1N12A

Crystal structure of the pape (n-terminal-deleted) pilus subunit bound to a peptide corresponding to the n-terminal extension of the papk pilus subunit (residues 1-11) from uropathogenic e. coli
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
138
structure length
138
Chain Sequence
VPACTVSNTTVDWQDVEIQTLSQNGNHEKEFTVNMRCPYNLGTMKVTITATNTYNNAILVQNTSNTSSDGLLVYLYNSNAGNIGTAITLGTPFTPGKITGNNADKTISLHAKLGYKGNMQNLIAGPFSATATLVASYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mature Fimbrial protein PapE
publication title Chaperone priming of pilus subunits facilitates a topological transition that drives fiber formation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 22
structure length 138
sequence length 138
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1n12A00
4BUQA 5JQIB 4CSSA 4XO9A 5F3FA 4AUUA 5FX3A 3ZL2A 1QUNB 3RFZA 5FWRA 3BFWA 4ATTA 3BFQG 1N12A 4XODA 2JTYA 4XOBA 4AV4A 4AVHA 1TR7A 5ABZA 4J3OG 5IQOA 4AVIA 5AAPA 2UY6B 5FS5A 4X5QA 4XOEA 4XO8A 4X5RA 3BWUF 3JWNH 1KIUB 4X5PA 2UY7B 2J2ZB 5FLUA 5LNEA 3ZPDA 1UWFA 4J3OH 4CA4A 5AALA 4CSTA 5F2FA 3JWNE 2VCOA 4AUJA 4X50A 2XG5B 3ZL1A 4AUYA 4AV5A 4XOCA 4AVKA 4AVJA 2W07B 3ME0B 5LNGA 5IQMA 4AV0A 4XOAA 5AB1A 5IQNA 2JMRA 1KLFB 4LOVA 2XG4B 3SQBB 1N0LB 3JWNG 1ZE3H 5CGBA 3MCYA 2WMPB 1PDKB 4J3OF
chains in the Genus database with same CATH superfamily
4LBAA 4BSVA 2G3NA 4JM0A 3VFTA 3ZE1E 1OE3A 4XRCB 2X4NB 4I2XB 4K71B 3FTGA 3TV3H 2VKWA 4UMGA 5I18H 1A6WL 4Y9EA 4QXUL 5CKGA 4MMZC 1C5CH 3FO0L 2CJ3A 4G6KL 1PX8A 3GXTA 2VLME 4UTBA 2X53A 1YAZA 1RHHB 2C7UA 1PY9A 3L2MA 4IJTA 1OGAD 2R4RH 4NN6C 3ZQXA 2YA2A 3D3VD 1RL1A 2DYPA 4XOBA 1F1AA 5TE4H 5IQ7H 4L8DB 5HPMA 3K6SA 3JV4B 3DROB 5FFGA 1KB5L 3VE0A 2W95A 1ZS8A 4GAGL 1E7UA 1L9TA 4Z3TA 5C08B 1OAUH 2BX5A 3GXPA 4IW4C 3VQ2C 1G43A 1DQLH 4J3WA 5A2KH 4RESB 5I1DB 4K0OA 5IOPA 2AI0L 4PRDA 5IHUL 5C0AB 3UTZB 1UCBH 1P53A 2CBQA 1Z9SB 1UA6L 1WBZA 3MX0A 3U2IA 3U4KA 2GBUA 1IT9H 1OWWA 3G5XA 4LB8A 4EN3D 1KEML 1W0VA 1AXSA 1LO5B 3AMKA 5DJYB 3HPLB 2CCWA 1R47A 5IUCA 3RNQA 1MW2A 4JMXA 4XC1H 2OW7A 2CPCA 3GSRB 3Q5YA 4XVUD 4ZPVB 2EKSB 3L95B 4Z7OF 2CO7A 4NQQA 5EO0A 1QATA 1JUFA 1HL9A 1HOCA 4WJKB 1N59B 3EBHA 2B1AH 4PJIF 4FOMA 4KQ0A 5BQ7A 5I75C 3I9AA 4JFEE 1TPXC 3G5VB 3MREA 1DO6A 4ZAKA 3FB6A 3L4UA 5TD4A 3QDGB 3ZRSA 5DS8A 1TTGA 1CICB 3OG4B 1GC1L 1HINH 3IDXH 3IGUA 2WBXA 1CGXA 3SDCA 3LEYL 1M2VB 2NQDA 3CVHA 3MGOB 3MRIB 4D0CA 3T8VA 2NY7L 5IROA 3LQZB 1A6AB 1NCOA 4OT1L 3ZTNH 1HCVA 4QOKE 2ZXCA 3PHOA 5DUBA 3KPPB 4UDUB 4PG9A 3B9KC 2Z64C 1PFCA 2X41A 3BWAA 2XFGB 1KWKA 4Y4KC 2PYFB 4X4YA 3OKLA 3TTSA 2DQFA 1J5IA 3NEOA 2EDYA 4Q56A 4TVSa 2XXGA 4R8WH 4WUUE 3BEVB 4I3GA 3HNTH 1HHKA 1YECH 2VDQL 2H32A 1T0MA 2CDEB 3M8OL 1U3NA 3DIVA 4N5ED 4R90L 1L4IA 4GXUN 1TZHA 2X4TA 5KVEH 2I9TA 4G80A 1T4KA 3FT4A 1CLYL 1OCOB 2MOVA 1ZV5A 1DVXA 4PS4H 4NKMA 4GW1A 4MJIB 1JNJA 5J6HB 4IRJB 1AZNA 1VDGA 2KZBA 4FJYA 4HV8A 4XP9L 3W0WE 2IQAB 3TO2B 4DGIL 3APCA 1Y18B 1N5AA 1KLUA 1UENA 3GK8L 1WFJA 4JY4A 3B6SA 3KWVA 1M7IB 1J9SA 5CO1A 4MA3B 3PGCB 1M3JA 1TQWA 1NMBL 2XV3A 4JRXA 2UUDK 2DLIA 4HMEA 1J8RA 2M83A 4FZEL 4F3FA 1MFCH 1HJBC 4FXKB 2ZF8A 4KQ3L 4XN9A 5F7FA 4JG9A 1CDGA 2ZCHL 5FCSH 1CI5A 1ZLSH 4HG4J 1JHTA 4L4TD 1OSYA 4AYDC 2RR3A 1A6PA 1WK0A 3HLAB 3TV3L 1NGZA 1W8NA 3OXRB 5I18L 4MCYA 3TYFB 4RDQF 4Y16A 2C4FT 1C5CL 3QPKA 1NCBL 2VAAA 1ORSB 4N1HB 1NPNA 5HDOA 5CEZE 2YAEA 4I3SH 1OTSD 4DP5X 5AG9A 1P1ZA 1EVUA 2MWCA 3WUWB 4IRZA 3QT2A 4PAZA 3P4LA 4QNPE 3J7HA 5FUOH 4N2FA 1P6AB 3ATBA 4KY1H 3BCFA 3LEXA 4FTDA 5IQ7L 3BRDA 1LMKA 4XPHL 2GEQA 3UCRA 4GO6B 1RZ7H 3TNMA 1S7RA 4FKHA 4WKZB 1NMCB 3CWGA 3P54A 3ROOA 2R0LH 3S97C 3UTTA 3GBLA 4AENB 4EAEA 3IS1X 1OAUL 4H1LG 1PD0A 5IKCA 1UOLA 1SPDA 4F2MA 2VR6A 4W4NA 2ZXDA 5I1AA 2Z0UA 1LEIB 4RDQG 4V2CB 4NWUL 4JZNB 2G2PA 1AIZA 3E38A 2CM6A 2QLVB 3QZWA 1KGJA 3DGGA 4IEFB 2J3SA 2AERT 4TXVB 2FGZA 5C7XL 1WCBB 5CMAA 4FQXC 1I7RA 1KPUB 2WXOA 4QRTB 4Q6IC 1N0LA 1K8IA 2C9VA 1BGXH 5AAMA 4AZUA 3HNSH 1DJZA 5GS1A 2WVVB 1BEYH 2EYSB 3LZOA 2Y5EA 5BUGA 1RURL 1B4TA 4DESA 5KBMA 1NAKH 3SY0A 1HINL 4WAFA 3LZQA 2YD8A 3DUSA 3QH3B 4NM4L 1IAMA 3V55A 4S1DD 3TASA 3D0VA 3BPLB 3L16A 1QR1A 4PS3A 1A66A 2BVYA 1A65A 4JNXA 2ATKB 3V52H 2GPZA 2QPUA 2ZOKA 2DMGA 2XBTA 4QJ3B 2K3TA 2QGEA 4QCIB 5DJ8A 3BUPA 1DDTA 3TTYA 4R8WL 3D39D 2FD6H 1JPGA 1ZT1B 3DVIA 4H8WL 1OGAA 5EU4A 3DARA 5IVXF 2W94A 3HNTL 2JI1A 4MKTA 3C5ZD 4F7EB 3Q9PA 3D3VA 3H7LA 3N9GH 5HY9B 4DFIA 1L5GA 3M1CA 3UTTE 1HVXA 2DLHA 1DR9A 3MFFA 3MA9H 5DEZA 4TOYH 5KVEL 1EEZB 3FS9A 2RFXB 1I3RA 1KIPA 2YRZA 1AACA 2KLRA 3HZVB 2QQLH 4HAKA 1VCAA 4PR5B 3IPBA 1K2DA 2QHRH 4PS4L 5AYUH 3TWYA 3IJ9A 3X12A 2D31B 5ADOH 1T22A 1G1CA 1FFOA 4M7KL 4PJXA 3FB5A 3A6OA 3ULVF 2ZKXA 4GIAA 4AT6A 3N42B 4EN3A 2VZTA 3Q8BA 2J55A 5JOFB 2V7HB 4U1KB 3HBZA 2F58H 4IQHA 4XNQB 4MDRA 3DUUA 3DA0A 3QWNA 5ETUB 5FM4A 1MFCL 1SLXA 4H25B 3D51A 4MVBC 1QPKA 3QCVH 1CXKA 1I8KA 3B8YA 3EUUA 3GSNL 2N0KA 3AWEA 1ZLSL 1BVZA 2Y7NA 4QXTA 3ZPDA 1BX2A 2XACC 4XE0A 5CR1A 1S9VB 4P3WA 1E50A 4FA8A 5JHDD 2DL9A 1ADQH 1IAIM 4LNVA 4RFEB 3T6ZA 5L9DH 5ACZA 3GFUA 5IHLB 1HSBB 4OCNC 4PJ9D 5EPMA 4DZBB 4G8IB 4U1IB 1WRFA 