1N12A

Crystal structure of the pape (n-terminal-deleted) pilus subunit bound to a peptide corresponding to the n-terminal extension of the papk pilus subunit (residues 1-11) from uropathogenic e. coli
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
138
structure length
138
Chain Sequence
VPACTVSNTTVDWQDVEIQTLSQNGNHEKEFTVNMRCPYNLGTMKVTITATNTYNNAILVQNTSNTSSDGLLVYLYNSNAGNIGTAITLGTPFTPGKITGNNADKTISLHAKLGYKGNMQNLIAGPFSATATLVASYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chaperone priming of pilus subunits facilitates a topological transition that drives fiber formation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
molecule keywords mature Fimbrial protein PapE
total genus 22
structure length 138
sequence length 138
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1n12A00
1TR7A 4XODA 4AV0A 2JMRA 4X5RA 4J3OF 4XOEA 3JWNG 3BWUF 4AV5A 4CSTA 4XO9A 3BFWA 2UY7B 4AUYA 4AUUA 5JQIB 4CA4A 1KLFB 2UY6B 4CSSA 4AUJA 3RFZA 4X50A 3MCYA 4X5PA 5FS5A 3ZL1A 3JWNE 4AVJA 4X5QA 4XOBA 4BUQA 4XOAA 5ABZA 4AVIA 5IQOA 5F2FA 1PDKB 1UWFA 3JWNH 4XOCA 5AAPA 4ATTA 1N12A 5CGBA 3SQBB 2W07B 1QUNB 2XG5B 3ZPDA 1KIUB 2JTYA 5F3FA 2VCOA 4J3OH 4AV4A 5IQMA 3ME0B 5LNEA 4J3OG 5AB1A 5FWRA 4XO8A 1ZE3H 2WMPB 2J2ZB 4AVHA 2XG4B 3BFQG 5FLUA 1N0LB 5AALA 5IQNA 5FX3A 3ZL2A 4AVKA 4LOVA 5LNGA
chains in the Genus database with same CATH superfamily
5HI3C 3EJQA 2D7TL 5K9OB 1DO6A 5H94B 1FE8L 4LNRA 1IGYB 2VZOA 4YHML 3CDGB 4WCYL 3CDYA 2H3XC 1KV7A 3MV9E 4BGDA 1QI3A 2CLZA 4KX7A 2AEQL 2P42B 1CU4H 1LK2A 1AZCA 2Y1YA 3BQUB 4AOFA 3X3GH 4WO4C 1D5IL 3DPBA 5LJYH 4RGOH 5I1GH 1HT6A 1Z66A 1Q9OB 3WLBA 3Q9PA 3UERA 4J3XA 3TBSA 4X5WA 4ZUTB 1JWMB 1J9SA 2ICEA 5F6IC 1I9JL 4KOCA 2C9XA 5IWLC 5FUOL 3SDCA 3ZKND 4M93B 3A4FA 5DFWH 1ZVSB 2IH1B 2QVFB 3UJJH 5E4EB 1ZT4A 3NK3A 4NO5A 3QRBA 2ED8A 2CJUL 2BP8B 3ILQC 1U3HB 5CM1A 5IKCB 3U0TB 1RUKH 1BQSA 5I0YA 3DGGA 4QF1A 4RMBA 2D0HA 4JFOA 1FVEA 2R56H 1XH1A 5BRZB 5IFHL 5KSUA 4FA8A 5EORH 1QA9B 5JXEC 1BQHA 1EMTH 2YXVA 1VADB 3DOHA 3PGDB 1QP1A 1ZHBA 4Z78A 5DEJA 4YDMA 3ARBA 2GTZA 3GI8L 1EMTL 4JQIA 2J1YA 5TD4A 1PCXA 2VQ4A 3FF8A 4U1NB 3TJHC 4BZ2A 4D0DB 4U6HB 1IGTA 3BPOC 2I7SA 4FYSA 3GKWL 3H3KA 2ZKHH 4AMWA 3EJSA 4KKLD 4DW2H 1ASPA 2KS0A 4LDLB 1I7RB 5IB1B 3DBSA 2EE0A 1NBYA 1G0DA 3BUYB 4JZNA 1K4DA 2R1YA 4JN2A 5BO0D 1QLRB 4WHYH 5ECGA 5D9SB 1C5DA 5DVPA 5IW3A 5GS1B 2BFVL 3OAUH 4HH8A 1N26A 4ENZA 2X2JA 4NKIH 2J8UE 2VXQH 4UZUA 1CFTB 5INDB 2WTRA 4JKKA 1RZJC 3DUSA 4LRNL 1M3JA 3BJ91 2FH6A 4LCIH 5LAXA 4N90D 4IRSB 3CUPB 2VT0A 3RFZC 1RU9H 2XKNA 1FORH 4XTRD 3UYPB 3VSUA 1X5IA 1ZSDA 4RGOL 1MWAB 3LS4H 3X14B 3VD9A 1N18A 3BAKA 4ADJA 2IQ9L 3NSDA 4JANB 1S7SB 3QWRA 2XWJA 1Y0LB 4PJDB 5DC0A 1AD9A 1WTGT 1XR8A 4WLCA 4QHLB 4D9QE 2FQFA 3HNSH 1F3JB 5E08H 2IANA 3HMWH 3OPZH 4A2EA 2CCVA 2GK2A 1DEDA 3A3YB 3R19A 2BSED 4IU2A 3T1WA 3FRUB 3RVTD 3SGDH 4K5PA 1M7IA 4AM0Q 2HG5A 5CEZL 4YHLH 2GYSA 3UTSA 1I7RA 3K6FA 1UVQB 4Y4HC 3MO1A 1KJ3H 2AANA 4XO5A 4AVHA 5GS3A 2B0SL 3FRPA 1K9TA 5DEGB 3IDYB 1LDSA 1VF5C 1SHWA 3HE6C 3DETD 1R3JA 1YHPA 4X9BA 3O6FD 4MXWL 5FF6A 4PRIB 4PJIE 1MFAL 2N59A 5IHZB 3S5ZA 2VDPL 4JG5A 5IMKA 5HYIA 1AO7E 3CN4A 1AAJA 1IAKB 2CWRA 3BAJA 4FN0A 4NN5B 4ONGL 4PRDB 1DQDL 1ZSDB 1P1VA 1RZQA 4LSTL 5C6PB 3C60D 4FTVD 3CLFH 1F5WA 1SLWA 5DDHB 1V05A 1VFOA 5F9WB 1E2ZA 4B6ZA 4F8NA 4XMPL 3HR5A 4MZ2A 2QVKA 2C9UA 1ES0A 5TE6H 2E27H 4JDVB 2ARJA 3ZDZF 3CSFA 4QD2E 3T2OA 3WKNA 1KGWA 2IADB 3EW3B 5EC2B 3EYOA 1EHKB 1BOGB 4CJ1A 1AD0B 3FO1B 1OTTC 1QO3A 4CADA 3L3IA 2WWNA 2BVQA 3CZFB 3M1BB 4K23L 5EO1A 5DO2C 4P4KA 4B27A 1MCCA 1S9XA 3HLKA 4S0TD 4TQIA 4R9HA 5CIPA 1TUPA 3F3HA 2BOBB 1IM9A 1CDCA 2O30A 5CP7A 2VWEC 3LZRA 2KZKA 3EOAB 3IFNL 5L8KB 3O3AB 3BQUA 4PJ5D 3DRTA 4HGWA 3RY4A 4Z3FA 1R4XA 1JIBA 1H3VA 2E76C 1T1XB 2SEBA 5IQLA 3WNJA 5CEXA 1AS6A 5JNYA 3ZZSA 1R3JB 4AIEA 2A77H 3U2JA 5DJ2A 3QFJD 4N90E 2HFFB 4ZZKA 5IVXF 3T0BA 1GKOA 3MGAA 2CU9A 4XTRC 1A3ZA 3SDDC 4ELKA 2DB8A 5IJCC 3GIZH 5DDHA 4BM7A 4G9DA 1TF4A 4XCFL 5ITFA 3Q7JA 2R0WH 1QLEB 2D3LA 3OHXB 3S3JA 2F0CA 5EO0B 1GGTA 2BP8A 3VXPA 1LQBC 4MDJA 3V6OA 1ZS8B 3AB0B 3GSVA 4JY4B 3G9AB 3GB7A 1AKJA 2F5AH 3FZUD 4FQLH 5EN3A 4AL8H 5BZWA 1DJGA 4OZGA 2YEQA 2Z9TA 1JPTH 4LHQB 3WAKA 5FW6A 4X9FA 1HS6A 2EKJA 1VESA 2DQUL 2WBJD 4HLEA 4DIXA 3D2UD 1G7IB 4KOBA 1Q9WA 1MVFA 4U4BA 1O9VA 1M1XA 1SY6L 4L5FE 4MB5A 1D3CA 2H2PC 4K3JH 1NCHA 4MCNA 3TCTA 2JJSA 3WUZA 1I53A 5D8JL 5AKVA 5D1QB 5EUKB 4GP5B 3WIHA 2RB8A 5D7JD 4WEMB 3WE6B 4NDMB 4XH2A 3V0WH 3L3GB 4IRJB 4BQ6A 4HT1L 4IS6B 3TF4A 5JNYB 4IU3A 1XF2A 2AZUA 1U8HB 2X4TB 3FT3B 1GHFH 2YEZB 1UADC 1UXWA 3BPCA 2PCPB 3E2HC 4LSPH 3D39B 2D7OA 5EU4A 4JQXC 4Z7NB 3HVDA 2HZHA 4UZGA 2J7LA 5CLWA 4OUUB 4ZXBD 4DUWA 3QZWA 4TSCH 2ZX8A 3OGCA 3QNFA 2LU4A 1FL6B 4JJOA 5IQNA 3JXAA 3UABA 5E7BA 2NR6A 5L4MA 2Q20A 3S97C 3TVMB 1ESOA 5FV1L 4AQEA 2RR3A 4WSKA 2PYED 3C09C 1MIEH 4ZW6A 5SWSD 3OV6A 3X13A 2PWEA 3O6LH 1AGBA 4XPGH 4GG8A 3BGFB 3L5HA 1UGKA 2GC4C 4PGDB 2X4UB 1N6QL 4J3BA 2JE8A 4ZSOB 4R90H 4YL9A 4MLIA 1UT2A 3HG0A 4JAMB 4V11A 5PAZA 4MQXD 2BW5A 2BVYA 1YSOA 3FQXA 3RZCC 3VCLB 1AI1H 5T1KD 3U2IA 5JIDA 3GJFH 1HH9B 4LVHC 4MB4A 3U79A 1K5NB 