1N1EA

Crystal structure of leishmania mexicana glycerol-3-phosphate dehydrogenase complexed with dhap and nad
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
349
structure length
349
Chain Sequence
KDELLYLNKAVVFGSGAFGTALAMVLSKKCREVCVWHMNEEEVRLVNEKRENVLFLKGVQLASNITFTSDVEKAYNGAEIILFVIPTQFLRGFFEKSGGNLIAYAKEKQVPVLVCTKGIERSTLKFPAEIIGEFLPSPLLSVLAGPSFAIEVATGVFTCVSIASADINVARRLQRIMSTGDRSFVCWATTDTVGCEVASAVKNVLAIGSGVANGLGMGLNARAALIMRGLLEIRDLTAALGGDGSAVFGLAGLGDLQLTCSSELSRNFTVGKKLGKGLPIEEIQRTSKAVAEGVATADPLMRLAKQLKVKMPLCHQIYEIVYKKKNPRDALADLLSCGLQDEGLPPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Leishmania mexicana Glycerol-3-phosphate Dehydrogenase Showed Conformational Changes Upon Binding a Bi-substrate Adduct
pubmed doi rcsb
source organism Leishmania mexicana
molecule tags Oxidoreductase
molecule keywords glycerol-3-phosphate dehydrogenase
total genus 129
structure length 349
sequence length 349
chains with identical sequence B
ec nomenclature ec 1.1.1.8: Glycerol-3-phosphate dehydrogenase (NAD(+)).
pdb deposition date 2002-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
A PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1n1eA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1n1eA01
2X8LA 2NTJA 1Y9EA 4PFJA 1QYCA 5JMPA 2HK7A 2H63A 2OBYA 4IDEA 1U8FO 1Z45A 2FHSA 1MA0A 3BIOA 2GASA 4PLYA 5JW6A 3VC7A 4FD3A 1ID1A 4RQTA 1LQUA 3VAZA 5L7TA 1F06A 3A4VA 1NM5A 2GDZA 2DFVA 1VJ0A 2HJSA 4I9NA 3CKYA 3PPIA 3FBTA 5JC8A 4XEHA 3CZRA 1GY8A 4BMSA 1Y9AA 5H82A 2X4GA 1V0JA 4BGIA 2XOXA 5JCJA 4A5OA 1G1AA 4LSMA 1PJ2A 4FGWA 2A35A 1KS9A 1E1KA 3ETEA 2G5CA 3LF1A 1J49A 1EBFA 4M87A 4XRRA 4WLFA 3HZZA 2O50A 4KOAA 4MIOA 1CEQA 5COBA 1LRLA 1E0DA 2EP5A 3BMNB 3QIVA 1E6UA 3OHSX 4RVUA 4PVCA 5TIIA 2CD9A 1DB3A 2FRDA 1N7HA 1Q0QA 5CPBA 1EQUA 3K30A 2ZTUA 4Z0PA 4RL6A 4E2ZA 4BO9A 1HE3A 4EUFA 3V1UA 3WG9A 1UP4A 1FXSA 2HMSA 5DBGA 3PHJA 5DBFA 1DRUA 4HNGA 5DULA 1D1SA 5JAMA 2RHRA 4QO8A 4IGFA 3RC7A 1SB9A 2FMUA 2VUUA 4BNGA 1P74A 2EKQA 1FDTA 1QLJA 1PIWA 1RWBA 1E3JA 3QWIA 2C2XA 4I9UA 5I9MA 1SAYA 4RVSA 2HJRA 2WD7B 3E9NA 4GX2A 1LU9A 3KV3O 1B0AA 5AYVA 1T2EA 3MZ0A 3HN7A 3RUEA 5IN4A 4WLVA 3QY9A 1OZAA 1U3WA 3CUKA 2VRCA 5KJFA 3DTTA 1E7WA 1KEWA 4ZRMA 2NM0A 4TSKA 1ISMA 2X6TA 3QVTA 1KY4A 2YY7A 1N9GA 2BFMA 3GG2A 1XSEA 1JWBB 1LRJA 2JD2A 3NT2A 1LDYA 1L7EA 5DCWA 2BGLA 2RHCA 3NJ8A 3RBVA 4Q3CA 1YBAA 4P4LA 1IL0A 3I23A 2DBQA 4R54A 4YT4A 1IHXA 3ROQA 4BO0A 4B8WA 3GFBA 4GWGA 5ICMA 3EK2A 1GR0A 3AM4A 3PHHA 3GHYA 1DPGA 1VJTA 3C85A 1UR5A 3WGIA 4WECA 4Z9YA 3R6DA 3PDUA 4FN4A 1QMGA 2BELA 2FPPA 5IZCC 4IJWA 4R16A 3PVZA 2HKIA 2Y1CA 3UHAA 1LSJA 2C07A 3RSHA 3VKUA 3CXRA 1CJCA 4ND4A 5FFFA 1YO6A 2WD8A 2O23A 1C1XA 4R1TA 4R68A 4B4VA 3JYPA 1YWGO 4UVDA 2B4QA 3ANLA 2YHUA 5I9NA 4ZQEA 4CMKA 5JE8A 3NAQA 3PLNA 4CMAA 3E5RA 3MOIA 4DGSA 1W8DA 1KVRA 4HFNA 1E5QA 1P1HA 3I9OA 3DBRA 4J7XA 4YR9A 4QECA 1LDGA 4CODB 2HMUA 2WE8A 1Q0HA 3ZV5A 3GUCA 4R41A 3C7CB 2WYWA 1BDMA 1XLTA 4FFOA 2EKPA 4PLWA 4U5QA 3GGGA 1EVZA 1QP8A 2PH5A 5KNLA 5G2OA 4NIMA 5IDYA 5IN5A 3F46A 2C29D 3L77A 1R12A 2EJWA 1LDEA 5TLSA 4JN6B 4OSPA 1GAEO 1TI7A 3LT4A 5DOZA 3JQFC 2H6EA 2DT5A 3QQPA 5C7OO 4J90A 2W2LA 2PZKA 2WEKA 3P2OA 4FGSA 2QYSA 2P5YA 2E82A 3TZCA 3ZW9A 2DFDA 3GVIA 1F8GA 5KJEA 4E5MA 3DZJA 1TB4A 4YPOA 1C1DA 4ALKA 3D7LA 4AVYA 4EW6A 3EDMA 4QT0A 1Y8RB 4PVDA 1IPEA 4YYZA 3GA0A 2IZ1A 5EMHA 4FBGA 1OOEA 5L7YA 3OECA 3ROMA 3PGJA 2C5EA 3WB9A 3D1LA 1V9LA 2DUWA 3NV9A 1EUZA 2Q45A 3PHIA 3PJDA 4I5GA 5JAQA 3MWDB 3Q0EA 1A5ZA 5A03A 1DJQA 4IJVA 3MJTA 4NBUA 3KYDA 4W7IA 3JYQA 1I36A 3GMSA 3KEOA 1HT0A 2VZ9A 2PD6A 1PJ3A 4R69A 5KTKA 2AQ8A 3W6ZA 4GKBA 2GLXA 5THKA 4F6LA 1AHHA 1QV6A 2D59A 3D3WA 1W73A 1PJSA 3U4IA 4CUJA 4DLBA 1DIRA 3R0IA 2VUTA 3MJCA 4RPHA 1ORRA 4UEOA 2VNAA 4M89A 5TS3A 2JD0A 2NNLD 2P91A 4DIFA 3RU7A 2QRJA 3CZMA 4IINA 1PEDA 3RASA 4BIIA 4Y6RA 3VOSA 2JJYA 4WLUA 4WOJA 2DVMA 5C7IO 3T4EA 3B70A 3GGOA 4XA8A 5BNIA 3EMKA 3VVBA 4BNWA 2GF2A 2G82A 2PKQO 1J0XO 2I5PO 4JK3A 1TT5A 1Z6ZA 2NQTA 4RCVA 2Q1SA 4S1VA 3RBXA 4TZKA 2UDPA 1R0LA 4MP6A 1LC3A 1N8KA 1JKIA 5F1OA 2D0IA 3WGHA 1JDJA 5CDGA 3PWZA 4QFCA 5CEJA 4KWIA 1NVMB 2Y1OA 2VYVA 5L3ZA 3GNQA 2AQIA 2Q1TA 2FPGA 1DC4A 3DBHA 1HDOA 2XXBA 3JQFA 3Q2KA 1HDZA 4MVJD 2IRWA 4I5EA 4XJTA 1XU7A 1MX3A 5LDGA 2DUUA 1X15A 3WS7A 5K0ZA 2JCXA 4CM5A 1GFSA 1DFHA 1DIGA 3SLKA 1PGPA 2IYOA 1SMKA 3GNSA 4UREA 4XR9A 4A03A 4CMIA 4EUHA 1AXEA 2X5OA 3IMFA 1MFZA 4PRLA 1A4IA 1PJCA 3FPCA 3R3SA 2WWRA 3KSDO 4PIVA 4CM6A 1YBMA 2YFHA 3EZLA 1DHTA 3HDHA 2PGDA 4LCEA 3ZZNA 4XGIA 4RGBA 4YRAA 4D0RA 2HRBA 2YQ4A 3GZNA 4JROA 2JCYA 1ONNA 4FDAA 2RH4A 1L1FA 2Q1UA 4BNMA 4LVUA 4AJKA 3C7DB 1K6JA 3K92A 1ONPA 3GQVA 1IUKA 3WFJA 1HL3A 4IZIA 3BTOA 4QX6A 4D3SA 3DMTC 1DAOA 3VH1A 4P22A 4RF2A 3W4JA 2OGUA 1DBVO 7MDHA 1R4MB 5GMOA 2VN8A 3RD5A 4B7XA 1ENZA 4BNZA 1YQGA 4OQYA 2PY6A 2WSBA 3WMWA 2NUAA 3GMDA 2QHXA 3CTVA 3OIDA 2BRUA 4B3JA 1H94A 2NLOA 2NU7A 3GVPA 4ZHSA 4J4BA 2RCYA 1HLPA 2FSSA 2RBEA 3ZNQA 5JLAA 1VKOA 1V6AA 4YBZA 2Y0CA 4RF4A 1HE2A 4NBVA 3OIFA 1R6DA 3GZ4A 1E3WB 1RM0A 3D4OA 1YXMA 2ZYGA 5CDUA 3RJ5A 4XKJA 1Q0LA 1E7RA 4LMPA 7ADHA 3LVFO 1ZK3A 4BB5A 2EHDA 4H16A 1EBUA 2D4AA 1H9BA 4LN1A 