1N12A

Crystal structure of the pape (n-terminal-deleted) pilus subunit bound to a peptide corresponding to the n-terminal extension of the papk pilus subunit (residues 1-11) from uropathogenic e. coli
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
138
structure length
138
Chain Sequence
b'VPACTVSNTTVDWQDVEIQTLSQNGNHEKEFTVNMRCPYNLGTMKVTITATNTYNNAILVQNTSNTSSDGLLVYLYNSNAGNIGTAITLGTPFTPGKITGNNADKTISLHAKLGYKGNMQNLIAGPFSATATLVASYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mature Fimbrial protein PapE
molecule tags Chaperone
source organism Escherichia coli
publication title Chaperone priming of pilus subunits facilitates a topological transition that drives fiber formation
pubmed doi rcsb
total genus 22
structure length 138
sequence length 138
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1n12A00
3BFWA 2JMRA 3BWUF 3JWNE 4X50A 4XODA 5FLUA 4LOVA 5FS5A 4CSSA 5ABZA 1N12A 3SQBB 2W07B 4X5PA 4XO9A 4AVJA 4XO8A 5F3FA 4J3OF 5F2FA 3JWNH 1KIUB 2UY7B 5LNEA 4AVKA 1KLFB 4XOCA 3MCYA 3ZPDA 4AV4A 4AV5A 5JQIB 1PDKB 5CGBA 4BUQA 5FWRA 4CA4A 1TR7A 5IQMA 2XG5B 2UY6B 4X5RA 4AUYA 4AUJA 5FX3A 4ATTA 4AVIA 4AV0A 4J3OH 5AAPA 4CSTA 4AVHA 5AB1A 3ZL1A 1UWFA 4X5QA 4J3OG 1ZE3H 3JWNG 2JTYA 4XOAA 5IQNA 2WMPB 4AUUA 5IQOA 1QUNB 1N0LB 3ZL2A 3BFQG 4XOBA 5AALA 3RFZA 2VCOA 3ME0B 5LNGA 4XOEA 2J2ZB 2XG4B
chains in the Genus database with same CATH superfamily
2M8XA 1ACYL 4RBPH 3TEYA 1FO0H 5E8OA 4PYHA 3RWIB 1IJ9A 4KRLB 3HHSB 5DZ9A 3T2LA 5I1CH 1NMCC 4FMFA 4P23B 1ZLWK 4U33A 4EOWL 4DVBB 3ZYOA 4GP8B 5GQBA 2NY2B 1Z9MA 9PCYA 1OZTG 4PV9A 1ADWA 1YPZF 5IKCA 1A6VL 2BP5M 1A0QH 2X09A 3V7AE 4ZD3L 5IW1A 5HHOD 5FGCB 4O2EA 1P9MA 4NOFA 1OM3L 3QDGD 1SDAB 1PTZA 2DAVA 1GMIA 4DCQB 4N0FB 3P4MB 5JNYB 3QYNA 1JYWA 4O58L 1HX0A 1UCBL 2COQA 2IPTH 3BWAA 4APQB 5BV7L 4G6AC 1JGLL 2CM5A 4MNHA 2AV7B 1H5BA 1W0WB 3ILQC 4TV3A 5DVMA 4G5ZL 4I2XB 1HH9A 4GIAA 1A3LH 5ESAB 3KVPA 4OCRL 1A6TA 1JAEA 3SKUD 4ZYKB 5DWUH 5D1ZA 4JPIA 1B88A 2LABA 4WCYH 2OI9C 2UZXA 1EO8H 3GHPA 2PCPB 4Q6IB 2EH8H 4BXVA 4F2ME 1J12A 1C12B 2MRYA 1KIRB 5CEZD 1TYEB 1NCJA 2FIRT 3MRKB 4U1HA 2HT3C 1OCZB 3BUTA 1T7VA 4N8PA 4XH2A 3ARED 4TVSa 3L4UA 2OSWA 2VDPB 1PYWA 1E9PB 1BEXA 4ES9A 4LU5L 4TXVB 2D03H 3H9SB 1KTKE 3LEXB 2F0CA 3ASNB 2CGRL 5AVWB 4U1LA 4CSZA 5DEFA 1NC2B 1MFBL 3C87A 1DE4A 3ZE0F 4QHLB 3ABMB 5KBDA 4JFYB 1UXSB 5BUPA 3T3PB 3WYRA 3RA7L 3Q0HA 4HH9A 1FWXA 4P23C 4UZUA 3QUKB 4L1DA 3LQAC 5AZ2H 1SHMA 2AAVA 4J4PD 5I5MA 3SIKA 3HZ3A 3LSOB 1C16B 1C8QA 5HHQB 2MQGA 5IHZB 4LP4A 2P47B 4OCSH 1Z32X 3JVGA 5KVGE 4LB8A 5DDHA 2AXGA 2IOOA 4YDNA 3ZHFA 4B7LA 2JJSA 5BRQA 4P3DA 1AC0A 2V2WB 1YMMA 4NQQA 3GRGA 5DI8B 1B6DA 2HLFC 3KYNA 4ODTH 2QQNH 4S2SB 3N41F 3V8OA 4PVBA 5DJZA 3M1BB 5KBPA 2XZAH 1NAMH 2Y23A 4AGPA 3WG7B 4XCNA 2LOEA 1LQSR 1ZHLA 1L9PA 2BSSA 1F13A 3ZHNA 5FCUL 1QZNA 1JV2B 3DXAE 2FQDA 5B38A 4HSQA 3OQ3B 1MJJB 4J8QA 3T8XB 1D6VL 5AZEH 5D7LA 2HH0H 3V0VA 4BSVA 3OQRA 5CBAA 5ITFA 1F3JA 5SWSB 1O6VA 1N2RB 3ZR6A 4U1KB 5T33H 3FCTA 1SM3L 3DPDA 3MA9H 5E03A 2DQTL 5I1JL 1DQTA 1T7WA 1YEDB 2W0FA 1F97A 3WJMA 2H32B 4U6HB 3GSOA 4K7FB 3II2A 2WY3B 3FS9A 4OZIA 1OSEA 1FORL 3D6GA 1QFWH 4R7NA 1UACH 1XGRB 5KUMA 2AJVL 2FVNA 1ZAGA 3C8KA 5DJXA 5TE4H 1J0KA 3DOSA 2CO4A 1O75A 2VDOB 5BJTB 4XE5B 3AM8A 4ZMYA 1R3KB 1TETL 5IVXA 1TETH 3TBYB 1UTDA 4XB3A 3QJRB 5D4JA 4OGXH 2KBGA 4PGEB 3NESA 1RUPH 1NGXB 5DS2A 2QFRA 2ZUXA 2I5YL 3HZYA 3P9MA 4KJPC 2C26A 3SJVE 3V0AC 2FWLB 4E9QA 2D0GA 2OMVB 3QDJE 1AI1L 1MREH 2Y25A 4PB9H 4UYQA 2B0SH 1AI1H 1MREL 4WO0A 8FABB 2WKOF 5F97E 3RBSA 5HDLA 2A0LC 4M7LL 1KV7A 2QBWA 2PYEB 3ETBF 3ZE1F 1KULA 4UILH 1TFHA 4J6RH 1KTBA 1DJZA 3N1QC 5D7KE 1HL4A 1DSFH 4OVVA 1VFAA 1HXYB 1QHOA 3K3QA 3UBXA 4MD5A 1JGDA 2EYSA 2UZYB 1JGEB 4EMZA 4UTBA 3R19A 4AYMC 5FW7A 1A7NL 4B53A 4FLSA 1BWWA 2XZAL 3EFOA 3DYMA 4G9DB 4N2BA 2CBMA 2HJFA 4PHZA 1DJHA 5LAXB 4GQQA 4HCRL 3WIHH 3W9DA 4U1JA 1BD2A 3ZW3A 4QWWD 5K39B 4KX9A 1DUZB 2HT4D 2BRRH 4CC0A 1NFDB 3Q5YA 5I24A 3HE7C 2KDGA 3ECQA 3FT3A 5KVDH 2OMTA 1UKSA 3KLAA 2R2HB 5HVWA 4LHUG 2A4ZA 4WKZA 1JGUH 1NCHA 5HHNA 5I28A 1KJVA 1ASQA 3IMUA 4KV5F 4HLJA 3HR5A 4QRUA 4TTGA 2FECL 4XNZB 4PJIA 5IJBC 1FGNL 4RQQB 5D1ZD 2XN2A 2X2IA 3LAFA 4FQHA 4UT7L 3ZDYF 2VJ0A 1OZUA 3ARXA 4HUUA 5BRZA 3QUYA 2ZOKA 4IOFC 4PN6A 3ZT5A 1MRFL 4ANVA 5I1IH 1PY4A 2B59A 3EJYD 4FKEA 4PJIE 3GJFA 4QT5B 3L3OC 3E38A 1RFDL 4JDVA 2PCFA 3KCPA 3VNZA 1RUKL 2R0WL 4U1MA 3UYRH 3PREA 3FHQA 4JFZH 3B34A 2FR4A 1CICC 4IKNA 4LFHG 4FZEH 3OB0K 4FNUA 5FGRA 5L2KB 5LLIC 4R5TA 4RNRA 3U9PL 4KBPA 1WS7A 5KBLA 3ZZQA 3GHBL 5C08B 4G8IA 4K5NA 1IRAY 1BD2E 1DUYB 1IT9H 5EOCH 1LQBC 2NNFA 2P24B 3E3QC 2RAMA 1AGDB 5KANG 5HHPB 3ZZLA 1NSNL 1CL7L 1O7DC 2RCSL 1LE9B 3C9NB 3HG1A 4L8BB 1ZMYA 4Y7OC 4UYPA 3VRIA 2UZIL 1TKWA 1ZVSB 1QSZA 3UG3A 1GGCH 5F7DA 3QYMA 3MJ9H 4AIOA 3BAYA 4TUJA 1CK0H 4ESKA 3BEVA 3Q13A 2VXQA 3NIGB 4BK5A 1EEYB 5TDPB 5CEXB 5MERB 1C5BH 4UIKH 1UVQA 4U1SB 2QDVA 3MLUH 5DQDL 3NJJA 6TAAA 1SVZA 5E1HB 2A6DB 1CICD 3DX0A 3QNXA 2VL4A 3MRDB 5FGBC 4OLUL 1WGVA 5JW3H 3T6QC 1JPTL 3S96B 2L7EA 1SY6A 1BZ7A 2J73A 1TZHA 4ZPVA 3CDFA 5TQ0L 3PHOA 3RWHA 2OMUB 5DF0A 4P2OD 1G6RH 3ZE2E 5DFVD 