P5MB 5K39B 2DQIH 2Q76A 4PWGA 1YZZA 1UATA 5FO8B 4ACPA 2WQSA 4G7VH 1SEBB 4JY5L 4R7NA 2MCG1 1J5IA 1USZA 4KRPC 1FRGL 1ZTXL 3NRFA 5HYJA 2L7EA 2YD1A 1XIWD 1A02N 4ELMB 2OSWA 2H2PC 5EUOB 2GJ6E 1JZ4A 4UQAA 3QYNA 3H0GA 3SE9H 2X4RA 4CRZA 1ORQA 4YLCA 1X9UA 1XD1A 4AKPA 4FS0A 3KPLB 4KY1L 2XFGB 2FWOA 4OLXL 5EF1A 1H0DB 3B2UD 3PHQB 2BS71 4G80A 4HDIA 4KO5A 1E8ZA 4OBSA 5FM5O 1UUNA 2RHEA 5A2LH 4AQZA 3GTGA 2AQRA 3ARWA 1BVLB 2C4FT 5EBWA 1JRHH 3P4MA 2CLVB 1TKWB 1S7QA 2PCYA 5DUJA 3MJ9H 3CN0A 4G6ML 4OIFA 5CJBA 1KJ3L 1BQLH 3ET9F 3ZW3A 5DJ0A 5CF3A 5C18A 2V7HB 4Z0XB 4DOHE 1H3VA 4FXKB 2MOVA 2R23A 3QUXA 4N2MA 4V1DA 5C0AD 1EHNA 3CDZB 2NY3C 1NCDL 4GKNB 4AK2A 4AYMC 2MOQA 2WINA 2B4CC 5KVDH 1S9WB 1RK0A 3FFCD 1OCWH 4M6NL 2J6WA 1HAUA 5D9SA 3UO8B 2WXQA 2QHRL 4RWYL 4LPUA 3TT1L 4Y5VB 3VUAA 2PO6D 2DQFA 4JDZB 1QNIA 4OM1L 3L5IA 2NY1C 1SMYD 4MA7L 2VSDA 3VI4A 5HYJE 4Z78B 5BRZB 1MFAL 1U8QB 4B95C 1L3NA 3V4PA 5D1ZI 5GIRA 1ASQA 5ESAB 2ZONA 4KU1A 5C71A 4Y4FB 2VUOA 3OKNB 4HIEB 1NLDL 2LU5A 3RVWD 3RWCB 2ZUUA 5FW8A 1OIOA 3QNYA 3D09A 5KYNA 1ML0A 3PP3K 4RH4A 3CFKA 5LDSA 5FYKE 1GPOL 2IWKA 3EOTH 4DF9A 4F7MB 4BZ1L 4ETQA 2OL3H 2ITEA 1KLUA 1COBA 3NZHL 3TU6A 1MPAH 3D85B 3SN6N 4JFQB 5E00B 4EE2A 3OUGA 1NFKA 2MSPA 4U7KA 2WBXA 4B5ZA 1GOFA 5IZ7A 1B0RB 1AP2B 1HVXA 4LARL 4F7EB 4CVZA 2ROXA 3P0GB 4EIZC 5HDBF 4Y89A 7FABL 1SHWA 3SHSA 1XGUB 4C57C 4JVUA 1HHKA 5CU5A 1F97A 3S5YA 2RCSH 1IBGH 3VI4F 2H3NA 1U8OB 2LLGA 3WEXA 4HETA 1OAYH 1YEIH 2CRZA 1IAIM 2NW3A 3MFFB 2FEEL 1XF2B 3UP6A 1XGPB 5EH1A 1KPVB 4R7DA 4XNYL 4MCYA 4RFNC 3G04A 1MFBL 3QZWA 4ZTOL 4WI2A 4AENA 1QZNA 3EYQC 2YSTA 2R0WL 4A67A 1UZ8B 5CGYC 3OKOA 2B1HH 4MAYA 4MCMA 4YK4C 3I85A 2C1OB 4XP1H 3CBJB 2AGJL 1MREH 4KKCD 4Y5XA 5A2CA 3B37A 1U8CA 1YY8A 2G2PA 2RCSL 3DTUB 4HCRH 1J8KA 3BW9B 1VACA 1IZJA 3DOSA 1KB9K 3CU7A 5CILH 2VDMH 3FTXA 