5A05A 1U4SA 2YYYA 1DAPA 3U09A 1PWZA 2JD1A 2NWQA 4BNHA 5L4SA 5IDWA 1A72A 3NT4A 4A27A 1TVEA 3E8XA 2B4TO 4MVJH 1JVBA 3I9KA 5I8WA 4CLXA 1ZCJA 2LDXA 1J6UA 2HAEA 1RM5A 1WMBA 3OP4A 3QVWA 2BMAA 1GCUA 5ITWA 1CF2O 1ZSVA 2FZWA 4R1SA 4BO6A 4IDFA 3ONEA 4CM4B 1H0KA 1NPDA 2X86A 4XD2A 3HWRA 1Z7EA 1P44A 5ENDA 3EZYA 3JD3A 3G0OA 1WVGA 3DAGA 5KVQA 2CF5A 5T64A 4EEZA 1C0IA 4OOEA 4F45A 1JW9B 3S55A 1BG6A 1GV1A 3U4DA 4CMEC 1OBFO 4PLPA 3JQ8B 1NNUA 4CV2A 2VUSA 1IY8A 1YQXA 4NZ9A 4XZ3A 4BGEA 2NVUB 5I7SA 2SCUA 3M2PA 4OQZA 4CR6A 4E31A 5HM8A 1LEHA 1DRVA 2X0IA 3JQCA 4NJMA 4DQUA 4AL4A 2PLAA 2CDCA 3FI9A 5A9SA 1ENPA 2BLLA 3O8QA 4NFHA 4YRDA 4CUZA 3WGYA 2Y0EA 3ZHXA 4E5PA 1B16A 3PJGA 3I1JA 1LLDA 1M6WA 1AE1A 4PZDA 4XB2A 4E3ZA 5AVOA 2X0NA 5L53A 3HDJA 5JCXA 3U4CA 2EW2A 2GRAA 1W4ZA 4DMMA 1Y1PA 4MPDA 5ER6A 5CPFA 3KXDA 4OSOA 2FZEA 1S7CA 4BNYA 4BKOA 1P9LA 1E7YA 4WPGA 5KCZA 1DIBA 3PLRA 4NJOA 4Y6SA 4KTTE 1YL6A 1QYDA 3WYBA 1U3TA 1QORA 1CYDA 3Q1LA 2AEJA 5BNTA 4UVGA 5ADHA 2Z1NA 1SCUA 3KSZO 4XQEA 2YUTA 3D4PA 1XA0A 1OC2A 3VZRA 1YL5A 3FSRA 3TOZA 4W99A 1IPFA 1HKUA 4LSWA 4QSMA 1YJQA 3D5QA 8ADHA 4BS9A 2O3UA 3FF4A 1LDMA 5CDTA 5K9ZA 2E48A 1V3UA 1T4DA 5A3JA 4U8GA 4KUHA 3GPIA 3KYCB 4B4UA 1ENYA 4I1IA 2VWPA 2IDZA 4URFA 1D7OA 3LC7O 4E30A 1DFIA 1ENOA 4M1QA 3OIGA 3FN4A 3GOHA 1JQBA 3LSYA 1MV8A 1SBYA 4OYRA 6ADHA 3F1KA 2Q4BA 4L75A 4AICA 1DC5A 2CVQA 4N5MA 2R6JA 4II3A 4CMBA 1ISGA 2OFPA 1DRWA 1ZSNA 4E32A 4ALMA 1IYZA 1HE5A 3RIHA 1I01A 3TZQA 5HS4A 3QWAA 3RVDA 3WSWA 3IUSA 3H9EO 4HX5A 2P5UA 4DC0A 3DAPA 1E7QA 3ETDA 1XU9A 3IIEA 1WDLA 3JQGA 3OQ6A 3EGOA 1CIVA 2QRKA 1JTVA 1KBZA 2GUGA 1MG0A 3AFNA 2HU2A 1CDOA 4FFLA 3UAGA 1DIAA 1MG5A 1VSVA 2NV6A 3UGKA 1PR3A 3RJ9A 4QUKA 1SO8A 4DLLA 2ZCUA 5DNAA 4DLAA 1TT5B 1ULUA 3DR3A 5CP8A 1WZIA 4GMGA 1TXGA 4FW8A 1KYQA 1WDMA 4XDYA 2OMEA 4UUNA 2EWMA 1GZ4A 3BMCA 2GGSA 4U0JA 1JWAB 4D3FA 1T2FA 5ICSA 5BT9A 2RIRA 3JQAA 4L9RA 1KC3A 2E4AA 2O3JA 3HNPA 2IZ0A 1GEEA 4RDHA 5KWEA 3I9NA 4FFPA 2B69A 4YCAA 4WLNA 3C8MA 5TJ9A 1SB8A 3G1UA 4IQ8A 3IAHA 1O94A 1U3UA 4OHUA 4R3WA 4TRJA 4Y67A 1DLIA 2P4HX 3RU9A 3JD2A 5L95A 1XR3A 3SXPA 2W4QA 4R1UA 2UV8A 1WMAA 2JCVA 1EQ2A 5L40A 4BNJA 4R9SA 4BKPA 1H2HA 4ZD6A 1WAMA 1E6EA 5J23A 1NWCA 2JHFA 4M55A 3UUWA 3N58A 3U49A 2HLPA 1MGOA 2AG5A 1Y7TA 3MEQA 2XPCA 3JSAA 2W2KA 1VL6A 1IE3A 1UJMA 3ADPA 5KKCA 4PRKA 4FS3A 4WEOA 1LI4A 3L0DA 3PDJA 1Z73A 4E2XA 5A06A 2OORA 3GEMA 1NQOA 1ZEJA 5JXWA 3I83A 1NXQA 1QRRA 5JDCC 1MXHA 2PGJA 2VHXA 3PP8A 3GVCA 1A4UA 4BMNA 4HY3A 4J16A 1P1RA 3K31A 4E6PA 5IXSA 2WYUA 4TQGA 4BL5A 4NU6A 2WE7A 4JBIA 5HBRA 4ZVVA 3VPSA 2PK3A 1QYXA 2ILTA 4NBRA 3IP3A 2DM6A 1ZIDA 2XAAA 4YVFA 4RF5A 2HUNA 2PKRA 4B7CA 1RM4A 3ANMA 5CG2A 4DL9A 3F5SA 4J43A 3MJSA 1M6HA 1PJQA 3SJUA 1PS8A 2Z5LA 2DTXA 3GRKA 5JC1A 2D2IA 1DDOA 4CLOB 2HQ1A 5A9TA 4C7JA 3HFSA 5B12A 5CHEA 2D5CA 3ZHBA 3IS3A 4XYLA 1EDOA 4O63O 1DFGA 2AW5A 2V6FA 4RJTA 5TT0A 3H5RA 3I9MA 1HYHA 3AI3A 1GQ2A 3MWEB 1D3AA 1LC0A 3FRJA 1O9BA 3BHMA 3H2SA 4E5YA 4OOFA 5BSGA 4GBJA 1I10A 1E1LA 1DJNA 5TQVA 4EDFA 3JQ6A 2X7HA 2DTDA 3MJ4A 4CM8A 1X13A 3A28A 3DZBA 1ADBA 1BW9B 5DOVA 5JY1A 3HUDA 1TEHA 4PG6A 1B8PA 1YH3A 4OXKA 1EFLA 4EUEA 4WLEA 2Q49A 4TZTA 4NH4A 1QXSA 3OICA 1UDAA 2O7SA 2UYYA 3QVSA 4FJ1A 4RLSA 3RKRA 4IJUA 2O3TA 4OKIA 1E77A 2PZJA 3WXBA 4BV9A 3TFOA 5FF9A 5JO9A 4CR8A 2J3JA 1J4AA 1KVTA 4UEJA 3IL2A 2ZTLA 4ND1A 1XQ6A 4K28A 4WCDA 3AI2A 4YJHB 2OHXA 1E7SA 2C0CA 4XYBA 5CG1A 3GK3A 1BRMA 1MC5A 5G0TA 4NPCA 4LRSB 3U62A 4AJLA 1C14A 3ZV6A 4EJ6A 1EUCA 2EF1A 2O2YA 2AE1A 4N18A 4LRTB 3W4IA 1U7HA 1YL7A 4AJJA 1JA9A 4JCOA 3QVOA 5KJ1A 4D3DA 3H5AA 1OAAA 5F1PA 2WTBA 1N7GA 1O89A 3K2EA 4FFMA 1BXGA 3S8MA 4ZU3A 5CAEA 2VWGA 4Q9NA 3WGGA 1T2CA 4AJEA 1RPNA 4J2HA 3U9LA 4BNUA 3I9JA 5JY6A 4ZQFA 1HZZA 2FR0A 3PJEA 2HMWA 4XYMA 1U1IA 4XR4A 1N9GB 4R3NA 1X7GA 1XIVA 1X14A 1KIFA 2YJZA 3OQBA 4D79A 3PI7A 3ZWXA 1CQIA 1YOVB 4BUCA 1T24A 2VHVA 5C37A 3N7UA 1YONA 1W0CA 3FCOA 1KVSA 4BO2A 2Q2QA 5DZSA 5DCUA 3NDJA 3TSCA 3Q11A 3RWBA 3P19A 3GPDG 4GPD1 3WWYA 4IDCA 4ALJA 1R0KA 3OJFA 1A27A 1MXFA 3KBOA 3NJ4A 4U0KA 4CQLB 2IXAA 4J91A 3KETA 4IM7A 4RVHA 4I5DA 1M2WA 2DBZA 1I24A 3IJRA 3ABIA 4CLHA 4IS2A 2NTNA 3DZGA 2QYTA 2J5QA 4FFNA 4FPXA 4J3FA 3WGTA 3JQBA 3LC2O 4IZHA 3WJ7A 4XQCA 1K5HA 2O3RA 1U2GA 2JAPA 3ZWAA 3L6DA 3VHRA 5C7LO 3NUGA 4NBTA 1LX6A 5G0WA 5BSFA 3TZKA 2JL1A 2NU8A 1ZXLA 4WNCA 5JYDA 3OFSA 1E3SA 1UXKA 2CY0A 3K5PA 4O0LA 4GLOA 1E3EA 4NQZA 3DFUA 1VL0A 2RAFA 3GLQA 3V1TC 2VTDA 1RYEA 5CFZA 4XCVA 5JFOA 1UAYA 3Q9UA 1LUAA 2EW8A 3D3EA 3DOOA 5COAA 3NX4A 1IZ9A 2PZLA 1X7DA 3H9UA 3TQHA 3DXFA 1H2BA 1R4NA 1V3TA 2QIOA 2D8AA 4ONEA 1NQTA 3DMTA 4PN3A 1F0YA 4DA9A 5I8ZA 3LT0A 4Z6KA 1NAIA 4AJOA 4XWYA 5I7FA 1YRLA 3RUCA 1R37A 5BR7A 2OUIA 3FR8A 4XGNA 1LBEA 3ZNOA 4H3VA 1E3LA 1ZO8A 4DIBA 4WCFA 2J5RA 4PZCA 3WGOA 1WXDA 4XIYA 3AW9A 2DC1A 3FR7A 4JJIA 4YTEA 3WQRA 1T4BA 3ZWMA 3E5MA 1U7TA 2C59A 2HK8A 1MUUA 4M86A 1E7MA 1ZNQO 1C3VA 4NFSA 3RC2A 5LDHA 1N1EA 4Q3DA 3OQ1A 4YAIA 3JQAB 3JQBC 4CLRA 4OKNA 4AG3A 4IGEA 1A7AA 4A10A 4YJGB 1B8VA 5KVCA 1DC6A 3K2BA 5JAZA 5I7EA 2CSUA 4JLWA 3RBZA 3PFFA 2ZYAA 2Q2WA 1AGNA 3WIDA 3SC6A 4BO4A 4YT8A 3QWFA 4CL3A 5IDXA 3GRPA 1YBVA 1CERA 4TRNA 1YKFA 5JAIA 2O2SA 5KKAA 2Y68A 1QYWA 3A14A 