1N12A

Crystal structure of the pape (n-terminal-deleted) pilus subunit bound to a peptide corresponding to the n-terminal extension of the papk pilus subunit (residues 1-11) from uropathogenic e. coli
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
138
structure length
138
Chain Sequence
VPACTVSNTTVDWQDVEIQTLSQNGNHEKEFTVNMRCPYNLGTMKVTITATNTYNNAILVQNTSNTSSDGLLVYLYNSNAGNIGTAITLGTPFTPGKITGNNADKTISLHAKLGYKGNMQNLIAGPFSATATLVASYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mature Fimbrial protein PapE
publication title Chaperone priming of pilus subunits facilitates a topological transition that drives fiber formation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 22
structure length 138
sequence length 138
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1n12A00
4X5RA 4XOAA 3ZL1A 4XOCA 2JTYA 4CSTA 3BFWA 3ZPDA 5IQMA 1KLFB 5FLUA 4J3OG 5FS5A 3ME0B 3ZL2A 5IQOA 2UY6B 4X5QA 2XG5B 4AVJA 1N12A 2XG4B 5FX3A 4J3OH 2W07B 5JQIB 4X5PA 1PDKB 1QUNB 3BWUF 4CSSA 2JMRA 4XOBA 5F3FA 5IQNA 4XO9A 4AUUA 5AB1A 3BFQG 1TR7A 3SQBB 4AUJA 5ABZA 4J3OF 5CGBA 4AVHA 5AAPA 3JWNG 5LNEA 2VCOA 4CA4A 3RFZA 2J2ZB 4XO8A 4AVKA 1N0LB 4AV0A 3JWNH 5AALA 1ZE3H 4XOEA 2UY7B 5FWRA 1KIUB 4X50A 1UWFA 2WMPB 3MCYA 5F2FA 4XODA 4BUQA 4AV5A 4LOVA 3JWNE 4AVIA 5LNGA 4AUYA 4ATTA 4AV4A
chains in the Genus database with same CATH superfamily
3HI5L 2C1OB 3X12B 1EO8H 2NY2C 2IDSA 2XWTA 2BCKB 2F15A 4HCFA 1KEMH 3DPDA 1XGRA 3NPSC 1SOXA 3QXAA 5DGQA 3US9A 1F4WH 3OXSB 2VSMB 3F5WB 5I6NA 1HCYA 1A6WL 1U30A 2PWHA 5TH2A 2K4WA 1IC5H 4HIEA 4QRPA 3PDDA 1EK3A 3MNDA 5IB3B 1LILA 4OR1A 1QATA 2DQUH 1CXLA 1BZOA 4MJIE 1NC2B 2G2NA 2ZUQC 3WTYA 3ULUL 3BZFB 3VACA 4M4RA 3FQRA 5BVPL 2YZ8A 1MSPA 2V5YA 3QUKA 3LNDA 4XBGB 2VIRB 2VAAB 2F61A 4YNYB 3BE1L 4WUKL 3MRGB 1X5GA 1OIOA 3WEXA 2AANA 3MRLB 3ZE1E 3BQUA 5IESH 5C9JA 4XO9A 2VDNL 1FNFA 1JWUA 2Y36L 3UERA 3ARSA 5BXFB 4FQ1H 3LKPB 1Q9LA 1XBDA 1QR1A 3F7RA 4JRYE 5D1ZD 3OJDA 4LGSB 1SDDA 3CZUB 4N0UB 5G4OA 4J39A 3W0WA 3H42L 4DPBX 1HSAA 3MRFA 3BPNB 1BLIA 4X6BA 5DMGD 5FR3A 4JKNA 3L2MA 3T4YB 4ODTL 2EKSA 2W9DH 4YDJA 9CGTA 3HE7C 4XHJC 4V1DB 4HU2A 4E41E 1G9NC 4JLRB 1KPUA 1OCWL 3T3MF 1OSPL 1B0GB 2Z0BA 5IBUG 1QTSA 4P9HC 1T89A 1PS3A 3S36L 4AIZA 1F58L 3LXAA 4JFXB 1FYTE 2NY4C 4K9EL 3RU8H 3TBYA 1XF2B 5J11C 2XV3A 1EMTH 5D2NB 4LPTA 3KGRA 5FCUH 4DO5A 1PG7L 1E4JA 2NPLX 2APWA 3Q1SL 1G7QB 5E8DH 5IBLD 1ED3A 3OKLB 1GIGL 3PIQB 1MRCL 1RZGA 4WENB 4HH8A 3VG9C 4YDIL 2WP3O 4QXTB 1I3RB 2VW4A 3T1FA 1TNMA 3FUNA 5CJBA 4P46B 1NGYA 1JTOA 3K5RA 4PRPE 4URTB 3RDTA 5KSVA 2ALAA 4KK8D 4U1IB 1EHXA 3MRNA 5CEXA 1UXSA 4YZWA 1OALA 1T5XA 5ANME 4HPOH 1EEZA 4E9XA 3BAIA 3K46A 2BC4A 2JV6A 4H2AA 2HCZX 5ESVA 3PWPB 3VXME 1YN7B 1WTLA 4UV7L 4PREB 2BNQA 4LMQI 1OGAB 4G8IB 4WTWA 5HDOA 1NGQH 4YGVA 1QTYT 5E2TL 3ZDYE 1D5ZA 5HHQB 4C4KT 2DQIL 4FQCH 2X05A 2H9GB 4OZHB 1U93B 1LP9A 1BOGA 4N0CC 2YIHA 3U4BH 4PS8A 5FF6A 4WW1A 3T2LA 1GJWA 3OAWA 3CTTA 7FABL 3EFFA 2UZPA 3KNBB 2VMDA 5IB5B 3WKPA 5HYFA 4QRPE 3ZL2A 3RZCD 1PZSA 2D2OA 4F7MA 4G3YL 4MMXB 2ZNXA 4G5ZL 4F8OA 5JW5B 1DJIA 2DQHL 3L13A 4I1PA 1UB6A 1F42A 2R51A 2VUYA 3PHSA 4YHLL 5BZWA 5KTEL 5F9AC 3DX7B 3PS6A 4U3SB 2NXZB 1NEUA 3MROB 2XTJE 5F96H 1BD2E 4HX1A 4PJGF 5LGHH 2VRQA 2VXUL 1FIGH 2QSCL 1FVCA 2C7UB 3SBQA 3WLBB 1UACH 5BS0E 3DARA 1PMYA 4E9QA 1J8KA 1VFUA 1D5BA 1D5IL 1SXBA 3LKRA 3KLKA 5L2KB 4MGXA 2VLKB 4LL9A 1UZ8A 4JVPA 1G4RA 4TQ8A 2QVIA 1H15A 5GQBA 4B7LA 3FT3A 4LPUA 4W9JC 3W0WE 4AM0Q 2VMFA 5IROA 4LCIH 3ZZLA 1NCOA 1XTLA 1GAFH 5E2UL 4J12A 2ZG2A 1MCHA 4S2SA 4QHNB 5ADOH 3GIVA 3AG3B 1DBBL 1LO5A 5CUSL 1OAYL 3HI6H 3FMGH 4M1DL 3EO9H 4G7QB 4LCWD 4M5YH 4XPGH 4YS4A 1I1AA 3KPSB 3F6LA 4J3BA 1N64H 3DOHA 3CBKB 5D4HA 2OS7A 1HHJA 2AJVL 1EO5A 1ZLSH 2NY5C 1KYAA 4MFHA 4XPHL 4G8GA 4WSKA 3K6SA 4YXHH 4ZAKD 1SEQL 2C9AA 4YSEA 3VXSE 1ZDQA 2XWJA 3B9KD 4H7VA 5MENB 4RMWA 5H2BB 2HT4D 5GZOD 1J5IA 4MJ4A 2ZPKH 1FO0B 1JPTH 3LN5A 4HCRH 2NDGA 3BH8B 1FGNL 2LE9A 3DETC 4DP1X 3HG0A 5AVWB 3N1PC 2WVVA 2H3XC 4FOMA 2X2HA 4KNUA 1ECYA 5EEZA 1E2WA 2C1OA 1U8JB 3X12A 1KEGL 2BNQE 5D8JH 2BCKA 1Z9NA 1ZV2A 3UIYA 2FX9H 2LHAA 4L1BA 4FQQB 3OXSA 3F5WA 1HQ4B 5DJ0B 4ADJA 1GYVA 5ACMA 4RSVA 2K3HA 3MRRB 3RJDA 4CDHA 3K6IA 4X5RA 4GRWF 1SBSH 3OPZL 4G9DB 3F01A 4OLUH 3KPPB 4ES9A 1GTFA 5IB3A 5TQ2H 1MI5B 3N42F 5CS7A 5T3XL 4BXVA 4DCQB 1NC2A 3BJ91 1HZKA 4JFHD 2H7WA 2GI0A 2IH9A 2QR0B 3RUGB 1ZT4B 2Z65C 3BZFA 1V3KA 3VRJB 5F3BB 3P4LA 4U1NB 1S7VB 4M62H 1OHZA 4FFTA 4KV5E 4ONGH 4XBGA 2VIRA 2VAAA 4RFOL 2XQ0A 2IOIA 3NJVA 1MN4A 1Y7VA 4LT7A 4YNYA 3MRGA 1W80A 2X1XR 3IFPB 3MRLA 3VGGA 4FQLH 1JNLH 2BZCA 2FATL 1MAJA 4X9IA 2CNYA 1UM6H 3FKUS 4Y1TA 2VLRB 3D34A 3LKPA 4DQOH 5BXFA 1MFUA 2IFFH 4I3SH 5L7XL 1G5GA 2XYBA 4J2XA 1QRND 1PD0A 4XCEB 1F90H 4N0UA 3L5XH 3LNIA 3MR9B 1MRDH 4IKJA 3V4VB 2GT9B 5TPWL 2AFNA 3T4YA 1NSNH 5I1IL 4R5VA 4V1DA 2HN7B 4JLRA 1B0GA 2Y7LA 4OFIA 4QXGL 4RNRB 3FUEA 5T8IA 1PZ5B 2VSDA 3BQUC 5D71H 4JFXA 1F2QA 1KMGA 2IH8A 1CD8A 1XF2A 2ZOUA 1UEMA 3K91A 2YBRB 5D2NA 3ULAB 2E7DA 5B3SB 1T3FB 3BSZA 1G7QA 2XCMC 3PJSB 1V10A 3PIQA 2ZWLT 1F8TH 1MJ7L 4QXTA 1I3RA 1JHLH 2DI8A 2PUQT 4P46A 4GXVH 5E5LA 4G8GE 