1WBYB 2RH0A 1PZDA 3U4EB 5EF2A 2VDLH 3HI6H 4I3SL 2UUDH 3MOBH 1NCAH 3VH8B 4B96A 3L5WA 2IH1B 4HKJA 5FO7B 3REVA 2AEPL 5FUOL 4OV5A 1MHCA 4AQEB 1JZHA 4KY1L 4MNGA 1H15A 5GGRY 3FUEA 1XSOA 5C6TH 3ZX1A 4HX1B 5DEGB 3ZT6A 4M1GH 4FNSA 4OCRH 3KPRD 1RZ7L 1D5BB 4ELMA 1X4YA 2EXYC 3MRFA 5TQ2H 1YC8A 4KJWC 4LSTL 1DSYA 1QEWA 3RBSA 3FONA 1KBBA 3G04B 4NO5B 1OCCB 1L9OA 3LNEA 3OG6B 4MZIA 3TA3B 4JM4L 1KC5H 3KVQA 5HHMD 2PW1B 1IZKA 2BNQB 3SPIA 3O2WH 3FN9A 4QYAA 2VLLA 1HYSD 4I88A 5F7AA 1TZGL 1S6NA 3D34A 2WUBH 1JF5A 5I19H 3VI3B 3P3YA 4JM2B 1J8SA 1P4LA 3V6BR 4J4PD 3S5LG 2BMKB 3OSVA 4JS7A 1HAWA 2Q7YB 1N8OE 1SXAA 1NBZA 2IADB 3MCKB 4L8BA 4ZSOA 1BEYL 5BQDA 4AITA 2VUKA 2YARA 5EUKA 2ICWB 2E8ZA 3ECWA 4YXKH 4P2QB 3S8GB 3I02B 4L4TA 2JQMA 1NAKL 4HA1A 3AITA 1RK7A 2VC2L 1R3HB 1T5XB 1CPUA 3SN6N 1TZIB 5ES4B 1OSZB 4M1DL 4L8CA 2P8PA 2MSPA 1NDMA 4YIQA 1MI5E 1N0XH 3SQOH 4F9LA 1E3XA 4S1RL 4UB0H 4KNUA 2MCAA 1U93B 3HE6D 2PR4H 3LRSB 1DEEA 2ZAIA 2XU9A 5EU7E 4YH6A 2PWFA 5DFVC 3UZEC 1X5JA 1JF6A 2FD6L 1KSRA 2E7LA 5EOCH 1KGYE 4HALA 1NCUA 5IQ9B 1A6ZB 4PJEE 5FUCE 4Z7WA 5CGMA 1IBFA 5D1ZB 4P2YA 5FLUA 3HHMA 4I3RH 1NUDA 1ET5A 5MHSD 3L3HB 3MA9L 1SUHA 3NDYE 4NPYA 3KD4A 1KT2B 2QQLL 2WQVA 3WEXA 3SPHA 4JPQA 1WZ1L 4MQSB 2QHRL 3QQ4B 3BKYH 4LSVH 5ADOL 2NR6D 5F2FA 4NQCB 3CZKA 3TN0B 3HI5H 2PABA 3LZRA 4DHLA 1D6VL 1TTCA 1G6RH 5IBUG 1ORQB 4JFDB 4RZCB 2E27L 3SGEI 3DX7A 5I76B 3ZTDC 4HIIB 5DMYA 4QGTA 3L4ZA 4NGHH 5GZND 4DP1X 5IB1B 2X4OA 3B83A 2V17L 4TUKH 4WHTA 5C0BE 2WCSA 2ISDA 2EVFA 2JKJA 1OPGL 2WJ7A 5HSFA 3FQ2A 2R56H 3MRHB 5TGBA 2CIKB 2VZUA 1GS7A 2E46A 1IM9D 1WAAA 2OMZA 1SJHA 2Z93B 3PY9A 4UIMB 4B50A 3IETA 4NNXA 1BMWA 3IWVA 5ISZE 4LCYB 4X7EC 1SY6H 1IAOA 1NCDH 3HC3L 3F5WA 7TAAA 1A1MB 4XPTH 3QZOA 4I0CC 2ERJB 2JKXA 4H26B 3APFA 3ZDXB 1WZLA 3HG0A 5B22A 3AJ7A 3FFCE 4NUPA 1W16A 4OF8A 4Y19D 5JPNC 4A39A 1DJWA 1FPTH 2FLMA 4K9EH 1V54B 4MAZA 2CR0A 5C6TL 2MPVA 2FWOA 3D39A 4KX7A 4XAKD 3H3KA 3C5ZA 2OZ4L 4PRID 1IC4H 2WLLA 1INEL 3KPTA 4AL8H 5ITBL 4LE8A 1O9ZA 1ZTMA 1Y6MR 5TQ2L 4FG0A 5AL8A 5EZJA 1TETH 4N0FB 3WIFA 4L8SA 2A6DA 1D6EA 2WP3T 4CN4A 4H2AA 3T2OA 3O9WC 1U2CA 5DI8B 2N7AA 4L1LA 1KC5L 4ZX4A 3O2WL 5KVDH 4XN8A 1TU2B 1IAKA 2DIJA 4ODWA 3FZUC 4DPCX 4FNRA 4JO3H 1RSYA 2WUBL 5I19L 3PAUA 2I26N 2FL5B 3NJJA 3VXSD 4E9WA 2EE3A 4LHUD 4ODSH 1YDPB 5GRVK 3U2SB 3VXME 3L8QA 4P3DB 4UTBH 3QUXB 5IVZA 4G43B 1F5WA 2CD0A 4CN6A 4Q97A 3ETSA 1YMMD 1XGPB 1JDAA 1QOKA 2YBRA 4K5PA 4RFNB 3QJVB 1WAAE 4RGND 5GSRB 3HG5A 5C1MB 4LRIC 5JHDA 5KBLA 4Z3IA 2G3MA 1AGEA 1N7MH 1UUSA 2DQMA 3PL6B 1FFTB 5LAXB 1PZ3A 4GG6A 3E1ZA 5GRUH 3A6CL 3SQOL 1LEGB 4PJ9A 2YUWA 3PJNA 5ANME 1YY9D 4G7SB 4UB0L 3ZLQC 4JCLA 4LT7A 5A2CA 1TUPA 1IARB 5FYKE 1NLDH 5IB2A 4CMMB 3MRJB 1AHWB 3D4GA 1UT1A 4JFZL 2NXYD 2XFXB 2IC2A 3B1TA 3C5XA 2W0FA 4NKOB 4N2LA 3US9A 5IB5B 2NY4D 3DYOA 3UAEA 4ZMVA 5FW8A 1SJEA 3SCMD 1DQJB 4O2EB 3ULVD 5E6YA 3FTZA 4KAQH 5AB1A 3PIQA 3WS3B 4M1CC 3EYSH 3BKYL 4HCIA 4POZD 4W9KC 3VM5A 4LSVL 1N70A 1GZQB 4QRUA 5A7EA 4JFQB 2VDQB 3HI5L 1KJMA 2YKLH 4XPGH 1AY1L 3QJFA 3CVHH 4NJ9H 3TEYA 1Z9LA 3VRIB 4JREC 1U36A 2NYYD 4N2IA 3UBXG 2H41A 2DH2A 3ALWA 4UTAA 1WF5A 3CFDB 4FMFA 1U8PA 2HVJA 3TFBA 4J4PA 4TUKL 4KO6A 5T3ZD 3VI4F 5LUMA 4XPAL 3RGVD 1JZ4A 1PG7H 1UOVA 4RISH 1KBVA 3DTXA 4AQOA 1O6SA 3SJVD 2CBTA 1ASQA 2H32H 4X0KB 2HJLA 2YPLE 1T66C 5EV7A 5JHDE 1SOQA 3RY4A 4LPTA 3QW9A 1EX0A 2GJJA 1G7IA 2OSXA 2PO6C 3K7UA 5CNHA 3HFFA 2CRIA 3FUMA 3NMEA 3PNWB 3H85A 4KJQC 1T83C 1NCDL 4LP4A 3ECQA 4PV1C 3RVUC 4QY8A 2GAZB 2X4UB 4XPTL 5AOKA 2EZ0C 2QMKA 3ARZA 4XP5L 3FK3A 3HE6A 1LEKA 1OWRM 2IOMA 3C6LD 5C9JA 4MAUH 4Z7VF 2VLRD 4FA6A 2QZ5A 3O45A 1JE6A 1FPTL 4K9EL 1JRHI 1CDIA 1JK8A 2CNYA 3EOAA 2QVFB 1I85C 4MMXA 3K91A 1H3GA 3KPRE 4AL8L 1G5GA 4P06A 3MNMA 1DEDA 1TETL 1HU8A 1T7ZA 1TCMA 1EHXA 2JKNA 4DW2H 1AC6A 5DU7A 5IFJA 4GUPB 2ODIA 3MLVH 1HZLA 3N44F 2ZX8A 5HHME 4Z7OE 3GI9H 5BW7C 2HFTA 2IBZY 4IS6A 2NR6A 4TYUA 5LXVA 1MNUH 1II4E 1TLKA 4XCYA 4TSCL 4JO3L 5C07D 1J0HA 4PJIE 5CN1A 4ZW8A 3TL5A 5F1IA 1UWYA 1S7VA 2D0GA 2ZUTA 2O5YL 1GJIA 1G7HB 1NCHA 4ODSL 4K7PX 3WJMB 1KYOK 2V2WA 5CJXC 4KBPA 5GZNA 3PF2A 4KUZH 4FJZA 4J1UA 4HPYH 2VW4A 4H1LA 1R24A 2EUZA 4IRZH 4TV3A 3CVCA 1DJIA 4ELME 5D5ME 2CZNA 2X0WA 3AT8A 3GSQB 3KPOA 1A7NH 1DN0B 3VQLA 4OIIH 5D7IF 4NZRL 3Q5TA 2J8UF 1IIKA 5HYJB 3GMPB 2WD0A 1FL6A 3BZ4B 4M6NH 5DZNA 1ZHNA 4NOFA 1CLZH 2F8VA 1IM9A 1N7ML 1YYCA 5GRUL 4WK0B 3V5DB 2QQQA 4LEXL 2ZIDA 2Q87A 3GSUA 1ONQB 2WIIB 3NJKA 3UERA 3D4YA 4PJCF 4APXA 5B8CA 1V3KA 1NLDL 3NN8B 4Y9BA 3WDHA 1GOFA 1GW6A 2BP0B 3ETBJ 1UQSA 3P9MA 1B2WH 2IAAC 1ZHKA 4Y19A 5HHVH 5A16B 3NIDF 1EBAA 1TFHA 3Q1EA 2VLJD 3WTUA 5DUMH 2BNRE 4U1MB 3VVVA 3MACL 2FQDA 4PRIA 1L0YA 4XN4A 1NOLA 4PRNA 2BS9A 2DW5A 4KAQL 5E9DE 1AOHA 5TDNA 3SD5A 2BIMA 1ZE3C 2Z7ZA 3T77B 3EYSL 4BXSV 1VENA 4PJ8D 1DN2A 2BSSB 1T89A 2YKLL 4XPGL 1OY3B 3BXNA 3CVHL 4NJ9L 4WFEE 4L5FE 5FA4A 2NTSP 2IOOA 3OX8B 4F1ZA 3EOBA 5FDYA 4LVOB 2OMTA 3FT3A 4IYKA 4WEUD 2XQYA 3VXSA 2HT4C 4LHUA 3L1EA 2JTYA 3GXUB 1U33A 4RRPG 3UPCA 3DTUB 2AK1H 3T0ED 3T1WA 3MYZA 3KZ8A 3QUKA 4TUJA 1PG7L 4QXVA 5JIHA 3EXJA 4W9GC 3PP4H 5IBLC 2P24B 3VU1A 1YMMA 3W9EA 2AXJA 2V9QA 4NZTH 3JUZA 5SWQA 3WIHA 