3V2GA 1KETA 1B3RA 5KJ6A 2EG9A 3INTA 4YAGA 1DC3A 5TSDA 4D7AA 1WWKA 2E6UX 4NMHA 2B37A 4AJ1A 4B79A 2ZIZA 1B8UA 4CLDA 3N74A 3TJRA 3C1TA 1EFKA 1GU7A 3FNHA 2E37A 3AOEA 3EW7A 1SNYA 4CV0A 2H9IA 3C24A 3VVCA 2EIHA 1ULSA 4PLFA 4N7RA 2Z95A 3DHYA 4CMEA 4KDFA 4HADA 3T7CA 1XELA 3UICA 3W8FA 3QW2A 4AFNA 3P5SA 4CM4A 3DZHA 2IODA 1BWSA 4JJGA 2F00A 1UZNA 4A26A 5EPOA 3H9GA 3KEQA 3PEFA 1QYVA 4FB5A 3PQEA 3WSVA 3JYOA 1I8TA 2VT3A 3ZWYA 2YHIA 3A1NA 1PWXA 3U5TA 2B0JA 3KM0A 4BMVA 3LC1O 5A9RA 2Q1WA 3ZWWA 3DEYX 3JQ9C 4DYVA 3RUAA 4IUYA 4BNFA 2NVUA 5HTOA 2AE2A 4Q3EA 3F3SA 1X0VA 2Z1MA 1U28A 3K8ZA 4FQ8A 3RAJA 4D42A 4J7CA 1TA4A 2VT2A 5AQ1A 3T7EA 4MKZA 3AU8A 4Z3DA 3NT5A 5A9SB 1LLCA 1X1TA 3KOUA 1ZKMA 1G0OA 1LXCA 1H6CA 3ORFA 4TMFA 1Y8QB 5G0VA 4PG8A 3L9WA 2VTEA 3D64A 3U4HA 2OBNA 4WASA 4ND5A 4L8VA 2C54A 4BO7A 3EYWA 5C3MA 1JKJA 5FI5A 2EGGA 1BVUA 3QRWA 3TDKA 1AHIA 1PS0A 3NYWA 1ISHA 1KVQA 4EZBA 5AXDA 3H7AA 1PL6A 5GZ6A 2J3IA 4QXMA 4UUMA 2GPTA 3UW3A 1NVGA 4C7KA 3CEAA 3F1LA 1FDVA 1PJTA 3S2FA 4ZICA 1A9YA 1IZ0A 5COQA 3GDGA 3QJ5A 2FR8A 5ILGA 4NNJA 4CLOA 3L4SO 2J3KA 4I8XA 2YDYA 3HADA 2DU8A 5F3RA 3ROPA 3WIEA 3FD8A 4BNTA 4E33A 5IF3A 2GYYA 4HWKA 1YJ8A 4GSLA 1SEPA 3ZU5A 3ZW8A 1R4NB 2A9FA 3EVTA 4XIJA 4R1NA 1HF3A 3BHJA 4YAJA 1UP7A 5TT1A 4L0QA 2I9PA 4YACA 3PFWO 2PH3A 4RVFA 3W1VA 1GUFA 2VOEA 2IYPA 3JQ7B 4G65A 1EK6A 4DPKA 4J0EA 4DXHA 2FWMX 1B2LA 2IE0A 4CM8B 1I2ZA 4NG5A 1ZFNA 2OL4A 4UAGA 1BVRA 1EVYA 3HB5X 3C7AA 4ID9A 3PK0A 2HDHA 3KO8A 1Q1NA 3V1YA 3O03A 3IOYA 4WK6A 4D41A 3UOGA 4II2A 3ASVA 1NFQA 5DBIA 3H3FA 5HS6A 1HTBA 5JPIA 1PZGA 1K0UA 4RVGA 1GYRA 4L74A 1R66A 3LF2A 3HG7A 3VDQA 4W82A 5L4LA 2I65A 3GAFA 4CL8A 4OGWA 2PGLA 5JBIA 4YT5A 1KEUA 3H65A 5HRUA 4YJHA 2JHGA 2I76A 2YQ5A 1B7GO 4AJHA 4FOSA 3G17A 4CV3A 4P38A 2ZKLA 4RPGA 2ZB7A 3SX2A 4RPJA 1PL8A 1GZ3A 4HFJA 3KB6A 2Q2VA 4XYGA 1ZSYA 3V8BA 2GERA 1UDCA 2G17A 3JQ7A 1LSUA 1NQAO 4LW8A 1LSSA 2VQ3A 2X5JO 4BNKA 1KEPA 3F4BA 3MTGA 3TL2A 1EK5A 3JQDA 3WYCA 4ZQHA 3W8DA 2Y05A 4MO2A 3V2HA 3WNVA 4CMCA 4EI2A 2ZTVA 4K1LA 2Y1EA 1WDKA 2HCTA 2VRCD 2WMDA 1H9AA 3BMQA 2LDBA 3K73O 3F6YA 3GN2A 9LDTA 3WQSB 3X2EA 3ZU3A 1Y6JA 3A9WA 2D3TA 1HDRA 1U8XX 4YQZA 2PD3A 4FFRA 3UCFA 4E5KA 1BDBA 3FWNA 5CEEA 1LLQA 4ZQBA 4YQYA 4D46A 3OJ0A 1PTJA 3LT2A 3Q9NA 3ZWVA 2IZZA 1B3BA 5IG2A 3F9IA 1QG6A 1YQDA 2PTGA 1V3VA 4H7PA 1RYDA 3T4XA 2I3GA 1PL7A 2J6IA 3BXXA 3GUYA 4I9HA 1LTHR 4J9UE 3HDYA 4WKGA 5ITVA 3ICCA 5G0UA 3BMOA 1KVUA 2Q46A 2PFGA 3VPGA 3CTMA 1XCBA 3FTNA 4QEDA 3RUDA 1NR1A 4F3YA 3LLSA 4BV8A 4QQRA 3E6AA 4HUJA 5AXBA 1P1KA 4UVHA 1N2SA 2BFOA 3NEPX 1BXKA 1WW8A 3JQAD 2R00A 1XKQA 3QE3A 4CM9D 1T1RA 1BMDA 2EP7A 2IXBA 1P33A 2Y67A 4JBGA 2R2GA 3UKOA 3WFIA 3JYNA 3MCVA 3KTDA 4XX0A 3ZWNA 1R15A 3BZUA 3V5NA 4YB8A 4QFDA 4GI2A 4DQXA 4IDBA 4KP7A 4CM1A 5A3VA 3AOGA 4MKRA 1KEVA 3EUWA 4OMUA 3PJFA 3M6IA 3DOJA 4CQMB 1UZLA 2E49A 4KUEA 4E21A 4MVJE 1HYEA 3WJAA 1K6XA 2EKLA 4YAKA 2O7QA 4JXKA 1B26A 3DBLA 4J49A 1F12A 2B5WA 4ESOA 2OZPA 2GO1A 5CDSA 3LZ6A 3BTUA 1FF9A 5T6BA 4BQRA 4CPDA 5JDIC 2YFQA 4ALIA 5JS6A 2B5VA 2HRZA 3AK4A 3I6IA 4IY1A 2AEFA 1H6AA 3LQFA 3WTCA 4CJXA 5GZ3A 3WICA 1SC6A 1GTMA 1H6DA 3ADOA 3WLEA 3VH2A 3JCZA 2WYVA 5K6AA 1F17A 4KMSA 1HWYA 4PLVA 2C5AA 5ENVA 3AM3A 1ADCA 2I66A 3DZFA 3WOHA 1HDXA 3W4KA 5JSFA 1SOVA 5CEFA 3PRJA 4IDDA 3QLJA 5G0SA 2QQ5A 2B83A 4YJGA 1TT7A 2HO5A 4LISA 3SC4A 1ZUD1 1WP4A 4FR5A 5TNXA 3SLGA 2CZCA 1N92A 4KTVE 4MKXA 1OMOA 1XGKA 3AWDA 4MP8A 2AA3A 1D8AA 4AJ4A 3DDNA 1UDBA 1FK8A 4WUVA 2NSDA 1LSOA 3TPCA 3TZ6A 5IFLA 2PZMA 4E2YA 1GADO 1JVSA 2P68A 1UUFA 3KVOA 4E4YA 1QLHA 4ZRNA 4RO0A 4XQ9A 5F1KA 3IKTA 2VRBA 3LLVA 3ZNNA 2GN9A 3I4CA 5T8KC 5KVVA 1M76A 5KIAA 1G0NA 2WDZA 1BTOA 5JDCA 4P8RA 1VL8A 4J0FA 1EE9A 4L4RA 5H83A 3WX0A 5MGBA 4RPKA 3I5MA 1E1MA 2C7VA 1NX6A 1UZMA 2CFCA 5TX7A 4UUOA 1EZ4A 3WTBA 1GYPA 1I33A 2DKNA 3LU1A 4BVAA 2TMGA 1HE4A 2GNAA 3ASUA 4RF3A 2AHRA 3M1AA 3IP1A 4MVJA 3ENNA 4Y8VA 4C4OA 3CIFA 3NGLA 5B37A 3ZWPA 5EERA 5JMWA 3EC7A 5IZ4A 4M8SA 3ONDA 4LMRA 4GVXA 3AI1A 1DIHA 4W9NA 3ZV3A 2AQKA 2YDXA 4GX5A 4E13A 4H15A 5ILOA 4RDIA 2PV7A 3GDFA 2XXJA 4P4NA 1ZJYA 1A9ZA 4BNIA 2WM3A 2I99A 2X5KO 3L4BC 3OEYA 2ZB4A 3PXXA 1GYQA 3Q6IA 4J4TA 3ZWOA 4Z9FA 1PGQA 4DBZA 4EBFA 3GN1A 3BHIA 3JQGB 1CWUA 2VZ8A 4ITUA 3NKLA 4ZQGA 4KZPA 4MDHA 1VM6A 4NHEA 1H5QA 1UAGA 3QA9A 1D4FA 3RUHA 2F1KA 4IMPA 2TMDA 3GAZA 3I4FA 3OA0A 1I2CA 4D44A 2VNSA 4XGKA 1X7HA 5A02A 4I08A 3UCEA 4OM8A 5GY7A 4DVJA 4PLCA 4GVLA 2VYND 5ES3A 2CDAA 2VZ0A 2B35A 1LA2A 2X1HA 3BMCB 3G1TA 3OEWA 1P45A 3NTRA 5HA5A 1FMCA 3O8QB 4U6QA 1PQUA 1Q7GA 2CF6A 2X23A 3ZDFA 4R9RA 4DPMA 5TF4A 1RJWA 4DUPA 3COSA 3GNTA 4KDEA 3RROA 4J7UA 4YJFA 1O95A 4DMLA 1GCOA 4O5OA 3AY3A 1I3KA 2P9GA 3NTQA 3BMOB 4DWVA 4CQMA 1O6ZA 1YDEA 2V7PA 4EITA 3DO5A 5T57A 4YA6A 3JQ8A 4CM3A 4X54A 4BNNA 3O9ZA 4JQCA 3H2ZA 5F5LA 4IMRA 3KHUA 1YB5A 1FDSA 4BO3A 1ZK1A 4WCFB 1NR7A 4WJZA 3ZU4A 1K89A 1T1SA 5AOVA 4O6VA 1M66A 3ST7A 1UP6A 1QV7A 2W2LD 1WZEA 3E1KA 4PLGA 4WOKA 4IIVA 3DAFA 3KLMX 3I3OA 2JFHA 1PSDA 1KC1A 4MVJG 1JU9A 3HHPA 3RKUA 4CM7A 4E5NA 3TOXA 3U0BA 3V2UA 1NHGA 4CLRB 3IDSA 2Q4EA 4IDGA 4R01A 1K6IA 1B15A 3ZU2A 1PJBA 3RUFA 3DBRB 4J6FA 1J5PA 3QWBA 2VHZA 1GUYA 3ANNA 3C1AA 2D1YA 2ET6A 5B4UA 4TVBA 4BNXA 4AJIA 