3H3PL 4HEME 4U1IA 5B1CA 1RERA 1A1MB 5TDOB 1QO3B 5KSAC 3PDOB 4TUUA 4IGBD 5KYWB 4YSOA 5CXPA 1NIFA 2YPKB 3AS1A 1BJMA 1T89C 2VDNB 3PWPA 1YN7A 3L3GB 4L0YA 4PREA 1KIUB 3U82B 5IBUB 1OGAA 2Y7OA 1NCAL 4G8IA 2WNGA 1BPVA 1THCA 4ALAL 4JO4H 4Y7MA 2P8LB 4PJHF 1G1YA 5HHQA 3S88L 1A47A 4M6NH 2H9GA 4OZHA 1U93A 2I60H 4H8PA 1KYOJ 1TPXB 3MLWL 1SMDA 5C0DB 1S78C 2OJZH 4K9JA 1KLGB 1S9XB 1JZFA 3ESVF 3OAYK 4LXFA 2C4FU 3RDTC 3KNBA 3NSFA 5IB5A 2DOCA 5FEBA 1GMEA 2OK0L 4IHOB 4KJYB 5CGTA 4MMXA 5JW5A 3B2DC 4WSJA 4NQTA 4AG4H 2TSBA 5L8JB 3NVQA 3H54A 3VRIB 3S97C 4DGIH 2DIJA 2XWCA 5AZ2H 1G9NH 1AE6L 3DX7A 4OTXL 2FEDD 3G08A 4U3SA 3MROA 5AOIA 3MV01 4P9HH 2MOQA 3TTYA 3W81A 1WT5C 1QWHA 3I3EA 2FO1A 5AW7B 2C7UA 3WLBA 3BYTA 3DNKA 3LPFA 3UADA 3HMWL 5FX3A 4ZX5A 3RE0A 2YA0A 3GI9L 3FB8B 3ARBD 5L2KA 1RZFL 5B3NA 3P3SA 3QZWB 3VGHA 2VLKA 1DFXA 4E9WA 4KAQL 3O2VL 4N0UE 4PB0H 4JFDD 2IQAB 3ARTA 4MD4B 2LV4A 4KDTA 5FYKH 4P2CG 3QUXB 3SGJA 3SO5A 1BYNA 2E9GA 4QHNA 3BDXA 2C9VA 4J1UB 5IBTL 4GSUA 1SBBA 1Q0XH 4L29B 3KPSA 5C8JB 4L3FA 4PFEA 4I18B 3HFFA 3FHQA 4KTEH 3BRGC 4Z77B 3QR2A 1GJIA 3BOVA 4XNYL 1K6QL 1KBBA 5D2NE 3W5MA 3MXVH 1AP2B 1F18A 4X8CA 3T0XA 1TQBC 1Z0NA 4G59C 3WXWH 1INEL 1JZJA 2YRLA 3VX1A 1IQDB 1JXGA 4AQZA 5MENA 5H2BA 1G0DA 1LWHA 3FZUD 4JO8A 1FO0A 4IBSA 1A7NH 3BH8A 4H13C 3ZJAA 4F37F 1MCOL 1OAQL 2AEQL 3CFCH 2C7FA 4ODXB 4ZMAT 4EXPX 3PWPE 3GSXB 1U8JA 3ISWA 1HYRC 4XC3H 3UTTD 4WV1C 2WXKA 2W0FA 4KI5C 4MA8H 2J5WA 1MREH 4GQ9H 4QTIH 1MJ8L 2O26U 3B7SA 2R69L 4YWGL 4FQQA 1HQ4A 5DJ0A 4OZHE 1DQTA 4HBQA 4LCCB 1U8QB 2IDQA 3MRRA 4X9YA 4A7GF 4DP7X 4EUPG 2EXYC 4U1LB 2KDYA 2IBGA 1KCRH 4FX5A 3KPPA 4G6KH 3OM3B 1AR2A 4G9DA 4H5SB 4N8VG 5KG9B 4ZXBD 1MI5A 2EDMA 4DCQA 3HMXA 4M3HA 4HZ1A 1CLOH 4PSRA 1FA4A 2MPAH 3RUGA 1OVZA 2QR0A 4X5LA 3VRJA 1TCMA 1ZT4A 1AIZA 2CUAA 1BEXA 1MCSA 1XB3A 4LLDB 4U1NA 1S7VA 1SPDA 4RX4A 1O0VA 2QPFA 4FMFA 4TPRL 4WO0A 4EN3C 2WQVA 5JYLA 1UOVA 2CJUL 3DV6B 4UNVA 2HAZA 3CHSA 2BP3A 5KVEE 1TT6A 2YN3A 1KLFB 1RZPA 3IFPA 4WU7B 5F7FA 3CE1A 2A6DB 2ZSWB 2P5EB 4ES8A 2AHIA 2VLRA 1F0LA 3GBDA 2UWEF 1N12A 5AB2A 1M2OA 1ULVA 3QIUB 3L5HA 4NBYB 3JT2A 4LKXB 4RFNB 3VFGL 4XCEA 1BAFH 3ZKND 2WD0A 1SLWA 1LQSR 2NY5H 3MR9A 2DQMA 1B4LA 1EH9A 3QJXA 4U4IA 2GT9A 1YNKH 5E4IA 3V4VA 5L2KE 2O93L 2BOBB 2X4NB 4EOWL 1FFRA 5HHMD 2VLKE 4G7VL 3LXUX 2BIQA 1BEYH 4GMTH 2C3WA 4OAWB 5IMMB 2HN7A 4G70B 1ACXA 4YE0A 3UBXG 3FPXA 2PYEB 1LEIB 4XMPL 4RNRA 2BSSB 1PZ5A 1MFAH 3BFQG 5C6PB 1NFDF 3JTSB 1TZOA 1Z9PA 3T2NL 3VGDA 3X17A 4ADIA 1LO3H 1GY1A 1I75A 2YBRA 1GHFL 3KPSE 1T3FA 5CFAA 1U8IB 2NT0A 3PJSA 1ZLUH 5D7SL 2XV2A 3BPNC 3OGOE 4DPRA 5FHAL 1IEBB 3HN5A 4JPKH 5BZZA 5TDOA 5KYWA 1A1MA 1QO3A 3PDOA 2Z4TA 1ZK9A 3O3EB 1IC7H 1CK0H 3BKYL 5E6RB 2YPKA 4UQ3B 1B88A 4AKPA 4HD9A 4B9KC 4R90L 1K8DB 2F0CA 5H4YA 3MYZA 3R19A 3L3GA 1F5WA 1G43A 1KIUA 1C5BL 1E30A 1ERNA 3RA7L 3TLRA 2IPUK 2P8LA 1O5DT 4NM8L 5D2NC 1PLAA 4R8WH 1G9MC 1XGPB 1TSRA 5TE6L 4ZBJA 1QWUA 1ZEAL 3QO0B 4UBDC 5AYUH 1B0WA 3TPUB 2GBTA 3DO3A 5C0DA 5C0CD 1JF5A 5IKCB 4NX0A 3HZKB 5EORH 1KLGA 3KW7A 4M7LT 1S9XA 5HPMB 4Y9EA 2ZX9A 3CFTA 1CI5A 3D50A 4YBQD 1QBBA 1AMXA 3IJYB 3R7QA 3LS5H 4K73A 1Z2KA 4IHOA 4KJYA 5KBNC 1MI5E 3ZQWA 4BRVA 3IJEB 1T2JA 3BSHA 3VRIA 2CLZB 4KXBA 3RUGE 3L3KB 1TTFA 1ZJBA 2BY2A 2ZXBA 3TWCH 5I8OH 1EEYB 5D4IA 5AVZB 4ZW5A 1Y6KR 1YYCA 4QKTA 1CFVH 2WLYA 4JZNB 5E6SB 4AJVA 1ZANL 2QFPA 5ISZD 4OIFA 3TA3D 3FB8A 2O5XH 2VLRE 1PF3A 1RIHH 2GTZB 4C59B 2CUHA 2WZPA 2D8KA 3QZWA 2NDFA 1VIWA 4IBQA 4MMXC 4QF1B 3PHAA 3V4UH 2IQAA 3UP1A 4EMZA 2W07B 4MD4A 5D2LB 1UYWL 1U6AL 5GGSB 1IGIL 3CX5K 2PKDA 1IX2A 3QUXA 4PJCF 2BP0B 1VF5C 3WGUB 4HULB 5C0NC 4J1UA 2EO7A 1P6FA 4NQED 4YDVB 3E8VA 4L29A 5HI3D 2VMEA 3SKOB 5C8JA 4I18A 2Q3XA 4GSRA 1HH6B 1MWAL 4Z77A 1WO2A 1QNIA 2QQLH 3TL5A 4JPQA 4Y2DD 3W57A 4NQCB 1BXVA 4ZYKB 3O6KH 4N2LA 3FQ4A 1AP2A 2E6JA 2DD8L 2A6KB 3L95B 4ZDHB 4K2UH 3ULUE 2O5ZH 1TVHB 5IWLA 1YEFL 2OMZB 2XWRA 2C3XA 4KDTC 1IQDA 4V2CB 4XAKE 1W8OA 3TO4D 4K8RC 4W9IC 5EEVA 1OTUD 2VWEE 4TKWA 4K0OA 5K9QI 2QPDB 5A40E 2W80C 4B41A 2C9UA 2J2ZB 4RGOH 4ODXA 4N26A 4E9YA 1AYRA 1RK0B 1NLBL 4WK0B 4YJZL 1IC4L 3GSXA 5D7KD 2B59B 4R0LB 4OB5H 1MCEA 4Z7QB 3B2VH 5CIPB 1Q0YH 1P9MA 3BGFB 4I9XA 2DQ6A 4LCCA 1U8QA 1ZT1B 4PEEA 4U1LA 4H5SA 4JB9H 4H8HA 5KG9A 4N5UA 3G7TA 1J9TA 1HILB 3QEUB 3GS0A 2APFA 5GGRY 5B7MA 1JPEA 5DUML 3U4AA 1YZZA 4NQQA 5J1SC 3OF6A 4LLDA 1N18A 3NP4A 1JZGA 4IRSC 2JJUA 3DV6A 3B43A 4JRFA 1NL0L 3VWJB 4AC2A 1KLFA 1U41A 2V2WB 1XR8B 4WU7A 4DEPC 2X4UB 4CAGA 2A6DA 2ZSWA 1IAIH 2P5EA 3LNFA 3NCYS 4OLZH 4YH6A 5B39G 2AERT 3ZE1F 3DSNB 4JFWA 1D7BA 3EF4A 2XVLA 2EILB 2NTFB 2YAOA 4D3CL 3QIUA 3DKHA 4LKXA 4TLSA 3FDWA 4XPAH 5E8PB 5E7FA 1VEPA 2QKSA 3H3KA 2F1EA 3AADB 4E68A 2BOBA 2X4NA 2VZUA 1AO7B 1XCTB 2H41A 1PX8A 2P8PB 4PWFA 5EULV 3X3GH 1T7WA 3QCTH 1AIFB 4OAWA 5IMMA 3EO0B 1MCIA 2OZ4H 3BW9B 4DKDC 4JZJB 2PYEA 4L0PB 2VTFA 2GPZA 1LEIA 1FE8H 5GGQH 4HIXH 1VRSA 2BSSA 1I8KB 2ICES 4FTVB 2NX5D 1QBAA 3V2AR 1CPUA 2WK2A 3JTSA 3T4AB 1NCHA 3QXDB 1R75A 1SJXA 1IBBA 1RI8A 1USZA 4NERA 1U8IA 4PCKA 1EA9C 3E7JA 4U3HA 3EYUL 1X5MA 5ABAA 1E8ZA 4Z6AT 5BMFH 2Y7MA 3QNZB 3FU9A 3JWOL 5HDBF 4FFVD 3GC3A 3K0YA 3LEYL 3C6SB 1R3JB 