1PKQB 4W9EC 1CXKA 5D2LB 1LM8V 1PJ9A 2UVEA 3QDGA 4OD3H 4N2HA 3QBTB 4Y2DB 5E8EB 3BQUD 4QY8B 5AW6B 5GGRY 5I5JA 1WZKA 1ZDSA 3MREB 1UXSB 2VXUH 1JVKA 1OW0A 3NPSB 4Q6YA 3ME0B 2H32A 2EVJA 1QFPA 1RLBA 2X4QA 1JI2A 3WTUA 4CS0A 2CKNA 1O7VA 2JWYA 4XCFL 1FIGH 1PQZB 1X5MA 4RISL 3TP4A 4JPKL 3ZY7A 2ZE0A 2XJKA 2DQEH 4IW4C 5KYXA 1OP4A 2FQGA 4OCWL 4GOSA 1U91B 1JZEA 4Q14A 4I0PD 2OMZA 4JM2D 3QDJB 4K5LA 3WFBH 4TM9A 3O4OB 5KUKA 4YJZL 5IQ7H 3SO3C 2OMUB 1BW8A 4EN3C 1RUQH 1XR9A 5IQ9B 2D9QB 3RYMA 3K6NA 3KYMA 4NRYA 1S78C 4KDIA 3LD8B 1I8LC 4Z95H 1BEYL 2VW7A 1U3HA 1FUNA 5ESVA 5HHNB 1SOQA 3BFOA 3ATEA 3KYKL 3ZSSA 4QLWA 1TPXC 1NQBA 2PO6B 3HG0A 5FFGA 1IC5L 5D93B 4O4YL 4LCYA 1WHOA 1EU1A 1A6ZB 2XY2A 3SDYH 3EYOA 5KTEL 3RDTD 4G2AA 3QIUC 4X7CC 3VXTB 2CGYA 4EXKA 2BWDA 2PWDA 2FYVA 2ADYA 2C3GA 1MRDL 3LNHA 2EXYD 4DUVA 2P5EE 2OTUA 1JNHB 4IMLB 1A6AA 4WHTA 3KGUA 2DLFH 3OHXA 4TNWF 2VUMA 2DY2A 1HCVA 4Z7UA 4DUXA 1MJ8L 2OTPA 2XWJA 4GY4A 2WIIA 5C0JA 2OK0L 2RGSA 4G3YL 1IBDA 3IDMB 3KWXA 4K8RC 3T0XA 3MNWB 3GSUB 1OLLA 1TENA 3FQTB 3NEEA 1A7OL 4UOJA 1AW8B 1RU9H 5HPMA 3WELA 1CO1A 4L4VD 3TLRA 4F5CE 2OYLA 4HFUH 1DVSA 2YK1L 1CLZL 3SQBA 4XH2B 2G9HB 3VI3A 4NGHL 2B08A 4XN8A 3SKNB 3B7RL 1PS3A 5AB2A 1S9KC 3VMNA 1IJ9A 1TLKA 4N5ED 3GD1C 4NNXA 5JMOC 5EN2B 4WGVB 4WNQA 4XMVA 5I0XA 1S7XB 3BP5A 1IBZA 3BSHA 3JWNG 2VZ3A 4KK8C 2IV9A 2J25A 4RIRB 2ZIDA 1QLFA 4X98A 1UWEH 4ONGH 5IFJA 3QCTH 5ACLA 4OI7A 4FXTA 1C08A 4M6OH 3U2SB 4E0RA 1RPKA 4H40A 4PP2B 3S3PA 3FRPG 3DX6B 5DS8A 5SWSB 5IEKB 2VQUA 2X0WA 4XNUL 1L9RA 1MNNA 2OULB 3ES6B 4P9HH 1A5FH 2PMZA 4JPVH 2NDGA 4DKEL 2XVGA 4KVNH 4O51B 5CS7A 4MD0A 2OAAA 3EJJX 4XC1L 5H4ZA 2DQHH 1SFDA 1HCFX 5IW6A 5HHVH 1PW3A 3VNZA 4HOXA 3CX5K 3B7SA 4FYRA 1ECYA 4JY6A 1OM9A 1C1EH 3DXAB 3MRCB 5EUOF 4FG6D 3NIGE 1OM3H 3LCYA 2EYTA 1AGDA 2BY3A 3O3EB 1NCOA 5EBMB 5FTNA 1PAMA 