2DQGH 3S35X 3CDZB 3B43A 5CINH 2X4RA 4N0CC 5F9JB 4X6EA 3MOAH 4QHMB 3MRGB 3O41A 3FDWA 1BOGA 1ONQA 3L3OB 2NCEA 1UC6A 3E2HC 5GS0C 4AZ8B 5EN3A 1KN2L 1CI3M 2ZXCA 4RRPA 5H4YA 2MH4A 4PTTA 3FB8A 2HFEA 2Q9OA 4FNTA 1UATA 3S5LG 3BPLB 5IB3A 1JF6A 1ID5I 4NUQA 4U4BA 2NY3D 2Y06H 3TN0A 5AW7B 4QRSB 4I4WB 1ZVSA 3DDFA 1OP5H 5F7DB 2VXUL 3D85D 2ZXEB 3QNFA 4R97C 5D6CA 4ZQKA 3QEQB 5CD5D 1Z7JA 1Q1JL 3MROB 4FFZA 2BP8B 3MLUL 1N7ML 2ROXA 2ZUUA 1PL3A 5B1KA 1CQKA 2BW4A 3JTBA 4YO0B 3A0OA 3FO2B 4U05A 2XFXB 1YEHL 3M07A 2ZT9C 3V79C 4I9XA 4ZZFA 2UX7A 4JRLA 5HY9A 3X1BA 3I6GB 4LRNH 5I75B 3F05A 1TZOA 4M9OA 4AQ8A 3E8UL 4K5OA 4UAHA 1Q8MA 3P30L 4KHTH 3KVQA 5DUPL 2OYPA 3SD5A 1P4IL 1X3DA 2ADJA 2B5IC 1Y0LA 2H2PD 2ZZUT 2AGJH 1MCQA 1MW1A 1OAQL 3SE9H 4F20A 1S7UB 1I3GH 2DWDA 1KELH 3GIZL 3VG0L 3UL4A 1CD8A 3L1OL 2RGSA 1B4RA 2IGTA 4O00A 4P5MA 4AMKL 2XG4B 3BP7A 1UXWB 2K7PA 3JWDC 1DQQA 4P59H 4MJHA 4NNYA 5DD3L 4R2GB 4MD4B 1DN0A 1DP0A 3ZZSA 2XSKA 3BP5B 4UDUA 1FJ1A 5AVUB 2O5XL 5D72L 4ZS6D 5D71L 3TCLA 1MFBH 5AOKA 1L0XA 1YAIA 3WY1A 4UTAH 2D31A 2UY6B 3MLYL 4QRPD 4Z7AA 1T5XB 4XCYA 1WH0A 4NC1E 2EO7A 5EORL 4D0BB 4Z78B 4ZAKB 1IEBB 4JFQA 2GK0A 3N04A 3HE7A 5CWSB 5FUZL 3J2PA 2EDFA 2WYTA 3PP4H 1DFBL 4QOKE 4RZCB 4DPRA 1WICA 2DICA 2OX5B 4W9ZA 5DR5H 1KXVC 5GZOD 3K5RA 1SVBA 1HZHL 2A3TA 4L3EA 4DUVA 4WTZA 4LP8A 1TLKA 4HLEA 3PWJA 3TF4A 5EO9B 3ORJA 3LH2H 1EGJA 1UOKA 1GH7A 3QK0A 2XC8A 4S1RL 4EDXB 4PS4L 4ATTA 1YAZA 1DQDL 5DHDA 3N1GC 3ISYA 3H8NA 5IK3B 2Q20A 4B9FA 3U36A 4K3JL 3PNWB 3VAEA 2DY2A 3VXTB 4OZHF 4KZCA 1RK1A 1QFUH 1UH3A 5JQHC 4PEEA 3F6IA 3LN9A 2Y1ZA 3HZVB 1CUOA 4WI0B 5D1XA 1ODUA 1CBVH 2OSLB 4K7PX 5FYJL 2IF7A 2IBGA 3ILEA 1FJ1B 3QDAA 4RAHA 5TDOB 4LHQB 2EIDA 2V6HA 1D5BB 2B3IA 2Z35B 4HAKA 4DAGH 3WL9A 2ZPKH 3GZKA 3QJHA 4N86A 1EJFA 5EZPA 2NY1C 3L54A 5D7IE 4NO5A 5FYKD 4MAZA 1YECL 4XXCC 1HZLA 4HUWB 3HG1D 4JN2B 2IAMD 4UT7H 3FO9B 1CFMA 1F4WH 1KCSL 1TQVA 3BC9A 3MZGB 1PZBA 1XSJA 4L0PB 4DOHB 3KPLA 3LY6A 3QJTB 4G7VL 3I6SA 5FO9A 2E3VA 2MNJB 4JZOA 1CLOH 3OTTA 1OSZB 2V2XA 4P8QA 1OARL 1BBJB 1G7IA 4BCYA 1U95B 4LLQB 4HUXA 2WM0A 3B2UC 3PWLA 1ZJBA 1D2PA 2WIMA 4JZNB 2OL3H 2VLRB 5F96L 3N0AA 3M17B 3QS3A 1FSKB 1AE6L 1QI3A 3VG9C 4TNVF 3G5WA 3TNNB 4QRSA 1L9TA 2D73A 2WIIA 3KNBB 4J7RA 1XGYH 4M7LH 3EYSL 4HFUH 1ZSHA 5EBWB 4AGLA 4FXLA 3MR9B 3HW7A 1LXMA 4N6QA 4PW3A 4EQ2A 3I6LD 1RHFA 3RJQB 2IH3A 4KXBA 1B0IA 3VXMA 4Y5VB 3F7VA 4Z7OE 3K1KC 4AEEA 3QRGL 3M8OH 3U9UA 4Z3IA 4YHNB 5E4IA 2ZUSA 1A25A 2JI2A 4N85A 4WRLA 5IMOA 3QI9B 1ITCA 1V3MA 2WQUA 4NYLA 4TRPH 1J5CA 2CRYA 3EHBD 3MXWH 4XP9L 4LCYA 5DURB 4OUUB 5BUGA 2DL2A 4JFTA 3I6LE 1FH2A 4IU2B 5AFAA 1D2OA 1N12A 2GUOA 2PTTA 3HI1B 4GAAA 1CYGA 5F3FA 3SKJL 1NBCA 2QVKA 1U6AL 3FCSB 4N20A 4XMKH 3FSWA 4UBDD 2SEBA 5LO7A 1V05A 1JZ4A 4FQLH 5GJSH 4NS0A 4MA7L 5DJDA 5BQDA 4F92B 4NJAL 4F8TA 4CBZA 1BFVH 2R8SH 4H4NA 1AGBB 2VXVL 3O6FD 4GG6F 2EVJA 2YWZA 5BV7B 1SHSA 1MRDL 3RVUC 1YHPA 3L3DA 4LDCA 2YEZA 3V9FA 4DH2A 4OZIB 3ATEA 5PCYA 1W72B 4HP5A 2OTUA 4YBHA 3VU2A 5CN3A 3MFGB 4Y2OB 3WHXB 3QWRD 5ALCH 3EGXA 3RVTC 4RRPG 5D1QE 2VM9A 1KIRA 4QTFA 4U1HB 4N0UE 5HGDA 4MQTB 1PQZB 4N1HB 3FF7A 3T4AA 4LEEA 1E2ZA 3X1FA 3BD3A 3EO1B 3Q48A 4JRYB 4OKVB 3VB9A 3I9PA 3VMNA 4YEEA 3FFDB 3NIFE 4YXKL 3EFDL 5AB2A 1I4FB 4JQIA 4Z7WE 4LL4A 4LNVA 4Y8DC 4JRYD 4MJ5B 2C4XA 3SDXE 4MCZA 4JB9L 1I7UB 1E9OA 1U8PB 3EBIA 5AW2B 3KYOB 5D93B 1N59A 3C5JA 4LKXB 2R69H 3WFZA 4G70B 5A6IA 3FFOA 4L3EE 4MSWB 1XZWA 2FO1A 5JDSA 3GTNA 4XNZC 4LPCA 3VSVA 1FG2A 1HVXA 4QWWC 5HHME 2PPAA 4DQOH 4PLKC 1I8KA 3RWHB 1F02I 2OJZH 5HD8D 1S4IA 3BD5A 4LLDB 4EI6B 3LSOA 4FL4C 4JY5H 1R3LB 1PX3A 1NFAA 1JCVA 4NRYB 3D4CA 1CE1H 3RX5A 3CIAA 3V5KA 4KMTH 3DXAD 4AIXA 4M4RB 4LP5A 3VXPB 3WFBH 4FQQA 4WLCA 4J3OF 4XN8A 1F6LL 5I1IL 4JO4L 4BDVB 3HMXL 2CDFB 3IDIA 2AJYL 2CKBL 3OGCB 1J0HA 1A6PA 2VJ8A 1NMBL 1S9YA 4PD4J 4NGHH 4PRBB 3C6SB 4JHBA 3CFDB 2BNRE 3VFRB 3MNZA 2VZUA 3PWVA 1DEDA 4FG6C 1NGQH 4O2FB 3WFCL 2Z8RA 2XV3A 3D8MA 4G72B 4K9EL 4UAOC 5GGUA 2X0VA 5DR5L 1U8PA 4ELMA 3UJIH 4PLNC 3CN4A 3O6FB 3VW3H 4HEPG 4JFXA 1IGCL 2WWNA 4E68A 3DX9B 1RY7B 3VJ6A 2QHRH 3B9KB 1KCWA 3RFZC 1K6QH 4JFFE 4CN6A 4U1MB 2DYPD 4AGMA 5KS9E 1BF8A 1NLDL 4ELKA 1QVOB 2VWEE 2YOCA 3I9GL 4GAYB 4LAJH 4PJ7B 5D1QB 4FTVD 4JFZL 2DQHL 5HDQH 1GGIH 2GW5A 2HTKC 1PZCA 2JLLA 3L7FA 1U3HC 5IBLC 5LJYH 3MOBH 3P3SA 5CUSL 3O45A 3DHPA 4K7PH 3LKSA 1MXGA 2Y1VA 5A2IH 4WI4A 2E4TA 2ICEB 3SDAD 1MWAH 2IALB 1JWUB 4UBDC 1NGZA 1RMFL 4YIQB 1T2JA 4HIXH 2J8UB 5HDWA 5CAYB 5HYSB 5EN2B 2GCYA 2VDKL 2K4AA 3NCMA 2YR3A 4QTIH 3ZOAA 2AITA 3FRUA 2R4SL 4IK7A 5H94A 3HMWH 1YYLL 4CAGA 2VDNL 1JPGB 4WFHD 4HU2A 5H37H 4HW6A 1I1YA 4O51A 2DM2A 4PSPA 1LK3L 3FYIB 4HWZB 1P7BA 5DHXB 1HOCB 3CVCA 4LLVB 2X4SA 5F2FA 1AQ8A 1D5XA 4AKOA 3QULA 4BYHA 1KPUA 1FZMA 1MFCL 4FYTA 4JG1L 1MPAH 4GO6B 3WEMA 3SYPA 2FECI 2UUDK 1XCTB 3DSNA 4WEBL 4KDVA 4IBWA 1Q72L 3U36B 4JQVA 4DO4A 2YA1A 4YLQT 5GHWL 4FADA 3CVHL 1FFTB 3UOAB 2DL9A 4ZUUA 1ZV5A 2WO3B 1I9RH 4MAUH 1JF1A 3VXRE 3NTCH 2VMDA 2H0FA 1TTFA 4KXZH 1WAAA 3EJJX 5I1DA 1D5ZA 1UM4L 3QZNA 1NH6A 3IN0A 3CN0A 3HE6C 4LL1A 4Z7VE 4J39A 4Z5RB 5F3BA 3ULVE 2VAAA 4FNPA 1AD0A 1SOKA 2D7PA 4NKQB 5AQ0A 1ZHKB 2DN7A 4P9ML 4D3CL 