3GSWB 2F5BH 3BVNA 1JTOA 3ZT5A 5E8PA 3GSNB 2VN4A 1QFUL 3ZGIA 3VSVA 5IVXA 3QJSB 3FUKA 3L3DB 3RZCD 4MLSA 3JWNC 3WJLC 2PPDA 4AMKH 3LZFH 1HIMH 4OD2B 1BM3L 4QHLB 3WV0A 3UC0L 1EEYA 3B34A 2VLKD 5SWZB 2DBJA 2DQCH 5HHNA 4P9MH 3K0YA 4AUJA 5ICXB 4GG8A 2AVGA 3LXUX 3SCMA 2AQTA 2O6EA 1A64A 3PDGA 4IKLA 3LPOA 1M3IA 1CFQB 5E00A 5FA3B 4PGCB 5T1JA 1MCEA 3JT0A 1BFTA 2N7BA 3MLVL 4FMVA 4HP5A 4NM8H 2N59A 3S4SB 1PX4A 2ZCLH 4ZW6A 1V3LA 3GI9L 1CXLA 4IOFD 2I7OA 5E23A 4O5LH 3V6FA 1MNUL 3DMMB 3EGXB 3WCYA 4BSWB 32C2A 3EYOA 4IRSB 3HG2A 1NCNA 3O4OB 4JANA 3O2VH 3VWKB 1F11B 1CN4A 3OJDA 1IGIH 4AH2A 4F8TA 5DXWA 4OZHA 1ZLWK 4F27A 4KX8A 2KPNA 4Y4FB 5E5RB 2H1XA 4X7FC 4F8PA 4PJAB 3ZYIA 4HPYL 4NJAH 4PJHB 2A74A 4IRZL 1CT8B 2CUAA 5I1JL 2VISB 1NKGA 4LLYA 4WEBH 2I60L 2XDHA 3RGVA 4WV1C 5I6OA 3K2UH 4OIIL 1T03H 5FHAH 2XLLA 2WWNA 3TH3T 3AM8A 4M6NL 1VEOA 5J1AB 4QRRB 2XKNA 3BAXA 4NAMA 1JP5A 3FQTB 2P80D 4QHKI 3VSUA 4RMVA 5IVXE 3HTLX 2ITCB 4F2FA 4GRWB 3M17A 4KXAA 4KTDH 4ZRGA 3CQPA 1EDQA 4DPRA 3ILQC 1I4FA 2VC2B 5K93A 1RZKH 1C8PA 4G8EA 1DUYA 2DQUH 1IC0A 3C6LA 4PN6A 4W4OA 2VLRA 5HHVL 4BQCA 3RWCA 3MLWH 4U1HB 5DUML 2FJFA 3FQNA 1ZPUA 1MRCH 1BEXA 2JE8A 1KJVB 1ZVHA 2GJZB 1CXIA 2HH0H 1R5WB 3LKNA 4MJJA 1QI3A 1FHGA 2E6PA 1PLAA 3D50A 1NGWB 4MJ5B 5J89A 4NT6A 4R96A 5IW1B 5I1CH 3SYOA 2YEQA 5EU5A 2X1XR 1BIHA 3VG9B 2RJMA 2EYRB 3NFPA 4L4JA 2P42B 3T4AC 4X5QA 1WWAX 2JV6A 2QELA 3L7EA 3CZSA 1NAMB 2BFVL 4WFFD 2XI9A 5C07A 4F91B 4TVUA 3ABKB 2BRQA 1RAMA 5F6IB 4ZMLA 4HETA 5FGSA 4DGYH 2YWZA 2AC0A 1NTDA 1NANI 3NIGF 4WHYH 5DYOA 1FSKB 2FIRT 3GSXA 4OZIF 2PWGA 1P7QA 3MJ8A 1IX2A 4DVRL 3LHPH 4A6YB 3SJVE 2A0LC 4MNQB 3US1A 2ILLA 4Z7QF 1OE2A 5E08H 2CHWA 1FA4A 2JKSA 2WTPA 4NZTL 4LCUB 1QRKA 3MLXL 2IWKA 3BUIA 4GAYA 4P05A 1CBVH 3JYCA 3X11A 1SHMA 4AM0A 2R1YA 1WDAA 4ZS6C 4IGBA 4XMLH 4LLMB 4U1SA 1BIIA 5T1KB 5K9OA 4C56D 1JWUA 2XXFA 3MRGB 4FCHA 5DSCB 4A2FA 5FV2A 3PDDA 5IG7A 3DSNA 3GS4A 5E4EC 1EWHA 1HZHL 3CDYA 4D3CL 3MN8A 5DF0A 1PF3A 3V79C 4UT9A 5J6GB 5EIIB 5D7LB 2VLJA 2DQCL 3T08A 4P9ML 2YXFA 3ZKQD 1BOGA 4HKBA 5BCAA 2CR6A 3CFEB 3KYOA 1E3ZA 3RWEA 3BDYH 4FULA 4NENB 5FB8B 4NM8L 1Y1DA 1CL7I 2HTLD 2ZCLL 4NYLA 4IMKA 4PLNC 2GK2A 1I3VA 5KJ7E 4PJ8A 3K4DA 1XCWA 4O5LL 2YJQA 3I3EA 4M62L 4OFQA 1ZDSA 3C9NB 5GRXG 4A2MA 3O3EB 1U3HB 4U3SA 3U0TA 3HRZA 4C54A 1ZXKA 2VZSA 3ARXA 1GZPB 3FN3A 2MMXA 5FOJA 5CBAB 1IGIL 3BEWB 1RXLA 2Q86A 3LIZL 4RGOH 5FEBA 3TO4C 4E42B 5C0JB 4M93B 3UROR 4P2RB 2DF3A 3QAZB 5HGDA 3WJJA 3LRMA 4NJAL 4Z5RA 1U2YA 3A22A 2Q6WB 4I7ZC 5HJ3B 1U95B 4AJYV 1EHNA 3T0EA 3G5ZB 3QIBC 4WEBL 3CFIC 1LNUA 1QSED 3WFHA 1ZS2A 1JWMA 2DMBA 5FHAL 1FO0A 2A9CA 4L18A 1N19A 4F7TB 3B9EA 4B9KC 4MLIA 1EPFA 2BRRH 1XCQB 1M56B 3LQAH 4N8VA 1TJMA 3IFOB 1ZRUA 5DK0B 1X6NA 1E6JL 2VM9A 4UQIM 2C3HA 1NM9A 2EKJA 3C75A 3FAXA 4KTDL 4ISVA 5B38B 1ZLWH 3SYCA 3FO2A 4YE4L 4PRAA 5F3HA 3RZCA 1QMUA 4OR1A 1RZKL 4NN5C 2R2EA 4M9OA 3RY6A 2DQUL 4FABH 4MJ6B 2G75B 4GP5B 3MLWL 2J1YA 3GB7B 3OHXA 5C6WH 4OLUL 1NCWH 5LDUA 5I66B 4HS8H 2VLKA 3B2UC 4KNTA 2HH0L 4YDVB 3CC5A 3SDAD 1E6OH 4MYWB 4ABUA 1A7OH 3CN0A 4UQ2A 1JGUH 3CSYB 5EBMB 4K4KA 3TONA 4BZYA 5I1CL 2UV3A 2OR8A 4J3OC 4PY7B 1M2OA 2NY6B 5INCA 3O8XB 3KCPA 4HJ0D 1CFVL 2X2IA 4TLSA 3WEAA 4JGUA 4KXZH 4E9YA 4R4BA 4RIRA 3QQ9C 3R4RA 4U1GC 3L9BA 2Y23A 3DURB 4ZXBD 2DD8L 4DGYL 2QV2A 4WO4D 3S36H 3EZJB 3T0EE 2R23B 3MDJA 4ZDHB 1A2YA 2AQ3A 4TPRH 1FFRA 4WW2F 1WAEA 1UGKA 3LHPL 1JL8A 1T2QL 4XI5C 5FYJU 3HIZA 3VGAB 4GIOA 2XQYK 5E08L 4E9RA 4NZFA 4PCYA 4EDXA 3BKJH 5C0EA 4DFHA 3C5JA 1OAXH 3IXAB 2FCBA 1CBVL 5A2FA 1CUOA 2NNFA 2X89D 1LE5A 3ARGC 1PZ2A 4AE1A 4JRYD 3UBXA 5M95B 1G9EA 3BP5A 2BP3A 2P80A 1TTRA 2NXZC 5GQBA 2AJ3A 1X9LA 4X4KA 3MBEC 3VB8A 4BIKA 3HC2A 3BIKA 1E9PA 4LO9A 3W3BA 4ZQKB 4N8UA 2H3XC 2BZDA 5E99L 4J23A 2FYVA 4K3JH 3EGSA 1HHGA 1TQCB 2UVEA 1SOXA 2YAFA 1UVQB 4P9HH 4YBLC 4UTAH 1ZA3B 1NM4A 2AKRA 3QDME 4H2CA 5D71H 5CJOL 3L3OC 3QJZA 3NGBB 5K59F 3GBMH 2GSGA 2WKGA 4O02A 1FZOB 3RGHA 3HLKA 3N1PC 4O51B 1FGVH 3INUH 2X4PA 1MELA 1YJDH 2P43B 3Q2VA 4IIQB 4CC4A 5LNDA 3UAJD 2WC7A 4OQTL 4LCIL 5EUOF 4FE9A 3VI4A 1MW0A 2A9BA 2FHCA 4PJ5D 4M48H 3WEBA 1RK1A 3AB0C 3UDWC 2XPYA 5DQ9A 1R5VB 3FQYA 4MRBA 3HS0A 5IVOA 4D9LL 4RX4D 1VESA 2R7EB 4JFEB 1SVZA 2A73B 2VE6B 2X7LB 3PRZA 5FYKL 4AXWA 3IFPB 5ANHA 1YPZF 2ZTBA 3OLDA 3Q7JA 4EUPB 3MNVA 3L3KA 2UWEE 3EJPA 1HXMB 1OB1B 1E7VA 1IM3D 5I5RA 3DI2B 1F3JB 2AEIT 1J88A 2BRRL 3T3PE 4Z77B 3H42H 1MREL 3LQAL 3EO0B 4QOKB 2RMNA 3ULUE 3K80A 4KK5C 1CC3A 3V8CA 5AW5B 4DUWA 4YHYC 2WJ5A 5LGKA 3RG1C 2WQAA 3F58H 3BJ91 35C8H 1WBXB 4WUUB 4C56A 3QBTB 2HG5B 5AZEH 3MXWH 4FABL 4WFGD 3BGFC 3EFOA 4CDHA 1CDYA 4KI5F 1NC4D 3LN9A 5E51A 3BGMA 4G6AD 3FTYA 2YQGA 2A2QT 4FS0A 2CPUA 3TPKA 5EBGA 4AK1A 5KVMC 1E6OL 2BVTA 5IOPB 4LFHG 3HR6A 4DWHA 4WI0A 4PCSA 2EUWA 1JGUL 4H1LH 4AEIH 1KGIA 2HJFA 1Q0XL 2WZ6A 4OCXH 4JGMA 1ZLVK 3W0WB 4RWHA 1AXSB 1R4XA 5JHMA 4YGVA 2EDXA 3CLEL 2BVPB 2OTUB 1WFOA 3ARED 3W39B 4KROB 4PWGA 1YEEH 3T8XA 4WFFE 1CDUA 1F56A 2NT0A 1SLWA 2VAJA 4UQ3B 3BAKA 2NY0C 4BK5C 2YKKA 2ZG3A 1LK3H 2H2SD 3D8MA 4FKKA 3N55A 5E5MB 3SB3A 4G7YH 4V1DD 3K5SA 5D7IA 3S36L 1UH2A 5TQ0H 4Z9KB 2WBJB 3NEXA 5SV3A 2ODHA 4HWNA 5F3FA 3HW7A 