5DLMH 1C5BH 1I1FB 3BIKA 4OT1L 4A37A 5DUMH 3FUMA 5JOPE 3L4UA 4FL4B 4MJHA 4TRPH 2IWGA 4H44C 4ONHB 1AFVL 2QADC 1BQHB 5TPWH 2CM6A 5FO2A 4BSJA 4DTGL 2XZAH 5LCVA 3QQ3B 2YQBA 3S3DB 2DM2A 4GKSA 5EZOH 3CU7A 1TFPA 2J21A 3MO1B 4MZ3A 1JF1B 5BPPA 1F45A 3KPPA 5EOCJ 1A7PH 3L4CA 4A7VA 3D6GA 2B15A 3DHPA 4BSWB 2Q76B 1UJTA 2CLVB 2Y2TA 3ES6A 4FG2A 4NT6A 4OT1H 4AQAB 2WZAA 4JVUA 1I3VA 4JPWL 5DS8B 3VWKB 1LEIA 3SY6A 3CH1A 4MBRA 4F7EB 4X5PA 5I76B 2Y5EA 5DSCA 3U1PA 3IXAA 1CICB 3NMEA 1EDQA 1V54B 3WJJC 1MREL 1T83A 4P3WA 1AS8A 5K39A 5IQ7H 3R0MA 1UHVA 5DHVA 2FUTA 4X6EB 2Z31C 4KRLB 1YEHH 5GSRB 3SOBH 1L7IH 1X5HA 4Y5XA 4P05A 4C56D 3U7YL 5E2UL 4A2DA 3E6HB 5LBSA 3L45A 3UCRA 5KW9H 4Y89A 2IPKA 5LBSL 5A3ID 3W81A 2IG2L 4ZSOE 4AZUA 4CADB 4OQTL 3ULVC 5C09E 3O2DL 4Y1TA 3L3HA 2ZUYA 4KHTH 5AW4B 4G8GE 1KY6A 3GFUA 2RBLA 2XFGB 2D4FA 2WINB 3VXNB 3KXFD 4F8OA 3MNMA 4Y16A 5KN5A 2JXMA 2CAKA 3GI9L 4XAKD 1U2YA 4KFMA 3GSRB 4LLUA 1CTOA 1E9QB 2NY6D 3KR3H 5FYLD 4PY8I 1QNIA 1F42A 1S7VA 3IGAA 4NP4L 3RKPA 2A6DB 4OLZL 3C87A 3DUUB 1ZHLA 5FGBA 1TYRA 3VB8A 5I16B 1VB9A 2YPLB 3B9AA 3IM1A 1MQ8A 1P84K 2IFFH 1KB5L 3R06A 2P47B 2AS5M 3TJEL 1KB5A 1KBVA 2FBJH 2GTZB 2OTUA 3JSSA 1V3JA 4JFQB 3CFDB 4M8VA 4WW1A 4Y2OA 4U1JA 4BZYA 5BUGA 2HVKB 1OTTD 4BKTC 3L3DB 5F8RC 3PQYE 5AW2B 2YARA 3WDJA 2GK0A 4X8JA 4GB9A 5LCVH 1I9IH 4YHIA 2DH3A 5LWYL 4ZXBC 3ZJAA 5I1JL 3VFNA 5CP3A 4TUUA 3O4LD 2V9QA 2JCCB 5B1KA 1LVEA 4K3EH 2EIZB 3QGVA 1AKJD 2BOLA 1DBML 1PNDA 1ET5A 2F54D 2VJ0A 4OCSH 1R47A 2H3NA 2XPGA 4PY7B 4DNLA 4G8FB 3QEUA 3C9NA 3CFMA 3HFML 1B0GB 2WQAA 4H0LC 4U49A 3HRZC 3TZVA 1ZT4B 3AACA 3IBEA 2RACA 4NO5B 4X4YB 2A0LC 3SYOA 2ZP0T 4FLSA 4KQ4H 3C8KA 1S7TA 4DGYL 4Q7DA 1UJ3C 2NY3D 1HILA 5D1QA 3V6FA 3LKQA 3C6LB 4JFSA 1RIUL 5F88B 3SE8L 1NIBA 2QGEA 4S0SD 4YGVA 1MWAA 3S3PA 2YD6A 2VO5A 2BZCA 1UASA 4L8SB 1IKNA 4U1HB 1MFUA 1YJDC 1KIUA 1B9KA 2J8UA 1ZANH 3FRPG 4POZC 3T0EE 2PWFA 5ID1A 1QHQA 3WNIA 2N7SA 3IKCA 3OKDA 3MX0A 5JDSB 2GFBB 1IGFH 1WBXA 2YXFA 4TL4A 4H1LH 4QJ5B 1T1YB 1JUFA 1D6EB 2ADIB 4L3FA 1BVKA 3Q06A 4TVSa 5K9OA 3VD0A 2QR0A 1A8ZA 1BD2D 4XCCH 3QQXA 2C26A 1A9EB 3G6JE 5D70L 4LRIC 4ZW8A 2EE2A 5AG8A 1CFBA 2NY3B 5F93C 4ZNEA 3U1SH 3ZIMA 2DWDB 2H32A 2PTUA 5BRPA 1TJIH 3IJSA 3UJTH 4GRLA 3UEZA 4XT1C 3KPMB 2DJMA 2KPNA 3UTPE 3MRIB 5D1ZC 4Y5YC 1A7QH 1COBA 2IDCA 4Z18A 4X7TB 2WQXA 5EWIH 1IBFA 2Y5TB 3L7EB 4NZDA 1ZLWH 5AFAA 2N56A 1YAZA 2BY3A 3P9LA 4EOWL 1I1AC 3DO7A 3BIKB 3EFDL 3G08A 5ESAB 5D5MF 3V5DA 1FNGB 3MQIA 2MRYA 3B4NA 4WUKL 3DHMA 5I6LA 5TDNA 5F88A 3WO3B 2EYRA 3I02A 4HCRA 2CA3A 2R83A 3EGXB 3JWNC 4PJ9B 1FCGA 1NBVH 4MJ6B 3V5HB 3CIAA 3ABKB 5AVUB 5FO9B 1W72H 2VSMB 5MENB 3HZMA 4JHAL 2X89D 3QWOB 1DEEB 1Z0NA 5F1NB 5I8CA 4HUXA 2P8PA 5E0FA 3I9PA 1YY9C 2LTQB 1SXNA 2R39A 2NQ3A 4PJAB 2AERT 1CBVH 1AR2A 2X1WL 3O4LE 3EBGA 5L2JB 4OF5A 3VWKC 4BE5A 4NRXA 3HRZA 2IAND 3FN9A 5DJ8A 1JD7A 5C0FA 3OAZK 1MWAH 1E7VA 2C1PA 2BWIA 4JPSA 5BMFL 3U82B 5EA0H 3DVGA 3ARUA 4NX0A 3UPCA 3G5YA 1JPGA 4MAYC 5LGJB 4RIRA 4YSCA 4CL7A 2FHCA 2YPLE 3SYCA 2YBGA 1VZIA 1CD1B 4YAQB 1M2VA 2GJ6A 3MJ9A 3BD4A 1RUAL 3KBFA 2AQRA 4Q56A 2EAEA 2ZPKH 3HHSA 4MXVE 1CCZA 5D55A 3I75A 4UOZA 4K94C 3I9GH 3O6KL 1GGYA 3DPDA 4KNUA 4WTXA 1BWMA 4QJ4B 3OSKA 4U0QB 2IGFH 4MX7A 4OF3A 5AAMA 2VB5A 4JY6A 4QAWA 4UNIA 3S5LG 5ITBH 1JZ7A 3VVWA 3O2DA 3N04A 2R2BB 4X4KA 3B2XA 1KB5H 3Q1EA 4P2OD 3Q6FB 4KKLC 2VLJB 3AMLA 5E8EA 2YD4A 3WFEL 5IFJA 1QFUH 4G71B 4X7SL 5GJTL 1IQWL 4WI4A 3LB6C 4Y2LA 2NY0D 2AQ2A 3H3BC 2P5EE 1X9QA 4WNQA 1X9LA 3QJUB 4PJ8D 2Z8RA 4UT6A 3IETA 1QRND 4E9WA 2ZTBA 3ALXA 3CFQA 1Z9LA 3QO0A 4OLEA 4KI1A 4KVCL 3Q6GL 4ZFGH 3FT4B 5DK0B 5EBWB 3BQUC 1V7ML 3EJYC 4TQ8A 2UV3A 1HSAB 1B3IA 4R8WH 2I24N 1HHKA 3GBEA 3N0PB 1IGCH 1Q9LB 4P23B 4PTTB 4POZD 3TYFA 3LEVL 5I18L 5EMYA 4MD4A 2H26A 4KTDH 1OIOA 4D8PB 5FLVA 2VDLH 4PJ6A 4KRPC 5F3HB 1LEIB 1DL7L 4I89A 1J87A 1SOXA 1Q94A 3SGEH 1I3RA 2ATAA 1MREH 4X98B 4E9SA 2ZCZA 4FYRA 3Q5OA 4ANUA 4EUPA 2CXGA 1TLKA 2X7LB 3T1FB 3TCLB 2JKTM 3BD5A 1ITBB 1UA6H 3UO8B 2J6WA 2ESVB 4OD2B 1SBSL 3U9UB 1Y1UA 5DMGD 5EC1B 1JJUA 4R26L 1CGWA 5DFVD 3V4UH 4UMGA 2R9HD 3RU8L 2G5RA 5T1KA 5F97E 4KY2A 4LCYA 1RUQH 4CBPA 3AY2A 4H8QA 3S5YA 3KL3A 5I1GL 1MFVA 3S4SG 3KPOA 4JX0A 5KYWA 2NNAA 3QZMA 4IBYA 2AEQH 2JKSA 3NCJH 1K5NA 4DAGL 1NMAH 3PG2A 1NKRA 1TJGH 3CFKA 3NIFF 3KJ4B 1T83C 2ROXA 2HKFL 4FQ2H 4KXCA 1BLNB 4IBSA 2FBRA 4A6YH 1WG3A 3TEYA 1JZHA 3MRPA 2I32A 1W0YT 2YWZA 1MIML 3H7LA 4HX1A 1P6AB 4QDGA 3VXOA 1LK3H 5E4IA 2VXVL 1UXMA 1VAHA 1F3RB 2H26B 4D8OA 1AR1C 4M3JA 4PYHA 3WEAA 1CL7H 1A64A 5CGBA 2KYIA 5HDBB 4IMKC 2DM4A 2ZUTA 2HRHA 2ICEB 2Q86A 4L5FH 2OA9A 4ZYKB 4D9RE 3VWKD 4L29B 3QUYC 4DK5A 4WV1C 5JIPA 5D7JA 4RAUB 2PWDA 4HOWA 4Z7IA 2MQCA 2WM0A 4P07A 1MHEA 2ATPA 4UINL 5DHYA 3UAJD 4OZIF 1U3HC 3P0VH 4YE4H 1YN6B 1CICA 3SCMC 3LNFA 3IB4A 1J11A 2L04A 2VR5A 1IC7L 2XVLA 3WFCH 1QR4A 2AQQA 2R4SL 4PPTA 3U9PH 2JLPA 4G6JH 3T2PA 4NN6B 4F8LA 3DXAE 3OR6B 4KMTL 4EN3C 2G9HA 4Z7OF 3ULSA 2QSCL 4XCEB 4Y2DC 4M43H 3T8XA 2JJSC 4UOW1 5BS0B 4EZKA 4HWZA 3HS9A 4MJIE 5FA4B 2JB6B 3UBXB 4MAUH 2AJXL 2JELH 4YDLC 5C08A 5IB2A 1GJUA 4NB7A 1RZ8B 5DZVA 2WQUA 4XWOD 5EZLB 2ZUSA 3REWB 4PG2A 3JZYA 4TNWK 3FU9A 4P2QA 