4HJEA 3KBHE 4LEBA 1IGIL 1J88A 4I3RL 4JG0H 4OLEA 1AHKA 5EC1B 1YPZB 1OALA 3AWGA 2HT3D 5EWIL 4G83A 1E90A 1MELA 1LK3H 3MXWL 2WVVB 4NQXB 4X7TA 2GTWA 1TJXA 2FSDA 1NAKL 4LLMB 1ZXQA 4PJAE 1S5IL 1V7NH 3QUMB 3L3HB 1B6UA 2TRHA 5K9JH 4M9PA 4ADJA 4NXKA 1Y7VA 5MEQB 2XWBA 3B9VA 3C60B 4LEXL 1WFTA 2NY2C 4YX2L 5AYUH 4KQ0A 1HQ4A 3L3JB 4MJ6A 3VFSA 1YY9D 4F15C 4B60A 4R8WH 3CMOL 3X17A 3REVA 5ID1B 1PCXA 2BFVH 3W11C 4N0CD 5HHOA 5I1HL 1YPZE 4GBXA 3MV8D 3FAWA 3MLVL 4IW4C 4ELMF 3KHQA 5I1HH 3TWCH 4MMXB 1E2VA 3PG2A 5JLZA 3WDIA 3KYKL 2B1AL 2RJMA 3QORC 5CIPH 3SCMA 5HYFA 1XIWB 1SOSA 1JZ2A 1NJ9B 4J3TA 3DMMD 3KPRD 1BX2B 4AH2A 1H8SA 4PP1D 3F8UB 2EH7L 3DRTA 3OAWA 4LGRB 4PI2A 4GXVH 1M71B 3J27A 4UWQB 5DS8B 4EN3D 4KNQA 3RTQB 2OZ4H 3EADA 4R6UA 2HG5A 3P54A 1U2HA 1RZFH 3A5VA 1P4LA 3ZRCC 1OY3B 1FHGA 1ZDSA 4CMHC 1GMEA 4AK1A 3BFWA 4HU8A 3VFGL 5EU6D 4ZUWA 3MLTB 3IDMA 1KG0B 5INDA 5C6PB 5KS9A 3HCVB 1KY7A 4ATWA 3HC0B 3SDXF 1ZSDB 1S7RB 3SO5A 2F53D 3D5OF 5ANMA 2W60A 2IQ9L 3GTTA 2ENPA 2X5PA 4GINA 1IB5A 4NBYB 2YSSB 1J1OL 4OB5L 1WEJL 1UM4H 3S98A 5ID0A 1SYVB 2VZVA 1EA9C 1BF2A 2VABA 3SE3C 5AAPA 2OYKA 5DMGC 1PFOA 2XQYA 1ZTXL 4ZFQA 2G5RA 2EC9U 4MJIE 4PG2A 5HYJA 2J7LA 1RK7A 1XF2B 3KPQB 1H3PH 4HWNA 2VM3A 4J3VA 4MXVE 4BH7A 2VCOA 2VKWA 2WTOA 1ORSB 5JYMA 1AACA 4RISH 3MRLA 2P5EA 3OVUB 4EJ1C 3K80A 1K4CA 3BCDA 3IFPA 3AG3B 4P5RA 2C1PB 4CDHA 1KYUA 1E8ZA 2H1LM 4G59C 4JM2F 4NN5C 3BAWA 4U6XA 4YPGA 3K8LA 4V1DB 2FWSA 5BW7C 4UIMA 1IL1A 4L2YA 5I18L 3W2DL 3AREB 2EDNA 4WO4B 4X9FA 3N55A 1V7ML 5E95B 4AUJA 1GZQB 1AS8A 3KLAB 1BAGA 1L7IL 1AXSB 5BO1H 1AFVH 4D9LH 4Z7OF 3IPEA 2MEJB 3H9SD 1E4KA 4C83B 3N3EA 2QQKH 1NIEA 1ZVYA 3PWNA 1BYPA 1GKOA 3LPFA 5DD1L 3ZE0B 2MHAB 4YL4A 3IDMB 2E47A 5AZEL 1I1CA 1A1MA 3HC0A 4RMTA 3TA3D 1EHNA 1UJ3A 1C16A 5SWSE 5E8DH 3K72B 4YHKH 1PZUB 1YQVH 3R06A 5B8CC 2PKDA 4OAWB 4K07A 5HHXL 5DZVA 3MV9D 2R23B 3S3CB 5FGCE 4NM8H 2Y06L 4MQ7A 5CM1A 1XCXA 3DXAA 5ACLA 4ABVA 1XMEB 4IBZA 3WS6C 1HKLL 5AOJA 3CFKA 3BVWA 4HFWA 3LS4H 4KGJA 2DWYA 2OMXA 3W38A 4N0YH 5DLMH 5LWYL 3HS9A 1U3ZA 1EBPA 5D96C 3U4BL 3QZOA 4P2OC 2K78A 4XAKD 2NY1D 4N90D 3R1GL 4OFYD 3ECBA 4JRWA 1QRNB 2OMVA 4OGAD 2J25A 1N4XH 5IJKA 4PWKA 5HI5D 5JHDE 5LBVA 2Q6WA 1WFNA 5HGBB 2YKKA 1D6EA 3B9EA 1EGJL 2WYHA 2ZSWB 4HIJB 5FHAL 4NUJB 3AC0A 1JHKL 2LTQB 2PCPA 2J20A 3INUL 3KPSD 4XPFL 4M62L 3WAKA 3ZIYA 4LDOB 2R7EB 3BN3B 2ZONA 4P5KB 1HILA 5FGBA 4ADGA 1WIUA 4DVRH 3QXWA 3QS2A 4JFHE 3FSZA 5JIDA 4F3FA 1J0YA 3MBEA 4RISL 1AYRA 3PGDA 4PBXA 4YQXL 3DHJA 4HUVB 1FHNA 2UVEA 2F9BT 1QHQA 1D7FA 4J1UA 5KG9A 2IPUG 4BIKA 4EDXA 1LD9B 1NFDA 5L4IA 4CVZB 4WZ9A 1VHPA 1QP1A 5F3HA 3PP3K 4OCMC 1YJDH 2YD4A 3KW7A 4UQ9A 2B3RA 3X3FL 2P5WD 1HS6A 4MDRA 4PJ5D 4OJEH 4UUJA 4XPGH 2O6PA 4HPOH 3KAAA 1ADQH 2OSLA 3L5XH 3VXME 5I0YA 1CICA 3WS3A 3B9AA 4ERSH 2PYEA 1KIUA 4X6DF 1EVUA 4X6DE 2OMWA 3U82B 5CN2A 4TVPL 2NX5D 2F19H 4ODBD 3EG9B 3EGSA 2LFEA 5C0RL 1QFOA 5JHAA 1IO4C 3G6JA 4FXKB 3FTUA 3WMPA 2BVYA 3CPLA 2XICA 4LCIL 4LCWD 5FGSA 2VOTA 2NY4C 4NDMA 1JHLH 4LCCB 4YHIB 4KKAC 4GW4A 4I0PA 4JCWA 5MENB 1CFQA 3MRNB 3KW8A 2YAEA 4YHOL 1T1WA 1RFDH 1V54B 2H6PA 1X7SA 4LCWB 1E6OH 3O3EA 3ARDC 1E6OL 2X3CA 1LL1A 1NLBL 1BFTA 4NKDB 4QTHA 5E2UL 3V0DA 3SBRA 3GHEL 1IAIH 3WTUA 5I5RA 5TE7H 3CHXA 4RGMB 4EZJA 1JGUL 4PJCE 1AZCA 3CQPA 1SN0A 1F3DH 4DFHA 5AENA 2W0FB 2VN4A 4JE0A 4H8UA 3E80A 3TJPA 5JPNA 4ACTA 2E74C 4OCLC 2PCYA 1CMOA 2FX8H 3MI6A 4HOWA 4XI5D 5IW6B 3PFUA 4LCCC 4OFVA 3BJ91 1RJZB 2F58L 4QXTB 4NNYB 5HYJD 3PPSA 3BKYL 3L3GB 4WNJA 4MA3B 2AJXL 4WJKB 5FHBL 2R1WA 5E24E 3C5JB 4LKXA 4PP1C 3RY6A 1DQDH 3OXRA 4W81A 3TWYA 4GQZA 3ZQWA 1FNSH 2BCKA 5DJ2B 3AG4B 1U8CA 4OR1A 3TIDA 3Q05A 3ERXA 2WP3T 5CCKL 4QLWA 3F65A 5CGMA 5DUBA 4IRZH 5JMRA 43CAB 1KLGB 4HS3B 2E86A 4JO8A 2PYEE 3PV6B 5KSUA 4AGQA 5GGRA 1OCWH 2BH0A 1JFQL 1CFQB 5JO5A 1UM6H 5HYIA 5ANHA 1UM6L 4NQDA 3N42B 1H3GA 2G9HA 4OGAC 3SYQA 2Z64C 4KOCA 1P5VA 1G0XA 1RZGB 4BCZA 1YMHA 2NY3B 2VAJA 2YBRA 5GIRB 3DBSA 2NY4B 2VRQA 2Q86A 5CR8A 3C09C 5K9OA 3CVHB 2CK0H 3JYBA 1S9YB 4U7KA 4XPHH 4U3CA 2ZX9A 2HTLC 1CZ8L 3QXDB 3GFUA 5JZ7D 3W0WA 3HAEG 1JWMB 1OK0A 3BZDA 4L5FL 3O8XD 1KBWA 4C4UA 3M1OA 5L2KE 2QKSA 2QR0B 1A4BA 1H3VA 3WNNA 3IU3B 5F88B 4JFYA 2X53A 1I1AB 3BUQA 4M5TA 3UCQA 3OLEA 3SYCA 1KCRH 3SCMD 1NMCB 2WLJA 4L3ED 1CFBA 1QTSA 4KFMA 3OR7A 2F1BA 4BUQA 4LGSB 3WUWB 1M4KA 2AJZB 2P7TB 1NL0L 5EEWA 4AQEA 3GMQA 2OP4H 3KPSA 4ZXBA 2WOBA 3MV7B 4ELKB 1AO7D 3BEWB 1FZKB 1I9IH 3LRSA 3L9YA 4M7KL 4KI5C 5E6ZA 4BJLA 2HJLB 5CILL 1P69B 5C0ND 3WTVA 3WKPA 2ADYA 3WUWG 3G5XB 5B3JE 4WNQB 3NTCL 4FQIH 1KSRA 3MXVH 3FT2A 2YMOA 3WXVL 3X3GL 4XVUD 5EU7E 5DZOA 2C8NA 2R2BA 4W68A 1MH5B 1YVLA 2F58H 1I8AA 1KCBA 2ED8A 4LOUD 2HUHA 4NFBA 4R5VA 2CKBA 5JW4Q 1R33A 1BQUA 15C8L 1JD7A 1PZ5B 4G6FB 3TH3T 4EI5B 4OTXL 4PSRA 3GUTA 2Q2EB 2VXUH 5JNYA 2QQNL 3F12A 1BYNA 1NPUA 1QR4A 3CC5B 4FCHA 1QA9A 3MGTB 4K3DH 1NAML 3OKOB 5T1KD 5DYOA 1UXLA 2GAZA 1WFMA 1NC4A 3Q8BA 4DGVL 3AT0A 3EDFA 4FQQB 2D4DA 3MRQB 5IR1A 5CMAA 3O2WH 3BPCA 3KLDA 3FN9A 2JJVA 2VB5A 3MUHL 1HTYA 2B4CC 3RGVD 1NCAL 2ZPKL 3ZRFC 1XF1A 3GSOB 4WY7H 4M3HA 3S3PA 4AV0A 1MUJA 4AC2A 1JOIA 3FQTA 2FQFA 3D0LB 4PJAF 4DTGH 2BNQE 1ZT1B 1UXSA 4PBWD 