2AP2A 4LKCB 1AO7A 4MS6A 1QRKA 2OXHA 1SYSA 3HBZA 4MNQD 5EZOH 5CCKH 2HXAA 5D71H 3SE8L 2AS5M 1KG0B 5AVQB 5CBEB 4Y9BA 1ZK5A 4I3RL 4OLYH 4X5RA 3TIDA 1FBIL 1TU2A 2J6EH 1HKLL 3C08H 3DV6B 3KPSB 1HN1A 5D96B 5IF0B 4ANWA 4G8GA 2VGLM 4PLKD 4UNVA 4IDJL 4JPWH 5DC2A 4EZKA 3WEOA 4OVUA 3S88H 1R27A 3G9VA 1PDKA 4HLZG 4P23B 2N56A 4FTVD 3VFGL 1UOWA 1INQA 5ILTL 2NW2A 3IM1A 1BLIA 4ZMVA 3WCYA 3CZGA 3QQNA 5EU4A 5DRWB 3HR6A 4CGTA 3JWOL 5I16B 4OLEA 1KYOK 3U30C 3UBGA 3EGSB 3NCJL 5B38G 3UPCA 1NBCA 1EZSA 2X28A 5GSRB 4LF3B 1W9XA 5CKAA 5DHVH 3GKWL 3CVHB 3K4DA 5J1AB 2DEXX 2NTFB 1PNDA 4WY7H 1EXGA 5KYUB 4U6HB 4NRZA 1DUYA 2LTQC 2ZX6A 2H6PB 2CIKB 3EO1A 4LSUH 1Q9LB 1TQUA 1E5AA 3UACA 4QJ4B 2FO4B 1VENA 4JFEE 3VB8A 3HUJE 2CR6A 4H88L 3LKSA 4N0YL 4AGPA 4DPCX 3LHPL 1IC7H 4OGQC 1WC7A 4C4UA 3HB3C 4XNDA 3SDCA 3CFBA 2OR9L 2CU9A 3GF8A 1A7NH 5MI0C 4KK5D 3E0GA 4U4IA 3LVTA 1G7JA 3QWOB 4HGWA 2YXFA 4W4NA 5FGBC 5KG9A 3MSPA 1JXJA 1L5GA 1AQKH 3RRQA 1RURH 5SWZD 4NQSB 5IFHL 5FUZL 4HUVA 2DIJA 1Z9PA 3AB0B 3BVWA 3TEZA 1WDAA 2JELL 1E6JL 3QIWA 2MNWA 3CFJB 1ZDQA 1UFUA 3C6EA 4XPTH 3NVQA 1O0VA 3B5HA 5L9DL 1SBSH 3M1CA 3VMOA 2C9PA 4OBRA 4JRWA 3WNMA 3GXNA 1QFUH 2O6EA 1CPUA 1T1YA 2J12B 1A1OA 3HI1B 4PG9A 3TWYA 3VXOA 3GHBH 4WFHD 5DZVA 5EOTB 5F3FA 5AW5B 5EU6D 5GGVY 5IMOA 1T0NA 2Y23A 3IXAA 1OPGL 1YEFL 4CDGC 5EIQA 4AUUA 5D4QA 2GUYA 5IB4A 1DDHA 1OF0A 1UZ6F 1N67A 3CN4A 2V9RA 3M07A 1N5YH 4OKVA 4YHLH 1DMSA 1QDNA 1NOFA 5FM5M 1RZKC 4GRLA 1B4JL 4LCWE 1KN2H 3QQXA 3FB5B 3L9RA 2IALB 3GDBA 1F1DA 3NSDA 5EC1A 4E41E 2YAPA 1XH2A 4GG6B 1NUDA 2WWOA 1I4FA 4FNPA 4ELKA 2CLVA 4C47A 5KJ7E 3HU1A 3GFUA 1DBBH 1ACZA 3B2PA 4XPTL 3I02B 2A6IB 3ZDXF 4KVCL 1TSHA 3EW3B 1VZGA 1JHKH 3CHPA 4XMLL 2W65A 3SPIA 2P24B 1FAIL 1OAKL 4G1EB 3DBXA 1C16A 1G0YR 1SLWA 1U58A 4EN3B 5IT2L 4JE0A 2TSAA 4ETYA 1AGFA 4F2MA 4E9SA 4HWZA 