2Y3NA 1H3PL 4H0IA 4Z7VB 4P59H 2OYMA 1NBYB 1WZKA 1JGDB 1N0LA 4O2FA 3RJQB 2C1PB 1CTMA 1JGIA 2IGLA 5D7IF 1NAMA 3KPSE 1S7UA 1EJOL 5FLUA 4NQXB 3M8OH 1G7MB 6PCYA 3BQUD 4PJ5A 3RIFF 2AK4D 3WHXA 2A74B 1OF2B 5FIEA 3SE3C 3TJPA 4UTAH 3HC4H 5DJZB 1EQWA 3NDYE 4MGXA 1XBRA 3TO2A 3COOA 4C56B 2P5EB 4ODUB 4PCSA 4MAZA 4E68A 3QG6B 1C08A 3ARGB 5IGXH 2R1XA 1KLFA 4EUPG 4X7TA 4U3SB 2WUCL 2H6PB 4GAFB 5GGVY 1L9SA 1K6QH 2B14A 1YUKB 2YUZA 3GGWB 4NNPH 1BFVH 2JKXA 3QDMD 4RVBA 5IF0A 3M07A 4Y5XB 1AH1A 3RDJA 2ODIA 2AJUH 1G84A 1GMEA 5CSGA 3VH8B 1MCQA 2G9HB 1U95B 5IVXE 3RGVC 5IKCA 1TIUA 4LPUA 4ZS7H 5I1HL 2YBRA 2XA8H 1MFEH 2P9RA 3D2UB 4F7TB 1ROCA 1PYWB 4ZO6A 5A2JH 2AW2A 2PLTA 4K5NA 4EMZA 2CLRB 4JPVL 1EERB 1IM3B 5GXBB 4Q4IA 3MRCB 3F5WB 1VIWA 2W07B 2J1ZA 3ELAT 1CE6A 1LO0L 2DS4A 5ICXA 1KGUA 5TE7L 4DP8X 2GY5A 3E9UA 4U1HA 1UYWL 1W91A 2YD2A 1N0LB 4KTEH 2EADA 4TYUA 4FI7A 5AZEL 1F4WH 1HSBA 4GMTL 3IN2A 1YN7B 4ISVA 4Q89A 2DYPA 4HV8B 3CCHA 3DYOA 2H0FA 2YAQA 1AQDB 1H8NA 2NSQA 1LP9A 5GS0H 1S78C 3N43B 1AOHA 3IJ7A 5IBLD 4HUKB 1MJJB 5GS1A 3STLB 3BAIA 4HKBA 2ESVD 4Q6IB 2ZAIA 2FJUB 5DR5L 2EDBA 5DJ6A 1CF1A 4EOWH 5C71A 2AJ3B 1KYUA 2VDNH 5DC4B 4ENEC 3NQKA 3IU4H 2JCCA 4GUPA 5KS9B 3D85D 1JZ2A 3VTTA 3PHOB 4JDTH 3QWRD 4ZW7A 4NGHH 3WDIA 3QORD 3JWOH 3P54A 1AIFB 5DUBA 2AQPA 4A7QA 1E5AA 4AC2A 5GGTH 5JQ6L 1CE1H 2NY0C 2IBZY 2VDRB 4LF3B 1T2JA 4HG4J 1XIWC 4APQA 4G3YL 3KPSD 1U8CB 4JM0A 4JFOB 3SKUD 4N28A 5KANG 2AV7A 3NIFE 4ZOCA 5FUZH 1FFPA 1INEL 1CXFA 3L13A 4XNQB 1LE5B 2WYIA 1RVFH 4GPVA 4KJQD 5C0DA 4HOZA 1A14H 1DYZA 1EZLA 1CXKA 1EGJA 35C8L 2BINA 3PP3H 4UT6L 3MXVH 1KBPA 3WMPA 2AMUA 4F58H 3DROA 1FG2B 2VE6B 3C75A 2BVOB 2BNQB 4CSSA 3DURB 3KPQA 1YMHB 3DRQA 4ONFL 2DKMA 4XHJD 1FFNA 1BVLB 4JO3L 1YEFH 1J5DA 1WC7B 4OZ4B 3S88L 1IQDA 3QYMA 2XX0A 5D6DC 4ZPTA 4DGYH 5E6UB 1FAIL 2PWHA 3MJ7B 1JDDA 2APSA 3QUHA 2WMPB 4NXSA 5I6PA 2WXNA 4J3OC 3MCKA 4Y88A 4QRTB 3T4YA 1UM5H 1IAKA 4B96A 3H2PA 3KPSB 4ICXA 1ZLVH 4ZD3H 4FXGA 1Z1WA 1GZPB 1ASQA 3JVFC 4G42B 2HJFA 2BDNL 3EBAA 1MUJB 1H8LA 1NWOA 2GT9B 3LXBA 4Z8FL 3GKWH 2XVGA 3BRGC 5H4YA 3ZHKA 2AQ1A 2ZX5A 3I9IA 5AG9A 3NEEA 3OMIB 4OI7A 1MELA 3B1TA 1Z9NA 1NCIA 1V7MH 3FO2A 1BAFH 1IAIM 4M7KL 4XCEA 2D3NA 4FZEL 3MV7D 3KXFE 2W91A 2XSKA 4MD5B 3ZE1F 5F3BB 2CHNA 4ZS6C 1ZGLM 1L3WA 4L9LC 5DJDA 1QQDA 4J3OF 2R2HB 3D39A 2IANB 1HINL 3IRZA 2DQFA 7FABL 4E9TA 4GAGL 3VXUB 3PV6A 4AVIA 4OIIL 1HHIB 3L5WB 1AACA 2ITFA 3L81A 4HGWB 2ED6A 1OAKH 1YG9A 3WMQA 3U4EA 3FT4A 1JZEA 5DK0A 4Z3GA 1UM5L 3FJTA 3MRDB 3ATBA 3VD3A 4N8VG 1DTUA 3BFQG 1PW3A 2BP5M 4M1DL 2CE6A 3MJ7A 4HMDA 3VI4F 4HKXB 2P43B 3NSFA 3IWUA 4G6KH 4DEPC 3ZQWA 1W72B 2KLSA 3MV8E 1B3JA 3FTZA 2XY2A 1RUAH 3KLAA 4R83A 4YIQA 3WTYA 1AHMA 3EOBA 3IMVA 3SGJC 4L9LB 1PFCA 2XJLA 5TF1L 1L7IL 5CEZD 4TTGA 4KUCD 4H13C 1ZS8A 3D33A 4FNPA 2WXPA 4K8RC 2BS9A 2XG5B 4CN1A 1KWKA 3TH4T 4IOSA 4UT6H 3HR5B 1IEBB 4Y5YB 2FWLB 5FUCC 3VH8A 2DMGA 4H88H 5LNDA 4WHTA 4YN3A 4FFVD 5F0JB 4W9EC 4PP1D 1XGPA 4I0CC 1TG8A 3MV8D 3RL2B 3DSFL 4XVJH 4OZHB 3M1BA 3VU1A 4BZ2H 4HWEL 2ADYA 1U0QA 2J4WH 3S0PA 2HN7B 2BLFA 1B6DA 4XO9A 5EDXA 2JFCA 2WC7A 5E6RB 3ESOA 4GT0A 5FC9A 5TTRA 1FFOB 3T4AC 5JW5B 4YHNB 3B7YA 3T0ED 3MRMB 1R33A 4PJFB 5ADOH 3KJ6L 2OP4L 1PG7H 4UM9B 2QGDA 1NGXB 5AB1A 3BKCL 4ATWA 1A9BB 3SDDD 1GCYA 3MRQA 2CO4A 4IBZA 1B2WL 5I1IL 3GUFA 5JIHA 4TRPL 1KLGB 1C12B 5FOBA 1VZHA 2Q7AA 3DMMA 4JBSA 3F7VA 4ZK8A 2PP7A 1AC6A 5IEKA 4L9LA 2DLFL 5TF0A 2O5ZH 3RWCA 5A43C 4JKNA 1JZ3A 2J57A 4E9XA 4HFUH 4L4TB 4YIQB 3MRKA 1I3GH 1U8IA 2HVJA 4OU3A 1QWNA 1T1WA 3NOIA 2APBA 1I9EA 5LAPA 1KELH 3W9DB 5I8OH 1BF2A 5I66A 1IX2A 3O6FB 1G7IA 2YN3A 3LRGA 5GGQH 2ZCKL 4QOKA 5FM4A 2PP9A 4GW1B 3TL5A 4HYTB 4JJ5B 2NT0A 2VDLB 1QKZH 4PS4L 5CP3H 2QPSA 3NA4A 4B9JA 3PAZA 1TZIB 3E3QC 2CGYA 4PW9A 3GS0A 1EZUA 5JPNA 3QK0A 4UMSA 5ADOL 4YHOL 2HYMA 3Q6FA 5IK3A 3AQZA 1NC2A 1NA8A 5C0CD 2GTWB 4BFIB 5AYTA 3X1EA 3UDWA 4DK6A 1LJMA 5ID0A 2OZ4H 3UBFA 1ILUA 1FYTB 4NO2A 2EUXA 1FGVL 4GKSB 1FFQA 3UPRB 2QQLH 3SJVA 2FJFB 2CH8A 1EZSA 1OVZA 1MRDL 2DBLH 5I1CL 1XV8A 4AGLA 4AIOA 1PD0A 4HHGA 2KZWA 1M56B 1EJ8A 3T9WA 3UZVA 4N2EA 4PLNC 4KK8D 1NLDH 4MA1B 2D4DA 3BFOA 2GSGA 3PNWA 4FNSA 1FLRH 1OALA 3FQRB 3FT0A 5BV7L 4QRTA 1G7MA 5JIQA 1E2VA 2XCMC 4AYFA 1MXDA 4IHOB 4NZFA 4UBDD 2ERJC 1J8HB 1KGCD 2HTKD 2ZSWA 4LL9A 4L18A 3VYNA 2WXQA 2XVBA 4XC3H 4PWIA 3WIHL 1S7QB 1J1XH 5LHDA 1OHQA 1AGCA 3N43F 1T66D 2R0WL 2VR3A 1S9KC 4LLQA 1BGXL 1S5HA 1EDHA 3LIZH 5IIEA 1SN2A 2W9DL 5DZNA 1BEYL 3VWJA 1MVYA 4HF5H 5CJOH 2NXZC 4PJHE 1M7XA 1IE4A 1FYTA 2VQ1A 2Z64C 2XKUA 3CFJB 1P2CB 1KGIA 2OW6A 3BP6B 3V0VB 4Y19D 1UZ8A 3ME0A 1CXLA 2B4CL 4EI0A 1U8QB 4L8BB 4K5LA 1Z3GH 4AQ8C 5EBGA 4NSKA 2CBMA 3Q1SH 4KHTL 3LZQA 2O72A 3QG7L 3RWIB 3QEQB 1R5WB 1RZIB 3JZ7A 3EYVB 4Z7OB 2N01B 1EEUA 5DS8A 2VXTH 4JM2D 4BSWA 1YUHA 4CU6A 1MFCL 3BWSA 3D52A 3TIEB 3SOBL 3CV5A 1PJWA 1RAMA 4WWNA 3I6GB 4Q2ZB 1J8KA 1OL0A 2DMCA 4YDJB 5CEYB 3LY6A 2L7EA 3NDZE 1SJEB 1H6UA 1QZNA 4FQXD 5KOMC 2ENYA 4N2HA 5K9JH 3F7YB 3HS0B 4K4KA 4R4NC 2QSVA 4K8RL 3V6BR 2FYVA 3LKPA 4D0CB 1SYSA 1DBAL 2AJSL 4JO8A 4ELMB 1MWOA 3NTCL 1P7KA 4P3CH 5SWZA 3GSVB 2QKIC 1QABA 1IGIL 4KK6D 3QORB 3LTVA 4MKTA 4RMRA 2PCFB 1KTJA 