5C70A 5HYQA 3BEVB 5F0JB 4Z77B 2JJSC 1TQSA 1T1WB 3IYLW 4GH7B 4Y2DD 3FTXA 1SDDB 4PJIF 4XC1H 2DOCA 5DQ9A 3VRJB 1HZKA 3IFOA 1T20B 1G5GA 2VLJE 1TTCA 1G9NH 2NY3C 5CJXA 3TJHD 4Z3GA 3ATAA 3ULUE 1T2QL 1OE1A 4UB0H 4X8XA 1JNNL 2YZ1A 2LAAA 1IUZA 1MHCB 2IDTA 4ODSL 5BRPA 4MYWB 4TN9A 3CFEB 4ZPTA 5HJ3A 3GI8H 1F2XK 1HI6A 2DD8H 3L4ZA 2DQIH 3PJNA 5B22A 4CRPA 1UWXH 4FFTA 4NRXB 1WC7B 1NMBH 1LDPL 3FB6A 4Y1TA 1LDPH 2ZXWB 3QXAA 5T1LD 4OGZA 5ANME 4E9TA 5BV7C 3V0FA 1PY9A 4AGNA 2J8UF 3BUIA 5CCGE 1J8HD 5AG9A 1FYHB 5FR3A 2DQJL 4K9EH 4DUWA 4DP2X 4LRIC 4F91B 1B3IA 4MLSA 1RV6X 2N1TE 4U2ZA 2HJKA 4M1DH 2Z1KA 3P30H 1FO0B 4JFPA 2P44B 3RZCB 4PGZA 2V9QA 1VIWA 3WMQA 3NFSH 4FNSA 5ISZA 4WU5B 3VVVA 3FQTB 3OB8A 3QR2A 3QZLA 4HH9B 4ONGH 5FO9B 1ZLUK 3MLZL 4HPHA 2EUWA 4RCAA 1QLFA 2AEQL 1GS6X 3ESMA 4IEFB 3U7WH 2H2SD 1F56A 2OJ1A 3AS2A 4Y19A 1SHWA 1BQSA 4PCKA 4QHKJ 1NQBA 2GJRA 4AM0Q 3JT0A 1VGKA 4NO2B 2P48B 2NY5L 2FBRA 3WKQA 2EKSB 3EHBB 5FV2A 5E9DB 1UD6A 4I3SH 4ENED 5IT2L 3Q2NA 4MSWA 1KENH 2APBA 4GMTL 4F57L 1J8HE 5KVDL 2B9AA 3MRHA 1LO2L 3WL9B 3GMLA 5DC9B 2XG4A 2E9JA 5EUKA 4IDLA 1T66D 4BZ1L 2IH3B 3DOIA 1A9EB 1I9JL 3S4SB 3BRFA 3O3DA 2P49B 1DBBL 4PWHA 4I9WE 1HH9B 1M9WA 3WN6A 1QMUA 3LXBA 3KL3A 1NMAL 4YDIH 3H2WA 4CC4C 4LEOB 4XC1L 3QQ4A 3ESPA 3EYVA 3X14B 5B7EA 1UZ8A 1CICB 4E42B 1U42A 1UWGH 2CRZA 3ROOA 5L6YH 5AG8A 5I1CL 2R2EB 3WXWH 4ES8A 1E27B 3QCUH 8FABA 1JRHL 1JHTB 1U95A 1PDKA 1Z9SB 3CE1A 3HBGA 1T04B 4G43B 2XWTA 1TENA 3NZHH 4LSPH 4Z7VA 5A2KH 1GAFL 1G1YA 2NY0B 3LRKA 1D5RA 1BOYA 2WTRB 3RWGB 4G82A 3ZDZF 2EE9A 3GS7A 4LQFL 4KTEH 4CADA 4N1EA 1A1MB 5FK9A 5AWNL 2WVSA 5AKSA 2WZ6A 3VXRA 1OAZL 5DK2B 2K0RA 4F9PA 1MFAH 1I1FA 1B4TA 3X1EA 2QSTA 3O3AB 5CSBA 2FL5B 2O26U 4FFZH 5CSGA 4QYOA 4XNXL 1INQA 3TO2A 2Y5TA 3VGAC 4XNBA 3CDGB 4J3OH 4JFOA 3W37A 3GMNB 3QRGH 2CLVB 3DTXA 4C56E 3VFVA 3RDTC 3GMOB 5I16A 3BP4A 4EAEA 1TVBB 2PO6B 4XMVA 3GK8H 5I6LA 3ATFA 1JZ7A 1NAMB 3O6LH 1IKNA 2D3VA 4RDQG 1UACL 1AVAA 3D69B 1N19A 3DRTB 1CGUA 4MDIA 1RIUH 2OR9L 2NYZA 1IBYA 4W9KC 1NJ9A 2V8LA 1JNHB 3FC8A 3ZLQC 1SBSL 1NEZA 4JJOA 7CGTA 2BDNL 4AZUA 2DKSA 2PMZA 3U6XS 1O5PA 4PRIB 3RU8L 2UXFA 3KCPB 3NABH 3OV6A 1GPOH 1PX8A 3IETA 4Z3HA 5IHUH 5E9AA 4ILDA 3JWNC 5DQJA 4JPKL 5ABZA 1KTJA 1ZS8A 3KJ6L 4Q2ZB 3V6BR 5CEZE 2HT4C 2DMHA 4BFOA 4NT6B 1KLFB 5FOJA 4BKLA 2AJXH 2AQ2A 4L9DA 4QAMB 4BHUA 5A6LA 5I0ZA 3QEUA 3LKQB 1P5UC 3KPLB 1J1PL 2A83A 2IFGA 4MQXC 2ADIB 2GI0A 3MROA 4PV1C 2VITA 4BQ9A 4CVZA 1EFXD 5J11C 3O2VH 3OD3A 4K94L 2NXZD 5BS0A 2Q8BL 4WKZB 1HHJB 1IAIM 4OQTA 3DLQR 1CT8B 4JJ5B 3KPTA 3SKOB 3FFDA 3OLDA 3BIKA 4UV7L 5FUCC 3T0VA 5LNGA 5H35B 3JBG7 2FBJH 4NNPL 3HI5H 1T83A 5DD5H 4LPTA 1JK9A 4J3WA 4OSUH 5DD5L 4H0IA 3FTWA 4K8RC 2ITDB 5TK4A 1KJ3H 4U6XB 2OZNA 2CNYA 3VXSB 5JXED 3CX5K 4UIMB 1SBSH 2J6WA 3RGHA 1ETJA 1J8HA 4G3YH 4ANXA 2AJ3A 4UT9H 4F7CB 3AWEA 1FG2B 1EJOL 2V9TA 1DVTA 4C59B 2YD3A 1H8OA 2E76C 1CDGA 4JPKH 2K7QA 4EXPX 3MHZA 3ZTNH 2WUBH 3QIUC 3DVNB 3GJFH 2CCLA 2VKXA 1FCGA 1WWCA 2ZXAA 1MCWW 3LRMA 4KXAA 4XX1G 4TL5A 2Z34A 5IESL 4GUPB 3L1EA 4TULL 4JG9A 3MKKA 4JHUA 3LH9A 2EO1A 4KI5D 4WO4D 2Z92B 5F0PB 1MCEA 1S9WA 3CFKB 3ARBB 3N1MC 3U48A 2VITB 5AOLA 1AY1H 2WLIA 5JOFB 4H20H 1J9TA 1U93A 1G7LB 3IXTB 3MCKA 3OG4B 3DXAB 3PP3H 3ZGHA 1BIIB 1C1EH 5T1DL 3AQXA 2P1YA 2M26A 1NUDA 5FF6B 2AEWA 4YC2B 3OHXC 3BQUA 4O4YH 4CN4A 2W0PA 4K7PL 1X5LA 1N68A 4N2EA 2DTML 3ROOB 2DQEL 1MVUB 3GXUB 5BUAA 2OCFD 4AITA 1M2OA 2VLLA 3WIHA 1XIWA 3DMMC 5C71A 5DEFB 1A7PH 1XIWC 1S7TA 1OF2A 4MB1A 3RVXC 3UC0H 1XDTT 1M1SA 1AP2A 3MRCB 4F8LA 3VG0H 1FRGH 4ZMWA 1N0XH 1SEBB 3GIZH 3GKWL 2VRAA 3LKNA 4LVNC 4HHGA 5JA8B 2F74A 5EDSA 3AB0C 2DI9A 3CK0L 2O5NA 4FMKA 1NWOA 1MG2C 1CYWA 1QFWL 1E8YA 2AQNA 2P5WE 3OKMB 3GJFB 2IEPA 3TXAA 4FJYA 3GBNL 3TP4A 3DETD 1MJUH 3W5MA 4F15B 3QCTL 3ILPB 2R4RL 1R3JB 2XPGB 1YCSA 2LLGA 3CXFA 3GMNA 3NCFB 3DTXB 1D5MA 4A6YB 3ZGIA 1S5HB 4OD1H 4NZRH 1SY6H 1GA2A 1P4IH 2IH8A 4PJBE 3P4MA 5CINL 2X6BA 4BFKA 3V4VA 5J9PA 3UZVA 1PZ3A 3AB0B 1A6AB 5LG6A 1ZHKA 3FB5A 4YHPA 1WSST 3DUUB 3MNDA 4DO6A 4DK6A 5KN5B 1J8KA 5LBSH 1KGWA 5E0FA 3VW3L 5HHXH 4Y16D 1YC7A 5JQIB 1A22B 2QSCL 3QUMH 1GYWA 3C9NA 3CGTA 5CGBA 1TQTA 2WKGA 2FT8A 2AANA 2FJUB 4C58B 4KK6D 5I6NA 3O3BB 2F53E 3P11H 4G1MA 2YPVL 4NWUL 4W6XB 1VZHA 3X2QB 3MREA 4F9PC 3I75A 3BGFC 1DJIA 5DA4A 4XT1C 5T1DH 3PXLA 4OCWL 4AT6B 2ZG1A 1NPNA 2DJ4A 3RIAF 2EDDA 3MVSA 4L4VE 2GIXA 2GKIA 2FYVA 3PHOB 3RWDB 3T4YB 1L9QA 2TRYA 4JEGB 4X9HA 2BVPB 4YSQA 2QLVB 3US1A 1WZ1L 2P3YA 1I7RA 1NGXA 4S11A 4IKKA 1LYQA 1FUNA 3VB8A 3APDA 1KJVB 4XCCH 2GSGA 1MFDH 1IBDA 1UEYA 4GRLC 1ZKAA 1MFDL 2OFQA 2FBOJ 5SWSD 1MQKH 2JKSA 4J3SA 4NO0B 3MV9A 2K4WA 3RFZA 3THML 5I76A 3UFIA 1U8IA 2YPVA 3DUSB 3K91A 4JNXA 5ICXB 3VFNB 2IIJA 1BZ8A 2NZ9C 2XNAB 3OXRB 4TOYL 3MODH 3SYOA 3T0WA 5GZOA 2JB5L 1MAJA 3LZQA 3KS0H 2XT1B 3OKLB 4J3OD 1ZGLB 3SGEI 2WXMA 3WO4B 1JWUA 4HHAB 2IDQA 3VYNA 5IFJB 3FFCE 4YX2H 3S36H 3C2AL 1A4CA 1NCAH 2IQAA 2NR6C 2GUYA 4NO3B 3SZ6A 1SRDA 2VC2H 2W9EH 5I6PA 4LLUB 1JGEA 8PAZA 3ETSA 2JTYA 5GSVB 3Q2WA 1OM3H 3K6SA 2YD7A 4KK9C 5FA4B 1RU9L 1TCRA 2P9RA 2JIXA 3TGXA 1CDHA 4EEEA 3TWCL 1O5DT 3MXVL 2Z4QA 4YFLF 4EE2A 1NCCH 3APNA 5EDXA 3LRHA 1OP9A 1Y0LB 