1N1GA

Crystal structure of leishmania mexicana glycerol-3-phosphate dehydrogenase with inhibitor bcp
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
349
structure length
346
Chain Sequence
KDELLYLNKAVVFGSGAFGTALAMVLSKKCREVCVWHMNEEEVRLVNEKRENVLFLKGVQLASNITFTSDVEKAYNGAEIILFVIPTQFLRGFFEKSGGNLIAYAKEKQVPVLVCTKGIERSTLKFPAEIIGEFLPSPLLSVLAGPSFAIEVATGVFTCVSIASADINVARRLQRIMSTGDRSFVCWATTDTVGCEVASAVKNVLAIGSGVANGLGMGLNARAALIMRGLLEIRDLTAALGGDGSAVFGLAGLGDLQLTCSSELSRNFTVGKKLGKGLPIEEIQRAVAEGVATADPLMRLAKQLKVKMPLCHQIYEIVYKKKNPRDALADLLSCGLQDEGLPPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glycerol-3-phosphate dehydrogenase
publication title Anomalous differences of light elements in determining precise binding modes of ligands to glycerol-3-phosphate dehydrogenase.
pubmed doi rcsb
source organism Leishmania mexicana
molecule tags Oxidoreductase
total genus 128
structure length 346
sequence length 349
ec nomenclature ec 1.1.1.8: Glycerol-3-phosphate dehydrogenase (NAD(+)).
pdb deposition date 2002-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
A PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1n1gA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1n1gA01
2D5AA 1A71A 1HYEA 2V6BA 3WBBA 1NX6A 1PGOA 5GY7A 2DFDA 5U4QA 3DBLB 1GZ4A 4JP3A 3PDJA 1C0KA 1R0LA 5TT0A 1CQIA 1NVTA 1Q7BA 1C1DA 4NBTA 4E13A 5I7SA 4AJEA 4XKJA 2DM6A 4Q3DA 1E0DA 3PQEA 5GZ1A 4PZCA 1O8CA 3ZWNA 2IEDA 1YH3A 3CH6A 1C1DB 1FJHA 5A03A 3ONFA 4NDNE 3ON5A 1KVRA 1RKXA 3DZFA 1PR3A 4LSMA 3DHYA 2J3JA 1FDTA 3JQ8A 4QSMA 2E37A 3G0OA 2WD7A 1F8GA 3X2EA 4BIIA 4ID9A 1H9BA 2VHZA 3DXFA 1E3IA 1V0JA 4A7PA 1KBZA 3JSAA 3PJGA 3D0OA 1U1IA 1HRDA 3EMKA 3WJ7A 5BSFA 1BVRA 1GY8A 2CSUA 1MA0A 3O03A 3K96A 3IP3A 3ZWOA 1HDOA 4IMRA 5EINA 1HWYA 2B4RO 2C29D 3PP8A 2ZJ1A 3WSVA 5A04A 4Z3DA 3PZRA 3F6YA 4IJVA 1BWSA 3JD1A 1U2DA 5DT9A 4RGBA 4R3NA 1QLJA 4ROSA 1O94A 2JHFA 5T8KC 1QYCA 5JPIA 3UCFA 5F21A 3ZHBA 3DZBA 4EJ6A 4HNGA 3BTSA 3DZKA 3INTA 4MVJA 3WMWA 1LEHA 1LUAA 2BGMA 4RF5A 5BT9A 3AOGA 3PXXA 4FIZA 3PJFA 5HS4A 2Q1TA 1GUYA 2W2LA 4JP2A 4GWGA 4CV1A 4CM1A 5U9CA 3IP1A 3BXXA 2AHRA 1EUDA 2YQ5A 2JL1A 2AEFA 4ZRMA 4CM3A 4FOOA 3WG9A 2BELA 3H2SA 5DOZA 4YEDA 3WLFA 2O3TA 4I5FA 4CL8A 3FTNA 3PFWO 3WTCA 4CQLA 3BHMA 4DQUA 3O8QB 1IZ9A 2Q46A 1MXFA 4DIFA 