1HDCA 5DN9A 1BSVA 4OH1A 2I67A 1MFPA 3U3XA 5A5EA 2HMVA 4U7WA 2Y1GA 4ZJUA 2ZCVA 4J2OA 2VYVD 2W98A 4EEXA 4E2WA 4XJSA 3JD0A 2YW9A 3IKVA 4FCCA 1P3DA 3ZCXA 3H5NA 4FC7A 3AFMA 1HETA 3GZNB 3B1KA 4J9VA 4YEDA 4TRRA 2YV2A 3E9MA 1GQQA 5C5IA 3RFTA 2O3SA 6LDHA 3G79A 3ETGA 2A94A 4HNHA 4XYEA 2PNFA 2OOSA 3AUAA 4HFMA 3GEGA 1C1DB 2VOJA 2EERA 3X2FA 4DIOA 4XB1A 2D5AA 3W8EA 5IAAA 2BH9A 1BHSA 1CQJA 2EV9A 2GD1O 3A06A 4J4HA 1NBOA 2PKQP 3QP9A 4MVJM 1P0FA 1H6BA 4S3MA 2O48X 3ENKA 1OC4A 1P0CA 4W7HA 5G4KB 1GPDG 3C3XA 3GG9A 4ROSA 3PQFA 3DZIA 4B3HA 3PWSA 2A92A 4XDZA 1GL3A 2NTVA 3DZKA 4CLEA 4WEQA 4CQMD 4EJMA 3H6KA 1ZXBA 1I3NA 2DBRA 3JD1A 3JTMA 2W90A 4BKRA 3JD4A 3WGZA 2X9GA 4M49A 2YV1A 3IUPA 1Q2XA 4NI5A 2XF8A 1VJ1A 1GV0A 3PIDA 3KSUA 4PG4A 1R4MA 5A04A 1GQYA 1ZH8A 1U2DA 3TRIA 4IDAA 2BF7A 2OP1A 2DPGA 3DBLB 3F47A 3GH3A 2P9CA 4GKVA 4JGBA 1I5RA 1OI7A 1EVIA 5JNLA 3OETA 2GN4A 1Z74A 3EVNA 2W2KB 3FTPA 3LT1A 1NPTO 4A73A 3B20A 2FY8A 2VHYA 1S6YA 4NK4A 3L07A 3OMLA 3AJRA 1JN0A 4HXYA 3MTJA 4PZEA 5EN4A 3ITKA 1XG5A 5B4TA 3D4NA 3AY7A 1ZK4A 3BA1A 1KERA 2DBVO 2PR2A 2B4RO 3MJVA 3OJOA 4IXTA 3ZWBA 3RFXA 2QZZA 3BAZA 5FWNA 1NPYA 3PYLA 3NGXA 5EJ2A 3G49A 2Y99A 4W4TA 4TKMA 3DBHB 4M54A 4R5HA 5TGDA 1A7KA 3DL2A 3OF2A 5EL0A 4DPLA 4UUPA 4F6CA 1JAXA 4OL9A 3KZVA 1ISJA 3NTOA 1NFFA 2X0JA 4HBGA 5JCJD 4IIUA 4INAA 3FNEA 4UVEA 1R0SA 3O4RA 4MVJI 2IEDA 3WBBA 4CMJA 1NQ5A 3ZV4A 2NVWA 4RZIA 1HEUA 3GVHA 2J5KA 3PHLA 2V6GA 2UUPA 3I52A 1C0LA 3VH3A 5ER9A 1I2BA 1EVJA 3ZN2A 1PR9A 2DAPA 1ZMTA 2QX7A 3NRCA 2Q99A 3KUXA 4Z3KA 4LK3A 4R5MA 1EDZA 2BHLA 5IXYA 1U5CA 1LQTA 2CMDA 5DDIP 4Z0TA 3GY0A 1ZMOA 3F4LA 4GX0A 3OM9A 1Z7BA 1QSGA 2J3HA 2A4KA 1XYGA 5LCXA 2NU9A 1M67A 3HN2A 4FSHA 5EQFA 4CMIB 3B1FA 1M75A 1WLYA 4FC6A 2VWHA 5L7WA 4J1NA 4FJ0A 4BGUA 1PGJA 1NP3A 5DP1A 1PGNA 1PS9A 3F5QA 5G4LA 2YHIB 3G3EA 5L9AA 1A71A 3AUSA 3AUTA 4YJFB 2HK9A 1GDHA 1XQ1A 2DLDA 2FOIA 1FDUA 4YWJA 4YDRA 4J1SA 4BNLA 4FIZA 1YVEI 1GEGA 2QG4A 5TJHA 3L4BA 3HB4X 3ZHYA 2OXIA 5U4QA 3LDHA 2O4UX 4WE3A 4Z0HO 1E3WA 3FHLA 3M1LA 4GWKA 3DQPA 3PZBA 1VC2A 2EGHA 3HE3A 3SVTA 3AOEC 4GLLA 2FN7A 2G76A 3WR5A 4YXFA 3VKVA 5L51A 1L7DA 4IPTA 4MVJP 2GSDA 4TVOA 1P1FA 1EE2A 1SEVA 3OH8A 4BKUA 2GN8A 3EY4A 4ALLA 2V65A 3K6JA 3D0OA 4GX1A 4CV1A 4Y6PA 2AG8A 1H93A 4HKTA 4IBOA 4RV9A 4Z9XA 2EXXA 4PGFA 5BNFA 4QO7A 2G1UA 2QZ9A 2VHWA 1VSUA 3UVEA 1UXJA 3JQ9A 3WWZA 3PHGA 2VWQA 1R16A 3D3WB 4RPLA 3E18A 4A2CA 2BD0A 4PLTA 4L76A 1AUPA 3VTFA 5JDIA 1BXZA 4A0SA 4HP8A 3B1JA 1ISIA 3CH6A 1JLLA 5KJCA 3S2IA 4B8ZA 1B14A 1PQWA 2ZQZA 4G2NA 1YOVA 4OIMA 2C7GA 1NAHA 3O38A 1VKNA 3Q3CA 3WLFA 3H9QA 3ROKA 2NU6A 3PWKA 1XEAA 3STHA 3UCXA 4OXYA 2AXQA 5IJZA 3OJEA 3CSDA 3ITDA 4PCVA 5THQA 3INGA 5LC1A 3DBVO 4O59O 4CM9A 4CQLA 1Q7CA 4AJPA 1TLTA 4BOYA 5IZCA 5T8KA 5L45A 3WNQA 3GF4A 2V6BA 3K9QO 2BFPA 1YB1A 4BQPA 4MOWA 4B4WA 1MB4A 4KQWA 4GQAA 3I9LA 3KLPX 4WCFC 1EEHA 1YGYA 3PYMA 1KY5A 3QVXA 1QR6A 5K6AC 1HDYA 4ND2A 2BKAA 3DTYA 1UXHA 1GD1O 1F14A 3I6QA 3E03A 4YT2A 2ZB3A 1VRWA 2NADA 4N54A 1ZBQA 3Q2IA 1N1GA 4GAEA 4W9NC 1XWFA 1ML3A 3RC1A 3ICPA 1U3VA 1VPDA 2GZ1A 4GH5A 4GL4A 4JP3A 3KRTA 3WMXA 1E5LA 2OP0A 5JO0A 1V8BA 2C20A 3FNGA 1GPJA 2CDBA 1O5IA 1OFGA 4GSKA 2VCYA 1P31A 1MLDA 1DHRA 2ZB8A 1K3TA 4WLOA 5EESA 3JQEA 2X0RA 3WYEA 4D45A 1ZK2A 2UAGA 4GMFA 5TRTA 1U9JA 1DEHA 1LDNA 3SBOA 4BO8A 5AXCA 4IJKA 4JX8A 2ZYDA 3SEFA 4FJ2A 4PLHA 3DHEA 2GZ3A 3WGQA 4P4GA 2Q50A 1N5DA 2B36A 5U1PA 4AJNA 1ADGA 1RM3A 3TZHA 5MDHA 1ISFA 4IXWA 1LJ8A 2P4QA 1D1TA 1NYTA 5EQDA 1I30A 2X9NA 2CVOA 4NDNE 4WGGA 3CPSA 4G5HA 4HFRA 1PZEA 1HLDA 1YS4A 3OJLA 2YV3A 1C0KA 3C1OA 1W6UA 1ZVMA 3RQSA 2ZTMA 5HWSA 2BGMA 4KWHA 3VZQA 3DONA 1Y5MA 3BTSA 4IQ0A 3RCBA 2GCGA 1HSOA 4LVCA 4CR7A 3PZRA 4F46A 3AY6A 1PZHA 4ALNA 3W6UA 1EUDA 3QV1A 1C0PA 3R3JA 4W6ZA 3B6ZA 5GZ1A 2FR1A 3L9XA 5KOIA 4TKLA 4D43A 1Y8QA 2HSDA 4E12A 3L6EA 4K6FA 4B7UA 2VYNA 4XQGA 4L4XA 1JAYA 2BI8A 1UH5A 4YAEA 4BNVA 4ZN6A 2YZ7A 3GGPA 3H9JA 2WD7A 3NDRA 2R00C 3TWOA 1X0XA 4DTIA 2UUOA 3GT0A 4KQXA 4JP2A 1AN9A 4QTZA 4NR0A 3LK7A 3RI3A 3UXYA 2JAHA 1E6WA 4KUGA 1NHWA 1HRDA 3GVXA 3GHHA 3ZH2A 2AMFA 3VZSA 1IB6A 4K26A 4I5FA 1PU2A 4J1QA 4L4SA 5CDYA 2C82A 3LYLA 2GR9A 2ZK7A 4MJLA 1EMDA 3WQQA 1SPXA 3VTZA 3S2GA 2FPIA 4MIYA 4E0BA 2JFFA 2G0TA 4R4JA 4B3IA 5B1YA 5DF1A 1LDBA 4Q3BA 5H81A 5I9LA 4D0SA 3CMCO 4NJMB 4CMGA 4G81A 3VZPA 1ZEMA 4BHTA 4J1TA 4TWRA 5AXAA 1FJHA 3GEDA 3VPXA 3VPHA 3OSUA 3MOGA 1Z75A 1VI2A 4PG7A 3AUUA 3OBBA 3HFGA 4OAQA 3HDQA 4UULA 2Y1FA 2JFGA 3R1IA 4UVIA 4N5LA 5FYDA 2X58A 2Y1DA 3BMNA 1LNQA 1NVTA 2I6TA 4NU5A 1X1EA 3MJEA 5EIOA 4RQUA 3H3JA 1P1IA 1T25A 4GGPA 4R51A 3E9QA 2EEZA 4XRGA 2BGKA 2CUKA 4Y9DA 4LCJA 3KYDB 4K9DA 4EYEA 2V6MA 2P9EA 3FPLA 3DMYA 1LRKA 3ZGYA 2DPHA 2J8ZA 2Q3EA 1Q7BA 2PA3A 3RUIA 2GZ2A 4CUKA 3IJPA 1PJLA 3P7MA 5FI3A 4JJFA 1U4OA 1KOLA 4MP3A 9LDBA 1LLUA 2AEMA 2CNBA 3M2TA 3ZI0A 5A4DA 3AU9A 1BGVA 4N5NA 3VPFA 5I7VA 1CRWG 4UEKA 3TFQA 3L6OO 3JV7A 4CMHA 4B4OA 3CMMA 3EHEA 5IDQA 8LDHA 1HDGO 3FNFA 1Y5RA 2H5LA 3UFXA 1K2WA 3TL3A 2W8ZA 5FEUA 2PWZA 4PLZA 3WDSA 3PYXA 4L73A 4U6SA 2OO5A 1Z82A 3GC6A 4Q3AA 3TF5A 1DOHA 2NQ8A 3E48A 1T2DA 1ADFA 2GN6A 1O0SA 4TRMA 2FP4A 4Q3NA 1ARZA 1QKIA 2NVBA 4FOOA 1F8FA 2O4CA 2BFAA 3OA2A 3KYBA 3PGXA 4IS3A 1U5AA 