2E9WA 2EZ0C 3X1GA 3X13A 4WTXA 2B1HH 2WXKA 4B9ZA 3HS0B 2EADA 3P77A 4GW5B 2OMZA 3NRFA 2X70A 4PJXB 2FJSA 5C7XH 5J13C 3QG7H 4XXWA 4JFHD 4P3DB 1QTPA 3KS0J 5K9OB 1K9TA 5B7FA 2YGOA 3BCFA 4MJID 1OSYA 4F1SA 2CGYA 2BVTA 2ALWA 4O2EB 2VXSL 3ATDA 2BIOA 1KCVH 4NNPH 4JRXA 2YK1H 1ZHNA 2JJTA 4PGEA 5LXGL 4IRZA 5F72S 4F33B 3WUWA 1I8MB 4XMKL 2F7QA 4FLOA 5GJSL 3DGCR 5JHLA 1B4JH 4YSEA 3QEGH 5F1OB 3GXDA 2EYRA 1E28A 5EC1A 4PW9A 2ZJSL 4LSSL 4KMQA 3FT9A 4PRDA 5AYTA 1WA2X 4QXVA 1RUPL 3OPZH 4QRPA 3MRMB 4WWNA 5I15L 5HHVL 3SPVB 3S37L 4XAWH 3A67H 2GJZA 1QLFB 3L3OA 4OI7A 1KBGL 2M1KA 2Z8VC 3HE7D 4JZNA 4NRZA 4Z18A 1XR8B 2Z4TA 4GXUM 3VD2A 1YYML 3QDMA 3D34A 1GOFA 2ODIA 5ACZB 3HS8A 3I74A 3HPLB 1JGDB 2EYSB 5ALCL 1Q0YH 2Q76B 3VDCA 1SZNA 3CLEH 2KZWA 2Y2WA 4E9XA 1T7ZA 4RX4D 1MCFA 1OGTB 3L4WA 3MV7D 4KO6A 3ZVVA 3F58H 4XNUH 4GG8A 1C1EL 1BLNB 2VSCA 3EF4A 3MNVB 4HZLA 4DWHA 3N5AA 1BVKA 2F53A 1II4E 4V11A 5AALA 3WLWD 2G3ZA 3JTSA 1Q9WA 5EOTB 3S3SA 2DQMA 5F1IA 3T4AB 5E1QA 1IGML 1SXSA 2QPSA 1OPGH 1P7HL 4A04A 4NWTL 4GXUN 2NPLX 4QKXB 1WDAA 1NBZA 5A2FA 4WK0B 3DIVA 4EZKA 2OW7A 2PPFA 4H8WC 4PRHE 4H25B 5HGDB 1EUUA 4AVKA 4OFYA 4MA3A 1IGJA 1T0NA 4X6EB 1OSPH 2VR3A 3VI3E 1HEHC 4W1TA 2QHRL 4R5XA 1UA3A 3JV6A 1V3KA 1CJYA 2XY2A 4YPJA 1SDDA 3LYRA 4P23A 4EIBA 2YGPA 3AT8A 1RUMH 1N0LB 1RJCA 1ZT1A 2XTJE 1FVDA 2K1MA 2WP3O 3QPKA 4KV5E 2FR4B 4U7SA 2ZKWA 3EOBB 3FMGH 5KBNC 1QEWA 2YA0A 4ZDHB 5IFHH 3MJWA 1MDTA 2IPUK 2OKMA 1TPXC 3QIWB 3R1GH 4AV5A 4BEIA 1EPFA 3ARGA 3SKMA 4ZFGH 1NLBH 4KUCD 2D9CA 4JY6B 1MI5D 3MRFB 2WLIB 4ZXBC 4X4YB 2Q86B 3V4PL 5FKPB 3OSVA 4NQSB 2ZUQC 4OF0A 1E27A 3HG1B 2I26N 1A9VA 3TO4B 2ZYIA 3JTSB 4RSYA 2R1YA 1AGDA 1ZRUA 3UO1H 3VXUA 5MEOB 4H2AA 1HH6B 3CZJA 1ADQL 1C5CH 3L5XL 4XODA 4AX3A 1N5YH 3RVVD 1W80A 1KTLA 5EULV 4BV1A 2FK9A 1KNOA 1MVUA 2HZHA 4FZ8L 2DKUA 4ZQTA 1S7WB 4S1RH 1OIOA 4UQBA 4YXHH 1OGPA 1GJWA 1YEIL 3T3PF 3L4XA 2WZPD 3QXUA 5F7FA 3VFRA 1IQWL 4MMYB 3ZDXF 1PW3A 1IQWH 4A7QA 4M6NH 3CFNA 4ZXBB 3GI8L 5TE6H 1K4DA 2Y2TA 1HSBA 1SLUA 3FSOA 5JXEA 1LWJA 3CXDL 4UINL 2K3TA 5EZJB 4IMLA 4AQ1A 3NRQA 1CFNB 2YD1A 5SX5H 2H3NA 2AKRB 2JFCA 1YEHH 4FF9A 4G8FA 4HX1B 4IRJC 3SQOL 5T3ZE 4GEJA 4QHUA 2OS7A 1A4JB 1U92A 3B9DA 2X9YA 2IC2A 4M8VA 1B9KA 3C5ZA 4GO9A 2D7NA 1MCBA 1FF5A 2SEBB 4G3YL 4HIHA 3GBMH 3K6OA 3KMDA 4F7MA 2BJML 4QF1B 4EXKA 1TKWB 4JN1H 5IVZB 1IC7L 1AKJB 2G9KA 3G6AA 1QA9B 3MGTA 3IB4A 5DEJA 5EMYA 4RMQA 5JZ7C 2VDRB 3ZQ9A 3UEZA 5AW0B 1AHMA 4DQAA 3CZFB 5BRZE 4LAQH 2P8PB 4BFGA 3BUYB 1T2QH 2IGFH 2R4RH 5T1LB 1JCKA 1QRNA 1SJXA 2HVBA 4KPHH 4MCYB 5E6YA 1JN6A 5FYKH 3UGEA 3WU1A 4WSGA 1PLGL 2JV6A 1ZA3A 4RDQF 4ZD3H 5T3ZD 4HHWA 4L4TD 5DZJA 1WT5C 5K33A 2X1PA 3HZVA 4FEMA 1X5ZA 4WI0A 3QUHA 4XTRD 5DJ8A 1AHWB 4OJAA 3SDAA 2B8OT 1PG7W 5MI0C 5C0DA 4G11A 3V95A 1O9VA 3HPLA 2EIJB 3DSNB 2OW6A 4OM0L 3CSYA 4CNIA 2XV2A 3HG4A 1IEAA 3NN8B 3QEQE 4HX1A 2OYLA 3ZDZE 5IW1B 4PB0L 4QAWA 4DPBX 4DKEL 3HI6H 1H9DA 3BKJL 3GXMA 4XNMB 1M05B 3CDCA 3K2UL 2G30A 4J23A 2CDGA 4PD4K 3TJHC 3OX8A 5I30L 1BZOA 4E41E 4N9GA 1P53A 3PQYA 4YZFE 3QRBA 3E9TA 2FL5A 5F93C 1GGCL 2F5AL 1LD9A 2NQCA 4L1HA 1JVKA 1GJIA 4U1IB 1JF1B 4K3DL 3TZVB 5F7LB 5FXCH 3TS8A 3FB6B 3AMLA 3HC2A 4A67A 2XX0A 4MJ2A 4LOUC 4OLZH 5E6IB 4Z5RA 3QBTB 3CSBA 2UY6A 4LEXH 1Q0XL 3ETTA 2VNCA 4O9HH 4JAMA 4HJUA 1P5VB 3KR3L 4XR8C 4UQ2B 1KV3A 4YDZA 4ZMNA 1M6OA 3WE6B 3A6CL 4RA3A 3UTPD 2UX6A 2YWYA 4Q6YA 5AVXB 2FIKA 2HVJB 4LCCA 5HHVH 3AG1B 1CE6A 5CILH 4QJ4B 3MYZA 2B1OA 4RDBA 3ML8A 3QPXL 4RESB 1WFOA 1N6UA 5M7QA 4HKZB 3ALWA 4NHUA 5B1CA 4NCDA 3AQYA 3UDWA 2Z4QB 1P84K 2ZSVA 5F89B 3L5HA 3STZB 1NBVL 5BS0B 2VLLB 4FQJH 4HKJA 3WXWL 1QLEH 1VZIA 1F4XH 4AI7A 1OB1A 2V33A 5F44A 2ADIA 4GXVL 5LVEA 2A6KA 3VD7A 3VFPB 3TBYA 3NMEA 3LEVH 4G7QB 1QG3A 2EDYA 1FH5L 3IDGB 4XNQB 3CPUA 3I84A 4P23D 4MMZC 3UYPA 1A6AA 3D9AH 1J48A 3KPRE 3V8CA 5J11B 4KVNL 3V7MA 3D3VA 4ODWB 3KHOA 4U1GC 2MIZA 2WXQA 2B15A 3ESUF 4MCZB 4U1NA 1W2KT 2MCMA 5HYQB 1HXKA 2KUTA 3D1MC 1EDQA 4LEOA 4MMYA 4TS6A 2GJ6E 2JI3A 3MO1B 2ICEA 4GMSH 1BSIA 5E1AA 5T1MB 3PXJA 5IB3B 3LH2L 3OPZL 4YLBA 2H8PA 5AVRB 3ZUCA 5EF2A 3ULVH 1MIML 4U1KA 2XQYK 4JR9H 1MIMH 2L7JA 3PJSA 1CK0L 4HJJH 4U1JB 5AUMB 3TT3L 4B0MM 3RWFA 5KBMA 1A47A 4FHBD 2XZCH 1RVFL 4WHTB 7TAAA 1XX9C 1FFRA 2IFFL 5CZXC 4KJWC 3V4UH 3T1WA 2EDBA 1XF4A 2NNXA 3M7OA 3UTOA 3IS0X 3D39E 4J8RA 1ORSA 3CZUB 3DGGA 4MX7A 4M5YH 1N18A 4MRBA 1CDIA 1D9KD 1NIFA 5KYYB 4AJYV 1OHZA 4HQQH 3FONB 1UENA 1XCTA 3O3BA 1GXEA 1CDJA 3LIZA 4F7EA 1XAUA 4OU3A 4A37A 3QXDA 1BCIA 2XI9A 4YWGH 3IGLA 1X7TA 4PQXA 5ICYB 3NP4A 2ILLA 2Q3XA 4I1RA 3RILA 1RERA 2ICWB 4B96A 5B1AB 5HDOA 4V33A 3UROR 2WLNA 3CUPB 4B41A 4UZSA 1GZPA 1FFPB 3RWCB 2AAAA 3I50L 4QO1B 4KKAD 4BQCA 1EMTL 2BY0A 3BD4A 5C9JA 1JNNH 4LE8A 1ORQA 1NC4D 5DZNA 4DN3L 1U8JB 4XCYB 2ENJA 2MHAA 1ZWIA 3NZHL 2Y72A 3ZT7A 5E08H 4WFHE 5DEGB 1EQWA 4PRIA 2ZYRA 5L2KA 3FQ4A 3QJOA 1AGBA 4KZEH 5C0JA 2I24N 4N5ED 3CHQA 3S3DB 4H13C 4P48A 5LNEA 5J0BA 2A74C 3IJYB 1RLBA 5EOQL 1XFPA 2QSQA 4V1DA 5A2AA 3VI4F 4FFZL 4HETA 2NY6D 2V7HA 1NKOA 1GYCA 3MUUA 4M62H 2IANE 4BZ1H 5A43C 2E7BA 3BWUC 1EEQA 4HS8H 4NQDE 3WKYA 4GLRH 5L7XL 2D2CC 2ITEA 4F5CA 1U8QA 2VLKB 1MCOH 4NUMA 3A3YB 4RX4A 1DQIA 