1DN2A 2BVUA 4KWUA 5LNEA 2D2CC 4NKOB 2F61A 2C9QA 4I1RA 3MYJB 4ZYKA 3BUQA 3WY2A 4TNGA 1NL0H 2J1WA 5BRZA 4PTUB 2V7NB 5C7ZA 2A4EA 4X5PA 1LO4L 4AJYV 5ABZA 5B39G 1JIBA 3GK8L 4CILA 3QA3A 4L8CA 1DQDL 2P26A 4Y4FA 2EYSB 2Y36H 2GFBB 3L3OC 1KCRH 1QLRB 4D2NA 1YLEA 3VXQB 3G5WA 1RUKL 5T5FH 2R1WB 5I1GH 3BQVA 2OI9C 4HQQH 2DKUA 5IJKC 4NQQA 4LGPB 5ESQA 1SXZA 2OZ4H 2QFPA 4AIXA 1A7QL 1JYVA 3OG4B 4DGWC 1MFCL 2CJUH 1AGEB 1SDYA 5D7KD 1SDDB 3L16A 4LLAA 4A7GF 3L3OA 1CBVL 5HYQB 4K0OA 2A7BA 4PRBA 4PV9A 4CVZB 4XVJH 4KAQL 4BV1A 2W9LA 3VXME 3BD4A 1AKJA 3WY3A 3BSZA 1MCJA 3U2JA 1V8HA 2YGNA 1E4XH 2PNWA 2HRLA 2XWTB 4K5PA 3MCKB 2R1XA 1X7TA 4Q2ZB 4ODSL 3WEXB 3KCWA 2D2OA 1CDUA 2AC0A 1HEZA 1CS6A 3TZVB 5AVXB 3MJ9A 1IEAA 3FZUD 1XGPA 4I77L 1A7NL 4CU8A 4EKXA 4Y2OB 1LWHA 3WENA 3MBWB 2Q7YB 4MCYB 1IGYA 1JP5A 2JXMA 1X6LA 1EERB 2XN9E 4HLEA 3GLZA 3FT4B 1Z6JT 1QO3B 5SWZB 3IJ9A 4ODUB 2VDOB 1UCTA 1P7QD 5BUAA 1MFDH 3UZQB 3JYCA 4YHKH 1PZAA 3ZX1A 3MX0A 5FM8A 2V5RA 5EU3B 25C8H 5HGHA 2Z31B 5KAQF 2DQDH 2X3CA 3NCCB 4Z7QB 3LEVL 4WNJA 2X42A 5I5IA 2WZPD 4KZEL 3DOSB 3C60D 3LKPB 4GP4B 3UGXA 4CDHA 2WBJA 4HC1A 4LSQH 2VMJA 5INCA 1KBGH 3QCTL 3OF6A 4BDVA 1UWEL 3UYOD 2YEQA 4ZFZA 5ADOL 4QIWA 1U21A 1XGTB 2GSIB 1AFVH 2BLFA 2MPAL 4DVRL 4J2XA 4R84A 2OI9B 4YEEA 4Y5YC 2WW8A 1DQTA 3QDME 1HE8A 4M29A 2V6HA 3KLKA 3RPIB 5IHWA 4NQCB 1E7VA 2Z6FA 2DWYA 4XWGL 3U25A 1Z3GH 4ZUTA 3WMSA 1BSIA 5I73C 3S88L 3VG0H 5B1CA 5C0EA 4JPWL 1DYZA 3ILQC 2NY6B 5HVHB 1CG9B 3ATFA 3Q2WA 4N8PA 5KVEH 4J3OC 4PJCB 4EIGB 2F53A 1Y18B 1CURA 3H85A 3UJJH 3TXAA 4JKWA 2JKNA 2OMUA 3KWWB 3ZVVA 1ITCA 2EDQA 2IEPA 1RKRA 3TVMA 3RURA 3FXIC 3H6JA 2JCCB 2YWZA 5F88A 3FQRA 5D6CB 3FO1A 1H19A 2J5LB 3G6AB 4FXKC 2Q87A 4YWGH 1D5XA 2NY7L 2B16A 2QGEA 4UOZA 1G9HA 1HHGB 4NXKA 4C83A 1DE4A 1TYRA 5T1DL 5KS9B 3BFQG 2ZSVA 3FU7B 4ZNEE 3RX5A 1TEGA 