1PZUB 3QAQA 4U05A 1F2QA 2CRMA 1CR9H 3GBDA 4AQ1B 4YBQD 2R39A 2ZJSH 4HUXB 3QJQB 2M26A 3IU4H 5F89A 1SYVA 1QSEA 5BRZE 5E4AA 3OKMA 4LF3B 1F6LL 3BKJL 3RPIA 5HI4D 4GMSH 1OAXL 4PJCA 3IKCA 4B9PA 3S7GA 4Z7VE 5JOEA 2H4EA 2FX9L 2HYMA 4OB5L 1A7PL 4G6MH 4NHCH 4JQXA 2X6BA 3RY5A 4C56E 1KWGA 2G2NA 5MEQA 3DVGB 2XWCA 2R2HB 3O11A 1BAWA 5DFWH 4MS6A 2H32B 1XF4A 3P4MB 3VXUD 1NBYB 3M07A 5IBTL 4PYHA 3QXAB 2GG1A 3MV8E 4NSKA 5E5LA 5DEFB 5F9JB 3AUWB 3CMGA 5GGSY 2I9TB 3OR7B 3AUVA 4UTAL 2ADJA 3MRRB 2VQ1A 2JFCA 4ALAC 4ZMWA 5EO1B 4DO4A 1MHEB 1R33A 2IDTA 5LBGA 3SDAA 2HFEA 4R2GD 1QWUA 3GBML 4YPGA 4HV8B 2O5NA 1UZGA 4UOW0 4X8XA 2ADGA 4GP8B 1WG3A 3FHAA 1FGVL 3EO9L 1I53A 3INUL 5MEOB 1YJDL 4U7SA 3F12B 1AQKH 1URIA 1AGFA 1T0NA 1XH0A 5JQ6H 3WIHH 3CZEA 1N2RB 1NFKA 4IOIA 4JKPH 3WNLA 5HVWA 1KIQB 5DRNA 3IU3A 1OTUD 3L1OH 4LOFA 4AGLA 2V9UA 3WLBB 5IJDC 2J8UE 1U8KB 5SX5K 4ZXBA 1AYOA 1BVLA 4NC1E 5LGHL 2KPWA 2OSLA 4WO4A 5IHHA 2VXUH 4U3CA 1DVTA 2WXMA 3P4NA 1NC2B 2E9WA 3VD2A 2GJ6E 4PJCE 4G6JL 3G6JE 5I2IB 1TVHA 4JY6B 4QO1A 2HRLA 3BISA 3H42L 3TIEA 3UAAA 4Y0GA 4I5BA 3KGSA 3ULVH 1FVCA 2Y4SA 4JRYA 2P9RA 2VDRH 3NIDE 4HWBA 4LSPH 5E6UB 1L0QA 5KSAD 4LZKA 2V3DA 3P02A 5EBLB 2YMXL 3A4FA 3M1BA 1CGYA 2WANA 1S3KH 3QDJE 1Q9WA 2MTPA 4LQFH 1D5RA 3D06A 3IMSA 4L5FL 3OKDB 5C8JB 5FDWB 4MAYC 2OM5A 1MAML 4FF9A 5F9AC 3UTPD 1XL6A 1I8IB 2GC7C 1IL1B 3DJ9A 3MJ7B 2ZKHL 4OFYD 5ESQB 4AEIL 5T3ZH 4OCXL 5CGTA 1WISA 2NQ3A 4AYMC 1MCWW 4ABQA 3LNHA 3VXTA 2JVUA 2BS71 2EDWA 3BAWA 4ELDA 4Q9QH 3E8UH 2E56A 1IC1A 1YEEL 3MBWA 4WDIB 3VRJA 3GHPA 5DQJA 1FNAA 4JDVB 4TTDD 3KXFA 3NJVA 3HAEB 4PJ5A 1IC7H 1XH3A 4DEUA 1HJCA 1LD9A 5DHDA 3ZRFC 1KG0A 3RTQD 5I5MA 3CFKB 1DVFB 3QYCA 1BZDA 5TQ0L 4RX4A 4Z0XA 4LNRB 43CAB 1CR9L 1NFIA 1ASOA 2E59A 5A3ID 1L7TH 4P3CL 4KKCD 3IU4L 4KWUA 2DLTA 2LW3A 5F7LB 5EOTA 4XN7A 4GMSL 2JLLA 4UV7L 1HC1A 2EEDA 5I82A 2J1XA 1IM3A 4YEEA 4FG6C 3TVMD 4F37F 2X88A 2QVMA 1K4DA 3GIZH 2EECA 2BOCA 4G6ML 3C6SA 4H40A 3P9WB 2FQEA 2IFFH 1OGSA 2AQSA 2D9QB 5AW3B 4ZFZA 4E0RA 3D7PA 2AXGA 2DYRB 3KEDA 3O2DL 3O6KL 4JHWH 1T1ZA 1BREA 4FL4B 5GSVB 5FECB 2FR4B 5AB9A 4YS4A 5F0LB 4BE6A 1NC4A 3ZZLA 3ECBA 2VXQA 3VXRD 2Y36L 1HH9B 2WXJA 1EZSA 3F7YB 4N90D 1BJ1J 3GJFA 3IDMA 5E9AA 3FQRB 1TEYA 3V0WH 4D0DA 4BQBA 4XNBA 1OM3L 2CNZA 4YC2C 1SDDA 1U8QA 3ECUA 3BQVA 1EQWA 2UX7A 4MD4A 3MUUA 3ZHFA 3IJEB 3UP1A 3WFBH 1AQKL 1QA9A 1RPKA 2AV1B 3BP7A 3UIYA 3TZVC 4FG2A 3AREA 4MFHA 4LIQE 4X6DF 2ARJB 5B1KA 2WGXA 3H3PH 5JQ6L 3BUDA 2WQWA 1Z5YD 2YAOA 1NINA 4OZIA 1CDCA 2XSKA 3L1OL 3DHPA 1GYCA 1YCSA 4LKXB 2PWEA 4LL4A 4XWOD 4XMXA 1I1AB 1KACB 4DEPC 2LT9A 2QQNH 3HPJA 2VXUL 1I75A 5EC2B 5KVGH 1DBJH 5E94B 1EV2E 3FSOA 5DJZA 2J21A 5IESH 1MF2H 3RWJA 4F8NA 1J12A 1MI5B 2OL3B 4EEEA 2KQNA 2DM4A 2ZYSA 3IF1A 2XPGA 4G3YL 3MU3A 3QC6X 1OP5K 4ELKB 4UM9B 2YAHA 4M8VA 4NQED 3S48A 3ULVL 3DYPA 5TK4A 1RJYB 4KI5D 3PGDB 5ITFB 3ZZQA 4ODHH 4FI8A 4FFYA 4E5XA 1E5UI 2XWZA 5CFHA 1IGCH 4Q9BA 1N6QH 5DHYB 5SX5H 1Q9OB 1IKNC 4K71C 5DMIH 1KCVH 4HPOL 4PJEB 4WFGE 3VXUA 3GBEA 4QGYA 3GKWL 5HI3D 2PPFA 4IU2B 1CGUA 2H2PD 2XV6B 3NCYP 1CFTA 3KMDA 3LDBB 1E8YA 2NW3A 4H20H 2ZOOA 3MO1B 1PNCA 4LOUC 1KXVA 4W1TA 4UOJA 5K39B 4RVBA 2WVSA 3RIKA 5T3ZL 3D2UB 3VJ6B 3OD3A 1FRGL 4NQUA 4QKXB 4I9WD 2IPUK 1F6AA 1KGCE 6TAAA 1DUZA 2X1OA 1T3FB 4FA7B 1FO0H 2AJSH 4PWJA 5AW7B 3RDTD 1S7XB 4Q9QL 3QEGH 3PHSA 2JSFA 2HFGL 1A25A 2H9GB 3NIGE 1N9PA 4IHOA 4XN2A 2BY2A 2EXTA 1TG8A 3V7AG 3X13B 4Y5YA 5HD8C 3BPCB 4RH4A 4YNYB 4OZIE 1ULVA 4DZ8B 3LS4H 5D9SA 3LIUA 1IMHC 1PZSA 1IC7L 3WNMA 1P84J 5C0BB 4V1DE 5LBVA 3WELA 4Z7QE 2ZWZA 5LO7A 4LLUA 5KSBE 3U6XS 1JXFA 3VYPA 4YDJA 1P5UA 3AMLA 5IMKB 5T1LB 3BPOB 5B39B 1KCWA 4UQ9A 5G5DA 1SXZA 3ESPA 2ZP8A 4HOWA 5J12B 1Q1JH 2Z35A 3RWDA 1ZK5A 1AZCA 3IRPX 3PAYA 1MJJA 4OF6A 5ISZB 4B95C 1A9BB 4XZUA 3TX4A 1UH3A 3GHBH 4G9FE 1RUQH 5B1BB 4JDEA 4JFPA 1XH2A 3L5XH 1BAFH 1ZGLM 2ZCKH 3GRGA 4NLAA 3UZQB 1A02N 3GINA 3FFCB 3GLZA 3WEMA 1ZIAA 3TBSA 3VXQB 1CFSB 1KELH 1CICC 3TESA 1OLLA 2ZPKH 5KSAA 4ANVA 4RMQA 2AXWA 2OMXA 4NFBA 3K74B 2NW2A 2P46B 4P5MA 4XPFL 5AVYB 1UADC 2DQIH 1BFOA 4P5TB 4N1CA 3EJZD 1PLBA 2R15A 3MRCA 1KLGA 4OCLC 2EC8A 1PKQA 3QO1B 2HRPH 2QSQA 4OGAD 3WKML 1Z3RA 4OFYA 2NLJB 5J7CC 1F2XK 1WCQA 2DH3A 2VSCA 4Y9CA 1S7SA 3BWSA 2MKLC 2VO5A 3CQQA 2DB8A 2AXFA 2EABA 4X7DC 2F1EA 3ATEA 3LKPA 5FUZH 3DX7B 1YUKB 3WFBL 4K15A 4PI2A 4FFWC 4KQ4H 2GC4C 4I0KA 3S35H 3H3PL 1LQSR 5T1DH 4FRWA 4GW4A 4XPBL 1FH2A 1JGLH 4WHTB 4YUEL 1CGSL 4WFHE 1CD1B 1FN4A 4BFKA 3VXMB 4WW2A 1WIPA 5DZLA 4DPAX 4ZO8A 2BIPA 3K71A 3WHE0 3DX0A 1VFBB 4IRJC 5E2VH 5J11B 3RTQA 4Y5VC 3ZHKA 4MDJB 4PBDA 3SO5A 2JKLA 2UYLB 5FW7A 4Z8FH 3P3TA 2G3XA 4W70A 2B0SL 5GZOC 5KVGL 1DBJL 4ZUUA 1FNEA 1N3NA 4UU9A 1HXYB 4UT9L 4FTVE 2CGYA 4PTUA 1HQRB 2CDGA 3CFBB 4FXKC 3PWJA 5ANMB 3TVMA 4Y7MA 3EF4A 3G5YA 4O02H 4KXCA 2Y06H 4BHUI 3F7LA 1QUPA 1NCJA 4XCNA 4CSZA 2OP4H 2LGNA 1IGCL 4X6FB 1N6QL 1QRND 4HUUB 2XRAH 4M61B 2O26U 5B1CA 4OJDH 3R4DA 5DMIL 1U8OA 4LK4A 1KCVL 3IJHB 4PP2A 3ZSSA 1MLBA 3QCTH 4OKVB 5DJAA 3ZHNA 2EQDA 1FBIH 4YL4A 5EU6D 3WFZA 4X6EB 1V55B 1XIWD 2R1WA 3EYQC 4WSKA 3H7BB 3VXRA 4H20L 5JXAL 4LBEB 4MXQD 2CLZB 1JV5A 3ARVA 5FLVA 1U42A 2GTZA 2P8LA 1QLEH 