4J3OF 1IEBA 1MPAH 5SV3A 4W70A 4OCNC 1OQOA 3K80A 2I32A 4IBVA 3O3EA 5FPIA 1J8HD 4UQ3A 5F0LB 1K8DA 4AQEB 4WI7A 5IMLB 1R5VB 1CGSH 1D9KD 4Z78B 2V37A 1GSKA 4H40A 2YPLD 3QC5X 2BM3A 4C57C 1FNGB 1NMAH 1HSBB 1XGPA 1YMMB 2B3IA 2BH0A 4AVKA 2VUKA 3ZDYF 5CD3B 5IVNA 3GD1C 4LHUG 3U9UB 3ULUC 1EBPA 3K8KA 3L5WB 3N06B 3NK4A 3QO0A 3TN0D 4JM2C 3TPUA 1J5CA 3CHRA 4H44C 4P3CH 5DI8B 3HZKA 5IKCA 2FSDA 4WHYH 3A67H 2P49B 5HPMA 1L6XA 2KLRA 2YWZA 2AEOA 4OI9A 4CJ1A 1IM9B 2X4TB 1U8NB 1PTZA 2KDGA 3IJYA 3LD8B 2DV6A 5CEZD 4ZJ9A 4GY4A 1CN4A 2VDLL 4YDNA 3IJEA 5I1EL 3L4VA 2D7TL 4I7ZC 1E9OB 2CLZA 3L3KA 4G11A 4HQQL 3HNSL 1JDCA 4Z3GA 3IMWA 5G4NA 1I3GH 4LIQL 3FSVA 2AXFB 2BHUA 1EEYA 2BWIA 2N0KA 3BEWB 3F12B 2FTAA 5D6CB 5B4MD 4M5ZH 1TPXC 1E4KA 4MAUH 3UJJH 4AUYA 4JZNA 5I66B 1IBDA 3Q9QA 1ASPA 3QWRA 2WW8A 4KITB 1JIBA 5AG8A 1BF8A 2P5EE 1CFBA 1E5CA 1JN6B 4S1QH 2GTZA 4XOCA 4Z76B 1SMAA 2XDHA 5F9JB 5T33H 5J6GB 3KYKH 5D70L 1UGKA 4XVOA 4XP4L 5FLUA 5BUPA 4IIZA 4NZRH 4QF1A 5JXEA 5E24E 4F2FA 2CPCA 1E9QB 2OSLB 5F7YC 2R15A 3SYAA 2W07A 5D2LA 3KL0A 3QGVA 5GGSA 5GS0D 2BP0A 3V0WL 4OW6A 1ZLVH 4XP6H 3FYEB 1C7TA 5BZDB 5HVHC 3RVWC 4I0PB 1KCKA 2ERJB 1DTUA 2PYEE 4YDVA 3SGKC 3ETSA 1FRGL 3IGFA 3ATEA 2AS5M 4PRBB 3SKOA 2GCYB 3C5ZD 2AJZB 4QTHB 1HH6A 3FUKA 1U3HB 2H2SC 4G1EB 2FBJL 4NQCA 4ZYKA 2VT0A 5T3XE 2BVTA 4OGAD 2D73A 3IWVA 1T83C 2XWZA 2A6KA 4U49A 3L95A 2BJMH 2D9QB 4L2YA 4ZDHA 3UP6A 5MHSE 1TVHA 4ONFL 2OMZA 2F8XC 3KJ4C 4GAJH 1CC3A 5HYSG 1D7FA 3UTPE 4AEHH 3ZO9A 3ZDZB 4D9QE 3MRPB 4H1LH 4BFGA 4TVPD 5F0JB 5HJDA 3M88A 3WS6A 4EZLA 3HJEA 5ESAB 5DZOA 1CE6B 2J2ZA 4E0RB 4Y2LA 2YK1H 3NJLA 3CAFA 1RK0A 1BYOA 3H53A 4I18C 3V4LA 5J1AB 2B59A 4NWUL 4R0LA 2DM2A 5CIPA 5AB0A 3KH4A 3RY6C 4B97A 3UZVB 1FH5H 3SDAB 1AD9B 1ZT1A 4TNVF 1ND0B 3GYRA 5C0BB 3LEVL 3FO9B 4KHXH 2N4IA 3QT2A 4KKCC 4YHMH 3WY3A 4PGZA 1HILA 3KXFB 3QEUA 3VI4B 3H9YA 4PS3A 4E9TA 4MXVF 1IKNC 3RAJH 3Q5TA 4Q0XH 2WVUA 3BZDA 5JQHC 5ETUB 4FEIA 4GS7B 3C5XA 5E8NB 5KJRH 4DVRL 3ARDB 4FLSA 1MWAB 1CIDA 4ZFZB 1BPLB 3CSYB 4KV5F 3VWJA 4LSQH 3MNZB 1A7QL 4OCRH 2OZNA 4NN7B 2V2WA 1XR8A 2IJ0C 5CN2A 2X4UA 1U8LB 4HIJB 3RNKB 4B7IA 2X09A 2X87A 3ATDA 1KPRB 2ZUXA 3DSNA 1N70A 3IBOA 3EXLA 4AMKH 2NTFA 4ZMLA 1VESA 2X89D 5E8PA 2E27H 3ABKB 3FUIA 5DUPL 4I87A 4ZMXA 3N3EA 1WIPA 1AO7A 1XCTA 4IKNA 2P8PA 5J56B 1IKFH 1J1PH 5TE7H 3MCLL 4K8RH 1AIFA 2HLFC 3EO0A 3GUFA 3BW9A 1KYFA 3BUBA 1ONQB 3P30H 4JZJA 1MXGA 3H7LA 5K1JA 2NY6D 1PIFA 1OGPA 4PD4K 4PLJD 2R69A 5L6YL 1BW8A 4PJ8B 1I8KA 3LAFA 4FTVA 5CU9A 2YZ1A 5CGYD 3T4AA 1P7KB 4NO3B 3QXDA 2XC8A 4JKLA 1NEPA 3K4DA 4RFNC 3UO1L 3L1OL 3MLSH 5CJ5A 4KMLB 1UADC 3IMVA 3QNZA 3NQIA 4N8PA 35C8L 1IZKA 3MV8B 3QS3A 5L9DH 4F5CE 1ZTMA 2AJUH 2EDQA 3C6SA 1B4JL 1R3JA 2WSKA 4C47A 3KWWB 3CN4A 4M7LH 2EVHA 1PAMA 1V7MH 3BH4A 1DSYA 1EIBA 4RGNB 4G7YL 5GSRB 5C07E 1VAHA 3GK8H 1FLRH 4X80H 2WO2B 3MLVH 3WNKA 4JY4B 4AQEA 2GBAA 5IMLA 1NKOA 1R5VA 4JCMA 4Z78A 2BXZA 2RA1A 2ZG3A 4Z7UF 1K72A 3U6XS 1RZKL 1FNGA 1YMMA 1HSBA 5B8CB 3QAQA 2Q2LA 3WS3B 3ZQ9A 5CD3A 1N7MH 3U9UA 2X0VA 4FQXD 3QCUH 3AT0A 2GSMB 3CXHK 3L5WA 3NCJL 1FUNA 4N2NA 4U6HB 4Z7QE 1KELL 5DI8A 4JFYB 3OC5A 2WLMA 2DRUA 3O8XD 5D93B 5GHWH 4LSVL 1IM9A 2X4TA 3GS7A 1U8NA 3HMXH 3O0RH 4ENZA 1O7SA 3JWDH 4IS6B 5E9NA 3SD2A 3BUYB 2EDLA 4YEEA 2V17H 4PH8A 4CBZA 2J7LA 5K1VA 1E9OA 2H1XA 1LE5B 4G6AD 1UA3A 3KAAA 2VSCA 1BQHB 2EDKA 3FQYA 5TDNB 2AXFA 1RZ8B 3S37L 5EHFA 1D5XB 2IBZY 2J8OA 3BEWA 3F12A 4RAHA 1VFBB 5D6CA 2AJXL 3FF8A 2CJSA 3QEHB 1UCTA 5I66A 3D51A 3VFPB 4FMVA 1KGWA 1NGPH 2NY1B 5DSCB 1JN6A 4WFHE 3BWAB 4O2EB 3FU7B 4Z76A 5F9JA 4DP0X 4EPSA 5J6GA 1A25A 1J5DA 5CM1A 2PW1B 4AENB 2FIKB 2MKWA 4XNMB 1E9QA 2OSLA 1PEZA 4R4ND 1RPUA 3CQFA 3HI5H 1JD7A 3QB7C 3Q2CA 1AO7E 5E94B 3PJNA 1WWWX 4P5RA 3HPLB 5AW9B 4A68A 1AHKA 3FCTB 3QPQD 5BZDA 4XNAA 1A6WH 1C5DB 1WLHA 4I0PA 1JPST 4DESA 1E4KC 4TVUA 3FFDB 2JKJA 1NCWL 1U8MB 1JF6A 2P1YA 1L7IL 4JKPL 4PRBA 3GSVB 4FTVE 2GCYA 3B3BA 2AJZA 2OSYA 4QTHA 4PY8J 1U3HA 3ULUH 4G1EA 5I8CB 2VAJA 2VDLB 3WKQA 3LXCA 2OTWB 5BVPH 3FBQA 2H2PC 4U31A 5IFAL 2EAEA 3HR5B 1I1CA 3CLEL 2WANA 1B3JA 3BE1H 4WUKH 4ALAC 2KH2B 2QZQA 2F9BT 3MRPA 1AXIB 1EAJA 2FGZA 4PHZA 4UMSA 2DM7A 3LJ3A 2Y36H 3T6QC 2WLZA 5ESAA 1CE6A 4E0RA 2XXFA 2VM4A 4YX2L 4F33B 4BQ9A 5K9KB 4W9KC 1F02I 5JHAA 5J1AA 1G5AA 2Q2EB 1ZPLA 4XTRC 3H42H 3BYYA 3CG8A 4KI1A 4TL4A 4HALA 1NH6A 4OF6A 3UZVA 3SDAA 1YMME 2UZIL 4M8QA 2FX7L 4ODTH 1AD9A 1ND0A 5D1QE 5C0BA 2YGPA 5EOCL 1V27A 3FO9A 3WNNA 1OSPH 5F3HB 3PQYD 4NBXB 4PRNB 3KXFA 3VI4A 4CADB 5KS9B 4PP2B 2AK4E 3ETBF 1F58H 1IBGH 2YN5A 2JLPA 4MDJB 4WFGE 12E8L 5ETUA 4RDQF 3B2PA 3BT2L 4LVOB 3VXOB 5T5NF 2VQ4A 3QYCA 3ZQXA 4CUCA 5E8NA 3VD2A 3BLBA 3WSQL 1FCGA 3ARDA 2APVA 1PG7H 3Q1SH 1MWAA 5GS1B 4ZFZA 4YMPA 1FG9C 3CSYA 1GIGH 4R0LC 3MNZA 1MRCH 1AOZA 3VFSB 5D1ZB 2X42A 5GISH 2Q6WB 5DQJB 1RKRA 4YDIH 4OLEA 4HIJA 1U8LA 3RNKA 1RZQA 5A6IA 1KPRA 2LTQC 2RCSL 2ZF9A 3ESMA 3L5IA 3AABA 3I3BA 2X4OB 1OO2A 3OX8B 2IC2A 4PTUB 3NG5A 1XGZA 2IPTL 4BFKA 4IMLB 5KZCD 3QDJB 2DJMA 2DQIH 2R29H 1ONQA 1KDIA 2YJLA 3VWJC 4XN4A 3T6XA 1S3KL 3K4AA 2IEPA 3PNWB 5HJBA 4PBWD 4PJ8A 3SO3B 3FFOA 2IH1B 1EBAA 3SIKA 7FABH 1MQKL 1P7KA 4NO3A 3L3OB 1Q9KB 5EUOB 