3ZV6A 1I3MA 4PLVA 4N7RA 3W1VA 4AG3A 3WWYA 3JQ9A 1HXHA 3D4PA 3QLJA 5JDIA 3QVXA 5JCJA 4IGFA 1V3TA 1YOVB 3D4NA 3QRWA 3GY0A 4X54A 3JQ7A 3Q6IA 4Z0TA 5IZCC 3AU8A 3AY6A 4KMSA 4KOAA 4BV9A 1H6BA 3NDJA 2IZ1A 2CDCA 5B4UA 3RUAA 4F6CA 4XEHA 2TMDA 1CDOA 3ZCXA 3DAFA 3V1YA 1M76A 4YJGA 1ZEMA 2O3RA 3DZHA 4IXTA 3ORFA 2XXBA 4YB8A 5G4KB 1LSUA 2QIOA 3F3SA 3ZV3A 2ZCVA 3RASA 4UAGA 3NDRA 2O4CA 3P2OA 5KVCA 4I5EA 3OA0A 4XYMA 1YRLA 2Y99A 1PGNA 2UYYA 5TGDA 4TKMA 3K2BA 5AOVA 1QV6A 1DIGA 2QG4A 2A4KA 1HE4A 3RUCA 3GT0A 2O2SA 1H2HA 3QVOA 2IYOA 1LTHR 5T64A 3ZHZA 2F1KA 4WLFA 2I76A 1R0SA 1UUFA 2BLLA 3GZNA 1MFZA 2P5UA 3MCVA 1XG5A 1EBUA 1Y7TA 5LDHA 4YWJA 2B35A 1NQTA 5JLAA 4P4LA 3BMNA 4BO6A 4BNIA 4N18A 4F6LA 1JA9A 1W6UA 2VUTA 2JCXA 2D1YA 1EUZA 3RBZA 3VTZA 1P1RA 2FR1A 1I3LA 3I9LA 2TMGA 1KVTA 3H9EO 5L53A 1N9GB 5JMPA 2D3TA 1SCUA 2CVQA 1PJLA 1YL6A 2GYYA 1H93A 2H9IA 3E1KA 2GN9A 4NH4A 2JAHA 2QRKA 2XAAA 3UICA 3HUDA 4JCOA 4RQUA 2ZK7A 2FOIA 5BR7A 5COBA 5KVSA 4BNYA 4BNUA 3C85A 4PG6A 4IJWA 4C7KA 1OAAA 1PZHA 2BI7A 3X2FA 1EUCA 1AHIA 2EJWA 4S1VA 4AJKA 4EI2A 1P31A 1PS9A 3O9ZA 1T26A 1VSVA 2PGLA 3D4OA 4J7UA 4AJJA 1U8FO 3M1LA 3GGPA 1H5QA 1HDXA 1YQDA 4IIVA 1CIVA 1CETA 1HDGO 3BMCA 3EUWA 4II3A 4U7WA 2CFCA 1VJ0A 4WEQA 3GNTA 3COSA 4YT4A 1B3BA 3WJAA 3OJ0A 1SNYA 3JQDA 1ISMA 1U28A 1OI7A 2JKVA 3ZV5A 2H6EA 3FWZA 1YVEI 1B26A 1EDOA 4B79A 1NAHA 4I5DA 3V2GA 3DBHA 1OOEA 1GUFA 1M2WA 1C1XA 1DC5A 2Y68A 4O6VA 4MO2A 1VJTA 2IRWA 3IL2A 2FRDA 1L7EA 3SX2A 4MKXA 2C2XA 3L9XA 4UULA 1P1FA 1D4FA 2BHLA 4LRSB 4RF3A 5JAQA 4RO0A 4FC7A 1QYWA 2NU9A 2C7GA 1RM0A 1KEVA 3A1NA 1OFGA 1YBVA 4YDRA 2CDBA 3WGGA 2EKPA 3PJEA 1B8VA 2DPHA 3LQFA 3RFTA 3AW9A 5C5IA 4RZHA 1K2WA 2X1HA 1DIRA 3IJRA 3BA1A 2JCVA 4IDCA 4O0LA 4OXYA 4N54A 2DBZA 1SAYA 4XQ9A 2G1UA 2PNFA 3WYBA 3EW7A 5FFFA 1Q7CA 4A03A 2OGUA 9LDTA 5KCZA 4AFNA 3IOYA 1AGNA 3SJ7A 4Z6KA 1PWXA 3H8VA 3OFSA 3PLNA 3I3OA 4YBZA 4FBGA 3DBRB 5T6BA 3HN7A 1X14A 1XSEA 2ILTA 3WGTA 2G17A 5JY1A 5IG2A 5JC8A 4BGEA 2NLOA 5CEEA 3AM4A 4LN1A 1NAIA 3U9LA 3GGOA 3BMOB 3I4CA 3E9NA 3VPFA 3BZUA 1WMAA 2B5VA 2JAPA 2Q49A 2X22A 3F1LA 4UUOA 2D8AA 3I5MA 5CG1A 3QE3A 4CUJA 1YB1A 1U4SA 2ZTMA 4J9VA 1EE2A 1HLDA 3DOJA 3NUGA 3BHIA 4D3SA 4I08A 1IHYA 3KTDA 5KJ1A 2BKAA 1GYRA 3AY7A 5HM8A 5TJ9A 4FR5A 4NJOA 2RHRA 4Z0HO 4P4GA 4W99A 4ZU3A 3QVSA 1Y8QA 4N5LA 2GERA 