4RZKA 3AABA 1DQQA 3DVNB 4AQAA 4B0MB 4Y1AD 4AV5A 1FO0L 2ZSVA 3OF6D 3QEGL 3NABH 3II1A 1WZMA 3OLEA 3LN4A 1NMCC 2OK0L 5I23A 3QZMA 4ADGA 3LS4L 1XZ0B 4GPVA 2X70B 1DE4B 4MQ7B 1BZ7A 4O4YH 2NX5D 1YPZA 5DWUL 1AFVL 4EXKA 1OP4A 2Z34A 5D7JB 2ZKMX 2J43A 2VDPL 1MWAL 1UHVA 4WI6A 4NOBA 1Q1JL 2WK2A 2YPLB 2VL5B 4EVNA 1T2JA 2PPCA 4XH2B 4P99A 1VB9A 3ELAT 3HG3A 3FULA 2P1YA 1P0SE 2C1OA 2P5EE 4BSJA 2Z65C 4I85A 1RUQL 2J71A 3SE9H 3L5XL 4NQEA 4YSEA 2ITDB 4Q9RL 1QEXA 1EDHA 1KELL 4R7VA 1LXMA 4N8PA 2ZPKL 4NRXA 5K59E 5IB4B 4XCEA 4N4YB 3SODB 4TQPA 3KPRB 3BPLC 5KG9B 2Y25A 5HHQA 3SPVA 1QUNB 1XF2A 2DQIL 3DK0A 3VXRE 1JMXA 1I3GH 1MCCA 4S1SH 1YA5A 2BIOA 1J8HD 2HN7B 5DC2A 4N24A 4XODA 2H5UA 3EZ8A 5GGRB 4YEFA 2Q7NA 3ORJA 3QULB 4X0NA 5EUOE 4KHTL 1BPVA 2JKRM 3LS5H 5HHMB 4Z7OB 1U21A 2QBWA 2OQJA 4KDTA 3ZMRA 1UZ8A 1S7UA 4KKBC 5DRZA 3K81A 1KGWA 5FUZL 2Q3ZA 4PJIB 1NIFA 1PQZB 2AQNA 3GJFK 2HX7A 1PX3A 4UMSA 3BP4B 4KQ4L 5T8IA 3RDTA 2FT6A 4PWHA 2H7WA 3FH7A 3Q5OA 5DC4B 1W72B 3RX7A 2EIEA 1KNOB 4UZSA 1JFQH 1JGLL 2GB2A 3QXDB 1AIFA 1DBAH 3B7TA 4BWTA 5BVPH 5HYSG 5K69A 4OUUB 3EXLA 3IGKA 3ESOA 1WT5C 4GFXA 4PS8A 4WU7A 2AEOA 3F85A 1RJZA 1A3RH 4A1RA 5BMFH 5D5MB 2MCPH 3O3DB 1QFWM 1YYMH 4U1LB 3OVUB 4P5KA 1FDLH 1F02I 2WWMC 5D1ZI 1DL7H 4YZWA 4JFXA 4LASL 2LHAA 3FYEB 4PWEA 2LR4A 3RURA 2XXCB 2OX5B 3ROLB 3T09A 5J9PB 3FRPG 1PS3A 3A67H 1BD2D 3BVDB 1L9NA 3B9KD 5J1SC 4Y4KD 2HT2C 1WFUA 4PVMA 3FUIA 3F7KA 5DFTA 1TSRA 3H2WA 1GMEA 3M88A 2NNAB 3PDOA 1B2YA 2YHGA 2BNRB 3II2A 4M3KB 5BZXA 3S3BB 3QCTL 1G7QA 4WJ5B 4PBXA 4X9YA 1H8SA 4O9HH 3QIUB 3UO8B 1NLBH 4K7PY 3MCG1 4DCQB 2OMUA 5E9DB 1FFNA 2QR0A 3QRBA 5IUSA 1XTLA 4IS6B 3C8DA 2O5XH 4OW6A 5JMOC 4I9WE 4F33A 3ASWA 1KIRB 3Q2WA 1NGXB 1CXEA 1VZHA 2Y1VA 1GOGA 2D8KA 3EYUH 3WMQA 2VABA 3RJOA 4U1NA 4GKNA 3IFNL 1JSYA 4FFVC 3RTLA 2NCEA 1OAZL 3AROA 5C3IA 5DK2A 1FC2D 4O4YL 4HS3A 4HWBH 3TA3C 4CSSA 4PJ6A 4JJ5A 4RAVB 2VXVH 5AVSB 2KL6A 1S7QA 2FBRA 5D72H 4Y1SA 1INDH 3RL1B 2JXMB 2X40A 3UGXA 4DN4H 4ES8A 5ID1B 1OARL 4JM2C 1RZPA 3MRLB 1JGVH 5D2LE 5D1XD 4JZJB 2BY3A 3I9IA 2FB4H 3QORB 4ODTH 5KYWA 5L6YL 3KLKA 4Z3GA 4UQCA 3JV6A 2ADYA 3IDJA 3IPFA 4HHGA 3DX9B 1VACA 3SE9L 3VM7A 3D0LA 1T2XA 2C9PA 1AZVA 3IN0A 1PY4A 1A7RL 4HUWA 4N2EA 1OW0C 4ACTA 2NDGA 4UIKH 1E5ZA 4X6CF 4AY0A 4K5OA 4TLKA 3U0PB 1J9QA 1QRNA 1FL3A 1HEHC 1FLRL 1HHJA 1IJ9A 4EQ3A 4LAQH 1MZZA 4ZX3A 2H6OA 5F7DA 2ZYRA 3L17A 4NCC1 2P8MB 5EU6A 3MOQA 1ZHLA 4E9SA 4S1SL 3ILPB 4B9YA 1KBKA 4MASA 5BVJA 1XIWA 1E28A 2J72A 2B3RA 4R4NC 4Z78A 3NK3A 1MNNA 5TDOA 3TCLB 4W93A 4NO0D 4Q8BA 5I8KH 2V5YA 2XCMC 4NX0A 5IB3B 2QGBA 4HJSA 3GM0A 3UTQA 4BDVB 3IAPA 3U1SL 4Y1AA 2AK4E 1B90A 2Y3AA 4RGMB 5D1ZC 3OF6A 3L3JA 4D2NA 3GRBA 1BFVH 4YAQA 3UL4A 1U30A 5K9QG 1FV1B 5EDSA 1Q38A 3QG6B 4A7VA 4FQXD 4J6RH 1MCDA 1JFQL 1JI2A 3NPZB 3QZLA 1DBAL 5I74B 1D5MA 5BVPL 1R3IH 5K33A 2DEWX 3PHQA 2OA9A 2Z8VC 4KFZC 2NX5A 1IBYA 1A0QH 5MI0B 3SPJA 3TN0C 2MCPL 4FQ1L 2CH8A 1NUNB 3RWFB 3IJSA 1FDLL 1JYXA 4APQB 3QFDB 1KTCA 1DL7L 4R9HA 2CLVA 4FAAB 2VXQH 1DJYA 1T04A 1TEGA 3TWCH 3QEQB 4OSUL 1MPAL 5IJVB 3GJFH 3LOWA 1QLFA 1Z5LA 5KJRH 3A67L 5AKSA 2BVOA 4MMZA 2WLIB 5DZVA 2B16A 1RP8A 4TNVF 1LWHA 2X4QB 1JZ5A 3SQBB 1FVEB 5F3BB 1FZJB 1EZVY 3VFWB 3CFJB 1W8OA 4AJ0A 5C7ZA 1KGUA 3MRQB 5HDLA 4R7LA 2C7FA 1AGDA 1PLCA 5F21B 5JR1H 4BRVA 4HK3J 1UXSB 1R3LB 4QWWC 1G7LB 3BKCH 1K85A 3ZTCC 1LO3L 1WGVA 3JWDH 3WN6A 4YJZL 5EU6E 4O9HL 1PAZA 5I17B 2ERJC 1J8HA 4AG4H 1QVOB 4G5ZL 4L4VB 2NY2B 5TF1H 4W9ZA 4AYFA 5ICZA 4X6DA 3D18A 1GYUA 1ODUA 2E74C 1YQVH 4M03A 4A55A 4B3VA 1AGBB 3AT0A 1G7MB 4J3UA 1YUHA 1A47A 4PRHD 4A7UA 1L7IH 3MRPB 1KFGA 1KXTA 3KLSA 1BXAA 3JWOC 4MVBD 3KPSD 2Q3XA 1G7PA 4FFYH 4YZFF 1PG7X 1KEGH 1QSZA 4LCCB 5AAPA 4MA1B 4JPIB 4M6OL 5D72L 6FABH 3SJVB 1INDL 5CWSA 3UFIA 3V6OE 4XXWC 1MCOH 4DN4L 4N6RA 2FYYB 2HT3C 2FT7A 2YXMA 3HI1A 5J13B 1SJMA 3UEQA 5FKAA 1NL0H 1XZWA 4HPHA 4ODTL 2EIMB 3S5LB 4KITB 3H55A 3QUXC 3ZKNC 4NFCA 4WSGA 4G8FA 3S96B 1OCRB 3O4LE 4GRMA 4XXDA 3US0A 1N67A 4YL9A 1BD2A 4M00A 3WNIA 3B9KA 1X9UA 1M7DB 8PAZA 4WI9A 4Y4KA 4EO5A 4RFNC 2IXQB 2GFBB 1PY0A 3QE5A 4KY2A 4RAUB 3TCTA 4EI6B 4X5WB 4EIGB 3PL6C 4EBQL 1IVTA 3AQDA 4QRSB 5JDSB 4LAQL 2MQGA 3L4CA 2Z91A 4LIQL 3DO7A 4DGUA 2EXYD 2WB1A 1E40A 2R9HC 1CLCA 3PWNA 4KJWD 3DVFA 4M7JH 4P0DA 4L3CA 4L37B 3V0FA 1MVUA 4XMTA 2MNUA 2IH3A 2H26B 4U2ZA 5I8KL 2F5AH 1AHWC 4CN1A 2GKIA 3DHUA 2CO4A 1JF1B 4H4NA 1Z3GH 3NACH 4EF3A 5HHXH 1NKOA 3FAWA 4DERA 2W60A 5JW4N 5T1MB 1RCYA 2ZUUA 2XPZA 1CFNA 2IMMA 3L3IB 4WU5A 2NMSA 2Y7QB 3Q9QA 1RJLB 2FH8A 5LCVL 4MBRA 3WYRA 2J1KA 1UH4A 2NY5C 4YQXH 4Z0BL 4PRBA 3DBXB 3KYKH 3MJ8B 4XBGA 3RQ3A 1A0QL 2XXMB 5IZ7A 5HYQA 5I8OH 4LHQB 1K5NB 3P0GB 4PREA 4U4IA 2XNAB 1EUTA 3CFMA 1E4XL 1ZWIB 3P2BA 3TBBA 4ZPTA 2R1YB 4K3DH 3BHBA 1KCKA 4UI2A 5A43C 2DWYA 4J8QA 3TWCL 3K72A 1H3PL 4KKLC 1OZTG 3MLZL 4BFIA 1B0GA 1CE6A 1XGQB 1KY7A 4DKAA 1IEAB 2WZ5A 3K8KA 1XR8B 1KTDA 4DKEH 1PZ5A 1RIVL 5DFVD 1PBYA 2G9HB 4XBPA 1G9MH 3S37H 1G1OA 3V4LA 5JR1L 4MZ2A 3QUYB 2H47C 4ATWA 3TXAA 1BPLB 2MH4A 4AJWA 3MLTB 2G5UA 2H0PA 3ARDB 3JWDL 3U79A 3LSOB 3AAZA 2JQAA 4U6HA 5EN3A 4RMUA 4B7IA 4Y2LA 5HDQL 1Q90A 2G5BB 1A5FH 5TF1L 2CCLA 3FQWB 1JMZA 4NO0A 3V4VL 