1IHYA 1JKFA 1O8CA 4OJNA 5BSEA 2ZATA 1ONOA 3QWHA 3BYZA 1GUZA 1PX0A 3FBGA 3VH4A 1PGOA 3CE6A 3ZWCA 3P2YA 4OXNA 3DWFA 4EGFA 2PD4A 2NACA 4DBVO 5JYEA 4WNIA 3O26A 1DSSG 3HQ4O 1NWHA 1GZ6A 1HXHA 2Y93A 4AJ2A 3D5TA 3ZHZA 1PJ4A 3HSKA 5DP2A 3WBFA 3BTVA 2HMTA 1DLJA 1VLLA 4HV4A 3ONFA 2X9VA 4TROA 1ZZEA 3PTZA 3PQDA 1DXYA 1UXGA 1C1XB 1P1JA 3DHNA 3UN1A 4NK5A 1YE3A 4DQVA 5L4NA 5KVSA 1IOLA 5B4VA 3EAGA 1NFRA 1HYGA 2Y0DA 4YRBA 1SZJG 1BW9A 4DRYA 4RVDA 4IQGA 2O3QA 3CINA 1I3LA 5U9CA 2H1SA 2UVDA 2DTEA 2C2YA 4MINA 2ZJ0A 1FDWA 3AM5A 3NDIA 4NBWA 4PG5A 1CETA 2BI7A 5TC4A 3GFGA 4Q39A 4BO1A 2WJPA 1I32A 1MC4A 1BXGB 2I3AA 3E82A 1ZW1A 3TNLA 4JIGA 1HSZA 3FWZA 4BB6A 1VE9A 4RORA 5DCYA 1MP0A 5G4KA 1E1NA 5T5QA 1AXGA 5T67A 3GDOA 2FSVA 3INRA 3RFVA 3QHAA 1SOWA 2IEBA 2POQX 4JNKA 5DT9A 5BQFA 3IQDB 4BGVA 4YJDA 1XHLA 2ZJ1A 4JBHA 3UH1A 2X22A 1V35A 2ZQYA 3BMQB 1WNTA 2P2SA 1G6KA 3JYLA 1WPQA 3ON5A 4MIEA 4DYDA 3H8VA 1T2AA 4Y98A 4RLHA 3VDRA 3DC2A 3TN7A 1Y81A 3SJ7A 2RH8A 1IULA 4K6CA 2DQ4A 4EJ0A 5F21A 3DOCA 3K96A 1ZK0A 1Y8RA 5BSHA 2QW8A 3RC9A 4ZGWA 4LGVA 5A1TA 4GGOA 1UXIA 3KYCA 1I3MA 1E92A 2QRLA 4DREA 4NFYA 2Y66A 1HZJA 5F5NA 3DFZA 4ILKA 1NASA 1P77A 4OO3A 3S2EA 4RZHA 3QSGA 3UF0A 3ZNPA 1DO8A 3ULKA 1NTOA 4BO5A 3HJAA 5A5FA 1RKXA 5EINA 2JKVA 1ZJZA 1E3IA 4MVJF 4ND3A 3DB2A 3PIIA 2CVZA 1T26A 1PZFA 3GR6A 1XDWA 3IC5A 4DC1A 2EJVA 1I0ZA 1PQPA 3H4VA 4O1MA 4ZA2A 4BKQA 1YB4A 1YDWA 2AQHA 3S1LA 4A7PA
chains in the Genus database with same CATH superfamily
1RPTA 5KSOA 1CY7A 1YHYA 1J09A 2NTJA 1Y9EA 4N0DA 1JDSA 3IB6A 4ARIA 1QYCA 2D5BA 5KZMB 4WY2A 4IICA 3B52X 2GVZC 4X44A 1W5BA 2H63A 2BISA 2OBYA 1K27A 2W6JD 2XTJA 3OZUA 3A6JA 5J9FA 5K8LA 1MA0A 4MUIA 1AO3A 4TTSA 4AY6A 3JWGA 1HG0A 2HU8A 1IDN1 3FVTA 1FYVA 1SVUA 2DFVA 4IDPA 2WG2A 2RC5A 2AD5A 2QVZX 4CKWB 1UKAA 4J94A 4IVNA 1RQRA 4LC9A 4RANA 4BTVA 3AF3A 3IUBA 4ZODA 1TFUA 5DSTA 1PV4A 4XEHA 3M5PA 4NEGA 2HV9A 3OKFA 5CX1B 3VSCA 4BMSA 5H82A 2X4GA 2I91A 4BGIA 3REFA 3FUVA 4UBKA 3HEBA 5JIBA 1W36D 4JL5A 2RGUA 2R751 3OAAD 4PQYA 2GJAA 4WIAA 3H04A 3E9CA 3NS7A 4U63A 5FO1A 1TO1E 5FL7A 3WMRA 1HOTA 2A35A 1E1KA 3ETEA 2Z2ZA 2KSQA 2JJ1A 3IT3A 3LF1A 3GEPA 1OAKA 4B82A 2PO5A 2Z2JA 3F49S 5CB0A 3GJYA 5FOTA 3A2KA 1UF9A 1LRLA 1QKKA 3ITEA 2EP5A 3TH5A 2QNIA 3L01A 4O2AF 4TKVA 4QAJA 1WKBA 1ABBA 4C2UA 1DB3A 4DR6B 5F3DA 1RD4A 5T4BA 4D0GA 4OX9Y 3E23A 4LJ8A 2ZWPA 2XDWA 1WPRA 5FOWA 4B3SB 1PLLA 3HCAA 5ALFA 3GUHA 3GRRA 2GHTA 1XTTA 3GRUA 4E03A 1G60A 4ER3A 3MT0A 2ADOA 4TVKA 4Q9KA 4J3NA 4EUFA 5BSKA 3WA7A 1FXSA 1T0HB 1F7VA 3PFBA 4E1VA 1G2IA 2DQZA 3C3MA 5DULA 5F52A 2HF2A 2RHRA 2BY4A 4A1OA 2VK2A 1ZJWA 1CDEA 3LY5A 1CR2A 3DQQA 1K63A 2FMUA 2HA2A 1WHTA 4MDEA 4E4RA 2OYCA 4JZKA 4DUZB 4FLFA 3F2VA 1PIWA 4H35A 1O8BA 1E3JA 1XTVA 5EIHA 5AM5A 3Q8KA 4K0KB 3F3MA 5I9MA 2ERYA 3CX3A 4IIJB 2OSVA 3E9NA 5BN3B 1GTVA 3B3AA 3G9TA 3FKSD 4GX2A 1LU9A 3LRXA 1B0AA 4HZUB 1FSPA 2DQYA 5IN4A 5FYQA 5F33A 1L1EA 5CD9A 4OB7A 1U3WA 3I58A 2I7XA 2YWRA 3PCTA 2DLNA 3C3BA 4X63A 2V5VA 3FG9A 1K08A 2C1XA 1MT3A 2DHQA 3FLMA 5AKJA 1QHYA 5IJ9A 1O5OA 1O77A 2VYFA 1L4YA 4ZHQB 2XKKA 3AG6A 1CJMA 3QVTA 1KY4A 1L4UA 3VTKA 3H3XA 3EQ8A 2G0AA 1OLUB 1UBHS 2JD2A 4D4HA 1RLTA 3DF9A 1L7EA 5DCWA 2ZG6A 2BGLA 3LXUX 3NRJA 4EG0A 3RBVA 4Q3CA 2HSZA 3UMJA 2VDMB 1R8JA 1L4LA 1URPA 1IL0A 4P4LA 1E1CA 1XMSA 2ZE8A 3OCWA 3C98A 5L3QA 2IYRA 5E8RA 2G7MC 4CF4A 3EUEA 1V5IA 5IH7A 3RGGA 1DWOA 1VYTA 1CF9A 3SHTA 3EGDA 1AF7A 1XMPA 2IK8A 3M6XA 5DN6D 2FPLA 1JEAA 1UR5A 1Q84A 1R0CA 3Q85A 4WECA 2A58A 4MI6A 4F4HA 7AT1A 3RV4A 1N6NA 4D5GA 2ZBUA 5EUQB 1FUKA 1RW4A 2QRGA 1JG6A 4LJ6A 4LAFA 1U9IC 2PV0A 3PVZA 4GU5A 2HKIA 5FP0A 1IJFA 4EB0A 4G9EA 1KOFA 3TMKA 4KRFA 5K6RA 4AMGA 3MMSA 1MPXA 2VH1A 3NVAA 4QBKA 4QYIA 2ZROA 3KV1A 3L43A 4H1UA 6YASA 1L5LA 2O5EA 2YMLA 4R68A 4RNDB 3JYPA 3BKWA 4LZPA 4F04A 3MTIA 1KIMA 3G5MA 2Z3WA 4M98A 4F2HA 3LHDA 2YHUA 4D81A 4OLHA 5IAOA 1XEWX 3E81A 4GF5A 4ZQEA 2D1TA 4CMKA 3DVQX 4E5VA 4WKCA 1WB4A 2ODQA 5A1JA 5K6TA 4CMAA 4NCIA 3MOIA 1R8XA 1BO6A 4DR2B 3PWTA 3SSMA 2NXEA 3A31A 4AT1A 5D5HA 4UBNA 3S1AB 1E5QA 4J7XA 8OHMA 4X1IA 1ZDMA 3A1WA 1RU3A 1LDGA 1DTSA 3TLMA 3PRYA 3SZMA 4CODB 2XT0A 1ZM9A 2BHNA 3QEBZ 3OOWA 2EZUA 4MEBA 3TD2A 2EJTA 3GUCA 4R41A 5I8PA 1OKKA 5HIIA 1M1YE 1Z5WA 2CLFB 2MHCA 1QQ7A 3BMXA 2EKPA 4GI7A 1ISSA 1KDPA 1XZBA 3ZC3A 4WBNF 3GGGA 4LS3A 3THWA 2JKYA 3ZHRA 1QP8A 5HXAA 1PZXA 3AJEA 5IN5A 3RYFA 3F46A 1I2MA 5IJAA 2EJWA 2HX1A 2QX9A 2JIQA 4WY8A 4CBVA 3AR8A 4D4GA 3TGWA 3MT7A 1XPOA 1KDVA 4JN6B 3NZEA 5JLJA 3M4ZA 4R1MA 2VSNA 1TI7A 5JISA 3JQFC 1V1MA 4KGDA 2W2XA 5JANA 5EIWA 4KR0A 3EIXA 3ZNNA 4GRDA 2PZKA 4FGSA 2QYSA 3ZW9A 1HV8A 2DFDA 4D96A 1R8QA 4MWDA 1XNJA 2OC9A 2CB0A 1K06A 2VF7A 3K16A 2A1TR 3DZJA 3NU1A 1Q1BA 5KO2A 4TTJA 1KPHA 3PR1A 3QENA 1L7OA 1W30A 2BEUA 4M9ZA 3LP8A 4BQIA 3RSLA 1F4VA 1J0EA 3X2SA 5KYKA 2ZJ4A 3D7LA 3H2JA 4AVYA 4FR0A 1WXQA 3EDMA 2MSKA 2D1SA 5AOCA 4LMBA 5IVHA 1MORA 1JR2A 2R62A 2ZRMA 1RXWA 3W79A 4EO9A 3GIWA 3W5BA 3QVGB 1OOEA 2XDYA 4ZKEA 3IJ5A 3K35A 3LQ2A 5IP5A 4MQFA 3ZZMA 2C5EA 5C34B 1ZNXA 2G9UA 4QUDA 2DUWA 5DKFA 5ELLA 2Q45A 3K4HA 1T2UA 5L8VA 1NF9A 4I5GA 4PZUA 3AR4A 1DJQA 1PD0A 3MJTA 1RWMA 1WCYA 4IJVA 1I80A 1NYRA 1OFHA 1XZ8A 2JASA 3R0QA 1I36A 1MAHA 4XWGA 