3D18A 1NCBL 3EHBC 1A6UL 3IJYB 2ZOLA 1KJ2H 3OHXA 3TURA 4GMSL 1LO3H 4G7SB 1ZSHA 4N2FA 1HHGA 2UWEB 2YQGA 3OMNB 4GT7A 4KJWC 1JZDC 4JM2B 4PTUA 5KVFL 3V6FB 1EHNA 3C2SA 1IT9H 3IJ8A 4OKVB 4Z3JA 5DK3A 5ICZA 5J5EA 3GNMH 2FJHA 3MUY1 2R0KH 1NCWH 4G11A 4PRBB 3BFWA 5AW7B 2ICWA 4AXWB 4DO5A 3ZBMA 3T09A 4FMFA 5GRJL 5JW5A 5GRVL 5GSVB 1U9KA 3L2LA 1LK3L 3MNWA 3NZHH 1A4KA 2XWJB 5H94A 3RKDC 4YHPB 1C12A 4RMWA 1YY8A 1NFDA 2F6AA 2CRYA 3NZHL 3A47A 3FF7A 3LN4A 5KG9A 1JF1A 3HN3A 3QJTB 4JGUA 4AK2A 2OPCA 3FFDB 3KBEA 5E4AA 5I74B 4LLMA 1I9RH 5F7WC 4B5ZA 1TU2A 4PWEA 5K9JL 4PJFF 4WUUA 2F53B 1XCQA 4OZ4A 1NPNA 3FO0L 4N0RA 5F7KC 2HG0A 1FIGL 3B2UD 3DRQB 4FHKA 1G7PA 4IJTA 3FB6B 4E42B 1MIEL 7TAAA 4ODHH 2NTFB 3VRJB 1CI5A 3WEXB 1QWHA 5BUAA 1CLZH 1GJWA 4O00A 4OF8A 1QSFD 5FW8A 2FLMA 1IEAB 4L37B 1I7TA 4QTHA 1NJ9A 3GZQA 3QG7H 4A2HA 1AHWC 2WXRA 1P53A 3ETBJ 5TJWK 4JAMA 4J6IA 1SDDA 1REIA 1G4MA 2AQSA 4JHVA 4KU1A 5C0GA 2K3TA 2P24B 4LDCA 4Q14A 4GXFA 5C6TH 5TE7H 3RZCB 4XN8A 1GIGH 2J8HA 3H7BA 3B6SB 5GZOC 5KYYA 3GDCA 1JPSL 5EBLB 3RWFA 1NANI 5KSUB 2CKBL 3L5JA 2VXTL 5IEHA 3QDGA 4Y7OC 4XGZB 1DUYA 4TUOA 3PQYB 1AXIB 4Z7UA 3OWRA 4P49A 2L4OA 4MD5A 5I23A 4F20A 1HL4A 1TCRA 1NDTA 4YC2B 4UNVA 4PLKC 3C5ZB 4CKQA 1WZMA 4B53A 2W0LA 1RJZA 3LQAH 4MJJA 5C7XH 3FH8A 2IFGA 2ED7A 4BWUA 2HLFD 4NCDA 4B9PA 3WU1A 4JREC 3QJSB 5C0JA 6PAZA 2ZXEB 1NOLA 3KGRA 4FQLL 5D4IA 3ZE2F 4BK5A 1XEUA 1CN4A 4X2UA 4YSRA 2GAZB 1GSKA 3VNYA 1IFHL 2X6CA 4MMYB 3VXSE 1SYVA 5JIIA 2ZE0A 1NGWB 4RAUA 4AEFA 3W37A 2R15A 2IAMC 4KO6A 4JKLA 2O4EA 3MCKB 1J8SA 4PW4A 3U0WH 4PJEF 5G55A 1PD6A 5CWSB 2VDML 4U3XA 1PAZA 3N2JA 5F7FA 2NY7H 3OLGA 3NSXA 1Z9SB 5DRWB 4XC1L 3NGBC 3WOVA 4FP8L 4N20A 2H2SD 3BESR 4X4YA 1IAIH 3CVHB 6FABL 2VLJD 1DE4A 5I1KH 1GYUA 1QATA 4QT5B 4WSJA 1NUNB 3WY1A 3S6CA 1R0AH 4NQVA 3X3GL 5EZPA 4UDTB 1UKTA 4OCRL 4DERA 4RMQA 3IS1X 4TVPL 3QUYD 5JZ7D 1E27A 3NP3A 5TDNB 4M61B 4PS4H 3H42H 4NQEE 5DHEA 5AZ2L 4WCYH 2VQUA 3OC8A 3MRMA 5ACZB 2IWFA 1FZJA 3ARBB 2W38A 4MJ2A 1ZHKB 4ZTOH 4L9DA 4OZIB 3GSUA 4LLDB 3US9A 2C3WA 4KJPD 2CO2A 4IKIA 4LAJH 3TA3A 1W6WA 1UD6A 3G5ZA 5ANMA 4F1ZA 4YXKL 3EOTL 2YSSB 2A74A 4DUVA 1ZHLB 3ARGC 3D87B 3S4SA 5KJRL 3B7UX 4DGVH 4HPYL 4BWTA 1EHAA 2WYHA 2WZPD 1RZJH 2HT4C 4JB9L 4MNQE 1EO8L 2XBDA 1XF3B 1W15A 2C9QA 2QSQA 4IJ3C 3HA0A 1RZJL 4JB9H 4M48H 4ELME 4YEFA 1ZVSA 2IH1A 3JWNE 3ROOA 3TONA 3VI3F 3BLPX 3LKOB 3WE1A 1L0XA 3SE6A 2OP4H 3MACH 1TTAA 4OKVA 5E6IC 1T03L 5D7SH 1XDTT 1PZ5A 4ZOEA 4QY8B 3NIDB 1EAQA 1NM4A 4P2RB 1A6AB 3CSYB 5IVZA 3ZRCC 3TTSA 1A7OL 3DGDA 4PJAF 3TTYA 5HY9A 4XX1E 4B0MM 3ENEA 2XN9B 4X6CF 3CN0A 3NIGF 3KEDA 5KEZA 3EYUH 1QLEL 1BCIA 4R4ND 5HDQL 4JMXA 4MLSA 3BPOB 1Z7JA 1OAUH 3DTXA 3VTMA 3H42L 4NS0A 4UDUB 5B1BB 4F15B 1QFPA 3K6IA 1FLTX 4FF9A 4UOJA 1NMAL 5FKAB 2YIHA 4ZMWA 2Q3AA 1JAEA 1EO7A 4OCRH 3UPRA 1PY0A 1GYAA 1QQDB 3S7GA 3B9KC 3CFTA 4WW2C 2YMTA 1HVXA 4ODWB 4X8GA 2XA3A 1FORL 2DKUA 2X6UA 1XCTA 4Z7WE 4YFLI 2E75C 2KMWA 3EH1A 5DHMC 2K7QA 3DC0A 3NSJA 5J6HB 2GHWB 2ADIA 1RJYB 4U3SA 4WHDA 3UAAA 3WTTA 3CC5B 2XZQH 4J1UA 1MUJA 3WJMB 2GT9A 1MF2H 2YA0A 4M5ZH 4NC0B 4QPEA 3U6RB 2XXMB 3DX9A 4BXSV 3PWNB 3TJEH 3H56A 1H9DA 3P40A 3FUJA 5DQJB 4K94L 2OL3B 4PV1C 3RTQC 5ERWB 4TULH 1SJMA 1ETJA 4HKJB 1A6AA 3ZY7A 3KNBA 1ZT1A 4F33A 5DVOA 4JDZB 25C8H 3L9RB 2HTKC 5KVFE 3TBBA 3B2VH 2ZOKB 4XE0A 3RGBA 3ZDXF 4W4OA 1BOGA 1JZJA 1Y07A 3KLKA 3HPLB 2W92A 4HC1L 3ESPA 3P3YA 1ZV2A 5T5FL 5T3ZL 2IV9A 1A7BA 3OKMB 2CG9X 4LIQL 4L0ZA 4CJ0A 1U93A 4NUMA 1DBBH 4NO0D 5IBUB 3VFUA 4MNQA 4PU2A 5DRNB 2QKIB 3AFLA 1AG6A 1IM3D 1Q38A 4HS6B 4K94H 3T77A 3S8FB 1HZKA 2DQEL 4KDTA 4O2EA 2NY4D 3D09A 4YZFF 3Q8AA 4BHUI 1ZXQA 3S5LB 2VOTA 3PJSB 4FZEH 1ID5I 1DSFL 3U6RA 5CU5A 3UJJL 2A9NL 2FJSA 2H5UA 2NDFA 5CCGE 4JRWA 4DQOL 1WLHA 4ZMXA 2VLRE 1BVNP 1CYGA 4ODTL 4JG9A 4L8CB 3BUBA 4KI5E 4I18B 4AV4A 1D5ZB 2VN5A 2YUWA 1CLZL 3N1GC 3EFFB 2WWOA 4GY4A 2K6ZA 1JHKH 3VD1A 3GT6A 4RWHA 1RCYA 5C0AD 3MSPA 2PTTA 4BBWA 2HLAA 4NQEA 3NCFB 3U0PB 4KXZI 2VL5A 1NGQL 2IOMA 2ZOUA 4ZFFA 5IP4A 3CVHA 1NAMH 2JKIS 4CN4A 1UXLA 4PJXB 1RJCA 4N9OB 4BSVA 4PVBA 3K72B 1PX3A 1BFOA 4XHJC 2R8SL 5MEQB 1F4YL 2UZYA 4ABUA 2X0VA 3A4DA 5F7EL 2NYYD 1YEFL 2O6FA 2V2XA 1PAMA 3PXJA 1WWCA 3ET9F 4HKZA 5D6DA 3OJDB 4FKHA 1IGJB 1A5FL 2WBKA 4EPSA 1Q72L 2WBJC 3D69B 4D3CL 3ILDA 2VZSA 3CSGA 1INQB 2HAZA 3SDCC 1CICC 3H54A 5IJKA 3WXWL 3O6MH 2DN7A 3IN0A 5D5MA 5F21B 1GSMA 1BVLA 3QCVH 5DD0H 5FGBC 4URKA 2Q2EB 4FNLL 4AIZB 5CBAA 1U8LB 2Y7OA 4YWGL 3IDXL 1N67A 2SEBB 5IQOA 2XWBB 3PJSA 2A4EA 2I60L 4N9GB 4DQAA 4PCKA 4PBDA 4ZOAA 3KYKH 1XF3A 3JTBA 1FIEA 4Y16C 3T0VA 2ZT9C 5KAQF 2Z92A 4DGVL 1DBAH 3UXFA 2PO6C 4O51A 5IUCA 2HCZX 1TCMA 4JO4L 4FULA 4FAAB 3BZ4A 1XZWA 5L6YL 1VFMA 1F4WL 4Z7UE 2KQNA 2NOYA 3EUDA 5HHOD 3B7SA 5CJBA 1C08B 2NY5L 3HZKA 3HS8A 5BOZG 3HAEA 4GBXA 3MBWB 3PDOA 1T20B 5F2FA 4P2RD 1TQBC 1ODUA 2AAVA 4ZDHB 1U4FA 2Z0UA 4KV5E 4XMXA 1H3UA 3GTTA 2UWEA 5AVYB 3RLSA 2E6PA 2F7OA 1JD9A 3SDAC 4BDVA 4E2OA 1SHXA 1H6FA 1VEOA 1NCDH 2WQSA 5AD0B 4WO4B 4YXKH 3WTWA 5KVDL 3TM6A 2J44A 1GC1H 2JXMB 1JI1A 1T6WA 1NEZA 4RA3A 4HHWA 5BW7C 1E6OL 2VR8A 4YXHL 1R5IA 1PMYA 4EE2A 3X3FL 4U7MA 1DJWA 4HJ1A 2PXYA 1LO4L 1U8MA 3LSOB 1G7JA 