1NEZA 4XO8A 1AZBA 1HAUA 5FC9A 2K4AA 2BC4A 5C2UB 1WIOA 4MA7H 1J9RA 4FQXA 1FG2B 4RMSA 3WNPA 3WKYA 4Q6IA 3IE9A 3AU1A 4PD4K 2VGLM 2HFFA 4JVWA 1KEGL 3IN2A 4XNDA 3MUHL 1CFBA 2OJEA 4M43H 4HIEA 1SMDA 2CCVA 2L7JA 2UZYA 1MCOL 3TU6A 5F8RC 1SHWA 1E30A 4AKPA 2OMBA 2LE9A 5D1XE 3NIFF 1QHPA 4RLDA 3DOIA 2DQTH 3ARBB 1DFBH 4OZ4B 3P4OA 1GS6X 1UG9A 2XC8A 2ZG1A 3E6FB 3FB7B 1UEMA 4GH7B 5I1IH 3R18A 3PABA 5ENWB 5H37G 1T5WB 3Q06A 5D93B 2LU7A 2Q7AA 3CPLA 2IV9A 3FTWA 5AOIA 2VDPB 1MWAB 3PFUA 1RULH 3FOLA 4OQ1A 4WI7A 3X1EA 3T6VA 1I1FA 2PCPA 3RIAK 4HJGA 5ESAA 3T71A 4MS8C 2V37A 1T1XA 2Q8BL 3BGAA 2XIBA 4ZO9A 2WXLA 3QDMB 5FKPB 2VXSH 4GNKB 1FZMB 2KZWA 5C09B 3VXNA 3T4YB 2EC9T 3DO4A 5DZOA 3WIIH 3O9WD 4KO9A 5TPWH 3AS1A 2XQ0A 1RZGB 1IJNA 2I9LB 4JQVC 3NP3A 2DEXX 2BNUA 5B3SB 3UYPA 4LLDB 3DC0A 1TQVA 3FZUD 4MD5A 3J8F7 1W0YT 5G4OA 1BF2A 2ZOLA 5KS9B 1HCZA 4ZMPA 3MRMA 4GKSB 1J87A 4D9RD 3N1GC 1IILE 2OCFD 4PRHA 4IBZA 4CC0A 5TH2B 1UTDA 2WXGA 3KYKL 3CMOH 4H8WC 3KPSA 3ZRCC 4P2AA 3DJTA 1UD5A 3KWUA 2UWEB 4UM8A 4I0PC 4JK0D 1I9JH 3A4EA 3M45A 2H6PA 5CCKH 4LVOC 2VNCA 1HKFA 3VFRB 4X99B 3T3PB 4Q6YA 4ZTPH 3QI9B 4Y4HB 3U46B 1A9EB 3BP5B 5JHLL 2EJ1A 5FO9A 5HHPA 3JV5A 4Z1PA 3PREA 4RFOH 2HUEA 3ILDA 5HYSA 4HUVB 5C0NC 1RHFA 1XB6A 1ACYH 4K94C 1ZHBB 1BAGA 2XWJB 5IMOA 1U8MB 3AZUA 4DKEL 2JKIS 1NUGA 1G9ML 3S37L 2HJKA 2NNXA 3F7VB 1V8HA 2DQJH 2WLKA 2BHUA 5AALA 3X14A 4CA4A 2IBBA 4PLJC 3QPQC 1GOHA 1DBBL 3B7YA 2LU4A 5IHZA 4PMEA 4A38A 3FRPA 2XN9B 4LEOB 5FFOA 1SJXA 2NSMA 1A5FL 4M1CD 2QQKL 4JFSA 1LE9B 1QSFD 3SKOB 2ITEA 4GI8A 4JO8A 3E1F1 5KAQF 2XN0A 4YXLL 1VAHA 3P9LB 4WTQA 2EILB 2EVGA 2BVQB 1I8MB 3L4YA 2DLEA 3FTUA 4FXLA 4A7GA 5DUJA 3HR5A 1F1GA 1E8XA 2R59A 3A5VA 1XCTA 3K6NA 4MA7L 4OZFG 3NH7H 4QTHA 3FCTA 3VFMB 4C4UA 3BH4A 4HCFA 2BP8B 5I8EA 4HH9B 3NFSL 3GMOA 1QO3B 2FO1A 4PJBF 4NPKA 4C55A 4M43L 4JAMB 3DMMC 5KN5B 5BRZB 4IRSC 4P5SA 3O4OC 3VWKC 3S0PA 1T66D 1JD9A 3D4ZA 1JN6B 5CKAA 2AZUA 4H13C 1H9VA 2PO6D 1K6QH 1AQDA 1DFBL 4L3EE 4Z7VB 1U8HA 4Y4FC 2BSRB 1B0IA 1I1CA 4KJQD 4U31A 4GKLA 5KAQG 3FL7A 4XTRC 2X3BA 3RVUD 1MLCA 2WLMA 3SE8H 3QQXA 2EZ0D 1RULL 3D52A 3R1GL 1E27A 1A22B 1FCGA 3UZEA 3MV8B 2W88A 4AEFA 3KCWA 2HX8A 3RAJL 4YFEA 2DMCA 4TKWA 5JOPE 4Y88A 4GW5A 2Y2WA 3N91A 2VXSL 6PCYA 4TM9A 3EBIA 1NICA 3T3ME 4CSPA 2VITB 3PYCA 2AV7A 3GPSA 1VZGA 1DBML 3I9GH 1BWWA 3WIIL 4HDIA 3ZDYE 4EN2A 1CVRA 4GBXB 4QR7A 3GBNH 4X5LA 3FU3A 4ZMAT 1QBLH 3NEEA 4PJFB 3G6DL 3HN3A 4F7MA 3TT1H 1UEYA 3N40P 1HS6A 3ULSA 4C83B 2H3KA 3MNDA 3QA3A 5DWPA 1IBHA 3IYLW 4OZGF 2J8UB 3OZ9L 1ED3A 4U3HA 3VMOA 4ZTOH 4A68A 3VG9C 3MZTA 2FEDC 3AQZA 2GTWB 4C4KO 5GGVH 4WKXA 4OU3A 1FAIL 3I6GA 1A7BA 3MLYL 3N0AA 2GJ6B 1I9JL 4N2KA 3VRLF 5BV7L 3G6JB 5CCKL 4AGOA 4HIHB 3NFNB 2PP9A 3FO1A 4MHHG 5F6IC 3P0VH 1DQML 3CZFA 1A4JB 1R17A 4X6CA 1IFRA 2ITFA 1NSNH 4RFOL 4N68A 1FSKC 2YEZB 1LYQA 3BPNB 1ACYL 4NQTA 3E2HB 3OKNB 4N87A 4PJDF 5HGHA 3I84A 2X0VA 2IOIA 2IO5A 3QDJB 5DTFB 1BXXA 5F1NB 5JPNA 2JIXB 4N86A 5FOBB 1KTRL 1Y6KR 2VQ1B 1NWOA 2DL2A 2DQJL 3RKDC 3C08H 2ALWA 2KLTA 4PJGA 3V9CA 1WD8A 3EH2A 3W38A 5MP6L 5IT2H 3UPRA 3OB8A 1KOAA 2X2HA 3ZY7A 4PWKA 5L8KB 4DOHE 1M71A 1BYPA 2J5WA 3CUPA 3H0TA 4NKDA 2P5WA 2FIKA 3GZQA 3O9WA 1YQ2A 4DUXA 3EG9A 4YVUA 2HLFD 3PWPD 1PCSA 3N85H 2BCMA 2CR3A 2RQ8A 2BCKB 1J5OL 1D7FA 2B8OT 5DD6B 4J3OF 4YHIB 3SBQA 4F7PB 3NH7L 2XWTB 1T0PB 4HJTA 4UT6A 2HT4D 3S36X 4YLCA 2XBZA 1M1XA 1ANUA 2TSAA 3NCWA 4NRZA 4DN3L 5KSVA 2ESVB 2VDNH 5IF0A 5L2KE 3P4NB 4TQEH 2HKFH 3APDA 2EO7A 3KDPB 1QAWA 3C5SB 3R7QA 1I7ZA 5D2NE 2AQ1A 4A7TA 1U3HC 2QL1A 3QEHB 5IBLD 1Z1WA 5C0DB 3L2NA 3HNVL 4XNYH 1B4RA 5JW3L 1F97A 1E8ZA 4OFDA 4OJYA 5IEHA 4M93C 4LRIA 3RE0A 4X6CE 3V6ZA 3QAZC 3HE7B 4MCNA 4TUOB 1UD6A 4WWNA 3V0GA 2VJXA 2N0MA 4TSBL 1IAIH 2B14A 2ZD0A 3MJ9L 4FYQA 4KPHH 1Q4NX 1MZYA 4BH7B 3IMTA 4NNYB 1ND0A 2ZX5A 1GGBH 4J3OG 1MN4A 5KSUB 2CBPA 1D9KB 2Y7OA 3BZDA 5I6XB 2VN6A 3CHQA 2GIMA 2IVFC 3OR6B 3HEIB 1BZ8A 4V11A 3SOTA 4DP8X 5J8OA 1LWRA 2WN2A 5DJDA 1O7VA 4NDMB 3C2AH 1UKSA 2E6JA 5KANG 3MRBA 2O61A 4BZ1A 4FFTA 2VERA 5KVFE 2X38A 1OE1A 1R5IA 3I9GL 4F58L 2R2BB 1KBGH 1SQMA 3B37A 1OSPH 1G7JB 2QDWA 3GMRA 4DKFL 1E67A 3FSZA 4MJHA 1QSFA 4HFUH 2WBKA 3DNKA 4JDZA 4NQDB 1QBLL 2NUTB 4TNWK 2D0FA 4R84A 3IKKA 1Q0EA 2CGZA 5C0CE 1J05A 3QNYA 1I7UB 5GGUB 2XWBA 1AO7D 4OFIA 2VDMB 2PTTB 4N26A 4UILH 4HZ1A 5KYUA 4NUJB 3SE4C 4L9LB 4JVUA 5DJCB 5F7YC 2DMKA 4XBMA 1ZT7B 4R5XA 4N2CA 1KN4H 2BOLA 2NY6C 1X5XA 3O8XC 1AANA 2KMWA 4QF1B 1N8ZA 3S3JA 5SWSD 2APTA 2CKNA 2B59B 2XWXA 1QABA 4PGBB 1Z6JT 3L81A 2P7TB 2CU9A 1BQRA 1BMGA 3TBYA 1R1CA 5A2JH 1JZFA 1FG9C 4A37A 2PO6A 1B4JH 4HKZB 1OTTC 4O2FB 3EYFA 1NSNL 4MDIA 1PYWA 3TT3H 2RBLA 2NUPB 1NDGB 3QUMA 2NY1B 2YRBA 5DMKA 1T83A 3VB9A 1SBSH 5F8QC 4YVNA 4GEJA 3IGAB 4KZDH 4X83A 1JJUA 2H6UA 3ILQD 1DJGA 2WTRA 3TBVB 3VGAC 2YPVA 5CLYA 3FUNA 4W6XB 3BOVA 5HVFB 2JK5A 3ZIYA 1R3KA 1TQBB 3DRTA 1Q9LA 2MCG1 2OSYA 4U7MA 4PP1C 1G84A 1I85A 5KZCD 3LRGA 5IT2L 3F64A 3ERXA 4KGJA 1SMAA 5HHOD 2DQGL 3PJSB 5AUMB 4R7DB 3NQIA 4MMYB 3KH4A 3OQRA 1AOZA 4RNRA 2HMIC 1A6TB 3KYNA 1MJ8L 3G9VA 5BW7A 3OKEA 3LN5B 3NIGB 3N85L 4KZCA 2JB6B 4LCWD 4NO2A 4YZFE 1X5IA 4X9BA 2E76C 2F1AA 2BW5A 4K9JA 3T1FB 