3ZU8A 5SX4H 4X6DB 2WXPA 2DQHH 4JM4L 1AOHA 2VE6B 3QNYB 1KBPA 4YHLH 5I1KL 3K71B 3ARWA 4DZ8B 1G1OA 3MV8A 4OFDA 1DLHB 2ADJB 2J5LB 4HUUB 4UYQA 5ECGA 1QG3A 2AQ1A 2J6EL 3KWWA 5ICZB 4GQZA 4Q6IC 4LEXH 1KG0B 1JYWA 2VXUH 4QOKB 3OSKA 2DZEA 3SQRA 5GSRA 1X5AA 3VWKB 2JF1A 1WWCA 1J11A 3ZDZE 4X98B 3WY4A 3WELA 5KBLA 1ROCA 4JY4A 2FWUA 3SKUD 4M1GH 5I6LA 3HTLX 3UBHA 1LMIA 1D5IH 2DJSA 4X0NA 4G9FD 4U6XB 4XB7A 3GXMA 5B8CA 1UWEL 2CNZA 3WS3A 2DIBA 3VMNA 1BJ1H 1HZLA 2PN5A 1RL1A 4ZUWB 4U6HA 1SVZA 3NCMA 3OTTA 3RZCB 1TKWB 4JFYA 3ZKXB 5E2UH 2UV3A 4I89A 1UD3A 3H9HB 4K94L 1IBFA 2D7MA 3RIFK 1OAYH 3DX9B 4M1DH 4IS6A 1FC1A 1PNCA 3BUYA 5I19L 4AGLA 3KXFE 3VI4E 5I73B 2MCPL 1TFHA 1BECA 1LE5A 3HHRB 2Y6SC 3C8DA 3GXFA 1BQHA 2AJVH 4Q9RL 1J1XL 1GH7A 1Z5HA 5TDNA 1DSFL 1RZ8A 3V0JA 1NCDH 4N6RB 1D5XA 1S7QB 3FN0L 3UAEA 4OUUB 1VFBA 3ARPA 3LNHA 2VDRL 4XPHH 2FEJA 1SEQH 3QEHA 5TQ0L 4OCLC 3WKML 1PPIA 1UWGL 2P4AB 3VFPA 2PR4L 5DSCA 4OGQC 5ACLA 4Z9KB 3RZWA 3LQAC 1SUJA 4FZ8L 3BAYA 1OP4A 3BWAA 5IF0B 2XQYG 1X7SA 3K6OA 4O2EA 3FU7A 4P57B 4Z0BH 4FQJL 4M3JA 2PW1A 4NUPA 4AENA 4AX3A 1M6OB 2FIKA 4XNMA 1BIIB 4YBHA 1K5WA 1F6AB 3GZPA 4MWFB 1KEGH 2WXNA 5IZ7A 3J07A 1JGDB 5E94A 5BVJB 2LLLA 2VM9A 4IM8A 3IMTA 1Z3RA 3HPLA 4UT9L 3FCTA 1C5DA 1IUZA 2XYCA 4HJIA 4P2QB 2CO1A 3FFDA 3OPZH 3BAXA 1PW3A 1U8MA 4HHGA 1BXAA 4XNQB 1UG9A 3GSVA 5GZNA 3CN3A 2BNUB 2XVBA 5IIEB 2JKRM 5T3XH 4M48L 5GJTL 3QNXB 3WOVA 7CGTA 2X6MA 3FTWA 4M7ZB 4NWTL 5I8CA 4IK6A 3BHBB 4L37B 2XRAL 1GOHA 1LTXA 2OTWA 4FNRA 3IDGB 3HR5A 4RFOH 3MGTB 3BVTA 5GGRB 1CL7I 2EH8H 3MV8E 3MOQA 5GGTA 2WY3B 2WYTA 4PRHB 4U0QB 5IUCA 4X5XB 2OYLA 3H1ZA 3QR1A 1M05B 2ERJC 5L7XH 4H8UA 4RGNE 3EYSL 4F33A 5K9KA 2RTTA 1RCYA 2K45A 2ZOOA 3QXVA 2FGWL 3LNEA 5FO9B 2B9BA 5LN8A 3CFBB 1G6RL 3IJ7A 2CDFB 3AACA 1B2YA 4TOYL 2D7QA 3FUHA 3PUCA 1P4LB 3NZHL 2ETWA 5I1IH 4WKXA 1E5AA 5ALCL 1WK0A 1YSOA 1CWVA 3H8NA 2PWGA 5F3HA 5JIPA 4PRNA 4NO2B 2HA1A 1NWPA 4CADA 5KS9A 4PP2A 3NTCL 1N2RB 1CGXA 4LL4A 3FFCD 2CE6A 4HGMA 4OGXL 4P5KB 5BW7A 4JQXA 2UXGA 1ZS2A 4MDJA 3L4YA 1FBIL 2ICEB 4XHQA 5DZLA 5AW6B 3VXOA 4XX1G 1DZ0A 4HEPG 5GS1A 3QRLA 3INOA 4RMTA 1QRNB 2NRDA 2GTWB 4IK7A 3DROB 3VFSA 5D1ZA 3VH8B 2KZBA 5DVKA 2Q6WA 3RX5A 3C60C 4WRLA 43CAB 1MJ7H 5DQJA 4QO1B 3IAGC 3SDAC 4AQ1C 1SHXA 1T7ZA 4H20L 5T3ZD 2ATKB 1JBJA 4KRPB 1FWXA 4OSUL 1JGUL 1OARL 1EVTC 1MRFL 2ZKWA 4YE4L 4WFFD 5GRXG 3WNMA 1X5HA 2X4OA 2BIIA 3OX8A 4RSYA 4UQCA 5E1AB 2H3KA 4PTUA 4Q8BA 3V79C 3SCMB 4PRDB 4XT1C 4IMLA 3LZFL 1NCAH 2Q20A 3QDJA 4X5WB 4GS7C 4ALAH 5FFLA 3S88H 3MUY1 5CLZA 5IV2B 4FLRA 3B56A 5EEXA 4LDEB 1HJCA 2BOLA 3PNWA 4MXWL 4HIIB 2W0LA 2IH1A 4L8DB 1CE1L 1YG9A 4PJIF 1NIEA 3NCXA 4LDLB 4U33A 3L3OA 3HLAB 1Q9KA 4KJQC 4UM9D 5EUOA 5E4OA 3ABZA 3FCGA 1JVLA 3SEPA 5LGYA 3ZHNA 5EF1A 2KPWA 4OLXL 2WTPA 2OK0H 4X6DA 4LB8A 4IGBB 4MX7B 5DYOB 2G60L 3ABLB 4JZOB 2WBKA 2VE6A 3QNYA 3Q48A 4IKIA 3DTDA 3K71A 4DZ8A 4ABVA 1DLHA 2ADJA 1AE6H 3AUWB 4HUUA 4OTXH 4UT7L 3HN3A 4W6XB 5ICZA 4JO3H 4QEGA 1KG0A 4XR8C 3DX6B 4KKLD 4QOKA 1FP5A 2B1AH 5DD0L 3VWKA 4LIQE 3SBWA 4X98A 3TGXA 1NKGA 3O9WC 4XNZC 4OF7A 1B90A 4B9YA 3ZTNL 1V55B 2ED6A 2UZXB 3GI9H 4YDMA 3MHZA 1RZFH 4U6XA 1IGMH 2ILLA 3QQ4B 2X4PB 4KAQH 3O2VH 2AAVA 5EOCJ 1WZAA 3OMIB 4ZUWA 3RZCA 1MLBB 1KUMA 1TKWA 3L81A 1FHGA 5A7EA 4WFED 3AS3A 1A4KB 3QVAA 3H9HA 3QFDB 2IFGA 1DQLL 4FLQA 4Y19D 5I6OA 5IBTH 2R1XB 3DX9A 2CCLA 4B27A 2WAHA 4UTAL 2E7CA 4BKTC 3SPVB 3JWNG 2ODHA 2FBRA 5E6YA 3B5GA 3L45A 2H0PA 2LU7A 5E1QA 4XBPB 4QHKI 4XNYH 2IMMA 2QDVA 3KWVA 5B8CC 4N6RA 1S7QA 4X9FA 4OUUA 4ETQB 1ZIAA 2HH0L 1AHWB 3LZRA 3RX8A 1XB8A 2QV4A 4PLOB 1Z1WA 1JPSH 4KKBC 3PWLB 1OP5K 4HF5L 2BSCA 4JFDB 4MS8C 5D93C 4LSDA 5IF0A 1KYDA 4EUPH 3ZT5A 4P57A 1MCOH 3P0VL 1OAQH 4TULL 5DEGB 2AEQH 1LDPL 1PJ9A 5AW1B 3WUZA 3BO8B 3PGCB 4H88L 2OMBA 1M6OA 2N1KA 1NFAA 1BIIA 2BRRL 2VN7A 1F6AA 2C9SA 3EH5B 2HRPL 4MWFA 3TPKA 4G42B 3U7YH 5F6IC 1JGDA 5BVJA 3QDJE 4GG6E 3LPGA 1MJ8H 3HW7A 2R69H 3EYQC 4YWGH 4AE0A 4NN6C 4QHMB 4X42A 4HDIB 4A7VA 4P2QA 4XNQA 3QARA 1MAKA 3EFDL 2OTUB 2NY1C 3GMQB 5IIEA 1DQQB 4XMUA 3ZZQA 1U3NA 3QNXA 2VDML 4Z3JA 4CDGC 3HA0A 2IDUA 2XQBL 2WN2A 3BHBA 1VZIA 4HS3B 4KK9D 4L37A 5EUOE 2H6UA 4ADGA 1IJNA 2EDYA 3ZTCC 4TPRH 3IDGA 1B9KA 2CJUH 2VZOA 3HC4L 3MGTA 5GGRA 5TF1L 4GJTB 4XPFL 4JL2A 5HPOA 2E47A 4DTGL 1JK9B 4ENEC 1JCKA 3CDFA 4PRHA 1I8MB 4X5XA 2VDRB 3UTTB 2QL1A 4MBOA 1M05A 3S2AA 3U1PA 3Q0HA 1DANT 3SGDI 4DHLA 5LWYL 3U9PL 5LG6A 3NJFA 4LSTL 2EEAA 3D39B 5GZNC 2ZT9C 4ZFFB 2E8YA 2A77H 1NDTA 1J0YA 1YNTF 5FO9A 4ZXBB 1KJ3L 3CFBA 4XOBA 2FJFB 4W6WB 1WC7B 1S9YB 2CDFA 2XN0A 4G7VH 1BWMA 5C08B 1HWWA 1P4LA 1HU8A 1HL4A 3LQAH 1GJUA 4I9WD 4M3KB 1BFOB 1PCXA 3CFMA 1I8UA 1MQ8A 2D7PA 1J5OL 2B1HH 3HC2A 4O00A 4XMPH 4KZDL 4NO2A 4WWOA 3B1TA 1N2RA 1U8CB 4P5KA 4PW4A 3FO1B 2PF6A 3OL2A 2ICEA 3GLEA 3T2NH 3BUDA 4NAMA 4Z3HA 3NZ8B 1GHFH 1XMWA 4XH2B 3VI3B 1L3NA 3FQ1A 1QRNA 1QHOA 2ED9A 2GTWA 2R7EB 3CC1A 3QJRB 3DROA 3HC3H 3VH8A 5D7SH 3CVIL 4FFWD 4OFYD 2LOEA 43CAA 4QO1A 1INQB 5FHAH 2FWOB 4QRRD 2ATKA 2XN9B 1GY2A 5HHMB 3IK2A 5TF0A 2NY3D 3BKYH 4P23C 5DQDH 5K39B 4E9LA 4GH7B 5E1AA 2BFGA 5E6ID 3WNPA 4FFYL 4KK6D 3SCMA 4PRDA 4JQXC 5CEZL 1F97A 5GRVK 2ZUVA 5DS2A 4LVOC 