3N5AA 3HR6A 4ZPVB 1JPFA 2VR6A 3ILPA 2F5AL 5KAQG 5CJOL 1EEQA 5J8OA 1LXMA 3VUAA 2Z6FA 3FFCD 4CMMB 3I85A 4O51B 4GQ9L 1ZIAA 1SF5A 4ZMNA 2FSEA 5F9DC 4PJCB 1P69B 1A6TB 2P48B 1L0QA 3AADB 4GQ9H 3ETBF 4MMYA 5D1ZI 4PRPD 4LSRH 2NXZB 2NZIA 3VJ6A 5DTFB 4A7GF 2VIRB 4MZRA 4HK3J 4CA4A 2A77L 3M8OL 3L5XH 3VXTA 1KG0A 5I24A 1LO4H 3KLHD 5EUOB 5F7DA 4RLDA 4KPHH 4UYPA 3KGUA 2ILLA 3QS2A 1MHEB 2ZWSA 3K7UA 3GHBH 3VSQA 1V10A 4IGBB 3Q5TA 5SWZD 3US1A 5D7JB 1C8PA 5EN2B 1OGPA 3J7HA 4FL4C 2DAVA 4X4XB 3T3PB 3CFJA 1RK0A 3SBRA 4YGVB 2HRLA 5D2NB 4JFHE 4MMZB 4XNDA 5J3HC 4YDVA 4G8GB 3MAWA 1ZVHA 3FTSA 4LEOB 4JVWA 1WUZA 1PG7X 4EN3A 4PAZA 5C6TL 3H7BB 1UKQA 4HMCA 3OMZA 3GK8H 1O7DE 4P5KA 3FB8B 3SKOB 3CQFA 1KBBA 4O02A 4L4VA 3T77B 3LXUX 4G6JL 5E8OB 4PBXA 4JNXA 2R4SH 1KLGA 2K9UA 3MZGB 5FOBB 2NCEA 3VFUB 3DUUA 1QSEE 2VN7A 3OKOA 4W9CC 1BJ1J 1XXDC 5CINL 4FADA 1EAPB 1IQDB 4NKQB 4ANWA 1MFMA 4B9GA 1M7DA 1A47A 1TT6A 1WCBA 5E2VL 1UM4H 4WENB 4K3DH 4C4UA 3QIBD 3W2DL 1A4JA 2LV4A 3L3DA 1T7ZA 3KLLA 4MYPA 4W6WB 4TOYH 1RD6A 4PJEA 4Y2DA 4CVZB 1HKFA 2LFGA 4JS7A 5CO1A 1J1PH 1RLWA 4LCVA 5F71A 3MFFA 2BNRE 5JW4N 4RRPG 1I1CA 4YHYB 2ZXGA 2AFNA 2LE9A 5DU7A 1KJ3L 3HNVH 3SZ6A 1DQDH 4M9PA 3U0TA 1I3RB 4M1CD 4GP4B 1S5HB 2OMTB 3BWAA 4N0UB 1SN0A 5CIPH 4AMKH 1DVFD 3MA7B 4JKMA 5GSVA 2M8XA 4U4IA 2FNBA 4P5RA 5D71L 5H35A 1R17A 2FRGP 3VXQA 3H6JA 3TC9A 4B7IA 1RLBA 5DZ9A 2BS71 1PG7L 5C2BL 1I8KB 2A73A 2XN9A 4JRYD 4MNGE 5D71H 3TU6A 1L0YA 4FJYA 3LXAA 1S7VB 1UT9A 4QHNA 3L16A 4U1MA 1KXVC 3WKML 4JL2A 4NERA 4LQFH 3EDFA 1M1XB 1INDH 3BVNB 2E9BA 3SGJA 4DKFH 4J2QA 3FUIA 4Y16B 3RY5A 3FHQA 3DHJA 5GPRA 3S36H 1KT2A 4LRNH 4F37K 4HCRH 4N22A 4QYAA 5DC2A 1BG9A 4PCYA 3VXUA 5C0CA 2F7RA 3MJWA 4H88L 2I9TB 1C8QA 1DSFH 1CDYA 2DWEB 3L6FA 3GNML 4HV8A 4PB9L 3S35L 3TH3T 3V0HA 3VXOB 5F72S 2XV3A 4M56A 1AR1D 2ID5A 5DI8A 1XMEB 5FFOA 2CBPA 2C9AA 1NCUA 1ZHNB 3SJVE 4MX7B 2PXYD 3WHE1 4OM1L 1UM4L 4WFFE 2B1HH 5K39B 3PWLA 2QFRA 4AQOA 2G3NA 2NY5C 3PGCA 3QCTH 2EECA 3FZUC 1JHLH 2HTLC 3NAAL 3ZTEA 2FD6L 3MLWL 3ZHDA 5HVHB 3RZCA 5H8DA 3HW7A 4DK3A 4WU5A 3M6DA 3IPBA 1TVBB 4QOKB 5GS0D 4NZJA 4W6YB 3MJ8B 4DHLA 4PVLA 1ACCA 1KBKA 5HSFA 1V8HA 3NJIA 3QISA 2PPDA 1XB8A 4QXGH 5HGAB 1VERA 3K2UL 5MI0C 1MNNA 4P2RA 1K4CB 1QFHA 4N8CH 2QPUA 2E7LA 3SBQA 1YEGL 5ADPL 4HF5L 3LEVH 3E6FB 3DO4A 4GAAA 1IIKA 1BXXA 1HILB 5DJCA 4EDXB 4DKEH 2ZX6A 2BY2A 2JKNA 5EUOE 3A0OA 5AB0A 2PXYB 3FL7A 1N70A 1X9UA 2ZCHH 4AKQA 4HALA 1MJ7L 4LPTA 2F8VA 4PJGA 1YNKL 3IMSA 2BRQA 1ZT7A 5C0AB 2D7MA 3NJJA 1MG3C 4JQXA 5EORL 2MIZA 4C55A 2OXHA 5GJSH 4WF7A 3VI3A 1CT8B 2LAGB 2R7EA 4YK4B 1JGUL 2H1PL 1UB6B 1G4RA 2FAUA 4X5WB 2WZ5A 4YR6B 1T22B 1X4YA 1F1DA 2C1OB 5LNGA 4GUQA 2HFGL 3U7WH 1IJ9A 1F6LL 4X8JB 4Z7VF 3BLBA 4XNXH 3K71B 1E8WA 4B9YA 4IGBD 5SWZB 4FQHA 1KTLB 4LLVA 1IE5A 3ZUNC 3QORC 4WU5B 1KBWA 1MF2L 4M5ZL 3TFKC 3ARPA 3H9HB 3ZK0A 3J2PA 4JRYE 4JRXB 4BJLA 4PUBL 4XN7A 5AEAA 3UGXA 3MRIA 4PRIE 1JZFA 3RL1A 3EXLA 4M8UA 1MHPH 3GMNA 3NA9H 1RIHH 1D7BA 1PLCA 2F58L 4AKPA 1G43A 2YZ1A 2L0DA 3EYSH 4KXDA 3TN0A 1FLRL 3V6ZB 2IH8A 3EJYD 3WG7B 5I6MA 2EZ0D 3JUYA 1NLDL 3S96A 2WP3O 3GSXA 4I9WD 3ZKNC 4FQQA 4NZTL 5JPNB 3GMRA 4NENB 4NQED 2A1WL 2WSPA 4HG4K 3GBNH 5E8NB 3VDBA 2XY1A 1M9WA 4I0KA 2OL3H 3CVIL 5IW6A 4QRPE 1CXHA 4ENED 2FIRT 1CDGA 1K8DB 4M6OL 3DIDA 4CMMA 1G94A 3VE0A 4EZLA 1U2CA 4KI5C 5DRXB 3RDTA 3MOBL 4TUKH 3VVVA 5L8JB 2GSIB 2VLRD 5I71C 3WEXA 4JUSA 4IGBC 4TLSA 3V0DA 3B7RL 4NM4L 4UTBA 2E7LC 2GTQA 3AG3B 5D9SA 3WN6A 1RULH 1PSKL 4R96A 1KEGH 5JA9A 2VITA 5EIIB 4IHBA 2WAQA 5AKTA 4XBPB 2ICWJ 3D39E 3KW7A 3LKNA 5J6SA 4OV6F 4XPAH 4POYA 1VACB 5KSAD 4JGNA 2W9EH 2X09A 4NCC2 3KE0A 3BYYA 1H3WM 3CGTA 1E9OB 4TL5A 3GZPA 4DPBX 2H6OA 2OMZA 4GMTH 3TN0C 3HZKB 3RGVA 2AJZB 3B3IA 5D6CA 3GO1H 1XAKA 1KJVB 4HJIA 2HN7A 1MHPL 2ICWB 3VSVA 1FVEB 4DFIA 4XVJL 1DR9A 3HMWL 2YQ2A 1XGPB 2Z65C 3OPZL 2A2QT 5F7NC 3WY3A 1E4KC 4UQ3B 4WNSA 2VR4A 1S9XB 2YGPA 3VXRB 4NC1E 2J8OA 1XCTB 3V8OA 3NFNB 3RNKA 4TVPH 1BQHG 4XBEL 1M7IB 2YAEA 2IQ9H 1YYCA 4P2QB 4IKKA 2XPYA 3ARDD 3A4AA 2NUPB 3DJZA 4K3EL 4JKWA 5G4OA 2WZ6A 4AIZA 5CBAB 2F18A 2H0EA 4ANXA 4HPHA 4F9LC 5I1JH 1MLBA 1QR1A 3UIYA 2B59A 4M7ZB 2E3VA 3MPCA 3OKLB 4PTTA 5AKSA 5DEFB 5L4FA 1IJNA 1OB1B 4PUBH 1T6VN 1T4WA 4Y7MA 3NQIA 3QR0A 5CEYA 4M1DH 1UJ3A 3RWHA 4YQXH 4PJ8C 5D96C 4NRZB 5GGRA 5J3HD 1UD5A 4JG1L 2VUKA 2V6HA 1D5XB 3PPSA 2G2NA 3NIGE 4PRDA 4BH7B 3QORA 1MEXH 4GSQA 4GRMB 3RAJH 3MJ8A 2VMJA 4ELMA 2WV3A 2V2WB 3IXAB 4RFNC 3RNQB 1NMCB 2G5UA 4LSVL 3ROLB 4Y4HA 4I5BA 4P2OB 1Z9PA 2CGRH 4PRBA 1MCLA 2EDNA 1OP4A 2DQIL 2YRZA 1P7QA 2EC9T 5CGYC 3IU3B 5DT1H 3BW9A 2CIIA 4F15C 5DYOB 3G5XB 5C9JB 4YLBA 3MZTA 3IGUA 4NEHB 5JR1L 3RX7A 1WZLA 4XGZA 1JNLL 3MLZH 4F2ME 5IK3B 2WKOF 2QMKA 3MYJB 4LLWB 1ZXKA 1SMOA 2B3RA 5FKAA 2WKLA 1S9YB 2E7DA 2OKMA 2AEPL 3F6IA 5HGHA 2J5LC 2Q7NA 3LSOA 4JG0L 1YRKA 4XNUL 5J6GB 3ZKMD 4ZAKB 4NQCB 1NCGA 3DRTB 3SDXB 3IDMB 3NK4A 2MPVA 3E8VA 4PLOB 3PLYA 4MJIB 1HZHH 2TAAA 1G7HA 4ZD3L 1LP9E 2YOCA 4PB9H 1ACYL 4NRYA 1QTSA 5LLIC 3R4DA 3KYNA 4QRAA 3S3BB 1UJ3B 1L7TL 1DQTA 1M6OB 3V0JA 4GRWE 2YS4A 3P0VL 3PWJB 1FUNA 3VXMA 2VZ3A 5F0MB 4J8QA 3EH2A 2NDGA 3KLHC 2NTFA 2BIOA 5CCKH 3QI9B 4X6CB 3QIBC 