4OT1H 5AYQA 4HOMA 1OOAA 2AHIA 3SOTA 1FFPA 2DF3A 1M2VA 1FNGA 4FA6A 2NYKA 2YKLH 1L9SA 2DLEA 3QFDB 5KYXA 5EV7A 1E5UI 2XZQH 1TTGA 3MLYH 4BFBD 4NSKA 2AABL 2Z8SA 3MLXH 3TCXA 2GJZB 1HL5A 1SY6L 2RR3A 5AL8A 3L3KA 1CGSL 2XACC 1KB5H 3HNSL 4J4PC 5KG9B 3SD2A 3EOYG 1CLZH 3AM8C 4XN5A 4R9HA 4PJDF 1CLZL 1V8HA 5KOVC 2E46A 1ZA6B 4G7YL 3BKJH 5AUMA 3UJIL 3FH7A 3WHE0 2OMNA 1E67A 3NYKA 3WELA 4PU2A 4Z95H 3JWOH 3DV4B 2VIRA 4PHXA 3C5ZC 3TPKA 4X83A 1IGTA 2O30A 2FE0A 1K6QL 5DUBB 4I13B 4Q58C 4Q14A 4Z76A 3ARZA 1CTOA 2R69A 2YJLA 3VE0A 4M6NL 5TPWL 1QO3A 2P5EB 4KY2A 5DZLA 3IDXL 1G7HB 3CNKA 2CA4A 4FNRA 1VA9A 3AXHA 4MNGA 3P69A 4LLVA 1QEXA 1XF2A 1F4HA 3UADA 3MRKA 4KJWD 2OX5A 1LWHA 5CIPB 1NDMA 3FTYA 4GKSB 4NLAA 1X5JA 4FFWC 5LCVH 4NPYB 1SEQL 2P52A 4F58H 2Q7YA 1H3XA 3OKLA 1XGRA 4LVOC 1MN4A 1TIUA 2R51A 4OFQA 1E4XI 1ZK9A 3V4PH 1R5VA 1VAHA 2UZIH 1MLBB 5LGHH 4JPSA 1DE4B 5H37A 5JR1L 1X9UA 2JVUA 1Y07A 2SODB 3BZ5A 3D30A 3BP5A 4NXSA 3VWKD 5I1DB 2C7UB 2XRAL 2JMRA 3LZFH 4N8UA 5IB5B 5DZAA 2YSTA 1DQQB 4HC1L 4YL9A 4AQEB 5JPNB 3LIUA 1FAIH 1Y6KR 4M6OL 1DBJL 1ZJAA 1C9SA 3EIFA 3OX8B 3X12A 1QVOA 1D5ZB 2BVQB 4GAYA 4NLHA 3TLRA 3WO3B 3KXFA 3HS0A 4GW5A 3WI9A 4K94H 2OZ4A 5I18H 2XVGA 3CN2A 1HHGA 1U2YA 3LTVA 1YJDC 4GY4A 3BT2L 2B4CL 1CGTA 3KLHC 1HL8A 1FZOA 2VN3A 3GD1C 4PJBB 3G9VA 4HFWB 5F9OH 3SGKC 4J2QA 3KYNB 2YRPA 5F9WB 3SBPA 3U9PH 1E3ZA 3UTTE 3CV5A 4YHIA 2YQBA 2C9SA 3ARFD 4L5FE 4QIRA 3FXIC 5GGUB 1OQXA 1FVCA 3NJNA 4HEPA 5LHDA 1JS4A 2GIMA 3H3KA 3TVMD 4PJEA 5C0NC 4BM7A 4KAQH 4HC1A 1EJOH 1XH3B 5HGBA 3DIFB 2OJZL 4ABUA 4LSQH 4Z23A 4ZTOL 1N6QH 4PJCA 3GJFK 3O2VL 5AW1B 3BMWA 4XBGA 3QUKA 3PNWA 3KL5A 2BPBA 4J12A 3ZRSA 5FO8B 3AS3A 1XH0A 1NDGB 3FT4A 4PW4A 4MXWL 2OR8A 1ET7A 3F04A 4G80B 2NNCA 2FB4H 3W82A 4YHLH 1IKFL 2X1WL 3BAIA 4L4VB 3IMTA 3DDGA 2K70A 4M5ZH 1GR7A 2FNBA 3MBXH 4X8GA 1BW8A 3UYRL 3BN9C 4UQDA 2AP2A 4MA7H 5C0BA 4J1UB 4OM1L 4TLKA 1CURA 1O6SB 1HHKA 2BDNH 3H7LA 4ZFZB 2WGXA 4ZUUB 3DIDA 2IPKB 5DTFB 1JV2A 2EXSA 2N01B 2Z8WC 4OIAA 5CFAA 5FB8A 1A21A 5IMOB 3HZKB 4TNVK 4X9YA 3K2KA 3IDJA 4XCNB 4WF7A 4I0PD 2L4OA 4WHYH 4BFIB 3VGDA 5IZ7A 3T8VA 3QWNA 1GTFA 4QHNA 2QHLA 4NCC1 7FABH 4JPIB 2Z9TA 2K6YA 2VZ1A 4FQCL 3LQZA 3W11D 4X6CA 3WFEH 3QULB 1SXAA 1QLEL 3L3KB 3L48A 4HUCA 4K23L 2BINA 3FU8A 1WGOA 3DX8A 4A7GA 4KK6C 3G6DH 1URLA 3UBXI 1G7JA 4OIIL 1PZDA 3MNZB 3GGWB 3RB5A 4NI3A 4W93A 2OQJA 1U8MA 2CHXA 2DM3A 2WQVA 5AVTB 4CGUB 3OMZA 5I26A 3L3DB 1H8NA 3GIVB 2HX8A 4PRHD 3P0VL 5F70A 1NM4A 2YJQA 1ED3B 3KR3H 1X44A 1EZLA 4RSVA 2DQTH 4B9CA 5I15H 2NDFA 1VCBC 4U1SA 1TXKA 4QRTA 2IO5A 4IBSA 1SHXA 4MMXA 4Y5VC 5HDBB 3ENEA 3TX4A 3M88A 2OXHA 4QRFA 4U6VH 1TPXB 3QIWC 2BLFA 1U8HA 3CZEA 3A4AA 4G7RB 3BWUF 3V6OE 5CLXA 5D9SA 2GQHA 3ABZA 1E9OB 2NX5B 3DETC 4LASL 2P46B 3CLEL 3NCEB 2E0PA 5AW6B 2OMUA 4X6CB 4B9KC 4NC0B 3GXIA 4XPTL 4KXCA 4ODHL 2W9DL 3VXSA 1BM3H 1N8ZB 3JTTB 3JV4A 3KPMA 4DERA 5I17B 4HKBB 2CUHA 2ODHA 1XHHA 2CKBB 4S2SA 1IFHH 2KL6A 1FCCA 1ORQB 3P4OB 4PR5A 5GGRB 3VFOB 4AZ8A 4FCAA 4R7DA 2D8KA 1AJ7H 1XL4A 4PJHF 5D1ZI 1SYVA 4U1IA 3MRIA 3K0YA 3HMWL 1TU2B 2ZKMX 1UZ6E 3TM6A 1ZV9A 2DQJH 2W60B 3N1PC 1BG9A 2PWEA 5C97A 4FQPA 1PPIA 4KKCC 1KYAA 3BLBA 4APXB 4BH7B 1F4WL 4DP0X 1KXTA 2DIEA 5EFIA 1OLLA 2VLRA 2DLTA 3O81A 3IJYA 3OAZH 3NCYP 1SMDA 5JUEL 4XPBL 3VRIB 1PDKB 1Z9SA 1S6NA 3GMMB 4WHCA 3L4TA 5ERWB 5ICUA 3WKMH 1AKJA 3BVUA 4F80A 4YXHL 3C75A 2PYFA 4PS4H 4XB8A 3UZEC 4WWKA 1RIVH 1WO2A 1BAFH 2QVTA 1NBYB 4RQQA 3ABLB 5MEPB 4YEFA 3NSDA 1MUJB 4JHAH 3S8FB 3RIAK 4Z7NB 1FBIH 1EHAA 2B14A 4DVBA 3PGDB 3ZDXB 1F90H 4WW2A 1QWHA 3I6GA 3NQIA 5DD6A 3V0GA 1QFUL 4N2IA 5FYJH 4HJGB 4HKZA 3MTRA 2XWJA 4M6ML 4PRNB 2F08A 2C4FU 3D33A 3RJOA 5T1LA 4F58L 3VA2C 4YNYA 3B2PA 5F7AA 1LEIB 1IGJB 2A38A 2FX7L 1JGVH 1YNTA 2EDOA 5F3BB 2C3VB 3H7BB 4Q56A 5DWUL 1OTSC 4LCYB 2YOAA 4F27A 4P9MH 4D3CH 4ZYKA 2NTFA 3N9GH 4UAOB 5IMMB 4FDWA 2XRAH 1J5DA 3KWXA 2MQ3A 5EH1A 1ZLUH 4XMXA 1XH2A 4AMKH 3T0XA 1RH8A 1M42A 4PY7A 1UASA 1U3YA 1AGCB 3WKML 2FD6H 2ITCA 4Z7UB 1TVDA 5L6YL 4B0MB 3S8WA 1NZRA 3HB3C 1U8CB 5D5MB 1JMZA 4ETYA 4HS6A 4A2DA 4XBPB 4X4YA 3O9WD 2BOLA 4MZ3A 2YXFA 3A47A 5HJBA 3FL7A 5C0CA 3BLPX 3EFDH 5J56B 1BD2B 3SE6A 1NCNA 4YE4L 2Y07L 3KWVA 3HNSH 5LAXA 3N1FC 3QO1A 4L3EB 2XDHA 4KGLA 2X7LB 5EU3A 4BZ2L 2JLPA 3SPVA 3T8XA 1U91B 3LNIA 1MI5E 3D7PA 1GC1H 4OLYH 3UH8A 4XO8A 3Q8FA 2R83A 1C7TA 4XMTA 5AAMC 4EQ3A 4ZAKD 3CQQA 4GJTB 5IROC 3VXRB 3NDYE 1AIFA 2CR6A 3OBAA 5LGYA 2NMSA 2ZOWA 3CVHA 3Q2LA 4WCYL 5JPMB 5K69A 3ECVA 5E2VH 1LJMA 3TBTB 4EI5C 4WI5A 4OZHA 1EJ8A 1AZNA 2MOGA 5IQOA 1T5KA 3TN0D 3ZYJA 2HG5B 3ZDYE 1A9EA 3RWDA 4K3GA 1P1VA 5DFVC 4HALA 4Z6AT 3GSWA 4XO9A 1UKTA 3PHSA 3FUJA 3VXQB 4HH8A 3EOTL 4JM2D 3FU7B 3D07A 2PR4L 4OLXH 1CGWA 4H2CA 1E4WL 1BYOA 1NM9A 2BCKB 4LSUL 2JKXA 2QV4A 3V5KB 1F3DJ 1USZA 4X99B 5FAAA 1L7TL 3SKNB 2JNZA 1T2XA 4FOMA 4R84A 4P3WA 1JYXA 4MFHA 2F7OA 5C09D 1JL8A 2EILB 3X3GH 4W6YB 3T1FB 4JW3A 5GS1B 5D5ME 7FABL 2APXA 2QFPA 1JXKA 2V2XB 4TPRH 3WNIA 4P2YA 3K8KA 1UH2A 1FNGB 4J3OC 5CHNB 3TYFA 1IAKA 3G6JF 3WFEL 5F6IB 1PG7L 2PP7A 1ZGLA 1OOWA 1A8ZA 4N28A 3CLFL 4HMCA 1HDMB 1LP9F 2WXRA 1KFAL 4QYOB 3BKCL 1ZA3B 4W6WB 5D1XC 5CZKA 3X11B 2PO6D 3L81A 2VDMB 3S3JA 