4OCSL 4X5WA 4NM8H 5BUAA 5IV2A 5GS1C 4LCWE 5F9OH 3UYOD 5TE6H 1ZEAH 2F5AL 5HP5A 5LG1A 1G6RB 1PD1A 4N2GA 5DK2B 4J3VA 4HIIA 2G0KA 1S9VB 4L8DA 1G7PB 4C4UA 1ZHLB 3TH3T 1WP6A 3HLAA 1JP5A 4JUSA 1XD1A 3O6FD 4X4XB 1F6LL 5LQBL 4NJ9L 4IGBA 3QJTB 3P1VA 1I9RL 1F1AA 3AU1B 4JZOA 4MX7A 4MS6A 5DYOA 3EDDA 1DVXA 2BWQA 5FDYA 4M7JL 1GS8A 3Q44A 2MQ3A 1WH0A 1IIIA 3L5JA 1PZ2A 2M26A 1DQKA 3BWSA 4GUPB 3VQ1C 3TFBA 1JGVL 3DX6A 3MRCB 1LWJA 1PCSA 5K9OB 1A1NB 3BIKB 4MQXD 3II1A 1DCLA 1ZANH 3EZJB 2OYMA 5K5YA 4PJ5D 2AAAA 2UZXA 5HI5D 2P80D 3HRZB 3L3OC 4QRQB 1TETH 1YYLL 5I1LB 2IG2L 3QQ4A 5JQIB 4XN9A 2X4PA 1BXXA 3BKJH 5EU6B 2YEVB 2BIPA 4F9LA 1MLBA 3D2UD 2VISB 1UYWH 1U6AH 5D4QA 1MDTA 2Y3NA 4Z7QF 4JFHE 1A4KA 2CUIA 3QFDA 5EOQL 1KV7A 1R4XA 1OWRM 1YEHL 2R1XA 3ZE2E 1TR7A 3OHXC 1JZ3A 3VWKC 2VXVL 3CX2A 4P2RD 3SBWC 3SPVA 1WBYB 4TVPL 4EO5A 4HAFA 5KYNA 2D7OA 1YMHB 3UDWA 1CLYH 1FI8C 1MWAH 2A2QT 4XBPA 2CIIB 2Y72A 2EC9T 5ISZB 2PO6D 3C8KB 2DKMA 1RSYA 4J5VA 4ETQA 2DD8H 3BDYL 1AHWA 4FERA 1QRNE 5I16B 3NMEA 5F89B 1YEFH 4O58L 1HNFA 1XGQB 3SODB 4AJYV 3PWLA 5DUJA 3ZKXC 4JFDA 2J6EA 2A7BA 4BIKA 1XH0A 1IBYA 4KKRA 3QJSB 5AOJA 4KROD 1N0LB 4JFED 3U83A 1QYGL 4R7LA 1X5YA 5BQDA 1SM3L 3CSFA 4GSXA 3K81A 5DEGA 3CU1A 3BO8A 3PGCA 4KO6A 5DWUL 2QVKA 1TDQA 5I73C 4KVCL 4FC3E 4P4KC 3FN3A 4DEUA 1NLBH 4POZD 1IC4H 4KKAD 4YHPB 4G42A 5I5IA 1UKSA 4OQ1A 2XZQH 2K0RA 3SDXE 2AJYL 1P84K 4MD5B 4PJ9D 4D0CB 4DGYL 3NJGA 1RP9A 2VR9A 4QHMA 4HDIA 4Y2DB 2AMUA 2JKTM 1QSED 3L6FB 2B1OA 5E4AA 3F6JA 4L4JA 3OLIA 2TSAA 2OTUA 3MBXL 3GMQA 1DQQA 2ZXCA 3WN6A 5HDRA 3IDUA 4HJJL 4KXAA 5DUMH 5AW2B 3P11L 1QPPA 1IGTB 3TO4B 4HS3A 2AVGA 4ZW6A 3QCVL 2WO4A 4NQDD 4AYGA 1E9PB 1NL0H 1M71B 2EDWA 4ABQA 1RZKC 5HHVL 1JK9A 4LAJH 3TYGH 4YLBA 5HHXL 1I8MA 3UTTA 2D7NA 1P69B 3ZHKA 3KCPB 3P3TA 1BG1A 1XSIA 5C1MB 4Z18A 2QT6A 3D39A 2VLJD 3KL5A 1R0AL 3AWFA 4ZFFA 5KBKA 2QPEB 4ZXBA 3Q6GL 2VXSL 4K5OA 3OXRB 5IHHA 2VR8A 2FJFA 1KZYA 1WC7A 1S9YA 2LR4A 4JDEB 4XVTL 3TWYA 1AFVL 4L8BB 5C08A 1XMEB 5AL0A 5B22A 3SDCC 3RVXC 3AM8A 1BFOA 2FHCA 2NMSA 2JIXB 3TH4T 2FECL 3ZMNA 5FM4A 4EI6B 4X6CB 4UT9A 1U8CA 4JPVL 2JSFA 4N2KA 2EDJA 5DVOA 1YAZA 3FO1A 5AOMA 3L54A 4Y8DC 1GR7A 1KFGA 1WHOA 3MUJA 3NZ8A 4LCUB 4XH2A 5EO9B 3VI3A 4LF3B 1AZZC 2R7EA 5JNYB 3RJQB 1HE7A 3EIFA 3GHBL 3VXUD 1INQA 4ODHH 3LEYH 2FWOA 4L9LB 1YDPB 2XN9A 3I9AA 1JZEA 1QACA 3N40F 3PWNB 5KVMC 4NQXB 4XWGL 1QBLL 2BS71 1AVAA 2XX0A 1IVLA 1UH4A 3D6GA 4JFDE 1XVSA 4ABWA 3N40P 1OLZA 5K39A 4Z7WF 5KEZA 4FA8A 3FU6A 5AD0B 3KHOA 5HD8C 3E2HC 4KH2A 4NZUH 1EDYA 2ICEC 2LT9A 5I0DA 2X0WA 2E0PA 2E75C 4YBLB 1KPVB 1TZHB 4ERSH 3AXHA 3U6XA 2GIXA 4UOJA 4PGBB 3V0FA 2GBUA 1G6RA 5DK2A 2JTDA 1UM5L 1JERA 4LVHB 1S9VA 4YXLH 4BM7A 4YDKL 4R4FL 3WIIL 1G7PA 1ZHLA 5I75B 5IHUL 4L8CB 4KRPC 2WWKO 1BCIA 3P3UA 5FAAA 3TO2B 5IB4B 3SE3A 4X4XA 2VDLH 1V3JA 3U0WL 1F13A 2H6OA 2YEZB 4YHNB 3AU1A 3D85D 4A2MA 1R3LB 3H4FA 1VCBC 3SCMC 1J8HB 3HNSH 4HK3N 3QEGL 4OM1L 3DJSA 4GUPA 1BVKB 4AV4A 3EHBD 4ORGB 1D9KB 4EN2A 2Z64C 5EWIL 3MRCA 5K9OA 1A1NA 3BIKA 4TNFA 2F1BA 3CN2A 5I18L 4Z3IA 3U1QA 1BGXH 4MZRA 5JORB 1G9EA 3BRFA 3UTTE 3TN0B 3ZDZF 4CSTA 5E1GA 1PY9A 2RH0A 3HRZA 4QRQA 3ZTEA 1T6VN 5I1LA 5E1HB 3D0VB 5D70H 4NIKB 2NY7L 4XP4H 4FNUA 3EO1B 4RA3A 3LS4L 1MFEL 5EU6A 1ZVHA 5CGMA 1ZOXA 5DMKB 3UL4A 2VISA 5I15L 3FS9A 4PG2C 3V0WH 5LDSA 4Y5VC 3RIFF 1T66D 4M5SA 4GQPH 1ZAGA 5AVVB 4FG6D 1XDTT 4K7PY 1FRGH 1K4CB 1KN4L 4P5SA 1RIUH 1WBYA 1X5KA 3OLDA 4WQOA 1FIEA 1I1RA 4HC1H 1YMHA 3I85A 1DUYB 3TCXA 2CIIA 5ISZA 2FBJH 4WI9A 3ALWA 3C8KA 1EAOA 4Y5XB 5IJVB 3CFIC 3VI3E 4HCGA 3KZ8A 4DIXA 5D55A 4RRPM 5I16A 3MLZH 5IK3B 4F9LC 5F89A 1EHKB 1OSEA 1XGQA 5A6LA 2R0WL 1XGTB 3S4SG 1KJVB 4YN3A 5I9QC 4JK0D 2EDRA 1WS7A 1N0LA 2XN9E 5HHME 3PAYA 3N0AA 4D8PB 4TNGA 3VVVA 3CC5B 2NSXA 4KMQA 1XSOA 1KIRB 2P5WD 4YHPA 4NWUH 3UDWC 1RK7A 1TJGL 1GW6A 5B38G 3NIGB 1WWBX 3C5ZB 4MD5A 2AV1B 3DX8B 4D0CA 1A64A 1RUQL 4Y2DA 1T2QL 3RFZB 4IIQC 1GOGA 3L6FA 4M8VA 3LEVH 1P4IL 4W93A 2G5UA 3EKCA 3AMLA 3S34L 1RJZB 4F91B 3T0DA 4JJOA 3KWXA 4W81A 4FZEH 1QW8A 4HLZG 5ACZB 4FFZH 1CGTA 2VO8A 3TO4A 2A74C 1IGTA 4UTAA 3FH8A 5E0QA 5FM8A 3WDIA 4BELD 4DVRH 3DLQR 4JG1L 3TBWB 2XXCB 1FDLL 3TBCA 1E9PA 4Y9GA 1M71A 1A7QH 1NCUA 1PZBA 2EO1A 4F8NA 3DX4A 4NAJA 1C1EL 2NW2B 3US1A 2WB1A 5DK0B 3ALXA 2WQWA 3KCPA 5J3HD 2BWDA 2AF2A 2QQKH 4N4YB 3DXAD 2G75B 1HDMB 5KVFL 5ABDE 1DJHA 4ZMQA 2ZONA 3DVIA 3RG1C 3NJMA 1CF8L 2QMKA 3OXRA 4FHKA 3TIEB 3TT1L 4JDEA 1L7TL 1QAWA 5F93C 2DH3A 4JDTL 4L8BA 5GZOC 2HJFB 2I07B 2KUTA 3MCLH 1N68A 2JJWA 1KTDB 1OTSD 2JIXA 3GMMB 3OKYA 3K72B 2JKSA 4LBEB 2ARJB 2AABL 2AITA 4X6CA 4EI6A 3R4DA 1KBGH 1KFAL 5T1KD 1OM3L 3O41B 1D6EB 3LRHA 3FSZA 1QEWB 4NUGH 4QRBA 4YDZA 5C7XH 4JO2H 4AOFA 1II4E 3L08A 4HWEL 1MCFA 4PCSA 5EO9A 4LF3A 3L1OH 5JNYA 2FT6A 4NBZB 5DS8B 3D2TA 4A2EA 1XF3B 2L7UA 3FQXB 5ISZE 5AVSB 1HHHB 4NKDB 3TV3L 1B4JH 4AI7A 4L9LA 1BZDA 1YDPA 4Y4FB 2LFGA 1SGKA 1UD2A 2FL5B 3AM8C 3PWNA 2AQRA 4NQXA 1SN0A 5JHLL 5EF2A 2C5DC 2Y07L 4IRJB 4G7YH 5AAPA 5AD0A 5FYLD 1AC6A 1FAKT 1AG0A 3HG1D 2EECA 1DHKA 1JSYA 4HIHB 1RZKH 1KPVA 2NCEA 1TZHA 2XZZA 3MUHL 2ZICA 4NQEE 4PGBA 3NCJH 1YY9C 4WW2B 3OG4B 3RTQB 5J6SA 3GS4A 1KELH 2G2PA 3FT9A 