4AUYA 1JYXA 2IVFC 3MRNA 3VX0A 3SODB 3QZWG 1C5DB 3TBTB 4F1SA 4I48A 3LX9A 4EXPX 1IGMH 4KK5C 5EC1A 1DVXA 1NCJA 1XF1A 2Z8WC 4KKQA 1JZ8A 1LWRA 1RVFL 2ATKB 2X4PA 3V7AG 2OMYB 1EEZB 3GUTA 3K3QA 4TVPD 3DX0A 4UT7H 1IIIA 4OGQC 5IVXA 4I0PC 5L9DL 4PJHB 3QULB 4LPXA 1U8CA 5DUML 5DZLA 1QX1A 1MIMH 1RXLA 5DZPA 2ZUXA 5D7LD 3CXDL 4LLQB 1A7OH 4POUB 2ZKYA 2MNWA 5EOQL 3P30L 3C5JA 4XNMA 2I07B 1JXGA 3OL2A 1FZOA 4Z7QF 2WB1A 3FT3A 4QHLA 5TGBB 1U8LA 2ZOTA 4XZUB 4ODXA 3TCXA 3ZR6A 3DKHA 3L3GA 3R06B 1GGUA 4OF0A 5EO9A 1AD9B 4IS6A 5EZOL 5EU6B 1TJHL 4XP1L 4YS4A 1XF2B 1TJGL 1URIA 3QIBB 1CLOL 4MKMA 4WK2B 3MLRL 2BVPB 3CC1A 2J71A 4L0PB 3KYNB 1HQ4A 1UZ6E 2CHXA 3QDGE 2PNDA 5T5FA 3KMDA 1QTPA 2ZUQC 4AZ8B 2BPBA 5F9AC 3QO0B 3FRUA 4NPYB 1MFCH 3ARWA 3LNHA 4XVSL 5C0CB 4P2QE 1DDHA 2JK5B 4LSUH 4JE0A 2I9TA 1NANH 3MUGA 1AI1L 2X1OA 3GMQA 2X4NA 4TSCL 4YFDB 4PJGF 2Q8BL 1OE3A 4FQHB 5C08E 1NFAA 3RWGA 1JV2B 3GLZA 5BOPA 4XXCC 1DFBH 3ZDYE 3FU7B 3P9MA 2PR4L 5E2TH 1OAXL 1OP5K 2WLLB 1JFHA 1I3UA 2OLDA 1IBDA 1HL5A 4JG0H 4EDWH 4KI5D 4TSBH 4XP6H 1N5AA 5LBVA 5HHME 1WIPA 3OD3A 5EIIG 3HIZA 4U6YA 4QHUA 2CLRA 3DXAA 3GF8A 2Y4SA 5GS0L 3CDFA 4QCIA 1WA1X 1BLIA 2EH7L 4AITA 5DHVH 1PYWA 4GINA 4FQQB 4RMVA 2CDEA 3K1KC 5FW7A 4M62L 5I19L 1HC1A 5B3NA 4EDXA 1NEUA 4KTEL 4X7CC 5IM7A 1ZWIA 4WFGD 3NFNA 4AG4L 1NFDE 4GLRI 3KAAA 3SEPA 5I0WA 1CGSL 5GGSB 2B39A 1XCXA 1BFVL 5EO1B 1IUZA 2DTML 4LHUB 4FXKB 2B59B 4P2AA 3TYGL 4Z76B 4B3VA 4YZWA 1E9PB 2ZG3A 3QPXH 4PJGB 3T8MA 2CO3A 4ELMF 5CZKA 1XEDA 4IRZA 2B4CC 2QL1A 1B90A 3UG4A 3LOWA 2WQRA 4BK4A 2NX5D 5ENWA 2BIMA 2VGLM 3TX4A 1URLA 1WYJA 4KPHL 5KYUB 4WI0A 2BVUA 5AW1B 2J12B 3FSOA 5ANHA 2CJTA 3GYRA 4MD0A 5M7QA 4E5XA 5BZXA 3NCYS 4Y5YA 3SQRA 3OGOE 4HHAB 1WK0A 3LQAL 3BP5B 1F18A 3QDAA 4FMKA 1ULVA 3BVXA 3L3OC 4XB8A 3SGDI 5DF0A 2VUYA 4R7NA 1XGQA 3S2CA 4AW4A 2H7WA 3S3SA 5BZWB 1SY6A 1HXMA 1NGZB 1T0NA 2GB2A 4IKLA 2FX9L 5B3SB 1AKJB 5CU9A 3CQQA 4WHCA 4NN7C 1MY7A 4EO5A 3SDAD 4B9FA 5AVVB 1QI4A 2IQAA 2QSCH 2AXFA 2AV7B 2BIIA 3UGUA 1ZWIB 1F6AB 3QIWA 4FX5A 4LCWE 4ZAKC 1KELL 2XIDA 4M62H 4QHMA 1HI6A 2IPUG 4APQB 5I19H 2PABA 1FH5L 4BCYA 4PWHA 1R3LB 4OJCA 3TNMB 4CSTA 2CLZB 1ID2A 3GBMH 5GGUB 3S37X 2EH7H 4UILL 5K9QG 1U8HA 5EEWA 2ROYA 2FEDD 2OMUB 4UDUA 4DO4A 3FOLA 4ALAL 4XVSH 3IKKA 5IOPA 1EFXA 2AV1A 2DLFH 1T80A 5E23A 4IDJL 5J1AA 3RDTB 2CLVA 2DYPB 3ES6B 4Z7QE 1AGFB 1PJ9A 3PXLA 4WI3A 2ZF9A 3F04A 3GS7A 3RTQD 4AYDC 4KMTH 1DVZA 5F7YC 2KLRA 3FO0H 3QCVL 5C0BB 3UAEA 4P9HC 1NDMB 2R0LL 3VI4A 4LNVA 4JO4H 1ZK9A 4P06A 1JK9B 3FU5A 4XMVA 2OMWB 3B34A 5AVXB 4LSSH 1ZLUK 4Y19A 4XXCA 1QNZH 4S1QL 4ZT1A 4UINH 5HHNB 2P5EA 5KSAB 2Q9OA 1T1ZB 1B0GA 4A7TA 1D7DA 1DQML 3MGTA 4AT6B 1P5VB 1BPVA 2GJ6D 1U8JA 4RFEA 3TV8A 3V6ZA 2H41A 2KHAA 3AXIA 1OV8A 1IGFL 5IF0B 5C9KA 4CC1A 1A2YB 1QLFB 2R0KL 2X40A 3VQ2C 4FFVC 5C09D 4F2EA 1XGYH 2ZUQB 1DUZA 1EBAA 3MKGA 4NKDB 4ZFZB 1NIEA 1J12A 2PPEA 3HEIB 1QYGL 4YHLL 3SY0B 1MI5B 3CFNA 4LGSB 4YBLB 3QUXB 4WUUB 4UZSA 2NY6C 2Y7QB 2YPLA 1F4YH 3AVEA 3GBDA 3KS0H 5D1XE 5IVOA 4NQCE 2X89A 5JHDE 4NHUB 3ETSA 5I1AB 3D25A 1MHCA 3BZFA 1NAML 1XXFC 3F6JA 4X98A 3F2LA 1OXYA 5I9QB 1A9EA 4ABVA 3EGDB 4N87A 4PR5A 5H2BB 5DGRA 3CFUA 3T3MF 2WCPA 4EQ2A 4XNXL 2G0KA 5IB3B 2VN6A 1WTLA 1ZKAA 3FFCB 1SUJA 4I1PA 3QJFA 3LPPA 1GAFL 5HHNA 1LTXA 4CMHB 3KLAB 3EOBB 2APFA 1OLZA 4E41D 5H4ZA 3K6SB 2Z3FA 3WENA 1HH6B 3ARFA 4A2FA 5HGBB 1DP0A 4ODTH 1EJ6A 1N5AB 4NBZB 1ZLDA 4GRMA 1N8ZB 4IOIA 4MMZA 4RRPM 3WJLA 1U92B 2NYYC 4H8PA 1AC0A 2GUYA 3NPSC 4P4RB 1QPKA 4WJ5B 1BZOA 2AJ3A 4Q97A 1KN2H 3F84A 2IFFL 3OJDA 2Q6WA 4QOKD 2OSLB 4UM8B 4CUCA 3PP3K 1HEZA 2NSXA 2WCGA 1U91A 1E4XI 1AO7D 4M5YH 4ODVL 5CILL 4G6AD 4N2IA 4GAGH 4NM8H 5IQ9A 3FQUA 4M4PA 2FLBT 4G8IA 3PXHA 3E9TA 4JFEA 2HH0L 4TULL 2X1XR 5CLXA 1CTNA 3MYJA 4LLWA 3SPJA 2HWZL 5I5IA 5F9JA 1MKFA 3HN8A 1OWWA 1EZVY 1J9QA 2J20A 2G9KA 3HAEH 4J12A 3O2DH 4CC4A 3C60C 1DUYB 2CIKA 4KO5A 3PRZA 3O6KH 2BC4B 1NPJA 4L3EA 4C4BA 4ZW5A 3KLQA 4Z3IA 1MN4A 4YAQA 4Z3TA 2X6BA 1OD9A 1BZDA 1RUKL 1LL1A 2O5YL 5D1QD 4YX2H 4QO1A 3QE5A 1E4JA 4U0RC 2ORBH 3K2KA 4X6DF 2AC0A 4Z9KB 3BZ4B 1PLGL 4WEBL 5DYFA 3T0EA 2OZ4A 1AZUA 1G6VK 1EUUA 3THMH 2EDMA 3VRIA 1H0DA 1PEZA 3K5RA 1DQJB 1YPZB 5FO7A 1QWUA 2VITB 4AJVA 3FO1A 2YN5A 1CE1L 1NQBA 3MV8A 3KPOB 5KYWB 1VZGA 5D1QE 1WO2A 4NQDD 5HJBA 4R2GD 3AXLB 2VDOL 4PJ9A 2EO9A 4WO4A 3L7FA 4Y4KB 4RZCB 2DL2A 5TK2A 4FQXB 2XG4A 2VRKA 5JHLL 4IIQC 2N7BA 1CPUA 4Z7VE 1HFUA 4PLJC 3EYUL 5E8OA 4H4NA 5ISZA 4U6HA 4AMKL 1FJ1A 1X5LA 4OGAD 4XX1G 4LEXH 1EFXB 2R69A 3PIQA 5E7FA 3D7PA 3P3UA 2L7JA 4OFVA 4KK8C 5GZNA 1OK8A 1QUPA 2CGZA 3KXFA 1DFXA 1HN1A 1HHJA 2XQYK 1PGRB 2MTAA 3EJZC 3HC0A 3T1FA 4NUPA 2CUHA 2GKIA 1UYWH 2YC1B 2WWMD 3LN9A 1R3IL 3W2DH 4K07A 3X2QB 2ITDA 5AKRA 1IBYA 4YXLL 4NZRL 5BQ7B 3RIAF 2E9GA 3D08A 4NC2B 1AGEA 3GSOB 3QJQB 3O0RH 4HUWA 4L3CA 4G8GA 1FQ9C 5E51A 4WRLA 2WNKA 4Q58C 4CVXB 1XTMA 4ZBJA 3NFPB 1P4LB 5C0ND 4RFOH 5D7LE 5JLZB 1AHKA 4FQJL 5JMOC 2IPTL 2MKLC 1UWEL 1LO5A 1UG9A 4HT1H 4NIYE 2ETWA 3LEYL 1ORQA 4BZ2L 1RK1B 3UBXI 2D9CA 3O8XD 4OFIA 2F8XC 2Q3ZA 1DEEA 4F7MB 1ECZA 3HFMH 1QOKA 4LNRB 4UQIM 4RRPA 1GW6A 4BINA 5H2BA 1WD8A 3O11A 3I9AA 2ZNXA 3MCG1 4X7EC 3S48A 4LLMB 5C0DB 