5EWLB 1HT0A 3I1FA 2VZ9A 4FMCF 3R3VA 2Q3MA 2DPYA 1TAQA 3IP5A 1SVWA 2I2AA 2PD6A 5K3FB 2OB2A 4R69A 3ZKWB 5KTKA 3RODA 5JARA 4GKBA 1ZM4A 3K0HA 1AZWA 5EXXA 4L27A 3WNZA 5KYNA 1W73A 4BZWA 1JX6A 2WLTA 2UXCB 4QLAA 1GA1A 1Z4LA 4R6XA 4P35A 3L5KA 1IOVA 2ZLBA 3MJCA 3VR2A 3QLVC 1OXSC 2VNAA 4X3OA 5JH7B 2QX8A 4IGIA 2NNLD 5IUNC 4HJXA 1SU4A 2AN5A 2QRJA 1QQAA 1QO7A 5C2JB 2VSYA 2QW0X 1L5OA 1QWSA 3ELBA 3QPAA 4Y6RA 4BIIA 2O2EA 2ZI3A 5LA6A 3KWJA 4WOJA 2DVMA 3CG0A 3MIZA 1BQEA 2V03A 4OP3A 5EJFA 2WNIA 1KAMA 1PCXA 1E5DA 2AGVA 3IAUA 4JK3A 5DASA 4Y6LA 2QGZA 3F7OA 2ATXA 1GSHA 4INJA 1U31A 2XQKA 4A5SA 4UUAA 3RBXA 4EFMA 5ALKA 2UDPA 1WZUA 4N7MA 1R0LA 4MP6A 1N8KA 2XSZA 3WGHA 1H2YA 5CDGA 1JQDA 2ZRNA 3ND9A 4AZ3B 3IR6A 1FFEA 1G9SA 3P0RA 1UOOA 2X7JA 2R7MA 3L8CA 3TSZA 4HCJA 2FPGA 1PW7A 3OT1A 4MVJD 4EGFA 2BHTA 3BWBA 1HDZA 4FE3A 3UHFA 1XU7A 1MX3A 3LMKA 9MHTA 1U9CA 4RU1A 4B4DA 1YB2A 3OCCA 4CM5A 4RK4A 3PENA 5CA0B 3GNSA 2I4MA 2JFWA 2WHRA 4DARA 1TGYA 1AXEA 4NG4A 5IVDA 3VMFA 1MFZA 1DZIA 3QXGA 5DVZA 5LA6F 4OHYA 6GPBA 3KT6A 1A4IA 1QTIA 4Q48A 2HB6A 2QK4A 3FPCA 1TC1A 3I2IA 1XJ5A 1TKCA 2G6BA 2WWRA 3R3SA 2B5OA 2FQQA 2G40A 2I6FA 2PUHA 2YFHA 1DHTA 4YHHB 3UG6A 1HE8B 2DWOA 3DLAA 3EWIA 4CDGA 2HRBA 4HUTA 4WZZA 1FP2A 3NWOA 4G97A 2OUKA 1QP7A 3IDOA 1ZWLA 4YMHA 1FFCA 2YZMA 3E9DA 2Q1UA 2CNWD 1UPAA 4LVUA 5DNEA 3GP8A 2LR0A 1K6JA 1ZQ1A 2WOOA 5ELXA 1F5SA 4OHVA 1V8DA 1IUKA 2O14A 4QX6A 3DMTC 4P36A 3RSFA 2ZR8A 2JARA 3IPXA 1EP2B 3VM6A 3TVDA 5L3VA 7MDHA 3KKNA 4ON9A 4DIOA 3CZQA 4C4YA 3K8QA 4OQYA 1AKNA 3MJFA 5CX1A 2NO1A 2NUAA 4HRXA 3OIDA 3H1EA 4PYNA 3R0JA 3KG2A 4B3JA 1QX3A 3ETLA 2AOUB 1XLVA 3EG5A 4HLUA 4MUGA 3SM3A 2HTEA 1EK2A 3WZMA 4BV3A 2IYTA 2R1TB 1GFWA 1W87A 3P97A 3LP5A 3LPMA 4R8RA 3OIWA 1KJNA 2PL1A 1HNWB 4GE3A 3RS2A 1P8AA 1P5HA 1ZD3A 2ISQA 5MF6A 3ZNQA 4EB6B 1EWVA 4RABA 5JLAA 1V6AA 1MO3A 2Y0CA 1NP6A 2GA9A 4RHUA 1HE2A 4NBVA 2BM0A 1CUAA 4RF4A 1R8SA 1QZ3A 1R6DA 5C7YA 5LYJB 2VSOA 1FSZA 4HHEA 1T43A 1EAMA 1ND5A 2GHIA 3T7TA 5KI6A 3WZ2A 3SXUB 2M6LA 4ZJZA 3HMQA 3NBKA 4GICA 3IP7A 1QFYA 3AMVA 1RSZA 2H1RA 4LMPA 1ZK3A 4CEHA 2HRDA 1YRYE 4H16A 1BU8A 1JHQA 1U3CA 4I4IA 3U7FB 1FUEA 4WZBE 3D3JA 5C9ZA 1UMBB 4ZGGA 1KWGA 5A05A 1BYIA 1ODJA 2YJ4A 4BVGA 1J5EB 4V3CA 1YZKA 2AI3A 2VHCA 2YOFA 3BWYA 3MW8A 3NWEA 3QLUA 3NT4A 4FDVA 2ZSHA 3HLKA 4M21A 4NCBA 4ZI3A 4XM0A 2A5JA 1RWPA 1AUOA 4V0RA 2PPVA 2NU8B 4F3TA 1FA9A 2ZZMA 1J6UA 1TQ6A 4FGKA 4BP9A 2A7QA 1G3IA 5E6SA 3QVWA 4CW7A 1GCUA 3V1LA 4GECA 5ITWA 4NXNB 3KHSA 4X24A 1ZSVA 2A5GA 2AJDA 2XX3A 4OP2A 4R1SA 5KC8A 4KR9A 1H3NA 1U7UA 3ONEA 2FFRA 3AYZB 2ZIFA 1VA5A 2X86A 3HWRA 3ORRA 1OROA 4XD2A 3SDZA 5FA8A 3T3MB 1A97A 2EU8A 3TQOA 4MYSA 5GGXA 3THOA 4AYWA 4PC6A 1VI6A 2ODAA 4MAMA 3HXTA 3ILXA 3RSZA 1VZ3A 4A8PA 1BCRB 3L7DA 2V9CA 3RJTA 4OOEA 2Z2XA 3W7BA 4E15A 1QIMA 3S55A 1BG6A 3U4DA 4HVCA 2XNDA 4CMEC 5B2EA 3U6BA 5B2ZA 3GB9A 5KWIA 1OTXA 1S89A 2JEOA 3FZGA 2X76A 4LHSA 2NVUB 1N2CA 1F0PA 5I7SA 3THYA 3M2PA 4JEUA 5H7XA 1GNPA 3E0QA 4JJ7A 1KU0A 3T3DA 5IKXA 4UBMA 3BFKA 3KLBA 4MTCA 1ST2A 4CYMA 2X3FA 4ESEA 1YR6A 1YCDA 2IHUA 3S7TA 4IEIA 2JJ2A 3AW8A 2YN0A 2BR5A 3O8QA 3SJZA 3FI9A 4BP1A 2VBIA 4OK3A 1DWUA 2YXBA 4CUZA 1NN0A 2ACEA 1QQ5A 2DPXA 1KZ4A 2J1LA 2X8WA 2Y0EA 3IMEA 3H16A 5DHFA 4NZNA 4BQNA 3QPDA 5GJCA 1L5NA 2AMYA 2AXNA 1Q1EA 3K0FB 5KHAA 4CGYA 5K8JB 2GK4A 1PBNA 3A1SA 3A7DA 4E3ZA 2EQ5A 3JASA 5DHAA 4RYLA 1AZTA 4OG2A 4B35A 1JJFA 2GRAA 3BK2A 4DMMA 2RFLA 1CEXA 5JXIA 5DHUA 1CVRA 4M60A 3MXTA 4BNYA 1CNFA 2H9AA 4BKOA 4RXTA 4WZBA 5E3IA 3U13A 3GEBA 4EJSC 5KCZA 1I2DA 1L1QA 3HKCA 4DA8A 5EJ7A 1UEXC 3CU5A 1U3TA 1F1BA 4BLWA 1EKXA 2QDKA 1CYDA 1Y1LA 2IPAB 5CYPA 2XRFA 3N8NA 5BNTA 2D00A 4GYJA 4JI3B 4UVGA 5A62A 5J5CA 4YRSA 5ADHA 4GP6A 2OXCA 4XQEA 3NBZC 5I7WA 1OC2A 3L6RA 5C31A 4LXUA 1CZHA 3VZRA 3DF7A 3TOZA 3PC3A 4WXMA 3GLUA 3DPIA 4W99A 3UPTA 1EP9A 4LSWA 2GZMA 4MMZB 4ZVOA 1A2QA 3KOMA 1NT4A 2BEUB 4IXMA 1M10A 8ADHA 1JALA 1XYVA 4TV9B 3FF4A 4GEKA 3KJXA 1KOJA 1MIOA 1OX5A 4WN9B 1JIJA 4B4UA 1F6DA 3KCQA 1ENYA 4AIIA 5EG5A 1MO5A 5IUJC 1Z34A 1P7PA 3F8WA 4HAIA 4JJKA 3LA8A 1PWEA 1RPJA 2QLTA 2AG0A 3HZRA 3E1SA 3RDPA 4C07A 2V98A 4QM6A 1DFIA 6REQB 4M1QA 1KDZA 3FN4A 4F92B 5KYYA 3GOHA 3PNBA 1CY4A 2O9JA 1DC5A 4N5MA 2FPXA 1OILA 2OZLB 5CCEA 2R6JA 4LKOA 4EHFA 1ISGA 4FE7A 1ZSNA 2WKWA 1NM5C 3ND8A 4M9QA 4QTXA 3CR3C 3H75A 2YIDA 1I01A 5EY5B 4KQ6A 3TZQA 4HOYA 2QTVB 1QNLA 2BDEA 3JWPA 4HDKB 1CRPA 3KALA 1FDRA 4FYKA 4RH3A 2K6GA 1FX1A 4PHTA 1SBTA 1E7QA 3C41J 4NS4A 1OJLA 2BBSA 3P9XA 3IIEA 5AI4A 5BW8A 1J7KA 1WDLA 1AGYA 3OT1B 3JQGA 4WAUA 4DWJA 4YROA 2W22A 2XTZA 2QRKA 1EFRA 2VDQB 3WKEA 4LY6A 1KBZA 4ITVA 2GUGA 3M4JA 3B48A 5FNVF 4DLNA 2BHRA 2G28A 2O5VA 2GAIA 4FFLA 5EHXA 3PFIA 1MG5A 3K20A 1U8EA 1CUEA 3D3KA 2FYTA 2ONCA 1VGQA 2F59A 4BECA 4DLAA 1T6YA 2INGX 4ZVRA 1W76A 5CP8A 3QSYA 1AD2A 1J9ZA 1JP7A 3UA4A 1R3UA 2G9VA 1Y3DE 3CRW1 5HNKA 3ZDYB 4Z4QA 1N8SA 2CHFA 5E4TA 1W7AA 1D0VA 3IERA 1NY6A 1GZ4A 1O0CA 2GGSA 4KLZA 2JF0A 2PRYA 1JWAB 5BT9A 4L5YA 2WUWE 4G0PA 2RIRA 2O06A 3A9UA 4EVIA 1Q95A 2O3JA 2V7TA 4K7JA 4BFXA 2QU8A 2YBEA 1IK4A 2B69A 4ZOBA 2CFOA 4YCAA 4Z99A 1PQYA 5AJXA 1GZ5A 5GP1A 4RTQA 5TJ9A 1N36B 1Y33E 1J5XA 3WI7A 1A8SA 1RJGA 2IH5A 3HJBA 4AZSA 1KFEB 3MCTA 3IAHA 