5L8LB 3F7QA 4LSVH 2B08A 4HGKC 4CN4A 4OZGB 4L8CA 5ICUA 4KFMA 4IOSA 1A6VL 3BAWA 4JRXD 5CLXA 3H9SB 5IB4A 3TO2A 2FLBT 2WQUA 1HL5A 4YHNA 2YEZA 3N41F 5KOMC 3D18B 1R3LA 2RD0A 1J8HA 3DUSB 4Q4IA 3CN1A 4GKLA 3AG2B 1E50A 1UWYA 4B5EA 4HMDA 1BVKA 2JCWA 2XI9A 4ORGA 1D9KA 1NAML 5C71A 3N04A 3L48A 2AJXH 1F1GA 2XU9A 2YD7A 1URZA 4FQXB 5D7KE 5JORA 1NCBL 1PX3A 2BW4A 4GKZB 1C12B 3TN0A 4LLQB 2N59A 5I6KA 3I9GH 2IQ9L 2X1WL 3O8XB 5E00B 5DO8A 3D0VA 4F7TB 3D52A 3SE3C 3EO1A 1J0IA 4FFYA 1HL9A 4KUCF 2ITEA 5DMKA 1UEYA 2QSVA 2Y06L 1NBQA 1V3MA 2ZE0A 4FYRA 3ZKSD 4FQIL 5DMIL 4HUVB 1QRKA 1KBKA 2ZYHA 1F45A 3QEQB 4KO5A 3GTTA 3V9EA 3HG3A 3VGFA 3U7WL 4PPTA 2L7QA 1PGRB 3CXDL 1I53A 1K4CA 4LK4A 1NCWH 4JO1H 1G0XA 1IM3D 4X6CE 4KQ0A 1L7IH 4JKPH 3DBSA 5KAQG 1TLMA 4PJDB 3WL9B 1DJZA 3VFWB 1DUYA 2OP4L 3D1MC 1GGBL 1UKTA 3HRZC 5FYJD 1L0YA 2FHBA 2F19L 1W2KT 4HUNB 4Y5XA 1KCLA 5IJVA 4YBQC 3P02A 3LN9A 2E46A 2NOYA 1MUJB 4LFHD 4X6FB 3B9VA 5IFAH 3RVUC 2NNRA 2ZXGA 4KRLB 5IK3A 5JOPE 2Y5EA 3CLEH 2OW6A 5CCHE 1A22B 1XGTA 1KJVA 3M86A 4Y1AD 3X13B 4ELME 3ZL4L 4G1MB 2FRGP 2DQDH 4D8PA 2F54D 3FB5B 3CC5A 4YX2H 2HVKB 4HT1H 1KIRA 2YMXL 5FOBB 4KQ3L 2CO7B 5CD5C 4WTZA 2PCYA 3C5ZA 3JV4B 4TS6A 2AV1A 1ZSHA 2FEEI 3DX8A 4NLAA 4WGKA 4KY1L 3TBBA 4MNQD 2UZIH 4GG6F 2DWSA 2FX7H 1Y1UA 4OCYL 4IDLA 5TE4L 2ZUTA 4AGMA 3RFZA 4F2MB 5EOCH 2V6HA 3GXUB 4HWZB 1KB9K 1JMXA 3T3MB 1ETB1 1RJZA 3IPEA 2JVUA 4FXKB 1DL7L 5T3ZL 5ACZA 4F8LA 4QLRA 2J8UF 1CMOA 5DC2A 3RB7A 4M6OL 4AGNA 5ITBL 12E8H 1CDHA 2EXWD 5DZVA 1AS7A 2WZ6A 1FVEB 1AR1D 3TBWA 3N44F 3IDIB 2GC7C 3HZYB 1J8HE 4Q6YA 1BVZA 1NPJA 3DVNB 3ILEA 3VA2C 2WV3A 4JFOB 3POCA 2E4FA 3JWNC 4R7VA 2FD6H 3FU0A 2NW2A 1THAA 3B34A 3QORD 5DK0A 2DQTH 4KI5F 4G5AA 2YPLE 4P99A 1E7VA 3A47A 4FXLA 4JGNA 4HJGB 4G82A 2YD8A 2G75A 1HDMA 2RCSH 3OAUH 4DN3L 1EHAA 5B1JA 4H4NA 3MDJA 2CALA 4OFQA 3IGAB 4U3XA 3TIEA 1DVFD 3ZL1A 2HJFA 2I07A 5BRQA 5CEZE 4XWOD 1KTDA 2IAND 2BOCB 3GMMA 1GVIA 1S3KH 3K72A 4LBEA 2ARJA 1E67A 3CVHB 2JJSA 2W1NA 5A3ID 2QPUA 3O41A 4WI3A 3ZZ1A 1PKQB 1D6EA 1LO0L 1MQKH 2FZ3B 5HI4D 1QEWA 2WXQA 4OLYL 3QJVB 4WTXA 1KTLB 2YD0A 1QP1A 5DUBB 3C12A 4K7PL 2ED7A 3MFFB 1R3KB 4BQCA 5DS8A 1DUZB 3IMUA 1XF3A 3FQXA 3RIKA 5I1KH 2X89A 3TJHD 4B9PA 1HHHA 2A38A 1TTGA 4NKDA 4HPYL 3UBXI 2Y5QA 2XZCL 2F58L 2J6EH 5KZCB 4Y4FA 5CCJA 2DN7A 2FL5A 4PP1D 4IYKA 2H26B 4PJGB 1L5GB 2ORBL 1NOAA 3H9ZA 4IRJA 5HGBB 1MCQA 1JZ8A 5LXVA 1RH8A 4J4PD 5EBWB 1KY6A 1V3LA 2YD2A 3ELQA 1JMZA 4HIHA 2QJDA 3RWCA 3Q5YA 1YEDB 1UWEH 4M29A 1QQDB 3O4LB 4AL8L 1RJYB 3S3DB 3AREC 2ZCLL 3CHOA 4WW2A 3RTQA 3LEXB 1XF5B 4M8RA 3NIGE 5T1JA 1YCSA 1U8KB 2EXTA 1YO4A 1BWWA 5BOPA 1JTTA 1A6PA 5DD3L 4OZGA 2XWBB 1MHHB 2QHLA 2DWTA 2X5PA 4QT5B 3H9SA 4NQUA 1C5CL 2UUDH 1URLA 5I19H 1XX9C 2CBPA 3K6DA 4FNQA 3D18A 4HHWA 4D7BA 2MCPH 4IDJH 3DUSA 4ODUB 5T5FL 3GXNA 2YSSB 5EB9A 3C87A 4NFCA 2GSGB 4FI7A 1J1XH 1FAIH 4TVPE 3ZUCA 1DO6A 1DSFH 3AB0B 5CCKL 3BMVA 3FN0H 3IDMB 4UB0H 4IBUA 3EOAB 4G9FB 4ZO8A 2VDRH 4JS7A 3QJFB 2HT3C 2RMNA 1G84A 1OOWA 1NFIB 3WKMH 5TQ0H 4HWBL 4FQXA 4Y5YB 4XVJL 2PR4H 4QMEA 4GKZA 1C12A 4GSQA 4LLQA 5KVGL 3FBKA 4FZ8H 3TF7C 5CZXC 5I75C 3FYIB 4NXSA 1ID2A 4PJ7F 5E00A 3O8XA 4DW2L 3BVDB 5DLML 5EO1B 4F7TA 3FTXA 1N0XL 2Z8WC 4MB1A 4JDVB 1SVBA 3QFJB 4L05A 4DZBB 1WWAX 3TESA 3F58L 3BVVA 3WE1A 1IEAB 1IEHA 3MOAL 1PY0A 1NA8A 4AIXA 4HUVA 5CLWA 1E2VA 4UT9H 3QEQA 2W81C 1AXSB 1TJXA 1T03H 2GKIA 1CUOA 2IOOA 4HYTB 4GRWB 3CFNA 3ZE2F 2N56A 5JW4R 1QUPA 2O6EA 4PJDA 3WL9A 4PMEA 2Z7WA 2VDQL 3N42B 3VFWA 5GJTH 1LK3L 2EUXA 1W6LA 2J1XA 4FXGC 3ARZA 5I5JA 2XRAH 4P2YA 2CBQA 3BFOA 1MUJA 2A1WL 2WYZA 4X6FA 4UTBL 4IHBA 4NEHB 5FGSA 3B2MA 1EVUA 3IFNH 4HS6B 3I9IA 1NAMB 1HCFX 2K9UA 3X13A 4FGMA 4L5FL 1H8OA 4G1MA 3LMJL 2WXMA 2P45B 1R34A 3K2MC 1KWKA 3OC8A 1VLXA 1ILUA 3EYSH 2CHNA 3FB5A 3RHWK 2HVKA 1FSKB 4RMQA 4B3EA 1G6VK 5FOBA 3IDNB 3QBTB 2CO7A 3E6FB 3GHEL 2AI0H 1KF9B 3JV4A 1VACB 1G6RH 1KC5L 5EZLB 4Y5XC 4ZMPA 4TOYH 3SDXF 3MGAA 3NZHH 1WEJL 2XY1A 4LQFL 4F2MA 3WTWA 5ALCH 4HWZA 2QZ5A 2YAFA 3JXAA 2YXWA 3GO1H 4JHUA 4BKSC 1CICB 3WEAA 3WTSA 4FXKA 1HKLL 4DKFL 3NTCH 4OGXH 3M07A 4Q58C 4OZGE 3SB3A 3T8VA 3RVVD 1FBIH 4Y4KB 4Z7OF 4BWTA 3T9WA 4DAGL 5HDWA 1EJ6A 1FVEA 5AALA 4ATWA 4BFBD 3TZVC 2GJRA 3IDIA 1FL6B 3HZYA 1AKPA 4MAZA 4ZTEA 3DVNA 2F18A 4N85A 2LLGA 4JFOA 4PQXA 1L6ZA 3C5ZC 3F7VB 5K9JL 2D3JA 3QUZC 4Y9FA 4H20H 1LXMA 3APMA 3EBHA 3RFZC 3BUIA 4HJGA 3CU7A 1R33A 1S46A 4N0YL 1N6VA 1AZBA 1CCZA 1ZT7B 1JGUH 2K3TA 3FRPB 1OARH 3KLSA 3THML 1MRFH 1NZRA 3V52L 4YE4H 3QQ9D 4CSZA 4EI5B 2JK5B 4WEUD 5AW4B 1OT1A 5ICXB 3IGAA 2FLRT 3VW3L 3HZ3A 3LZFH 4TLKA 4NC1C 5D1XD 3H0TB 2J73A 3QG6B 4OLVL 3T6VA 5IHBA 4PJHB 3MRJB 3TJPA 7PCYA 3DV4B 1PG7W 1UD5A 4A7UA 2R0ZL 1P4BL 4RRPG 2BOCA 1S4IA 4IJTA 1K85A 2G9HB 3CVHA 4MXWH 1YC8A 2WUBL 2ZCKL 3B7YA 2KERA 4XP1L 4XP5H 3OZ9L 1PKQA 5IM7B 2FZ3A 5D7JD 4UI2A 1BMZA 1KTLA 1BIHA 4FCAA 5DUBA 4OLXH 1XL6A 2V3FA 2YPVL 2FX8L 3NRQA 4KVNL 4GB9A 4NKIL 4O02H 4PJDE 1JFQH 2ZD0A 3MAWA 3MFFA 1R3KA 4Q52A 2G60H 3ZMRA 1BX2B 1DUZA 3GBEA 2DAVA 1UXMA 2EINB 1ETA1 3VD5A 1KXHA 4NS0A 1YNLL 1QZ1A 1UURA 2OA9A 2OMTB 2WLNA 4UT7H 5JUEL 4YUEL 2FWSA 4PJGA 2H26A 3V7AG 1L5GA 1CVSC 4NCDA 4R96B 5DD0H 