4MA1C 3QVAA 4P46B 2ZG3A 1KTDB 1RZFL 1WQVT 4FD0A 4TQEL 4BHUI 1TMCB 4UTCA 5D4IA 4YHYB 5GZNA 4XN1A 3A24A 5KYYA 2GYSA 1KJ3L 4YZFF 2WLLA 3MRHB 1KBBA 2ADGA 4NZ8A 1OTUC 5HJDA 2H45A 1EO5A 3HNVH 3FTZA 4LARL 1YNTF 3CDZA 3VH8G 2VLRE 2Y7LA 3P2DA 1S8DB 2CHZA 4QHMA 4XX1E 1IAIL 3RZCC 2CO6B 3BXNA 1SXCA 1KXVA 4FHKA 3GMQB 5E5LA 2NQDA 3QDMD 2YMTA 1BMZA 5AB1A 3QZWG 1ICTA 3ZE1B 2PP9A 2PWHA 3EBHA 5GJTL 3BAJA 1DVFB 2ITFA 3W56A 4HJJL 4OW6A 2VXQL 5CJ8A 3IS1X 5J6GB 2XZCL 3ROLB 1BJ1H 1G6VK 2EYRB 1ZA6A 5C0GA 1MAKA 3CAFA 3EYQC 4YHOH 1YEIH 3Q6GL 3LPPA 1PZ2A 4DPAX 2HG0A 1DVUA 1GCYA 3PWJB 3HE6D 3OAYK 4RH4A 1P4UA 4NQED 2C9XA 4PRAA 1Y1UA 4HZAA 1I75A 2ENYA 5DURD 4GG6A 1IKNC 1A7QL 1IBBA 3L4YA 4X0NA 4ZMVA 1W8NA 1RZ8B 1DZBA 2GJPA 4F8NA 4TF4A 3QWOB 5ABAA 3OKOA 5IVZA 1DLFL 4BXSV 1HOEA 1TQCC 2NXYD 1U33A 1EHLH 1DVQA 3IMRA 3H3PH 2I60H 1RPQA 1S9WB 5AW3B 3HHSA 3MRQA 2ZSVB 4NPYA 4NCC2 1YMME 1R24B 2DJUA 3QSKB 3PS6A 1GYAA 2MQ0A 4CVUA 3ABKB 3H42L 4XVTH 1SLXA 4ANKA 2N7BA 5EA0H 2Y36L 5AKVA 1QR1B 3I3BA 3K74B 2OTPA 2AS5M 2BIMA 2L04A 4H8WL 2X42A 3D69A 4Z77A 1SEBA 4FQ2L 4ONHA 2B2XH 1XR9A 3BEWA 1UJ3C 2C7UA 3L4CA 3LRSB 3CSTA 4TQEH 3V52H 4QNPE 3EJSA 1DVXA 5B38B 2UUDH 3S48A 4WUUD 5D71H 3LHPH 1S2EA 4UT9A 3T04D 3MO1A 3TBTA 3LV3A 3APMA 1RSYA 4F7TB 5CD3B 3FT2B 1WC7A 3GO1H 5T8IA 3R4DA 2F7PA 4KI5F 4LBEB 5JW4R 1K8IB 1MCDA 1L9NA 2Y2YA 3Q6FB 3FB7A 2XOTA 3INUH 5FUZH 2R23A 5KSVB 4OZFA 4JK0D 3QHFL 5DJDB 3L1OH 2WIIB 5BPPA 2WHVA 1DFBH 2X3BA 4JO2L 4MJ4A 1FFQA 1XAKA 3RPBA 4MLIA 3JSSA 5DO2C 1WBXB 5DJAA 5DQJB 2A83B 2ZXGA 2QQLH 4P5SA 5EBMB 4M8RA 2YEZB 3L2NA 3OGCA 3QQ9C 3JUYA 4G9DA 1MFCH 1QO3B 2G3NA 1CI5A 1T89A 1PLAA 3U0PA 4JRYE 1WA1X 5J4MA 1CXEA 2EEFA 2EIZB 2ED9A 1QSEB 3IDUA 3LS5L 2QV2A 2WXJA 1AOHA 3TV3H 3SCMB 5IR1B 2FIKB 4BFFA 4N0UA 4JDEA 2W81C 2EIKB 2G4EA 5F0MB 1E5YA 4OUUA 4OM0H 4UZGA 3ZKMD 4ZS7H 1OV8A 5I6XC 4WGWB 1MFNA 4Z3EA 1U8LB 5D7IA 4FGMA 2AJ3B 2JH2A 4XMLL 1O7DE 5JXEC 1HT6A 4PJ7E 1LVEA 3U1PA 5A40E 2R1WB 3MA9L 4K4KA 4OZGE 5HHQA 1XF3A 1HK6A 3OKDB 3DWTA 2JIXD 2J55A 3GMPA 3KWWB 3TPUB 2YPLA 2F5AH 1JGIA 1UWFA 2YSSA 5E6SB 3EJPA 2HRHA 3VFVB 2ZX7A 4JQVC 4JKLA 3TZVA 3U7WL 1FL3A 1I3UA 1A8JH 2J43A 1C08B 3DRQA 3FRUB 2E9BA 5H94B 5KOMC 3RL1B 4TVPD 3PU7A 3VUAA 1BEYH 5C6TH 2GCYB 2YKLL 4I0KA 1WTLA 3B9KC 3P1VA 3PFQA 2QADB 1GGBH 3COOA 5DXWA 2ISDA 2A9AA 1VEOA 5MP6H 3FO1A 5I74B 5L88L 1O0VA 1IMHC 3JQOB 2R2EA 4G6KL 2BSDA 4E36A 1XR8A 1U93B 3HHMA 3IXTA 4QLRA 4HF5L 5CGTA 4CU8A 2WWOA 4LDLB 3ZL2A 3AREC 3BO8A 3LPGA 4E9RA 4BGDA 4CSPA 5I0XA 1JGLH 1UT2A 3W81A 1AZZC 2Q0ZX 4LCUB 4F8OA 5ICZA 1OF2B 4PJ9D 2G60H 1A6WL 4U7MA 2YUWA 3VWJA 2H6PB 1JWMA 4LSTL 4XBMA 4TUKL 3L17A 3H9YA 2R0KL 2HFGL 4QT5A 1EO8L 4APQA 3BRDA 5EIQA 3MYJB 1KIQB 3BKML 4UNVA 3FQNA 2EH7H 3MJ7A 4OTXH 4Y5YC 2MJWA 5D1XD 2F5BH 4HLZG 4GSUA 3TEZA 3P9MB 4NYLB 2X12A 2J6EH 3MA7A 3K72A 3MCG1 4LU5H 4NO2A 3DK0A 3GMLB 4PY8J 1BM7A 5D1XB 1U8HB 4XN2A 4CSSA 3L9BA 3TJEH 1H0DA 3WBDA 3Q43A 4O4YL 1TG8A 4PJXA 3TESA 3D0AA 1UQSA 2C9UA 4LLMA 4KROB 4YIQA 4AQOA 5FECB 4NN7C 4R4FH 3QARA 2FT7A 5TGBB 5I6KA 4WWKB 4A39A 3AROA 3TIDB 1BHGA 5ISZB 1BPVA 1NC2A 2O5ZL 4K94C 2QVIA 5EO9A 1QPPA 1OAQH 2NSQA 4KROD 3SE9L 4QHLA 4Q6KA 3KE0A 1FYTA 3D2TA 1KN4H 4E9WA 4MNGB 4JR9L 2RHEA 5JW4M 2NY7H 5E2TH 3CZLA 1KLFA 1GHFL 2VDOL 2VR4A 3LS4L 1NCBL 4TSBL 4X9GA 4ZT1A 5IQNA 5JORB 1T04A 1MEXL 3B2VH 3WFHB 1M7DB 1HWHB 2DDQL 4X7SL 3VGFA 4QI3A 1S5IH 1V7NL 1G7QA 4JO1H 2A99A 3S96A 5LN8A 2DS4A 3MBEB 3B2DC 4Z0BH 2CO3A 4ZFGL 4D8OA 4XNUL 1A6VH 4NKDA 4M48H 5MEOA 4NC1C 5HP5A 2NTFB 1K8DB 3D9AL 3W0WD 1KNOB 2UZPA 5J6SA 1PGRB 4ZW8A 2WW8A 4S1QH 5LXVA 5DQ9B 4GKLA 1P4LB 3SODB 4WUUE 3KEHA 4EO5A 5IQ7L 2VW7A 3KL0A 2D7OA 1BVNP 1Q0YL 1UWGL 4FQCH 3S5LA 4PGBB 3H3BC 2ORBH 3RTQD 3IVKA 3GLAA 1DQLH 3MTXA 3S6CA 1ROWA 2OMWB 5L2JB 1ETB1 4TRPL 1H15B 3VQ1C 4C56D 2G3MA 1WZMA 2WINA 5EU6B 3SE4C 4AG4H 1EWHA 1N5AA 3DMMB 1YEDA 4WJG3 4ZI8A 3H6AA 1ACXA 4KZEL 5EBGA 4X8JB 4DP1X 1MFVA 2NT0A 3CBRA 4GPVA 4Y8AA 1PZSA 2R15A 3D08A 4MB3A 1B4JL 1KENL 3UMTA 1FO0A 2Q3AA 1RLWA 4RIRA 2ZJSH 4LSSH 4YJZL 4ZFOA 1PD0A 4I18C 5D5MA 5ADPH 4B5EA 4WHTA 1MKFA 1KYDA 1KLUA 2L3BA 3NA9L 2VR8A 4CC1A 3NA9H 2V3DA 4FEIA 4OF3A 1BVKB 2F53B 5JPNC 4M1CD 3MRIB 3WY2A 5ADOL 3ZIMA 1JPST 4ELMB 3VDBA 1L4IA 2OMZB 2CIIB 2BW5A 2OBGA 5FHBH 2R1YB 5BZXA 1IC4L 2Z91A 1ZPUA 3GNML 1F6AA 5IEKA 2FLMA 1MQ8A 2XX1A 4YDMA 3REWB 3OWRA 1CLOL 3B7TA 3KLKA 3BHBB 2DJSA 4NSKB 3PUCA 4MKTA 4F93B 3HRPA 5A3ID 3WGUB 4V1DD 1KGCD 1NEUA 6PCYA 2VXTL 4XP4L 1OEZW 2N7AA 3B3IB 2AK4D 4URTB 4ZUTB 1VJSA 1DO6A 3EOBA 1WHOA 1EAJA 5T5NF 5ANMB 3F7PC 2ARJA 3EYVB 5I30H 1E50A 3QIBC 1MHPH 3MRMA 3K6NA 5K5YA 3LV3B 4NUPA 2BVUA 4RFOH 4ZOEA 1A4JA 5GGTL 4Z0XA 3STBA 3AG2B 3D3VE 1IC7H 1CFNA 1HCVA 3C5XA 3L8QA 1S9VB 1YMHB 2WMPA 4NO0A 1MCKA 1FIGH 1VACB 2J5LB 3L95A 4M02A 5G2NA 5HHOB 5D8JH 1B0WA 5DYOB 5D93C 5J3HD 4G8IB 2WLZA 3ULAB 4HWZA 1BEYL 3LZLA 3MOBL 5C6TL 5FLVA 4BZ2A 5FV1L 3G6AB 4UQ2A 2ZD0A 5MHSD 2MNUA 4FQHB 2CIKB 3VSUA 2X1XR 1DLHB 5TDOA 4WAFA 2XBTA 2UWEB 4PP2A 3D12B 3WJLA 3D52A 1H3UA 1XSIA 1I8LC 2Y3AA 4JFED 2C9RA 5AL0A 3FK3A 4AT6A 3TBCA 1YJDL 4WTWA 1EGJH 3PL6A 5HVGB 3CFIC 4YSSA 3NABL 5IBUG 3MREB 1Z5YD 