3IJ8A 2IQAB 4I18A 5C6WH 1QR1A 1G7QA 1W72B 2MWCA 3QNXA 5EZIH 3ZRCC 5F7HA 3IDJA 1CT8A 3MACH 3LEXA 4AONB 2C4FU 5C0DB 1D5IH 2K3HA 3WY4A 2WXJA 5DVLA 2V3VA 3P3YA 5J12B 2HRPL 4KROD 4AQAB 2X6MA 5DYOA 1MWOA 1YCSA 3LEYH 1UXWB 2J6EL 3C08L 4QXTB 1A3ZA 5BCAA 2JCWA 4AVRA 2R1YA 3L5WB 5ANHA 3MAWA 2XWCA 3FPYA 4WEBL 4BZYA 3O45A 2CO1A 1MCWM 2EADA 1NBVH 2O6DA 4F7PB 5JHLL 3NEOA 3GBML 3RU8H 2OS7A 4YPGA 2OPCA 1JWUB 2NOYA 5EO1B 1CIUA 3FAWA 4U3XA 1Y7VA 3FQ4A 2NNAB 3LZPA 4L4VE 4J5VA 1T0MA 2X44D 1U36A 3GSNH 4EAEA 4WNQB 2GK2A 3VGEA 2IV8A 2Z92B 4P5SA 4ODHL 4P5TC 3H9SB 3TT3L 4Y1AB 2DOCA 5HI4D 5F7EH 2ZUTA 3SSGA 4MNHA 1S9XB 5CZVL 4MJ2A 2FE0A 2A0LD 3DO7A 2DLFL 2KLTA 2EXTA 5JHDE 2VDML 4R7VA 4WU7B 3AREC 1JZJA 4HD5A 5BOJA 5E2WH 4JM2C 4KJWC 1WUZA 3FU6A 1K4CB 1ANUA 3SDXE 4FFZH 2C3HA 2C7UB 1SVCP 5BXFB 1V7ML 5L4JA 4YXLH 4MAYC 3LQAC 3TN0C 5I73B 4X9FA 4IBVA 5C0CD 3ULUE 4ABUA 3TJHD 2G4GA 3IDXH 3NA9L 3W38A 4BH7A 5CM1A 4TNEA 3OJVC 4AW7A 4LKCA 5FCSH 4FXLA 4AMKL 1SYSB 4TOYL 1M71B 4R8WH 1CTOA 1YMHA 1BEXA 1I3RA 1FV1A 3DV6A 4LLDB 4RZCA 2C3VA 1OE1A 2QELA 3PAZA 4QTIH 1TQSA 4NNPH 3LRHA 1TFPA 3BJLA 3SUMA 2KMWA 2C8NA 1JN6B 4LQFL 2NXZB 4OIAA 3MOQA 1KGCE 1GC1L 3RWIA 4XPBH 2MQ3A 5E8OA 4LEOA 2PF6A 5E2VL 2CQVA 4HG4K 5EU4B 4ZAKB 1R5VA 1SXCA 3VI4E 3HA0A 2JKRM 2FBOJ 3ZZSA 1THAA 4ZAKC 4B9GA 4LF3A 4CNIA 2ENSA 2QSCH 1BBJA 2BIQA 3SGKA 3OWEA 1HL5A 2YPKA 3PNWA 3TBSA 1H3TA 5DZ9A 5TK2A 4WI4A 1LNUB 5JHLH 4RGMC 3VWKC 4JFHD 1KY6A 2Z8RA 5FYJD 4O5LL 4E5XG 3MRJA 1NCGA 3HC4L 4DP6X 1VF5C 3UZVB 3O3DA 5D7JA 5FYLL 3IYLW 4O2CA 1T3FA 1OB1B 2OBGA 1LO2H 2E74C 3QZWG 3Q9PA 3QC6X 4L23A 4J7RA 2J55A 4NO5B 5CN2A 5ID0A 2VQ1B 2EEDA 4MHHG 2X05A 5D2NA 1S7UA 3PREA 4EKJA 4HMCA 1OKEA 4OJEH 4HYTB 4LSPH 5C1BA 1X5YA 3ZKNC 1JD9A 5BRPA 5KJRL 4PCTA 5JHDD 5EWIH 4G6KL 4JDTL 3D08A 4XNXL 1X44A 2EAEA 1RFDH 1DL7H 4DEPB 