1X7TA 3Q05A 4JRFA 5GZNC 5JOPD 4X6BA 4GIPD 2ADFH 3VFVA 4OB5H 5FX3A 4KX9A 3P73A 3BP7A 4C47A 1FVCA 4JRLA 2OL3A 4JRXA 4K9EC 4AH2B 2VDMH 4HH9B 4F2MB 1YNKH 4ZX4A 4G70B 4LMQI 1CD1A 1YLBB 2R1XB 1MDTA 4ZI8A 2GITB 3HMXH 1NLBL 2Y2YA 2VNCA 4N68A 2RQ8A 4RIRB 4MAUL 3ESVF 4YSTA 1GOFA 1SEBA 2GJZB 4MQSB 1ZLSH 3RJDA 3OZKA 3HC4L 2B77A 2XETA 4TNFA 4V2BA 5JYMA 4APQD 4MCZB 4GFXA 4OFPA 3GSNA 1QASA 4Z6AT 4N5EC 2FECL 4NP4H 1GIGL 4F2FA 1O6VA 3WEMA 3IWVA 4PP2A 1ZGLP 3TEUA 1F1GA 4IQHA 4PGCB 2JJVA 4XCYA 2A0LD 1HE7A 1WHPA 3QQ9C 4FXTA 2J8UF 4UU9A 5B8CC 5DK2A 5JW3H 2LLLA 4MBOA 4ZXBA 5J6GA 2FIKA 4OH2A 4UYQA 1WSST 5LN4A 3MOAL 4YUEH 2X6VA 5FKPA 2JI1A 3QZNA 4F7KA 2ZOKA 5I74C 4HJJH 4C83B 1QSEB 2DM7A 5CS7A 2CIKB 1EAJA 2UWEF 4M43L 3W0WB 3WNLA 1LNUA 2N3JA 2FL5B 1AZRA 1KOAA 1JGEB 4KK6C 1KFGA 1WFIA 4L8SA 4KC3B 5JUEL 3ZGHA 3ZYZA 1UVQA 3SPVB 1OAXH 4PLJD 5EU7C 4ESKA 4OZFB 3MNVA 4QHPA 4YHPA 3IFLL 1D5MB 3BDYL 1D5ZA 2VSCA 4DZBB 1JVLA 5J1AB 2DYPD 3GRWL 2Y06H 3MN8A 3NFSL 3G6JF 3Q5YA 1I9RL 3PV6B 1S7XB 1HHHA 2H2SC 4YE0A 4MS8C 5I76A 2XT1B 1JWUB 1BBJB 4Z77A 2WBJA 5LGHH 2UX7A 1E2WA 3D0VA 4M9OA 3MNDA 4I87A 1K3IA 5JHAA 2OTWB 1UA7A 1INDL 1Q1PA 2I60H 1MRFL 1B4JL 2EUZA 5TQ0L 5C0EB 3V0IA 4QY8A 3QUZD 3RL1B 4DJMA 3TWCH 2V2XB 4IRSA 2CNZA 2Y1AA 4QKXB 3CLWA 1XGTA 4MA7L 3AXLA 3N41B 4XRCB 1VEMA 4LCCC 3ARDC 5KYYB 2OYKA 2DEXX 2WB7A 1AFVH 1HXMB 1T0NB 3K4AA 5FS5A 3V4VH 2IADA 3SHSA 4UU9B 2JH2A 3VFSA 3WJJA 3ELQA 2OMXB 1PEWA 1FJ1B 2D73A 4X9IA 5BUPA 3VX1A 1W0WB 1BJ8A 3V6OE 3HAEG 4AE1A 5IG7A 1M1SA 3SBWA 3FO9B 1T4KA 5DJXB 5F89A 3JWOL 4FNTA 3D4GA 2WN3A 2NLJA 1UFUA 2MJWA 1CG9A 1I4FB 4MJIA 4PJHF 2XACC 1SRDA 2Z7WA 5TQ0H 1GKEA 1T1XA 4XPGL 3ZE1B 32C2A 4OAWA 4YSOA 1JHKL 1GZQA 4J1UB 5EBMB 4EAEA 1FNEA 3TVMA 4R0LB 4IDJH 1EVUA 1DQKA 3NTCH 1QFWL 2W95A 3OPUA 1EXGA 5CWSA 5I6NA 5J9PB 4HPOL 4MSWB 4NUJB 1FA4A 3QDJB 3U25A 3WYRA 5GQBA 1EANA 1IEBA 1NMCC 3NFSH 2P49B 2PO6D 1PG7W 4N1EA 4I48B 1I8MB 3IJEB 1M7UA 1BZ9A 4LSPL 1DL7H 5EU3B 5C3LD 3B2UC 4GRWB 1ED3A 3DIVA 5B7MA 1XIWD 3HPLA 4XHQA 3HJ0A 3HB3B 4PG9B 3WY2A 1B88A 4NWTH 3NSYA 2V7HB 2YD5A 1NC4D 1CFVH 1YECH 1Z9SA 3J27A 1WV7T 3WY4A 4JPVH 2XZZA 5HYSB 2NXZD 2EDLA 4DGIH 3O6FA 3A23A 1AO7B 3GI8H 1A1OB 4HP5A 3P4NB 3CN1A 1CICD 2YGOA 1UQSB 5AYUH 4ORGB 2OFQA 4XOEA 4WFGE 4RGNB 5DVLA 4BGLA 2G2PA 1ZJAA 1D6EA 2P4AB 1JPST 3CN3A 3ZT5A 2BWQA 2A38A 1JVOA 5IQ9B 4I13B 5SX4I 1DVUA 1T6BX 2XNAA 4KK9C 3L3KA 3ZDZB 4YOKA 4U7SA 1A22B 3LZFH 5E6IA 4UQBA 2VW4A 2BCKB 3LZOA 1WZ1L 3A6OA 2W81C 3VWKA 3WFEH 4YSSA 4HLZH 5HVWA 1AHWB 1XH2A 4WI5A 4X7FC 3UO1L 2Q76A 2BXZA 1OSZA 1JOIA 5E5RB 3ZE0E 2CZNA 4HGMA 5E9NA 4GO9A 4JG1H 1FZMA 2CDFA 2EKSB 3TBVA 3EFFA 1MWAL 1XD1A 2WJ5A 1TZHA 1P1ZA 2DQHL 1P5UA 3CFBB 4UTAL 2I9LA 4XC3L 2XIIA 4ALAC 4ELKB 3K2MC 5C0IA 4L8CA 2VDOB 1SYVB 2PR9A 2J88L 1JBJA 4E41E 1MHHA 3KPNB 3UTSE 1SXBA 2HFFA 4YC2C 1NFDF 1GJIA 3M46A 3LIUA 2Y7LA 3QNYB 3QUYB 4KRMB 3M86A 4GG8B 1BZ9B 1ORSB 2BSCA 4TVUA 2IANE 4FA6A 3BH9B 5DQDL 2FWOB 1H5BB 4KROB 4YHOH 1RJLB 3ZOAA 4I3SL 4R7XA 4ZO7A 3BXNB 5BMFH 2NNRA 3ULUL 2AZAA 1IC5L 4GXUN 4QHKJ 3ZZLA 1CL7I 1YEDB 1OGSA 2YAFA 2CJSA 2QQLL 4JRXD 4TSBL 1UWEH 1F97A 3X3FH 2FLRT 2PR4H 4TXVB 4V1DD 4LSDA 2P24A 4RFOL 3ZYOA 4XOBA 5I17B 3FOMB 3T3PF 3VH8G 5CR8A 3UDWC 1X7SA 5D7SL 1PX4A 2JV6A 3BUQA 5D5MB 3P11L 3B3BA 1K8IB 4LEBA 3ARBD 5TE4L 4ETQB 2DW5A 3DECA 1SZNA 4S1DC 1ANUA 5EUKA 4AQ1B 3VFTA 4MJ5B 4JFFA 3L4VA 4QLRA 3FQRA 4LO9A 5AW8B 5B1JC 3FBQA 4PSRA 1EZVX 3EFDH 1N64L 3G5ZB 4KBPA 3US0A 4FFWC 5E6SB 1HYSC 2OJ1A 3RWGB 2DQJH 2UXVA 4JFFD 1F4HA 3MODL 3V0AC 1BZ7A 1KFAH 1X4ZA 3F00A 2JKJA 3WJMA 3MLRH 2JNZA 3BISA 4J3TA 4NIKB 1UCTA 1PFOA 3O6ML 3LDBC 2PYEE 3IRCA 3P0YH 5CSZB 5SWSE 3WLWD 4EQ3A 4O5LL 2RFXA 4NNXA 4LDEB 3WV0A 4HJ0D 4NQDB 1CMOA 3CJJA 5L0QC 2UZXA 1KDIA 3P2TA 2VW7A 5CEZH 1KPVA 5BV7B 1P7QB 3BGAA 3BCDA 2CIIB 3CVIH 1PKQA 4R5XA 2J4WL 3HBZA 5JO5B 1BSIA 2CK0H 1I8IA 3DSFH 3HE6D 3D0AA 3RI5F 2C3VA 4HS3B 4KKAD 2FNWA 2A1WH 4RX4A 3DK0A 4U2ZA 5D7HA 1KT2B 3IBOA 5JHMA 4U1KB 5JLZA 5GS1C 4IJ3B 2EXYC 3HS0C 2VTFA 1CLVA 3H4HA 3V4UL 3VFOB 1WT5A 2QVIA 1YUHB 3F64A 4HDIA 1BVZA 1L5GB 5BQDA 2Y23A 1CDIA 3CPUA 3JWNG 4FG0A 1T0MA 2LT9A 1UCBH 5CXPA 1IBHA 3T2QA 3V79C 2OBGA 4LLAA 4HJTA 3UMNA 1E3FA 3HCVA 4PJAE 3TT3H 3GMMA 2DWSA 4UUJA 1E5YA 1YEIH 5IEKB 4E9VA 4ERSH 3MV9A 1ZLVK 1U8PB 2WLKA 3QZBA 1RZ7L 3RIKA 4NWUH 4ODSH 4OI8A 1IFHH 3MRFB 3HZVA 3MLVL 3WO4B 2O6PA 5DD5L 4OD3H 4NQDA 4PJ7B 2XTJC 5TDOA 3FPXA 3G08B 4FDWA 5E94B 2AK1H 3BT2L 3CXHJ 3OXRA 5IFAL 2QKSA 4P5MB 3Q6GH 1AD0A 1DVFC 4CC4C 3RFZA 3APFA 2YLKA 5IHBA 3KPLA 3ZMRA 4G9FE 4EVNB 2C4FT 3TBCA 5BRZA 2JKWA 1YCSA 3G6JA 5KW9L 1FO0A 1P2CA 2FB4L 5FYKL 1E4WH 1CD0A 1EEZA 3GUTB 3NIDF 1RL1A 5KN5B 2V5TA 2OXHB 4XODA 4JFFE 3FSWA 3LHPL 2P8PB 2R69L 3KCWA 3GMMB 5E6IB 3KBPA 2WXOA 5EEXA 2AQ3A 2XFXB 1JHLL 5I75C 1K3ZA 3PPEA 4Z76A 4BUGA 4N85A 1JZ4A 3GJEB 5LG1A 4EZJA 3NIFB 4CC0A 1BD2A 1Y6MR 2ZG1A 5BV7C 4DOHB 1GPOH 2ZWLT 1AS7A 4L0YA 3CDZB 4C57C 2RHEA 4Q2ZA 1EV2E 1XWVA 2WP3T 4AZ8A 4DZ8B 2ZOWA 5HPOA 3VMPA 2WYZA 1GZHA 1J5OL 1J5CA 3U4EB 2CCWA 4ZX6A 4PCTA 4S11A 5D1XD 5IMKB 5AAWA 4EKXA 2FWOA 2H9GB 3DBXA 3ZN6A 3U9WA 4N2CA 1KZQA 4S1SL 3AY4A 5FYJD 3UZEC 