4NWTH 3NGBC 3QO0A 4V1DB 1BM7A 5IJKC 5KSBB 1CDBA 5CJXA 4G1MA 3V4VB 2VDNL 2Z6FA 4HWZB 4YDNA 4IIQC 3B5GA 2HKFL 5MEPA 1K4CB 4P4KB 1MY7A 3QNZA 1EAPA 4J27A 2A0LD 4FQIL 1YEDB 4XNYL 5IMLA 3NZ8A 4RWYL 1LLAA 1DSFH 3HC4H 4G9FB 1JV2A 3FH5A 4ZS6D 4KU1A 2GITB 1XGZA 4HZLB 1QX1A 2CO3A 2Z4QB 1EJOL 3L7FB 1GGBL 2X6VA 2QDVA 2BSTA 3CTTA 3KAAA 2ATPA 2GK0A 2NZ9C 1SBBA 1FYTE 4QHMB 3MZGB 1CXHA 5CLTA 1FYHB 3C2AL 3MUJA 3F62A 3VW3H 1XF5A 1XSJA 1QQDA 1SF3A 2IANE 3O3BA 2OULB 3KR3H 1I7TB 1NIDA 4FQCH 4YHKL 1X5LA 5H37A 1H0DB 5INDB 3A6BL 1P5VB 3VD9A 4Y7OC 1KBGL 2RCSL 3OGOE 5GGSB 1OSPL 4OI8A 4F5CE 4WWID 5EO9A 3AWFA 1GJWA 4AM0Q 4HFUL 1I8LC 3ZN6A 1G5AA 1A9VA 4ETQB 3PWPA 3MFGB 2COVD 1S8DB 1GGTA 2H1LM 4BUHA 1IGJB 2EIZA 4QUOA 4UILL 4F57H 1KJ3L 3TO4D 5DEJA 3EO1A 3A0OA 2V3FA 2Z0BA 3H6JA 1KN4L 5E2WH 5G2NA 3CIQA 4JLRB 4ZFFA 3OMZA 3Q2LA 3RUGF 3QIBD 3CZNA 3OAYH 4JG1H 3QWRD 4KROC 5AQ0A 5H94B 4QLRA 3U36A 1EO5A 4DF9A 3GSOA 2WNWA 2CIIB 2FBOJ 4FTVB 3C60B 2Z8RA 3HC0A 4L23A 5DJ6B 5D6DC 3ZDZF 4YSQA 4QDGA 3FQUA 1HDMA 1B4JL 1DVYA 2W91A 3CV5A 2AJZB 4PV8A 1CZ8L 4YSPA 5F9WB 3T9WA 4M9PA 2WBJC 2YUXA 1V3JA 1SBSL 4AQ1C 2PYED 2Y69B 4YK4B 3WJLA 4KDWA 4NUQA 2WOYA 5DD1H 1FNSH 3IDGB 3FRUB 2QZQA 2P45B 3JTTA 1PGRB 2J2ZA 3LKSA 3B2UD 3VMNA 2ZUXA 3KJ4B 5FYKU 3L08A 4ZTEA 2I07B 2ZAHA 2PR9A 1OL0A 2QADB 2YC1B 2OMNA 1XR9A 1O5DT 4J3VA 3FCSA 2UZIH 4J3OD 2RA1A 3UP6A 3QIWB 3HHSB 3UPAA 4QD2E 1TQTA 3ISRA 3V5HB 1BXVA 1LTXA 4F1SA 1S9XB 3TS8A 2VWEE 2W65A 4H8PA 4CBZA 3MV9E 2AGJH 4NWTL 3DHJA 3EF7A 4GS7B 4U1JB 3QQ9D 2BSBA 3G08B 1AO7A 3FTVA 4H88H 5TF0A 1JZ3A 5BS0E 3H9SD 2O6DA 2YRPA 2UX6A 3MR9B 3NIFE 5M94B 2W0KA 4NZJA 4R26H 3W2DH 4XI5D 5SWSA 1FZKA 2F6AA 2DS4A 1OCZB 2VR7A 1C08A 3D30A 3PQYE 3WGVB 4WV1A 5I1KH 4MB3A 3Q6GH 2GCYA 2HWZL 1QBBA 2P5EB 3HC4L 5BRPA 3OM3B 1A3QA 2E9IA 3KWXA 3KPQB 4WWOA 3ARGD 5MEND 3CXHJ 3VG0H 4OZFA 4BKLA 2DKSA 4FP8H 4B7LA 1DLHA 4OTXH 2NXZD 2F74B 4I18B 4HUMB 3EFFA 3MBED 3NTCH 1YSOA 1ZCRA 4KK6C 2YXVA 5IMMA 4ECNA 2R1WB 3VXRB 4JFOB 3OB0H 3VW3L 3FT0A 4W9IC 4CC1A 7FABH 2IH9A 1ETZB 1EXUB 1HCFX 2IBZX 3KR3L 3NP4A 3Q1SH 3VFSA 1DSWA 4ZD3H 1JWSB 4FQCL 4YHPB 2VZ3A 4FQHB 5EUOB 4U6YB 4MCZB 5HTSA 3TOPA 4PJ7F 2AEWA 4E2OA 4QRPD 5HHOA 1JPEA 1S7TB 1BQSA 4XMPH 4WNQA 5JO5A 2YD4A 2FSEB 1DO5A 2DI9A 4QRQB 1ZGLP 1ZPLA 1YEHH 5DVMA 3T4AA 4LCWA 3LEVH 4KXBA 3IJYB 4G1EA 4ATTA 4PJBA 4F57L 2IBGA 3GRWL 2ED9A 2OPCA 4X8JB 3GC3A 2DDQH 2ADIA 1CGWA 5IV2B 3PU7A 1P69B 1F4HA 4WK4B 1UM5H 3CH1A 4U33A 1NFDE 2GUOA 3EKCA 4JG1L 4AKOA 2IWGA 2XQBH 1P7HL 2R0KL 5IQOA 1XMEB 4D7BA 5BZDA 3DOSA 4J8RA 1KYUA 1BVNP 4IKNA 4JN2B 5AOMA 1C12B 4ONGL 3LNIA 1T80A 1DVFC 3U7WH 2JJUA 4KK5D 2XZQH 2VSKB 4OD3L 3AG3B 3JXAA 4DVBB 1U8LA 3GF8A 3MNWA 3KDMA 1F6FB 4ZO7A 3CX5K 2Z92A 5FGCB 1BVKA 4AQ8C 5BV7B 2XG5A 3KE0A 2FQGA 1HH6B 4ZUTB 5DD1L 1FNSL 3HUJE 2FHFA 1CF8H 4TULL 1I9IH 1U4FA 1E9QB 2J88H 1LP9A 3AS2A 4WY7L 3WDJA 4AIOA 4D7PA 2VH5L 1VADB 4FQQB 4OAWA 4JUSA 3RU8H 1WEJH 4NQSA 3JV0A 3T65B 2GT9B 2WWKO 1N4XH 4X7SH 1U92B 1EO8H 2OSWA 1ES0A 2VW6A 1FVDA 2ZKYA 3HG1D 3V4PB 1HSAA 1T7XA 4FL4C 2WP3O 5D4IA 2DWTA 1UC6A 2K78A 2W59A 3LKOA 4NRYB 4P23B 4LCWE 1JD7A 4AEHL 5IEKB 1MCJA 3MV7D 1JK9A 5AEAA 4WCYL 2OTWA 2NY0D 2CKBB 1FFPB 2GI0A 3VD4A 3BI9X 2CO2A 4H88L 3TO4A 1UACL 5JPMB 5D6CB 4I4WB 4W6WB 4P5KB 3VXPB 5GS0C 1XB8A 3JTSA 4R26L 3WKPA 1KB9J 4UQBA 1JGEA 3R06A 1FJ1B 1URLA 3W2DL 4AI7A 1P2CB 3QIBA 1BXUA 2CO6A 1OF2A 3O41A 3QWRA 1M6OB 5D2LB 1B6DA 1Q72H 1RZIB 4UDTB 3Q01A 1PDKB 3R0NA 4WNSA 1KBWA 2FDBP 4JFWA 1VZIA 4I9XA 4K55A 2VKXA 1LVEA 2A6KA 3OXSB 4FP8L 5AW0B 4OTXL 1I1AC 1MIMH 5KVFH 5HVGB 4FNPA 5E7FA 5AW4B 3NTCL 4QLWA 2LVCA 2PYEA 5KVEE 5KYXB 5F88A 4HS6B 4AC2A 1KCUH 4BFOA 1OV8A 2LAGB 3ZVVA 3RP1A 3H9HA 3DPBA 4W9JC 4WSJA 2OMUB 3A47A 4UT6H 2ZSWA 7FABL 2F53D 5KBKA 1T20B 3LNGA 3Q1SL 4XAWL 5EU7C 1WC7B 4ODXA 4TSAH 4PTTA 4PV9B 4FD0A 3TJHD 3VD5A 3B5HA 3MTRA 1ZLEA 3NG5A 5I71B 2W0PA 5DD0L 3OKYA 4A04A 4XMPL 3KHOA 5FUCC 2L04A 4OZGE 4EZKA 2AK4B 1C7TA 3HZMB 1E90A 1ZV2A 4TVPD 4LSQH 4M7ZB 4G83A 4JQIA 3GGWB 4YO0A 4XNXH 3G6AB 2Y5TB 3LDBC 5CUSL 1AJ7L 3LEVL 1MJUH 2C8NA 2DJSA 3P77A 1ZJAA 1UJTA 4HF5L 4GRLB 2WKOF 3FT2A 5CIPB 2VIRA 1OPOA 1MFMA 3QZWG 4C57C 4RSYA 1W91A 4HGWA 2DDQL 3BESR 3H9SA 1AR1B 1JGDA 1P7KB 4AQZA 5CSZA 1RK0B 5F0MB 3GUTA 3FQXB 3BT2H 3SKNA 3UTSE 8FABA 1UYWH 3ALXA 4KTYA 5GISH 4JL1A 1EGJL 5ERWA 5B1JC 3ET9F 3MLUH 3IMBA 5A2AA 4PJDE 3D0LB 4NIKB 2HLAB 2DWEA 2DMHA 1KTBA 4BZ1H 5EMYA 1PEZA 2XZQL 3ARGA 5MENA 4U6VL 1AKJB 3APNA 3BPOC 3L3GA 3RL2B 1ACXA 4Y5XB 3FO9A 5J12C 5CZKA 4G9DA 4PJXF 3MBEA 3N2JA 5CEXA 2J1ZA 2DM7A 2YWYA 3WL9B 1GA2A 3AS3A 3QJTB 2YA1A 3WTTA 2ICES 3RVTC 2PW2A 3EH3B 3B9VA 4BK8A 1Q94B 3PWLB 2PP8A 5D8JH 2FZ3B 1CF8L 4C8XA 5ID0A 2A5UA 2IQ9H 2CHZA 1DDHB 4QAMB 3PAZA 1K3ZA 4MAYD 3NRFA 3QCUH 5FR3A 3LRLA 5E6IB 5EIVA 1A4KB 3L3OA 1CIUA 3RU8L 4GKZB 2K1MA 1VEMA 1TCRB 2YAPA 1ZVYA 4X7SL 4P4RB 4Z7UA 3QUZB 4GAFB 4NO3B 4FLOA 3VFVB 2VERN 4FQ2L 4LVNB 3VGBA 1BQ5A 1M9WA 3QUHA 4KXZI 4QRPA 3HMWH 4KZEH 2V5SA 2CGRL 4P5TC 1X5KA 4XP4L 2V2TB 4KGLA 3UACA 5DR5L 4FNLH 2F54E 2PPEA 1OAKH 3AU0A 3QJRB 3TPUA 3QUMH 3ZSTA 2ROXA 3UDWA 1JS4A 4JHAL 2I24N 1DVQA 1S9WB 2EH7H 3L6FA 