5HGBA 4B53A 3PV7A 4M8UA 5EBWA 5IEHB 2LABA 5K69A 2D4FA 2E7MA 4UQIM 2AXJA 4TTDD 5AEAA 3ZTNH 5IOPB 4URKA 3I2CH 2HX7A 4FNLL 1XF4B 5F1KC 1MAML 1YEDA 5F6HI 1TEFA 3O4LA 4UM9B 1RJYA 3UTZB 5H37A 5F7EL 2XSKA 3LEXA 2YGNA 4K5MA 1XF5A 5DD5L 1KENL 1DBJL 1U8KA 4EIZC 2Q7AA 1HIML 5EIIB 5H35B 3B37A 4Y4FC 4Y7OC 3UTOA 5LDUA 2XWBA 1MHHA 3GSUB 4QT5A 4XMXA 5EOTB 4H0GA 5F9DC 1EEUA 4IRJC 5BV7C 4UTAH 3T3ME 4LAQL 4MXQD 4E5XB 5CJXA 5A7BA 3CFQA 2GAZB 3ARGC 3HAEB 2BX5A 1NCNA 3BN9D 4KY2A 4ODUA 4PLJC 4XE5B 5TJWK 3NJXA 5J4MA 2YSSA 4LQ1A 3W56A 2GSGA 3W37A 3WBDA 3JZYA 4CMMB 4V2BA 3IDMA 4OQTL 3BJLA 3EOAA 4G9FA 4AQOA 3QJFA 4Y0GA 3RTQC 1OANA 1NFIA 4Y5YA 4YGAB 3TJEL 3D33A 2UY7B 4HF5H 4WF7A 3SE4A 4X7CC 4JAMB 2DDQL 4BA0A 3ZMEA 5JHLA 2OR9L 4YSDA 3RGVC 5ELIA 1LWRA 4AEFA 2WKLA 1MCJA 3P0VH 3K7UA 5EO1A 3HBPA 2FJUB 1X9QA 4PWEA 4FADA 1LDPH 2IADB 3C9NB 3LRGA 5AVTB 3MA7B 4JDVA 3MCYA 3QFJA 3TV8A 2BRRH 3EDFA 4BZYA 2QADD 2KYIA 1K2DB 2DM3A 4DZBA 2FHFA 1IEAA 4TYUA 2DTML 1DQDL 4W9EC 4P49A 4ZMWA 2F5BL 1QTPA 3BUQA 3GJFK 3GKZA 3V6OA 1WG3A 5INCB 2Z31D 3TXAA 5IJBC 2JQZA 1AXSA 2BFVL 2NSQA 4TQPA 4YVNA 5AVXB 3EFDH 2YD3A 2WUCL 3CUPB 4GW4B 1AS6A 4DFHA 2VXTL 1PKQE 2WZAA 2VDMH 3DK0A 2BLFA 2XQBH 4W9ZA 1MCNA 2NY0C 2YGQA 5I71C 5IB1B 3HC4H 5C2UB 5TF1H 4HUWB 3EFOB 2VYRE 1KYUA 5CU5A 4TSBL 4HS6A 4AYBA 1NAMA 2ITCB 4LHQB 1NAKL 5EEWA 1M9WA 1JI2A 2NXYC 1CFQB 1P2CB 2WJ5A 5LWYH 3U9PH 3IE9A 2NZIA 2UWEB 4ZQKB 1MIML 4ZW8A 1A6AB 2DMBA 3EUUA 1ETZB 3IDNA 3DUHA 3QIWD 3E6FA 2OR7A 1RVFL 3QP3A 1VACA 4GI8A 5EZLA 4FQPA 4RWHA 4F80A 1OT4A 5D9SB 5DR5L 3FO0L 4WLCA 4I3GA 4HSAC 2C9QA 4KKPA 4G83A 1KZQA 1ET7A 3T0ED 3BPCB 5AB9A 1CICA 5CSGA 1KB5L 1J5OH 1CXEA 1IAOB 1EXUB 4KZDH 2YQBA 4CC1A 2JB5L 3A24A 2DQGH 2XFGB 2ZKHH 4N9OB 2V5TA 5C0AD 3OB0H 5JHDB 1NFDB 1B0IA 4WHCA 4Y4KA 3SOBL 2RQ8A 1MCKA 4KPHL 2R4SL 2VDQB 4JHAL 3OPUA 3RWIB 1ZTXL 4XCNB 1FL6A 4U05A 2BVEA 2P26A 3V8OA 3RTLA 3CVIH 5JPNB 3QQDB 4KJPC 3F7VA 2ATAA 2WBJC 2ZP0T 4XB3A 1WBXB 4Z1PA 4G9FE 3MXWH 5J06A 5IJCC 2YMTA 2QFRA 3A4AA 3NA9L 3FRPA 1ZT7A 1P6AB 4HJ1A 4LASL 4I4WB 4RBPH 4XOEA 4FXKC 5EZIL 4EI5A 2JK5A 2FYYB 2VXQL 2NSMA 3SDYL 5HYJD 3PP3H 2MRYA 2IH3B 2DQCH 4FFYH 5ICXA 2ICWB 4UDUB 2FQDA 3GDBA 1T21B 2EDHA 5CILL 4EDWL 3H0TA 3WTUA 4OCSH 3FCBA 3GWJA 3QG6A 1UWFA 2MHAB 2H47C 1W0WB 3W11C 4PJHA 1G0YR 3MRJA 1AI1L 3DV4A 2NR6D 4KJWD 2RJMA 2F5AH 3KMDA 5CP3A 1FZOB 1OGTB 4AY0A 1O7DE 2G9HA 4WY7L 3LB6D 5F9WB 2Q8AL 3JTTB 3AFLA 4ONHB 1O5PA 2Y2TA 3ZRFC 5IM7A 5EZJB 1FPTL 5CN1A 1CD9B 2Y6TE 1F86A 1ILSA 4GRWE 5FO8B 4QRRB 4PGDB 2DPKA 5LQBH 4NJ9H 1DQML 1I9RH 1BX2A 2NY3B 1GGIL 4MVBC 4ZUTB 5ICYB 3WN5C 2OMTA 2ZOKB 2PXYB 5E4EB 4MDRA 3LZNA 3MRKB 2ICWJ 3WUWB 2XG5B 5EUKB 4R96A 5DVNA 1WAAF 5IEHA 1DVYA 2CKNA 4GW5B 2DF3A 3SQOL 3ZGIA 5IOPA 1FZKB 3KDPB 2A9NL 1HL8A 1L9RA 3ECBB 1KGUA 3GEWB 1XF4A 1O6VA 1WGVA 2IG2H 2EE3A 2PTVA 1OZUA 1QI4A 3EJYD 4BSWB 2FO4B 2G30A 3BVXA 3UTZA 1IILE 4G7RB 4YAQB 4DOHB 1VZGA 3ATAA 3O6FB 5ILTL 1WA0X 2RB8A 4QIRA 1A3RL 4GINA 5LBSA 2IO5A 3OMNB 4PJCB 2EE2A 3S6CA 3WY2A 5EIIA 3QUHA 3AITA 5H35A 2TAAA 4APQC 3GSUA 5EOTA 4X4MA 5IQLA 2FB4L 1XR9B 4E5XA 4NJAL 2VL4A 1OKEA 3WFBL 5J13C 1UOWA 2GAZA 2CR0A 3HAEA 4A2HA 3DOSB 3WO4C 1TMCB 1AZCA 4B60A 4BFNA 4AYFB 5CHNB 4FMKA 1RY7B 3QUMH 1HQRB 4R7DB 4U1KB 4CMMA 3SDDC 1VENA 3WEBA 4OI8A 1T1YB 3BDYH 1DJXA 1WISA 4WNQB 4BK4A 4GIOA 4A1RA 2J71A 3HC0B 5IJKA 2WLKA 3APDA 4O58H 1NDMB 2AQQA 2UY7A 3REVB 4KGJA 5FW8A 4ZFGL 1NCTA 3D2UB 3QIBD 4JAMA 4CSPA 2HTKD 2EYTB 1CZ8L 1BFVL 1BQKA 4XCYB 1QYGH 3ML8A 1SM3H 3B2UD 2IADA 1HZHL 5FGBC 3C9NA 4WHDA 1VHPA 1RPKA 3GZOA 3MA7A 5CJXC 4KVCH 5DWUH 1OLLA 2XVGA 1K2DA 4YHIB 3RVTD 1GYWA 4P2RB 1WIOA 2NY2D 4Z0XB 3UZQB 4UIKL 3MN8A 4WJ5B 2Y25A 3AB0C 2XPGB 4DGYH 4BDVB 4PJHE 5INCA 1WS8A 4YFLI 2H0FA 3BAJA 1F3JB 2PO6B 2AXWA 3D0AA 4A7GA 4PGCB 3T6WA 4N68A 4XODA 3GRWL 4ORZC 4NI6A 4Y5YC 1DJGA 3T77B 3CUPA 3FPYA 3MKGA 4GW4A 3SE4C 3QI9B 3BZ4B 2EZ0C 3IAQA 4ZW3A 4HJJH 3JVGA 5CF3A 3P11H 3M1OA 4JEGB 5EDSA 5IY5B 1NGWB 4XI5C 3MLRL 4QRAA 1MNUH 4C56D 4U6TA 5T3ZE 4KROB 5IB1A 6FABH 4JFEB 2GUOB 3I50L 1ZLWH 4XMKL 5DT1H 5T5FA 3UG4A 4HUWA 4WFFE 3EFOA 3GZKA 1XL4A 2B15A 4WEBL 2OCFD 5HHVH 1O7DC 5DFWH 5BV7H 1U4EA 2ITCA 4MA7L 2XOTA 5HHXH 3V6OC 4R83A 5CJOL 4UNTA 1TIUA 5IVXF 1CFQA 4Y4HC 1K5NB 2DBLL 1LNUB 1P2CA 4PJ9B 4HWBA 3ZE1B 4ELMF 5BNXD 2WPGA 5L2JA 5CSBA 3FTZA 2UWEA 4ZQKA 1KXVA 2A9ML 1A6AA 3WHE1 1QSEB 1ETZA 2C26A 2QBWA 2V5SA 2VZTA 3NQKA 5JIIA 3MBED 2UYLB 2VXSH 5DA0B 3MV11 4XVTH 2A99A 4KQ4H 4BHUI 1AFVH 5D9SA 3NDYE 3K8MA 1A8JH 2WNXA 5E56A 4PVBA 4XHJD 3BPCA 3SKJH 1KGCD 1IAOA 5DJ2B 1JFHA 1EXUA 4YK4B 3ECVA 4HGWB 4NQDB 3NEXA 3T0AA 3F7LA 3SY0B 2PP9A 3ZT6A 5JHDA 1NFDA 1TTBA 2CA3A 3P3YA 4X4ME 5E0FA 2NY4D 3QDMD 4YSAA 2BK8A 3QWOB 1LYQA 1FSKC 4G8EB 3VSVA 3RWIA 4NP4L 4I77H 4XCNA 2Z1KA 1LM8V 4BZ1L 4XPTL 4MAYB 4NRZB 1MCWM 1DFBL 3QQDA 5JPNA 3GHBH 4LBAA 2PW2B 5HDBB 1WBXA 3L16A 1XGUB 4UTBA 1NPNA 3WHXB 1FQ9C 2D3LA 3QPKA 1YEIL 2CXGA 2QGBA 5FOJA 1J18A 4WHYG 3FTYA 5FYKD 4NN5C 4XWGH 1CICC 4I4WA 3NP3A 2OI9B 4XP9L 5E95B 2FYYA 3FU3A 2WXOA 4NKOB 5FK9B 5SX5K 2IH3A 4GP4B 5IGXL 2ICWA 3DC0A 4X2UA 4UDUA 1T21A 4GNKB 4Y4KC 1PLBA 1W8EA 2R9HC 5EIQA 