5GRVK 1R3HA 2H4EA 5HDQH 1ETB1 2F8IA 3P02A 2YZ8A 3ULUE 3QEUB 4DSYA 2VL5B 3BWAB 4G3YH 2DICA 4KDVA 3AABA 1S5IL 5KVEE 2A83A 3RHWK 4KZCA 5KS9A 4E41A 1ZVYA 3DIFB 4TKWA 1YNTB 2FX7L 4AVKA 5TFSH 1Z9MA 2Y25A 3PQYA 1XGYL 3KBHE 4IRSD 3SO3B 3MXVL 3V9FA 1NCWL 3GMLA 4K3HA 4W9GC 5AUMB 4FRWA 4Q9RH 2F54A 3QUXA 5E70A 5FEBA 3RWIA 3MRHB 4PRHA 4MB3A 1FZOB 3WL9B 4NUGL 4AVJA 3NN8B 1QLEH 2HX8A 3O41A 4P5TA 1O9WA 3O6LL 3FQWA 3EOAA 4Z7AA 4IBLT 2NLJB 5DLML 1TXKA 4JHZA 2IBZX 1WIUA 1KN4L 2AITA 3HNVL 3FO9A 5D2LA 5T3XD 3LV3B 4K71B 3HRZB 4W9JC 5B38B 1CLCA 1V55B 3MACL 1QFWM 2J25A 4R84A 5C09A 1SMAA 2GSGB 3PNWB 4NGHL 2BIPA 2Y5QA 2Z91B 4OCYH 3SKMB 2VAJA 3FB6A 2APTA 1KXTA 4ZSOA 2DMBA 3AM8A 3PJLA 5TDPB 1RIVH 3O4OC 3ZR5A 2V3EA 3RRQA 5F6HI 3SCMB 4APXA 1KSRA 4J3OD 4Y16D 4HJJL 2V0AA 3U9UA 1UENA 3D2TA 2X38A 4XMKL 3REVA 2ALAA 5FAAA 3BIAX 1NFKA 4X4XA 2YXWA 1M71A 3H53A 2AJYL 3GPSA 4AYEC 1NC4B 4D7BA 4ZUWA 3VNZA 2V9TA 2WAHA 1MW3A 5I1KL 2K6WA 3ULAB 1J0KA 4MXVF 3CFCH 4GXUM 4HAGA 1NFIB 2CRIA 4HIPA 3N50A 3NYKA 4GW1A 3APCA 5JQHC 5F9WC 1MW1A 2UUDH 3WE6A 5E24E 2W9DH 4HU2A 4QHMB 1LD9A 1EWHA 1NUGA 1L9MA 3BDBA 1SVBA 1QEWB 2HG5B 4JPKH 1U30A 3QAZC 3WIAA 1GTNA 4L4VB 4ZYKA 2J6EA 1TQWA 5DRZB 5FFGA 2D8KA 1MJJA 3LNEA 5C7ZA 4L1TA 3L3KB 2DWEA 3L6FB 4JO1H 1OO2A 1FHNA 3GJFB 4K2UH 5DJYA 3QO1A 4OF6A 3R8BB 2IF7A 4IRJC 1K6QL 3JTSA 5EO0A 3ECWA 3K71A 4I77L 1TTBA 3VXPB 1PZUB 2ZWNA 2C7UB 1SJEA 1PTZA 2VLMD 4ZUTA 2NXYC 1YVLA 1J0JA 4FQCL 3O8XA 4E5XB 2AJXH 2JELL 4UIKH 4UQ9A 3LH9A 4R7LA 5E5MB 4J5VA 2WKOA 1XF5A 3PE9A 5HYEA 2J5WA 1OAQH 2HJKB 4UNTA 3EKCA 4RGMB 1NFIA 4X99B 5ETUA 3TT1H 3BGMB 3IAPA 4EI6B 3IF1B 2LU3A 2RCSL 1B0IA 1U2HA 2M26A 3WUWG 4LHUG 4F9PC 2EDXA 2OMTA 3AB0C 4G8GD 2BERA 5T3XE 4GNKB 8FABA 3HHMA 1KB9J 1RUPL 1JGEA 2D7QA 1FI8C 2IQAB 3LRKA 4XAKE 5AW3B 3UP1A 5B3JE 1ZTXH 1XMWA 4TUOB 4HQQL 3UZQB 1NKGA 2HFEB 3I3EA 4HFWB 4LAQL 2Q3XA 4G1EB 4BXVA 3U7YH 2BHZA 1SOSA 1OPOA 1FFNB 1K72A 4GRWH 4U1JB 4Y4KD 4TQEH 3OKMA 4FOMA 4TNVK 5E9DE 2F1BA 3FOMA 2E47A 2WQWA 4Y9CA 2JF1A 3MRJA 2D0FA 4IMLB 3MTXA 4OR1A 2GSIA 3VMNA 2I69A 5GZOA 1GGBL 3WHXB 5CZXD 4JFFB 1D5BA 4PJBB 1YY9D 3ZW3A 1WS8A 4G59C 4HFUL 3QUMB 1KPRB 3F7KA 4P2YA 5BCAA 3F7QA 5D7IB 5DMKB 4OZGE 2J6EH 1SEBB 2GJZA 2YSTA 2IMNA 1BZEA 3U4BH 4DESA 1G1CA 3GLEA 1JE6A 3IS0X 3WNKA 1SYSB 1IO4C 4J4PC 5KTEH 2HKFH 1JF6A 3T0DA 4QTIL 1XF4A 2D31A 3MJ9L 5HHPA 1G9MC 1CLOH 3BN9C 1KPUB 3NCJL 4M02A 4GS7C 3K81A 3DX6B 2X87A 4MHHG 3ZVVA 3B9VA 4JRXE 4AJWA 2VC2B 3FONB 3TIDA 2GI7A 3ULSB 3V5KA 3BVUA 3QPQD 4OTXH 1RUQL 1KJ2L 3K5SA 1RU9L 5EOQH 2IJ0C 4C56E 5E95B 3MRRB 5F7EH 1BQUA 5D1ZD 3MRCA 1JUFB 4UT7L 1CUOA 1YC8A 4LVOC 4BV1A 1NSNH 4PGEA 4B5EA 4P9HL 1U8KA 3S5LA 1R3LA 4M29A 4QYOA 1OAZH 4ZX3A 2NY1C 4KZDL 1S7WB 1TQCB 2VLRB 1HSBB 4U1GC 1JN6A 1OSPL 5HGDA 1ZTXE 4EN2A 1IARB 4GMSH 3HE7B 4BFEA 2OJEB 4NUJA 4RQQA 4LGRB 1A6UH 3GZOA 4WWKA 5GGTA 3SB3A 3N55A 1WEJL 1FG9C 4MA8L 2EDOA 5F0LB 1OB1A 3VI3B 5D7LA 3VFWA 4FZ8L 1RK7A 1KV3A 4K55A 4X9GA 3W11D 4DQOH 4QMEA 1C1EH 1R5VB 1ZLUH 5L2KB 2E86A 3SKJL 3U6XA 3P69A 1MFNA 1KTLA 2PPFA 4OFYD 2XWTA 1NINA 4LQ1A 1BWWA 1PCSA 2ITDB 4G82A 3B56A 4UQEA 4KY1H 1AQ8A 4M1GH 4LOEA 5KVEL 3EGXA 3D12B 1AO7A 4LBEA 4IHOA 1S7RA 1KY7A 4LKXA 3RVWD 4DW2L 1VGEL 4D0BA 1H9VA 2NTSP 2Z7UA 4PJIA 3BO8B 3Q2NA 1TMQA 5KSAC 1AVAA 4MAYD 1ZE3C 4LF3A 5D6CB 5KVMC 1JYWA 1HX0A 4K3JL 4AGQA 3DOIA 2WTOA 4QNPE 3DVFA 5T3ZH 3W39B 3JVGC 1MVUB 4IRZL 3OKKA 3NEOA 5DJCB 3K6OA 1AGDB 5K59E 2A9BA 3I9GL 4L4JA 3UGEA 5D4QA 3HI5L 3KCPA 3KYMA 5F70A 3FQ4A 4MRBA 4J3UA 5GJTH 3P77A 3BAYA 3GM8A 5BV7H 4AV5A 5ISZE 4H5SB 4AYGA 4LSRL 4YSEA 3O11B 1XO8A 4Z7VA 2NQCA 4FQ1H 5HTSA 2WBJB 2RJMA 2YEZA 1ONQA 3SD2A 3VWJC 4N8VA 1OY3B 5ITBL 1IKNC 2XRAL 3ARVA 3FCSA 2WWKO 2YPLD 2Z91A 1R5VA 2GCYA 1GC1C 2TRHA 1Q9LA 1FAIH 1OZTG 3EO0A 3ZKSD 5EF3A 1QBLH 3RZWA 4DP0X 5E5MA 3LD8C 1FBIL 3B1UA 3IVKB 4ZQKA 1HNGA 5EPMA 6TAAA 1WVZA 4JO3H 4YHKL 2FUQA 4G6ML 3SE9L 1KDJA 4GW5A 5BZDB 1DO5A 4CVXA 1BIIA 1X5KA 2Q8AL 3NFPA 1N8ZA 2WGXA 2E9WA 3I6SA 3OG4B 1CZ8L 1OCCB 3ARFB 4D7PA 4OJEH 2ZJSL 3LKPB 2UY6B 3K72A 4BE6A 4NI6A 1T5WB 3QP3A 1AGEB 3GSOA 3KD4A 1BA9A 1HKLH 2EDDA 2DBLL 5F6IB 5I1CH 3BH8A 3V7MA 4XPBL 1N0XH 4R3SA 3TNMA 1NKOA 3Q48A 2R2CA 1KGCE 1PKQB 4PJ7F 5CUSH 1Y18B 1IAOB 5EHFA 1LYQA 5JQ6H 3HMXA 5E1AA 5FA3A 3UX9B 3EJRA 4G80A 2N0KA 2VR7A 3VXRA 3MU3A 2E27L 2PCXA 1WA0X 3AQYA 3WUWB 3ZE0B 3WN5B 4G1MB 4DF9A 3FUHA 2MCPH 2G3XA 2Y9RT 1TJIL 5EFIB 3IDIB 4R0LA 2VDQL 3F7RA 2WXHA 1M3IA 1AZBA 4QUOA 1QKZL 3LEXA 3PIQB 4LLDA 4X6FA 2OXGA 3M17B 1KB5B 3NJXA 3MODH 4JFEE 3EBHA 4FXKC 3CCHB 5IMOB 1CFQA 4KKBD 5JPNC 5LGJA 4TPRL 1N5YH 5FYLE 1AKPA 3A21A 1RH8A 3RWJA 3ARED 1NDGA 1AXTL 3DGCR 3QXDB 5E8DL 4M3KB 4NM4H 1WFNA 4G6FD 3S34L 3MHZA 5JHBA 5EWIL 2FECI 4PRAA 1UB6A 3CUPA 4GI8A 3TFBA 3NJVA 3ATEA 1EEYB 3QUXD 5DHXB 1BREA 2NNAB 3DX2A 4LKCA 5I8KL 5AVRB 4GEJA 1DLFH 4E42A 1A5FH 4NO3B 3RWDB 2FEEI 4N26A 3S37H 3ZYJA 1RIUH 5CUSL 5GS0C 2VRQA 4FLHA 4WFED 3U2SB 2Y1VA 1J5HA 2DWYA 1NBZB 3ESUF 5FO7B 4L05A 1WEJH 1H3XA 1DVFB 3CD4A 1AG0A 5DMJB 4XP9L 1MZZA 4Y4FA 1IGJA 5BVJA 1J10A 4FFYL 4NAQA 3IETB 1WUNT 4M6AA 5A2LH 3QXAB 5T3ZE 3TNNB 2NY1B 2NR6C 4NQCA 5D1XA 4AUUA 4JM4H