3W37A 5CHNB 1GCYA 3BC9A 4E68A 2YPVH 1VPOH 1XCXA 1HZKA 1KCSH 1P4IH 3WENA 3B3IB 1DBKH 1VFAB 1Q72L 4R7XA 4OJCA 4FQLH 2UY6A 3LD8B 4FG6D 3LAFA 5J11C 5MENE 4G8GD 3O4LB 2A4CA 5JYMA 5KVFL 3UYRH 1U8NB 1OHZA 2ZX6A 3PWUA 1QLRB 1SEQH 3CDZB 2ZXEB 1J0YA 3K6DA 1WFMA 3E6HA 4JR9H 2KC0A 1TXKA 2WSPA 4QXGH 1U58A 3OV6A 4UZUA 3BUYB 1GTNA 1KCUL 2FWLB 3H56A 3O6LH 2XOTA 2DWDA 3EDDA 2AQPA 4KV5E 2EEXA 3MOAH 4UT6L 2YQBA 3WY3A 4KKZA 5G4MA 4G7RB 3LZPA 3KLDA 4AIZB 3BKMH 3BUBA 4QRPE 3WO4B 1FH5L 3U0WH 4PRPD 3RILA 4OCWH 3NPSB 2APXA 3HG1A 1CYXA 1UJ3B 4QPEA 3UBHA 2OMYB 5D4HA 1CYWA 4HIJB 1E9OB 3TZVD 3D09A 3OL2A 2A77H 3RHWK 1JFHA 1MJUL 1KLFA 1C5BH 2UZXA 3MV7A 3VFPB 2XTSA 4GSDH 2H3NB 4BK5A 3N1MC 5AWNH 4A2LA 2NSQA 4FDWA 4WWPA 1HI6B 1UXWA 1X7SA 1ZK9A 1PKOA 1BQHA 1SEBA 2BIHA 4DETA 1EFXD 1FE8H 1NEUA 1O6VA 4PGDB 2IPKB 2FO4A 3HA0A 5FYJD 3AXLB 1OEZW 1UT2A 3FOMA 2C1PB 4XNMA 5GISL 5EEWA 5E2UH 5GPRA 4U6XA 1AQ8A 3IB4A 3W9DB 4RBPK 5JMRA 5I16B 2OXHA 4FADA 5IFHH 4BZ1L 1AD9A 2CWRA 5IIEB 3HRPA 3KWWB 3IDNB 3MRDB 5D7JC 2MQ0A 5H37H 3ZL4H 1XF3A 3OTTA 1XGRB 5HYFA 3FHEA 3PFQA 4M8RA 3OGCB 4P46B 1XAUA 1ZE3H 3O3AB 1RKRA 3I75A 1MY5A 4XGZB 4QRBA 1OGTA 1ZDQA 2OMVA 3EJSA 4YDIH 3RX5A 3D05A 3K3QA 2J5LB 3BZEA 3EFDL 5D8JL 1CVSC 1BBJA 1KDJA 2GUYA 3BW9B 4G6FD 1DQDL 1R3JB 4LPCA 5AW1B 3QCUL 1ZLDA 3NZHH 1OVZA 4LOUD 4NZ8A 2F53A 2G60L 4GO9A 3VFUB 2ZONA 3CFCH 4B3EA 4ZX5A 2KI6A 1MH5B 3ILEA 4E41E 5AD0B 2X1PA 3KYMB 5EZLB 1NGPH 3HMWL 1T1YA 3T6WA 4KZEL 3Q3GB 4UNIA 1BW8A 2JB5H 3VQ1C 1ZGLA 1DANU 5I26A 2Q8AL 3KBHE 1JRHH 4JCWA 1GR7A 2G2RA 4ONHA 5HD8D 4JFFE 4LLQA 3GXFA 5C08D 1HX0A 4FNLL 4IDJH 4LU5H 4MZRA 3QQDA 4X9FA 2EYTA 3QUML 5HGAA 5C0AD 1BZ9B 5CM1A 3DV6B 2EH7L 4GQPH 5DJXB 3ABMB 3JWNH 2YPVL 1VPOL 4NQXA 4KJYA 4JO4H 3HFMH 2V0AA 4Q2ZB 4HCRA 1P4IL 4DKDC 1DBKL 5D1XB 3IXTB 1B0GB 3DXAE 1A14H 4X6BA 2YD5A 4YSOA 4XCFH 2JCCB 1A4AA 2HRHA 2MCMA 1UB6A 3VH8G 3VCLA 1S7WB 3GJEA 4OF0A 3MLRH 4JM2F 5JIMA 4OLWH 2LTQB 1SEQL 1QYGH 2ID5A 4KTEH 4AKQA 1S5HA 1CICD 1T6WA 3I2CH 3SDYH 1O9WA 4JR9L 3TIDA 4QXGL 3D9AL 1AP2B 5I24A 5LWYL 1TTAA 3O6LL 5I1LB 1OB0A 3QFJE 1NUFA 2R29A 2VR3A 3TEXA 4NC2B 3GI8H 2OMWA 3P3RA 3MOAL 4LPWA 3EDFA 1FFQA 4KK8C 4MAYA 1ZA6A 2GHZA 4WGVB 4ZUVB 2WZPD 3KEHA 4BFGA 4YHLH 4LSRL 2X5PA 3FU8A 1ETJA 4YDZA 2J73A 4QJ4B 3BKML 1G9NC 3DTDA 1DHKA 5I8CA 5FGRA 1YO4A 3S2AA 1MUJA 3U0WL 2GY5A 2K4WA 2XG4B 3PWVA 5EBWB 4M8QA 3QIUC 1K8DB 1D5ZB 4FFWD 1HQ4B 5DK3A 1U41A 2HVKB 2A77L 4HK0B 4GG6F 4N0UE 1C5BL 3RUGE 1WHOA 3QPXH 4OZFH 2J25A 5F7NC 4OGYL 5AWNL 4FERA 4HBCH 4MJID 4IRJD 4NZUH 3TYGH 1TTUA 1N5YL 3VGHA 2WSDA 1PJWA 5CILH 5I9QB 1M57B 1AGCB 1JPSH 1MIEH 2K7QA 1FE8L 2LU3A 4N3TA 1G4MA 5FCUL 5GZOD 4J5VA 3C8KA 1KCRH 4KC3B 2RGSA 3ZR5A 4ZYKB 2V9TA 5E2UL 5FWQA 3K8MA 5DRWA 1IQDA 4Y2OA 4Z95H 1MCQA 5LGJB 4BCZA 5CP3A 1KPRB 3BAYA 1ZT4B 1P1VA 4CVXA 4JDTH 5I0XA 1ERNA 5GIRB 3F2LA 1EMTH 3A24A 4K5LA 4JG5A 3DIDA 4G8GA 3ZL4L 4NUGL 4UYPA 3AACA 3ELQA 3TNNA 3KPNB 5BXFA 1U8CA 1XXDC 1VSCA 4PHZA 4NQVA 4QHUA 5E7BA 1N64H 5DJ2B 3RWHA 1H3TA 4YDIL 2YJLA 1U8IA 4JZJC 3QORC 3ECVA 5CF3A 2BO0A 5CD3B 5CSGA 4PJ7A 4OJEH 3WO3B 3FFDA 1HHHA 4QYOA 1FUNA 3EYQD 5KVDE 1H3UA 4YFLF 1DZ0A 4ANWA 2DLGA 5GS2D 3FUDA 4P57B 1J11A 4AZ8B 3CFCL 3GIVB 4FLQA 4ORGA 1T1WB 3PXJA 4IMLA 4IDLA 2JJVA 2K8QA 4YBHA 1NGPL 4CW1A 1Q9KB 2V7NB 2X44D 4PRPA 4I1PA 1J0JA 5CEYB 3VGDA 2DYSB 5C0GA 1YVLA 2ADFH 3TZVA 5CBEA 4PLOB 1KTKE 5CN2A 3PV6B 4LU5L 5BO1H 2DKUA 1C1EH 3N06B 4KX9A 5ESVB 3LB6C 4UOZA 2FX8H 3V0EA 2MHAB 4AVJA 1GGIH 4UM8B 1CIDA 4BM7A 5GHWL 1P4BH 3MXVH 3CGTA 4X4XA 3KPMB 4JO4L 4RGMC 1EFXA 2YFNA 2E9JA 3HFML 4X7TA 5CP7B 5IOKA 1XD0A 1I1YB 2GY7B 3ETTA 4CVZB 1JNHB 3PG2A 5FO9B 1RVFL 3Q8AA 4L3EB 2CLRA 4M8UA 3S9DB 2GJPA 1A14L 4M4RB 2BS8A 2WQUA 5I74C 3SBPA 4NLHA 5HYSB 3T0BA 1YY8B 3QWOB 15C8H 2AJXL 5HGBA 3U48A 1BZEA 2BERA 3K4AA 5MI0C 2XJLA 3FN0L 4XC3H 4CUCA 4OLWL 3OJ2C 4WENB 1JVLA 1GAFH 3CDGB 4NPJA 3EJJX 1PG7W 5D1QB 1UM4H 4APQC 3OAUH 1XBRA 3SDYL 1A6UH 4JKWA 1IKNA 1Z9MA 2ZNWA 4XRCA 2X4NA 2Z9TA 3BAEL 2VRKA 4I2XA 5ICYB 1TKWB 3FHQA 4HOZA 3MUGB 5F7KC 1LGVA 3T3MB 1WA1X 3GI8L 3WMSA 2H8PB 4B0MM 1TDQA 2DM3A 4YHLL 4KMTH 4N9GB 4MYPA 2A38A 4JFYB 3ZDYB 3BSHA 3WAJA 1RHHA 1ZTXH 4FFZA 4LEBA 1UWXK 4KKBD 1IEBB 1IBBA 2DIAA 5B7MA 4FQPA 1XCTB 2EO1A 4L8DA 5AZ2H 5C70A 1WS7A 3JV4A 3DROA 3TEUA 2ENPA 4PGEB 5J0BA 3WE6B 5C08A 2NY2C 3VO0A 2R4RL 4LVHB 4I48A 4BQ8A 3DX4A 1A1OB 4BCXA 5I1DA 4NZUL 5TE4L 5C0AA 3UTZA 4OCMC 1Z9SA 3I6LE 1WYJA 3SPCA 3PPSA 1LILA 4Q0XH 3UOAB 4A67A 2GHWB 3EYVB 2OR9H 1UWGH 2ZUWA 5DJYA 3HPLA 5FO8B 1DQLL 1N26A 5EN2B 4X42A 2Y6TE 3ESNA 1T6BX 3ZW3A 4Z95L 2ZXBA 1J7VR 3GSRA 4AWJC 4ZPVA 1UCBL 2EKSA 3KH3A 1KV3A 3L95A 1TT6A 1IT9L 4JDTL 4MSWB 1BVNT 4CGTA 3SE3C 4LCCC 4DGVH 4MA1C 2IDFA 1C16B 2V5MA 2KS0A 4HKXB 4JRXE 4XB7A 3G5VA 2HT2D 4XC1L 2WNKA 4WLCA 1Z2KA 3S37X 4J3OH 4DP6X 5FPIA 3QDGA 3KWTA 4GAJH 2WIMA 1CICA 1N64L 2W38A 4JQIH 5J13C 2D7OA 1F4AA 1M2VA 3RIFK 3MGOA 1F4WH 3MRIA 4ZODA 4K3HA 5CCJA 1CS6A 2B1AL 1VHPA 2H1PH 1A6AA 3LQZA 4GQQA 2FJSA 4OCSH 5KBPA 4W9LC 5IWLC 5AB0A 2D2CC 3KPPA 1S4IA 4UDUA 1SDYA 4TRPH 4KK9C 4DOHB 3IDXL 2WZPA 2PYFA 3QWQB 5DJ0B 4JPVH 4OH2A 3MCLH 4RAHA 1RUPH 3BEVA 4FYRA</