2MHAA 4Z23A 4Y19E 1W0WA 3L17A 4HKJB 3IM1A 5EU4B 1SXZA 2QSTA 3ZKMC 5IQ7L 3C6LB 4POUB 1FZOA 4N0CD 1OGTA 2EXSA 1UM5H 1NDGB 3JTTA 4YHOH 2BSED 4YDKH 4R4FH 4L4VD 4ONHA 4OFYA 4YSRA 4DEWA 3P3RA 1NBZB 2XY2A 5EZJA 3VM5A 3LQZB 4CN6A 4HJUA 1KB5B 2IAMB 2PPCA 5FO8A 4QRRA 2HFEB 5CZKA 2A0LC 3PL6C 4PGDA 4EI5C 3U0WH 4L3AA 2AMGA 3O0LA 3CLFL 4ZUTA 5ICYA 4KX8A 2NQCA 2ZOKA 3QEGH 4OM1H 1XAUA 2C8NA 2PXYA 2VR6A 3MRKA 4HETA 4J6RL 5EWIH 3WUWA 3V9CA 2XG5A 5EUKA 2XTJB 4IKLA 5I8KL 1BD2B 1H3XA 3FT4B 5I18H 5DZ9A 4WEEA 4Q6KA 4GW5A 3UGUA 1ECZA 4EBQL 4MJID 1FZKA 5HGAB 5BS0B 1YJDL 4MJHA 1Y07A 1MKFA 4OD1L 3F6IA 3ECBA 5F21B 3SYQA 2UWEE 1JHKH 2XG4B 2Z7YA 2ARJQ 2W59A 2I69A 3LS4H 4BSWA 2FO4A 2FR4B 5I26A 1EUTA 4YAQA 2YD9A 4Z7NB 2FJGB 3O6FA 3DYMA 3QRGL 5I15H 1ASOA 1MVUB 3D85B 3BVWA 2AEPL 4PJCA 4X6EB 5IFHH 3QZOA 1A4JB 1NMCB 3GJEB 5AKSA 4JW3A 3H6AA 5GRJL 2HFTA 1DQJB 1XR9A 3EHBB 2ENSA 1KN4H 4PWGA 4PV1C 1HS6A 1T6WA 3DOSA 5JHDE 1NFDE 3U48A 2HFFB 2XV6B 5JMOC 1MJUH 5CHNA 4AYFA 2P80A 1HQRA 4R7DA 3B5HA 2YBGA 4U1KA 1GYCA 1T1YA 4MB4A 5KVEL 2X6CA 4WNQA 3HC0A 3MOBH 3ELAT 4I8DA 1B4RA 4KOCA 1NDMA 1UXLA 25C8L 1W72L 3REVA 1WA2X 1KULA 2R0WH 4R2GB 3D2UA 3VXSB 3S0PA 4RDQG 2EYTA 5TD4A 2HG5B 2JWYA 2B77A 4XCYA 1QFPA 3MUUA 3VGAC 2B8OT 3G04B 3K1KC 3ZGHA 2WXHA 3DETD 5C0RH 4I9WE 1UT1A 1E8YA 2WXGA 4L5FE 5I24A 5AUMB 5J12B 1WD8A 1JXKA 4YHIA 1OEZW 3VO0A 1HTYA 4P2RA 2Z6FA 1TJGH 1GZHA 4Z0XA 3UZQA 3CHQA 5D4JA 5DCCA 3QAZB 1CYGA 4WJ5A 2SODB 2XPGA 3ECUA 4BDVA 4ZMYA 4OZIF 1RUQH 3MA9L 1T2QH 1F3JA 2J25A 2PO6A 2VC2L 4PRPD 4PGCA 5IJKC 1IBZA 2R39A 1P4IH 3BDBA 4JPWL 4MJ2A 1VFAB 3S34H 3T77A 2VH5L 5E8OB 1HC1A 3QI9A 2YD6A 3BZ4A 5DHXB 5I0WA 3CV5A 3CHPA 4QY8B 4CU6A 1NGWA 3AT8A 3NACL 4PBDA 4QRRE 1AGBB 2VDOL 4JFEA 2GUOA 5JHMA 5FA4B 4LP5A 4JG1H 1HHKB 3MRQB 4M1CC 2AQTA 3P54A 4OD2B 4OQTA 2P5WB 1C1EH 2YMOA 4XPBL 4MHHG 4AL8C 1ZSDB 3ARVA 1CR9L 1INDL 2DLHA 3BPLB 1K5NA 1DVSA 1LNUA 1XEDA 4PJ9A 3IPFA 3RHWF 3NESA 5LXGL 4QRPD 5IHLB 3H7BB 5KVFH 1QSEA 4QRTB 4XO5A 1PZAA 1ADQA 2DMHA 3Q1EA 2FQGA 5I0ZA 2UYLA 1CF8H 5H37H 3QQXA 1J5HA 1LLAA 1L7TH 2CMRL 4JDTH 3S3BB 4HKXB 1FC2D 2F53B 5F7KC 3DVGB 4JMNA 1S5HB 4A7SA 4PSPA 3S48A 5DJ2A 4PS4L 3PJLA 2AABH 1ZGLB 4HGWA 4NQDA 5EU7C 4IEFB 3SY0A 1KFAH 3GMLB 1OM3H 3BQUD 1J12A 3QWOA 4G8EA 3H55A 1EJOL 1KXVC 4HWEH 2BY3A 4OFKA 4XMLH 4WWKC 2YAPA 4MAYA 4NRZA 1FZMB 3MNWB 2VR4A 1R3IH 2PW2A 4PJ5E 4UU9B 2ARWA 1XGUA 4LARL 4PG9B 3FO2B 4TVSa 2EJ1A 3WHXA 1Y0LB 4KK9C 5E5RB 2UUDK 5JHLH 3GLDA 2HUHA 4FEMA 5I30L 1OWWA 2AP2A 5KSAD 2Y07H 1OP3H 2XQYK 3FTVA 4AKQA 3FCSB 4NKOA 1UHVA 5FK9A 4N25A 3GSNL 1FLTX 1AQHA 2E7HA 2V9QA 3ML9A 4WK2B 3L9YA 1D7DA 3AT9A 4X7TB 5T1KB 2OPCA 4Z7UB 4LSSL 4K07A 1XFPA 3HUJE 4HKJA 5DD1L 2ZJSL 2H1PL 5JZ7C 5EU4A 2R0KH 3C6LA 1KCVL 1WITA 2XBDA 4P2RE 2OV0A 5FKAB 3M6DA 1NDGA 4F57L 1IKOP 4GRWH 4J3XA 1S78D 4HCIA 1NBZA 3AY4C 3LQZA 3T8MA 2ZKMX 3HNVL 2CK0L 1KB5A 2IAMA 4L4TD 2HFEA 2AZAA 3UO8B 3EYOB 4KUCD 4NNPH 3V55A 4A7QA 5AFAA 4PJDF 3K2IA 1IE4A 3ISYA 4NQSB 3NJHA 4JFEE 3P4NB 1NAMH 2G5RA 4N2FA 3WLWC 4GKOA 5D7LD 3F3HA 4UTCA 2YUWA 1BD2A 3FT4A 3AC0A 2HB0A 5F9WC 3UJTL 3NH7L 1NCBH 2FJHB 5F1NB 1Z66A 1L3WA 3ILQC 2ZYRA 5BS0A 5HGAA 1YECL 4NQVB 4X7SL 6PAZA 4JFTA 4OV6F 4ICXA 5B1AB 1C7SA 1G7JB 2XG4A 1E90A 2VXQA 1GMIA 2I9TB 2Z8VC 1KGIA 1QSEE 2FR4A 3O6ML 4FP8L 1Q94B 4R97B 2FJGA 4JREC 2Y06H 1MVUA 3WXVL 1BQUA 3D85A 2PXYC 4X6EA 5L4MA 5E4EC 4FQIH 2QVTA 1A4JA 1TQCB 5DMIH 3FOMB 3GJEA 3ULVF 3NGBC 4A04A 3AXIA 2OULB 3CXDH 2I7SA 3SGEI 3CFJB 1DQJA 5L8KB 5MI0C 2RAMA 1SJHB 4BCYA 4NQDE 1ZLEA 4KXZH 4YL4A 1OHQA 2O6DA 2Z1PA 3EOBB 2ITFA 2BZDA 2OP4H 1GGBH 4N3UA 2HFFA 1OD7A 2ENJA 3E9TA 4EAEA 2L04A 4HBCL 3DPBB 2F19H 1OF2B 4WTQA 3S7GA 3GQFA 5DHYB 4ZUVB 2VLJE 1UUSA 5DZJA 4XBMA 1LDSA 2FSEB 5LB1A 4HZLB 5HDBE 4N28A 3VXSA 5GRYA 5T1DL 2ESVD 2N01B 2VW7A 1CB4A 2HG5A 3ZL4H 3VFNB 4NGHL 2BHZA 5HGGS 4CU7A 3G04A 2PWDA 3E3QE 1W0VB 3AQXA 4QD2E 5AUMA 2B0SL 1PBYA 2YMXH 1IM3B 1OAKH 2GW5A 4B96A 5E5MB 4AZUA 2WXIA 1UFUA 4KI5D 5CP3H 3IKCB 4MZIA 4QYOB 3WENA 1TTRA 1N5YL 3SJVD 4KY1H 2OCJA 5TE4H 4OCYH 4EXKA 5DZNA 2HT2C 2HPOA 2DM4A 1F4HA 4TNWK 2X4RB 3R4RA 4HSQA 2EXYD 1RUML 1VFAA 1DL7H 1X9RA 5E8OA 5T3ZH 3WFCL 2C4XA 5FUCE 1RZJL 3VXUE 2AGJL 2G9KA 3QZWG 4QY8A 3R0NA 4M6OH 2EIJB 1C8PA 1YEWA 5ITBH 4KDWA 4OKDA 4XVUD 3IN0A 1AGBA 2IBBA 5EMYA 3IRCA 5FA4A 1P7QB 4MMZB 4QHLB 2FJSA 1H3UA 4DO4A 2EDOA 4EN3D 1HHKA 3MRQA 2F54B 3SE9H 1BBDH 3CBRA 4AE1A 4OD2A 2JQAA 2P5WA 2O6CA 1ZTXE 1RIVL 1ZSDA 4QWWC 4Y2NA 2PPEA 2KZ1B 3IJ9A 1HNGA 4NB7A 2W94A 1W72B 4MNQB 1FN4B 4LLVB 3FUFA 3H7BA 4OVVA 4QRTA 3QI9C 1LQBC 4RQQB 2ZX8A 3ES6B 3LIZL 2JELL 3KWTA 4U7MA 1NBVL 1ACYL 4N2AA 1EZVX 4D2NA 4HKXA 1NGXB 3EYVB 2F53A 4NI3A 3L3DB 3ETBJ 3DVGA 1S5HA 4Z7NE 1NEZB 3K0WA 1AR1B 1ZGLA 2CO4A 2BCMA 3W1ZA 4IBLT 2JI1A 4IEFA 4JHWL 2OSXA 3GMLA 2VC2B 4F92B 1I8LA 3HAEH 3B6SB 4YDLB 1LO0H 3GRWA 5T1MB 4Q56A 1NGZB 5E2JA 1EHLL 4LLAA 3QORB 3MJWA 4KOBA 4Q9BA 3RWDB 2GITB 4K7PH 4MBRA 2PCPB 3V0VB 2WLHA 3ARFB 4ACPA 1FZMA 3MNWA 4LMQE 3BKCL 2ZWNA 3IRPX 4LESA 1TZGL 2VDOB 4N2HA 4OT1H 3J27A 4UU9A 4N24A 5C2BL 1TCRB 4PG9A 3X11B 2XZCH 2F58H 3FO2A 5IQ9B 4ZX6A 1Y0LA 1DVFB 5H4ZA 4BQBA 4DN4H 4V1DD</