2IG2H 1FN4B 3NK3A 2IG2L 1TCRB 1LO0L 3ZDWA 1NIAA 3QCVL 1G1CA 3FTVA 4IMLB 3KWTA 4FKKA 5C0EA 5D9SB 3NOIA 2C9AA 1MWAA 2P7TA 3HZYB 4G8GB 4YDVB 4Z95L 3T8MA 3KPSB 3U30C 3L9RA 4YQXH 1T3FA 3QUML 1MIEH 3F7KA 4JO3L 2CLZB 2YFNA 4XNMA 1CD0A 2N0MA 1HHHB 3U2SB 4N4YB 2E56A 2VR9A 1BD2D 2XKNB 4K55A 4A7SA 2J6EA 4EIZC 2APFA 3U46A 5BCAA 3OLIA 2VERA 2VQUA 1EZSA 2ZUYA 4AY0A 3Q9QA 3VXQA 3L16A 4Z78A 3G5YB 5AEAA 4TUJB 1NKRA 3QCTH 1IM3A 3BAEL 4PLKD 5GSRB 3RX9A 4OGYL 4A6YA 3ULUH 3LEXA 5KVEL 4M3KB 1CVSC 4GRLA 3ASOB 2CIKA 1TEFA 4G5ZH 4C47A 4NT6A 4NQSA 1OTUD 2BIIA 4KO9A 3C6SA 4FXKA 1A7RL 3MRNA 4NZRL 3CC5A 1NGYA 5IM7A 3GSUB 5CZXD 1KJ2H 1BXXA 3OJDB 1B0RA 4UM9A 3TA3A 1KTCA 3QRFM 2X40A 4YHNA 5FYLD 1KCUH 1OCRB 2BNUB 2HWZL 2AI0L 2NUTB 4X99A 2F74B 2OMTB 5TF1L 3X13B 5IK3A 4I48A 1U9KA 3AZUA 5FA4A 3EO9H 4XP9H 4RGNB 2ATKB 5FDWA 5T3ZL 1YRKA 2DLIA 4OLUH 4AKPA 1T3FB 4CADB 4EBQH 4EBQL 4IJ3B 3L9EA 4NX0A 4A6YL 2FAUA 3LZPA 2V2WA 5DI8A 5CJ5A 3V4VH 1LO5A 1PLGH 5C0BB 3QFGA 2AXGB 4AQ1B 5CJQH 4Y2LA 1G87A 4GYBA 3IMVA 1QYGL 4M7KH 1OCWL 1HSBB 3D4ZA 4XXWC 1NGQL 1R17A 3J7HA 4KJQC 2P42B 4ZQKB 1OGAD 1QI4A 5ETUA 3PWPB 2J8UA 3H3PL 4ZOBA 5EZIH 3PDGA 4XMLH 3BSZH 3HG3A 3F6JA 5DMIL 4H8PA 2VGLM 3T3MF 4LNRB 3BMVA 1C8PA 1T5XA 1Q94B 3QIUD 4FQXA 3T3ME 3NPSC 2FTAA 2ZSWA 3GKWH 4AXWB 3J8F7 2VWEC 3EDEA 3NSXA 4IOFD 4JE4B 2A4EA 5FDYA 3FCGA 4LCVA 4GS7C 4QD2E 4O2FA 3CCHB 1IC1A 1EV2E 4HT1H 3RIFK 3TNMA 1DDHB 1S7UA 4FQ2H 1AAJA 4N2CA 3ZHLA 3EJZD 1X5YA 3HI5L 3LZNA 4RLDA 5F6IC 3TN0C 5GRXG 4M5SA 4ISVB 3CXHJ 4UU9A 5D7HA 2E7CA 2DWDB 3BT0A 5D5MF 1H3TA 2VN5A 3QNXB 4YSTA 2WBJD 3IFNL 3U0PB 1HE8A 4I88A 2WKLA 3ESOA 4AJVA 2XLLA 4ABQA 4H5SB 2EE3A 3ARRA 1A9BA 2J12B 3CFQA 4GAJL 2BM3A 4NRYA 1DR9A 4JBSA 3ZY7A 1BZQK 1T7XA 4L37A 1A3RH 4BSWB 4BK8A 4H1LB 2GSIA 4NQVB 2CBQA 4X8CA 4QUOA 1WYJA 5CLYA 3R06B 5HDBF 4AW4A 3HE6B 4RZCA 5K1JA 2BNQA 2EE2A 2RH0A 3DX7A 3AS0A 4ZAKA 1JNLL 3KJ4B 2CRIA 4MD5B 2FSEA 5FYLL 4W9LC 1S5HA 1EAPB 3STLB 3HG2A 2X2YA 3AACA 3IETB 4K3JH 4WJ5B 2FO4B 3K0WA 1IGYB 2VXSH 5HYSA 2ZKHL 2NW2A 4XTRC 3QFJB 4OLWL 4KQ3H 4ELDA 4QRQA 3C5ZD 3S0PA 3X3FH 4B5ZA 3WJLC 5C1MB 2H3NB 1MRCH 5D70H 2FGWH 2ENSA 4IK6A 4PJ8A 2X4QA 5A16B 3HNVL 4JY6A 4GBXB 4HIJA 4G6ML 1MHPL 2YA2A 3IEAA 1N2RA 1XB3A 3LEYH 4OLVH 2HVJA 2Q6WB 4PJEE 1G7HA 3V6FA 4PWFA 4UQ3A 5DRNA 1YMMD 4F37F 1E5AA 4KJYA 3U0WH 3ULVC 5JIIA 2BWIA 4GQRA 4YDLC 1OWRM 2RD0A 4KK8D 1T0MB 3U0TB 5BVPL 5H35A 4U6YA 3NT0A 1P2CB 2A7BA 2H4EA 3HUJE 5ELIA 5DHYA 5EU5A 5T1KB 1OP3H 5C0JB 5IJCC 3X11A 1O9WA 5HI4D 4E9VA 2ADJB 3ZU8A 1AGEB 3UO8B 5EWIH 1A7BA 3GIVA 3CDGA 3O6LL 5I75C 1LO3L 2J88H 4YK4C 4PGDB 4P59L 1KZYA 1IC4H 2EACA 3N44B 5D6DC 5E8OB 1E65A 3B7SA 4HDIB 5I8KL 1KWGA 5EEZA 4QEGA 1RJYA 2DH3A 4GS7B 1UQSB 4BINA 4CW1B 3T6VA 5FECA 3RG1C 1P84J 3E1F1 1YNKL 1E7UA 3DX7B 2X89D 5JDSB 3F84A 5KS9B 2Q7AA 3OKNA 1AD0B 4FMVA 5IF0A 3DTUB 3QJQB 4OKDA 4LMQI 1WS8A 3GYRA 1VEPA 4KNSA 5KYXB 3VFUB 4HF5H 4NAQA 2BK8A 3FPYA 2OMYB 5FYJE 1CWVA 1XGQB 3DV6B 2ICWJ 1GW6A 1PSKH 1ZVHA 5C0IA 3BIAX 1IEBA 3PWUB 2HKHL 1Z66A 2AV7A 3CD4A 1CQYA 1MVYA 4RNRB 1KIUB 4JFSA 1M57B 2MNWA 2PYED 2OSYA 1VENA 4LHUD 3RYMA 3NJGA 5TE4L 5KWYC 4G7VH 1SJMA 2OR7A 1G4MA 3KNBA 4EOWH 3T0EC 3DJ9A 2X4PB 4TL4A 4X80L 2PW2A 4LHUB 2WQ8A 2ZOLA 1U2CA 3H56A 3F7VB 4K7PY 2V7NB 2ZCHH 3FU0A 4H8QA 1E7VA 1UZ6F 2QQKL 3SOBH 4LQFH 3QIWA 1JYNA 4R7XA 4B7IA 1IKOP 3K46A 5GZNC 1OT1A 1ZIAA 1E4KC 4O9HL 3MACH 1Q94A 1FNEB 1UVQB 4FQXB 2KKQA 5B39A 3GZPA 4JZJC 5HDRA 2Z1PA 4X6BB 1VERA 2K6WA 3I02A 3AUWB 1LO2H 1XXDC 2CU9A 3S4SG 5L0QC 4WW1B 1WV7T 1IM9A 3NFSL 4R97B 4XE0A 2O5ZH 4H26A 2AJUH 3PL6D 1AO7A 3PCYA 3B83A 1S7QA 5F7EL 4MBRA 2RACA 1M05A 5CJXC 2WXFA 4IRSA 2BFGA 3P4NA 3JWOC 4KJQD 3CFUA 3OKMA 4AK2A 3NN8A 3SSGA 3WFBL 4KDWA 1SOXA 1TDQA 4XMPH 3SGJC 1AO7E 3GLZA 1FGVH 3AU1A 3DPBB 3L7FB 1W72A 3UBXB 1R5WB 2WBXA 1XGUA 4JO3H 4I89A 3PPEA 3PDOB 2KZBA 1G0DA 3QI9D 1D9KC 1SN5A 4NI6A 3WNOA 5IT2H 3C2AH 1SMOA 3APFA 4E42A 1ETZA 1MJ7H 1WT5A 2DQGL 3DVNA 2W9EL 2VC2L 2HTLD 3MV8B 1J10A 5KYWB 5K59E 4X98A 3UTZA 2FYYA 1BVZA 3H2QA 5AZ2L 1DN2A 1DJWA 1HI6B 4AVJA 4R0LA 4X50A 3PWLB 2IANA 3LKRA 2C1PA 4MCMA 1CL7H 4Y4FC 2AVFA 4R83A 5ACZA 4JQIH 1G1OA 1PLBA 1I1YB 2VL5B 3O0LA 4H0GA 1L6PA 2JKIS 4YFLI 3F62A 4V1DE 1HOCA 1HEJC 4PV9B 3FQUB 4X7DC 4QRUB 1W72L 2CQVA 3NIDF 1AXIB 1UB5A 3BVXA 3LKPA 4AJWA 4HIEB 1W0YT 1WWAX 2BVEA 2Y6SD 3KPNB 1XXFC 3OF6D 4PRIE 5DK2A 5IMLB 4PV8A 4DKTA 1RZJC 5LQBH 2MFNA 4IBYA 2VH5H 4R7NB 1YUHB 3M6DA 5F9OL 5JOEA 1RURL 5AAWA 5KTEL 3T4AC 4BFNA 1KG0A 1T6WA 3G08B 4OZ4A 3IPFA 3OGOE 5IVXB 1QPXA 3NGBC 4EI6A 4ERSL 3WTWA 1E8XA 3IDGA 4KRPB 2R69L 1DN0B 3BDYL 1OAUH 1DDTA 2VISA 2W5PA 4LVEA 1UHVA 2FUTA 5F7NC 1IEAB 4YDJA 3V9EA 1EXUA 2X1OA 4A2FA 5C08A 1HYSC 3EZ8A 1LTXA 3D48R 4S1SH 3TT1H 1SXBA 1Z9NA 1C12A 4XP6H 3FFCD 5D8JL 4Y4HB 4YS4A 1Z9LA 1DQML 1NCGA 3WEXA 4FZ8H 3FUHA 3FYEB 2ARJQ 4JO4H 5EPMA 1W0VB 5GGSY 3FU3A 1ITBB 1S46A 2NYYC 4LQ1A 3M1CA 3KDPB 4JKMA 1HNYA 4NHCL 2KZ1B 2X6CA 4NQDD 4NO3A 2J5LC 3T0AA 1BFSA 2RB8A 3IAQA 2YD8A 4FKHA 1TJIH 5T3XD 3NFPA 1PLCA 3OJ2C 1KDIA 4O51B 1VGKB 1JIBA 3Q6FA 1QPKA 5KVFL 5E9NA 1BQHA 2I07A 3P0VH 4LARH 4N3UA 2GBAA 5BVJB 4GKZB 2Z31B 3SDDB 2NXZB 1HHH