4TRJA 1Y5LA 5A0VA 3W78A 3QLEA 3GV0A 4POAA 4PZYA 2O7NA 5IKMA 3OQNA 1KY3A 3JD2A 3MJHA 1XR3A 1N2GA 3AEKA 1QFSA 1RTKA 2G71A 1UPFA 1WMAA 3KD2A 4DM3A 5IKEA 4P4SB 4R9SA 4J0HA 2HH9A 5HF9A 4EHHA 3JU3A 4UW9A 1L5VA 1E6EA 3WIBA 3FDXA 3VNRA 3ZZ0A 4I1YA 1XN1A 3KZNA 4HQRA 2FW9A 3UW1A 2GNOA 3U49A 5FD8A 4UDNA 3K5IA 4E3WA 3ZCPA 1AQJA 4E51A 4N8EA 3ZXIA 4QICA 1OFCX 2M1ZA 3OQHA 5C0OE 3KTAA 1K9VF 3DO8A 3GBPA 5KKCA 3R7LA 2E89A 3KPVA 2PN1A 4D57A 3FZEA 3X1MA 1EX1A 3GEMA 4ARAA 5GJBA 2WT8A 3EFEA 3KQTA 4TTRA 3SM9A 4BBAA 4YUVA 4O1IA 2VH2A 1YR3A 2GKOA 5MN5A 4RTJA 2PWPA 3QBTA 2PGJA 2QG6A 3HLYA 3VR0A 4HEQA 4Y6GB 4JVNA 3WHPA 3IO3A 5ALJA 1F20A 2YVAA 3AESB 1PG2A 4E6PA 3K31A 2BDUA 1QR2A 2WWWA 4NU6A 4TKZA 3I61A 3DL7A 2DOKA 2C9DA 4LEIA 2XT9A 4ZVVA 5A6VA 1FMTA 2HRRA 2XUJA 3RM3A 1IOZA 1IIRA 2V1XA 4WZAA 5KNDH 2CV1A 1AF4A 1FS4A 2XNDD 1BKSB 2XAAA 3EEQA 4RF5A 5DEIA 3T5CA 5LOVF 1ACJA 1CTQA 1RM4A 5CG2A 5JAPA 2I2CA 3F5SA 1VKZA 2KE5A 1LW6E 1GKIA 3SJUA 4N48A 2ARKA 2Z5LA 1OWNA 4ENRA 4Y9UA 2KI5A 2XUGA 3L4EA 2HJ9A 3ZUGA 4EK9A 5IANA 3B1WA 3NTVA 3HFSA 2FPPB 3S27A 5B12A 5CHEA 1T4MA 3AKEA 1NQWA 3M5WA 3KSAC 1DFGA 1G5FA 1GRVA 1W85B 3E1GA 4JH0A 1K5GA 5SY6A 4ZCRA 4FGUA 4RJTA 3H5RA 3HPRA 4FI3F 1GLGA 1JZQA 1PWHA 2QUBA 4NCKA 2GPWA 3LZCA 3Q2OA 2POCA 3PQCA 3CJRA 2DFNA 2ZUUA 3HB0A 2QRZA 1D3AA 1LC0A 1ZONA 1O9BA 2VNIA 2ZBDA 3E7WA 4WL0A 4YR7A 3H2SA 2IS1A 1A3CA 1WB6A 1XLTC 4GBJA 2F9MA 4HD8A 5TQVA 1V8FA 4LOKA 4RK7A 5EUCA 1NIPA 1VYVA 1VL2A 3WLIA 2GILA 1WETA 1VMEA 5K8TA 2Q0HA 2A7XA 3BFJA 3L7AA 5JY1A 2XUFA 3STWA 5LUAA 3HUDA 1D6JA 4PG6A 3ZGNA 3GL9A 4CTMA 3SDBA 3QM1A 4CT5A 2PKYX 1YACA 2ZAIA 3HCRA 1C3LA 3OPYI 3Q8WA 4L9SA 3SNHA 3VDNB 2P2LA 1RC1A 3OICA 1NW5A 4RWZA 2O7SA 4KH1A 2EJCA 3A6KA 3T9CA 5TS2A 3I0ZA 1W581 4IEFB 3GLGE 1UXOA 3RKRA 4DCVA 2F48A 5CU7A 1Z8HA 5K20A 3LCRA 4UPVA 3ZYZA 4UTRA 2AYYA 4BV9A 1Q57A 4XFJA 1EI9A 5FF9A 1Z5PA 5JO9A 1CLEA 1V43A 3I64A 3I8XA 1LS1A 1F0KA 1GTJ1 4TXHA 4UTNA 4YJHB 3KEMA 1JBKA 1Q92A 3TG2A 1VP3A 4JVMA 3HJTA 2AZ4A 3N2ZB 1GRNA 4HDRB 1A5BB 1C7FA 2MTBA 4O5AA 2OGTA 3PNVA 6NULA 3MC1A 1OYOA 1JG4A 3DDWA 3FMIA 3K09C 5KYUA 3VR1A 1WA5A 4B32A 4FHDA 4Q01A 4EFLA 2Y1LA 3A9VA 3F8SA 3H5AA 3CVYA 4RFSA 3DZ8A 3V4RA 3IKMB 3DXZA 3PJRA 1BD4A 1BXGA 4HNUA 4ZU3A 5LFAA 3VYSB 4Q9NA 1M6YA 2CLOB 1IG3A 3WGGA 4AJEA 1D2AA 5FWXA 4DDTA 2ZBGA 4J2HA 3N1UA 3G7UA 4M1OA 3W2HA 5KEIA 1YMUA 1H4QA 1UQUA 2FR0A 4K03A 1AKMA 1BMQA 3KT8A 2AVNA 5AJWA 2Q6VA 2GBGA 2NZJA 1GZ7A 2C31A 5C8VA 4BJHB 4O2RA 4D79A 1LB1B 1YK1A 3O8CA 1XJCA 1YOVB 1X1DA 4BUCA 1T24A 5C37A 1BCRA 2PKCA 2VDUE 3G02A 1QQBA 5C8ZA 5DCUA 3DS8A 3NB0A 4ABTA 4RQBA 1J8DA 2Q5HA 3Q11A 4X90A 1WX1A 3RFUA 1QE0A 3RWBA 1QIDA 4RE6A 4IDCA 3IIMA 4BN0A 4DA4A 1VKJA 4H59A 2PNJA 2V54A 4MSUA 1VIVA 3OJFA 3D6HA 5E4FA 1MXFA 3NJ4A 5IASA 3TLCA 1H2AS 3L79A 4IM7A 4Q6BA 4CRWB 2DBZA 1RZUA 3UJAA 3ABIA 1NLZA 2NTNA 4FFNA 1CY6A 2GPSA 3DMFA 3WGTA 3SF8B 2R9VA 4ARZB 1HDIA 4IZHA 4QOEA 5CT8A 3SMVA 3WJ7A 1NVFA 4HLDA 4HMQA 3BT7A 2VP4A 1J42A 2CNOA 2RKOA 1QAQA 3L6DA 4OQEA 3KOYA 5AHXA 4DCMA 2O8CB 1Z07A 4PQFA 5BSFA 1V1RB 3TZKA 4OM7A 1E6CA 3TAHA 4PYQA 3IQEA 1QRAA 1JJIA 1SHZA 1ZXLA 4WNCA 1Y3IA 2JJMA 5JYDA 3FFTA 1K9SA 4G8BA 4X00A 2FW0A 2Z5FA 1YJBA 3PD0A 4NQZA 4B0OA 3IGFA 4DBLE 1EK1A 3IP6A 1QF9A 4ZXPA 3IURA 2YJ5A 1ZCZA 3BBLA 2UVPA 2GTIA 4IMIB 4NH0A 2GDJA 3Q9UA 3AF6A 1RYFA 2WM8A 4QPJC 2PUTA 3DOOA 5I9BA 3KQNA 3NHAA 3NX4A 4PC2A 2QLNA 1A69A 3GLVA 3L49A 1FBTA 4I6JA 4MUFA 3VSEA 1DBRA 1S3IA 1FIUA 3E5NA 3DXFA 1H2BA 1E6MA 1V3TA 2FMKA 1L5YA 4I1OA 2BBTA 4DV7B 4UZSA 1PHRA 3U4QB 3TS1A 4NZYA 4MYHA 2A8YA 3KE9A 2SCUB 4ZRDA 5CA0F 4X8MA 3CWQA 4TV9A 1VDMA 3LT0A 1RYNA 4HH3C 1XTJA 3COPA 4X64B 4RZIA 4XWYA 5IWAB 3C74A 3SF8A 1NA5A 3Q40A 4EX6A 1KZGB 4TL9A 1ORHA 3FR8A 1U2EA 2QLLA 4UBOA 2W37A 1LBEA 3SYRA 4EG3A 5AVVA 3VNAA 4FR2A 1P9NA 4I4CA 4A8HA 4DIBA 2QROA 1N57A 3C6ZA 1XHEA 2Q4TA 4PZCA 5CRIA 3I1IA 3ZLBA 2MSCB 2C83A 3AW9A 2DC1A 1R5OA 4INOA 4JJIA 3UMYA 2IX3A 1G5PA 3E5MA 4P86A 4WJLA 1U7TA 1Z5NA 1DU4A 1JBQA 4AF6A 2RGYA 5LDHA 3UC5A 3JQPA 1R9JA 2ZVQX 4NOJA 1SVMA 4MV5A 1TW3A 2G9QA 2ZRKA 3FAZA 1EM8B 3JQAB 5JZ9A 2FX5A 4OKNA 1PDOA 2WP0A 1A7AA 1BFDA 1RMQA 1Z0KA 2E0IA 3EGEA 4IGEA 4YJGB 5EXDA 3VXKA 5LD2C 1T8TA 2CXSA 2JFBA 2WAMA 4N3CA 5JAZA 4X41A 3AF0A 5JCZA 4MVWA 4U2FA 3RJMA 1AK2A 3D7NA 3R44A 1JHAA 4FNGA 2QAGA 4F11A 4L0CA 3GRYA 2AMLA 3WIDA 4MS4A 5LP6C 5FLKA 4DG5A 5IDXA 4CL0A 3GRPA 1OE0A 2BMDA 4L1KA 2MINA 1XTBA 2O2SA 4GMDA 4MYCA 5KKAA 2Y68A 3A14A 3L0PA 2R6AA 1OI2A 1IHUA 2R7KA 5KJ6A 3INTA 4K46A 3CVUA 4H7EA 3VC3A 5A4IS 1GSIA 3BK7A 3L6UA 2E6UX 1WXXA 3W3AD 2BH2A 3C5WP 1YK0A 4Q9HA 1I1NA 3L05A 4BXOB 3DGFC 3RH0A 3C1TA 5B1EA 4KXYA 5EJAA 1WBBA 2VP6A 4QYXA 1QH8B 3GWZA 4JB2A 2ZS9A 3N0RA 4LDJA 4ZT7A 4CV0A 1MJFA 4WACA 3DHYA 3HVRA 1J7JA 3B60A 1XELA 2CL5A 5T3YA 2B8NA 3W8FA 4CM4A 1ZHFA 4URVR 1QVWA 5JI3E 1JFSA 4JJGA 3DR5A 2NZVG 1UZNA 3OJWA 4A26A 4DLTA 1KA9H 1GPAA 3H9GA 3DVAA 2WSSD 3P0IA 4Y2UA 3A1DA 3NYRA 4QDOA 5KQLA 4R2IA 2E1PA 3JYOA 1XA3A 1I8TA 2R66A 4PPYA 1PL0A 3ZWYA 1NQUA 3U5TA 1RAEA 5AW2A 1PFUA 4BMVA 5FOSA 1N5OX 3I30X 3DEYX 1ZW6A 3LKBA 2NOAA 3RUAA 4BNFA 4S24A 3VR3D 5JQWA 4KACA 1Z8DA 2QRPA 4MKHA 5EIFA 2OA0A 5JWRA 1QDEA 1U28A 2W4IA 4FDLA 4IYRA 