3I50H 2MJWA 2UXGA 4UTCA 1GYVA 1PCXA 3HZMA 2IDFA 4H8HA 2NR6C 1HD5A 1G5AA 3TTYA 3MDJA 3CC1A 3GJFK 5EBLB 1PLAA 2OJEA 5F7EL 2O72A 2X4SB 1NEZB 2XYCA 1PMYA 5CGTA 3APDA 5IY5B 3MLYL 4NZDA 2JKLA 4MRCA 5GJSH 3T2NH 3D06A 5BUPA 1DEEA 5KVGL 4BQ9A 4FQ2H 4PJFF 3ABZA 4Y4HD 2CXGA 3BAKA 2EDDA 3ZHNA 4AITA 1MCQA 2NY4C 2RMNA 2VWEE 1T83C 2FZ3A 4PJ7B 4U3HA 3FQWA 2BHYA 2BOBB 3NQIA 3U0TA 2VZ1A 4KY1H 4H1LB 4PJFB 2K6YA 3BAEL 1KT2A 4FABL 1GHFH 3INUL 2YBGA 4KK6D 2W0PA 2EVHA 2MPAH 4ELKB 3HRZB 1O6VA 1ED3B 5LO7A 2DTSA 1AQDB 3O9WB 5AVYB 4YAQA 3QR0A 4JPQA 4CBPA 1WISA 3C5ZD 5MERA 1TZAA 2AV7A 5D1ZA 3ELQA 5EO9A 1I1YA 1YEWA 1GKOA 2CJTA 2P24A 1NOAA 3OVUB 4ENEC 3ZQXA 4QHUA 1K8IB 4HLZH 2HFFA 3W11D 3ARBB 4F2MB 4JDVB 3QEHB 4BZ1H 3O3BA 4PD4J 3UL4A 1YDPB 4PW3A 4AQ1B 3RIFF 1N8ZA 3HPLB 2NY7H 4ALAH 4YS4A 3LKRA 1ACYH 4YFEA 4A7VA 3N1FC 3S9DB 5ID1A 5KYWA 2O61A 1AR1B 1BBDL 5D96C 4WEBH 4Z8FL 1WAPA 3ZTJG 2AEQH 1CXEA 1A3LH 2G60L 3KNBB 4K2UH 5C2BH 4S2SA 1UA6L 4XP5L 5D1XC 4TQPA 1PYWB 3D4GA 1BG1A 1RZJH 2D9CA 4I2XE 4OZHA 1SOKA 5C08B 4FG0A 5JUEH 3J27A 1U8MB 1LTXA 3J7HA 4AGQA 5EEUA 5AALA 2ED7A 4Q8BA 4X4ME 2EYRA 3S34H 1P9MA 2J1ZA 3NFNB 3BH8B 5AQ0A 4PJ8A 4WW1A 3O8XC 1E9PB 3FONA 1ZSDA 3PQYD 1MWAB 2XG4A 4OUUA 4DKTA 4B0MB 4MD5B 4C4BA 1AFVL 4XVOA 1YPZF 2VXQA 4M7LL 5HYQA 2CLRB 2CGRH 2NUPA 5F1NA 1J9TA 3HLAA 4XCNA 2QLYA 4U7MA 2J71A 3SJVE 1RUMH 4WO0A 2HVKB 1B6DA 1N0LA 4I5BA 1YA5A 4R26L 3W1ZA 2P5WB 1BAFH 1UD6A 1JYXA 4OFYD 1OAZH 3F84A 5T1KA 3LEVH 4Q6IC 5EIIG 2WXMA 5C0NC 2ZXCA 3FL7A 3L48A 3WLWC 4XC3L 1UHVA 5DK3A 1HEZB 1CR9L 4PGZA 3BT2L 1ZHLA 4YUEH 1SHMA 5I1KH 3WTWA 3ZE0B 2JXMB 4OQTH 3NEXA 2JB6B 4PP1D 2NSQA 2ZP8A 3HHSB 1BVNP 2VMEA 1NC2A 4I4WB 1ASOA 2Q7NA 2F1AA 4XMKH 2EC9U 1ZIAA 4Q6KA 5EPPA 5GZNA 2DQTH 3VU2A 3O2DL 4AYDC 5IT2H 5A2JH 4JN1L 5HGDA 3DTXA 2WYIA 5GJTH 2F8VA 3IMSA 1G87A