3RAJA 4D42A 3ICWA 3U7IA 5KOHA 4J7CA 1TA4A 5AQ1A 3FWKA 4YCJA 1L5SA 4Z3DA 5I48A 2C8JA 4AKHA 4ZV7A 1EXMA 1NOIA 4GP9A 1MEEA 2QJWA 1KZ9A 5K45A 4ZDKA 2QN2A 1P7WA 4RMJA 2QMQA 4UNPA 1JEDA 1G0OA 1LXCA 5ESRA 2G0NA 3SIWA 1Y8QB 4PFKA 3BJIC 5G0VA 2H16A 2WC1A 1TYEB 1EGMB 3WK9A 3D64A 3WWDA 3U19A 3LT5A 1W48A 2C54A 4KRYA 3LXXA 4BO7A 2B1JA 2ASVA 2A5YB 2WUVA 2GLUA 4M8KA 1E5TA 2UZ1B 3GCDA 1EAYA 1QG0A 1W59A 3K9LA 2AC7A 3U1TA 3T7JA 3OZDA 3QUQA 4FKMA 2H7YA 1ISHA 3TKYA 4P4TA 2CHEA 4P3XA 2GAJA 5K6AC 2WMYA 3LBAA 4Y30A 3HFJA 4NDAA 1TUGA 2GPTA 1NVGA 1XQWA 4JWKA 2GK7A 2C2ZA 4YLYA 1IZ0A 2G1PA 3GDGA 1J2EA 1JEOA 3GRCA 4UE2A 2ZUWA 2B61A 1G8HA 4GKKB 3L4SO 4AKSA 1V25A 1VJRA 3N0TA 1KAQA 3FD8A 3EOZA 3VR6H 2JHAA 3AHGA 4CKYA 3FLEA 3SYLA 1OH5A 1RIIA 2A9FA 1GNSA 2ZIVB 1RP7A 1HF3A 2J87A 2EBWA 1UP7A 1A4XA 4PHCA 4UTOA 4IIFA 1NNLA 5HMLA 2OC4A 4DUGA 1GARA 3OTQA 1KZ6A 2PH3A 3AC0A 1GUFA 1R0BA 2P4UA 3OAAA 4IOLA 5EWJB 4WOCA 1MKYA 2IYPA 4G65A 4LBZA 5AVTA 1EK6A 3JALA 5FPTA 2V7XA 4HB3A 1BDIA 4NOKA 4OQFA 5DLQC 1PYOA 2IE0A 4IF6A 4NG5A 1ZFNA 4TXLA 4UAGA 5IYZF 1BVRA 5BV8A 1EVYA 2GEDA 3A4NA 4M9RA 3MMNA 3BOSA 2CJXA 2HDHA 2Z5VA 3PK0A 4FOPA 4GM4A 4RIHA 4V1CB 3BIFA 3L0SA 4J2TA 3EQ6A 4Q9DA 4CFYA 3HACA 3PNOA 4ZU1X 3H3FA 2W6JA 1HTBA 5HS6A 2Q3DA 4MVXA 5AK4A 1Q83A 1QHNA 4RVGA 3SJBA 4HDMA 3LUDA 1R66A 4LSGA 3HG7A 3VDQA 2PX4A 2I65A 3GAFA 3HB7A 4CL8A 3J81k 4OCZA 1HI9A 4KZKA 4CVNA 4EL5A 1R4AA 1X74A 3L4KA 1KEUA 4KQFA 5G1NA 4ZTBA 3D31A 5DEOA 4YLEA 1VDZA 2NSYA 2ZOSA 2YQ5A 3L41A 4H7FA 2OV1A 1B7GO 1OTHA 2WICA 3LWDA 4AJHA 4FOSA 3U40A 4OGGA 5KTRA 3LQ1A 2ZKLA 3IE2A 4RPGA 4HAVA 1S2MA 2FZ4A 1J0DA 1U8AA 1VMKA 3CX4A 1PL8A 3SX2A 5ICCA 2K2WA 1CD5A 3JATB 5LLDA 3THYB 3U60B 3ECCA 2GERA 2P6MA 1UDCA 2CLHB 3IUQA 3DB1A 3PV0A 5DIZA 4LW8A 1F8UA 3CH7A 3HBMA 5E1MA 4B74A 1KEPA 1S8OA 2VLBA 2W6IA 4NRDA 3PNYA 2IKQA 4M6WA 3UAYA 1OIXA 1RZRA 2RGAA 3RRMA 1EP3B 4ARBA 3AUXA 3V2HA 1R50A 2XVXA 4EI2A 2IOQA 2YOHA 3DOFA 4BBJA 4UFPA 4BGDA 4CDNA 5JJ5A 1G3RA 1WDKA 2HCTA 3N2NA 4ZFNA 5BV7A 4K2HA 3A6PC 2XGMA 3H6HA 1XL1A 3GN2A 4XE5A 1U9ZA 3OZBA 3L8DA 1IWBB 3WQSB 1Q17A 1QFZA 4NWIA 4QREA 1Y6JA 3GUVA 3D0KA 1SQ5A 4FK8A 4IILA 2XRYA 1SIOA 2VPZA 3BL5A 2QTFA 1V1RA 3U7QA 1WRBA 4E5KA 2CJPA 1W1UA 4JU9A 4YGXB 1QZUA 3CONA 4ZQBA 4D46A 1TMOA 2QZPA 3OJ0A 4S04A 2C03A 2ZXFA 3GAMA 4UU7A 1H23A 1AB6A 1XTRA 2FI1A 2YWCA 3LT2A 3AF2A 3AHEA 3PE6A 3Q9NA 3H42B 1ZAKA 1G20B 2I1LA 5AKKA 3WRXA 3F9IA 1B6TA 2WJGA 1OASA 2EKBA 1V3VA 2VDNB 4AURA 2Z6UA 5KMGB 2O19A 2RAVA 1NRXA 1PL7A 3GUYA 1L4MA 1CUGA 1LTHR 3HDYA 3LE8A 4XUDA 2BMJA 2ZJ2A 2JJ8A 3C14C 1XCBA 4F3YA 2COUA 3GFTA 3W5IA 3LLSA 4I8DA 2FPRA 1XF1A 1N2SA 1SPBS 2FP4B 4Y7DA 4E5UA 3E0XA 2BFOA 2HBRA 2RGGA 7GPBA 1L3CA 1WW8A 3JQAD 4L3VA 4X6LA 4WV3A 3IMKA 4URUR 2VPPA 1K6EA 4NENA 4CM9D 3CNNA 4IG4A 2N47A 4MKGA 3OHPA 3VC2A 1ZESA 2ONYA 3M9WA 3R0VA 5LOVB 5HE8A 4M0FA 5DBEX 1VIMA 5DM4A 1N9KA 2G06A 4MUMA 1SOMA 4AMZA 4DQXA 4IDBA 4KP7A 2WABA 2NU9B 3RSGA 4CM1A 2HLHA 2IBSA 2FSPA 5PGMA 1NW6A 2WP8J 3EUWA 3HRIA 5K05A 4HWOA 5EOVA 1X1QA 2H1HA 4PZZA 3FNIA 5IKOA 4I4TB 3WGNA 3ODPA 3DOJA 2VF4X 1H4VB 2VXCA 1JJBA 1YNSA 2E49A 2IIVA 3PDWA 1GUBA 4JHXA 1X7WB 2JLRA 2VDPB 3WJAA 4D1YA 4A6XA 1SURA 1AHNA 4CKCA 5BVHA 4L78A 1T4CA 5MFPA 3AHFA 3L1UA 3G2MA 5IC6A 1GSAA 3VU8A 3CTPA 4M36A 3NR2A 4G4SP 2GO1A 1KYTA 2Z4TA 3TTVA 5FR2A 4L0MA 3ZOKA 2A9VA 4A2PA 1Q6YA 1OXMA 3E7FA 2XYGA 1Z0UA 2CE7A 4X7PA 3P4YA 4ZJYA 2H2DA 2YFQA 1CS4C 4LG1A 2HCJB 1U1DA 5JS6A 4JELA 1CS0B 3HL0A 1KJ8A 3I6IA 1ZI9A 2X2OA 2WZQA 4QOIA 2BMWA 4EVRA 3PF9A 1V47A 4CJXA 8ATCA 4AF8A 1Z0IA 4IXDA 3HHEA 4HQKA 4D4KA 3WLEA 1W5FA 2QD4A 1Z6YA 2DP4E 1ZN7A 2XHZA 4KVFA 4PLVA 3LQ4A 4Z86A 4DSTA 3TNYA 1Y82A 3AM3A 2I66A 4IOKA 4BEWA 1EHIA 1WCV1 3TIIA 3UXMA 2MSDB 1GPKA 2Q9CA 4Y9TA 5DLEA 3O92A 2FUKA 3ZOZA 5JCPA 2HDOA 5KNCH 3H9BA 3WV4A 5TQ2A 4G1BA 2B83A 3HGQA 4YJGA 1WMEA 2HO5A 3LJKA 2PUGA 3BK1A 3P2MA 1QH8A 2BGJA 3SC4A 5IVKA 4BVKA 4TWIA 5B30A 1SVNA 1Z06A 1WP4A 3MAAC 1TC2A 3ADDA 5AW6A 4REMA 2V7BA 3AR9A 3LQYA 4LDAA 4UXJA 5TNXA 2CZCA 3VI3B 1T4CB 4L22A 4KTVE 3T12A 1YD7A 4MKXA 1OMOA 2ZDQA 1QIIA 3E7PA 2WF9A 5HK8A 2QTAA 2AFHA 1K7XB 5ANRB 5T3UA 2PQMA 3DDNA 3U7GA 4MI9A 4WUVA 1MQSA 2FPUA 1Z38A 3E2PA 3TZ6A 2PZMA 1FFDA 4DJTA 2P68A 4BZPA 1A9XA 2GJKA 1UUFA 1WZCA 3KVOA 4E4YA 1QLHA 3DD5A 2EBHX 4ZRNA 5LMNB 1RHJA 1JHYA 1EBBA 1K4MA 1PV1A 2WKPA 3N2GA 4RO0A 2VRBA 2FWAA 3QFFA 1EIWA 3LKZA 3IHTA 2NNWB 1M76A 5KIAA 3K9FC 1M2GA 1PK7A 4C6SA 1LTQA 2WDZA 2HJWA 1KFJB 1JR4A 4PTZA 2BFCA 2BTQA 3HYRA 4DKXA 1OIVA 3R20A 1EE9A 5B5SA 5JDCA 2JGDB 2P69A 3TTWA 2PUEA 4MJ3A 1U80A 3LXRA 1WQ3A 1NX6A 2LW7A 1XDUA 2OB1A 1W36B 2I3ZA 4UAVA 5TX7A 3MGKA 3A4MA 1JSCA 3DYVA 3V3TA 1J1UA 3WTBA 3ICVA 3EA4A 4JXJA 4XQ0A 3ZI4A 3Q5EA 3TZBA 1H3EA 3W90A 3V8MA 4CEHB 3LVBA 2GNAA 3IIJA 1V4VA 4ZKDA 2GPBA 3IVMA 4RF3A 4TV8F 3G1WA 2AHRA 3IP1A 1ZD4A 2QUHA 4J0QA 3PQ2A 4Q00A 3CIFA 3ZJ5A 3TLAA 4Z7OB 1P2TA 3QEJA 5IZ4A 5UKDA 3G5LA 1XALA 4AAYA 2AXPA 2YDXA 3BGVA 4ENPA 4GX5A 2PXAA 1K97A 3EYAA 4RDIA 3B2NA 4LJ7A 2VXYA 4IVRA 2WRZA 3LV8A 4P3YA 3DNPA 4LYYA 3ELYA 1H1DA 1SBNE 3E3LA 1NQXA 1NVKA 1QF6A 3GT7A 2FFBA 4ND7A 4JLOA 1N25A 1VCOA 1MABA 2ZB4A 3OZ7A 4PHHA 1A9XB 1P61B 3DLHA 1YQTA 4DBZA 3B3FA 1NOJA