3OA2A 1IZ0A 3VZPA 4D42A 2VWGA 4UEKA 3ZDFA 3MWDB 2YHIB 4NFHA 3QP9A 4J90A 3LU1A 3DAPA 3OF2A 4I5GA 3OQBA 4R1TA 2WM3A 1W73A 2I9PA 2B36A 1KYQA 4JBIA 3ZHYA 2HJRA 1YQXA 2OUIA 4PVDA 1EVIA 3HNPA 3VHRA 3Q1LA 4GI2A 4GLLA 3ZU3A 1FDUA 2UVDA 5A1TA 2J5KA 2Y66A 3CE6A 3NT5A 1UDAA 4HFMA 4YT2A 4HNHA 5A9RA 3CINA 4D43A 3CSDA 3E03A 4RVHA 1MUUA 2AG5A 3GAFA 1LRJA 2WYUA 4RDHA 3S8MA 4P4NA 4OYRA 1JTVA 3LC2O 2QX7A 1T1SA 4BNHA 1LDNA 2FN7A 2RIRA 4DLBA 2O3JA 5BSHA 1GU7A 2C7VA 5IXYA 3DEYX 3PZBA 4FFRA 4AJNA 1V9LA 3IS3A 3GVHA 4BO1A 3FBTA 3I6QA 1YB5A 5JY6A 4FCCA 4CMAA 5C7OO 3WFIA 1F17A 2YW9A 4ZQEA 4J4BA 1PJ3A 4CLOA 4R1SA 4PLZA 5HTOA 3ZWVA 2G0TA 4NQZA 3H7AA 1Q2XA 3WBFA 1F14A 3LK7A 2BI8A 2QQ5A 2YFHA 4QTZA 4OL9A 4JJIA 4U5QA 4Z3KA 4CLOB 2PY6A 1BW9A 1LC3A 2EP7A 3OETA 3UN1A 4CQMB 1X1EA 4WCFC 4XB2A 1K6IA 2W2KB 3NRCA 1W4ZA 3FR7A 3Q3CA 1C0IA 1T2DA 1NFQA 3TL2A 4OO3A 4DTIA 4H7PA 8ADHA 1BW9B 4H16A 1U3TA 4PGFA 3LSYA 1ENYA 3CUKA 2X58A 1DC6A 3TQHA 1DBVO 1E1KA 1I30A 2CDAA 3RU7A 3WDSA 1U3WA 3U62A 4LSWA 2AXQA 4QO7A 3PYXA 4JGBA 3I9MA 2ZB7A 5CDSA 2D4AA 5TQVA 4J43A 3I9NA 3A4VA 3BTOA 1AE1A 1DHTA 1PX0A 1E7MA 3GUCA 5L4LA 2JFGA 3AFNA 4QT0A 4BNMA 8LDHA 3RUIA 5FI3A 2O2YA 2X5JO 7ADHA 1Z6ZA 1W8DA 3F47A 1NR7A 4J4HA 4DQVA 4GGOA 1QYXA 1LRKA 4XGIA 3PWZA 2Y1CA 2E82A 2YUTA 5KIAA 1DPGA 3BAZA 1WDMA 4YAIA 1PGJA 4DWVA 3RD5A 5A3JA 4NMHA 1YB4A 4A73A 5TT1A 1YDWA 1Y5MA 4UREA 3HZZA 2Y0EA 4OJNA 2VWHA 5KWEA 4NFSA 4I9UA 2EF1A 3WFJA 3LF1A 1Z7BA 4AICA 3ROMA 4D3FA 3K31A 4QEDA 1I3NA 3R3SA 2JD2A 3PDUA 3KV3O 1HSOA 1PJBA 1U7TA 4BO0A 1DXYA 2HU2A 3RBXA 5L40A 3GLQA 4RPJA 5CPBA 1E3LA 1NYTA 4JX8A 2F00A 4FPXA 3M6IA 4D45A 2PD6A 3ZNOA 4A27A 4E30A 3S2FA 5AXAA 5IFLA 4ND3A 4XD2A 4E32A 1EEHA 1Q0QA 5JXWA 3SC6A 3H9GA 4BGVA 2YV3A 4A0SA 3ST7A 2B5WA 4TKLA 2RAFA 3M1AA 3MWEB 5IF3A 3CTVA 4Q3NA 5DBGA 2C59A 2BF7A 3JQBA 3ONDA 4CODB 4XZ3A 3VVBA 2FSVA 1PJ4A 4J7XA 4PLCA 1KEWA 2O3UA 2FR8A 3QVWA 2EJVA 5TIIA 4LVCA 2Q50A 2J8ZA 3PQFA 4BO3A 1B3RA 4KDEA 5JFOA 3TL3A 4A2CA 3NDIA 1U5AA 1T1RA 3WYEA 2X6TA 2EW8A 3C1AA 4IQ0A 4C7JA 2GZ1A 2DPGA 4MJLA 2Q1SA 5MGBA 4DLLA 1JLLA 2VRCD 1ADBA 3GEGA 1C14A 3AWDA 4M1QA 4MINA 2G5CA 1YL5A 1CWUA 1RM3A 4IDBA 5IJZA 3H5RA 5H81A 3RKRA 1WDLA 4BS9A 4YRBA 2BGKA 1YO6A 4UVIA 4DA9A 5GZ3A 2CZCA 1SEPA 2OBYA 3L07A 1R16A 2AQKA 2D2IA 4FDAA 2YFQA 4P8RA 1ARZA 3JQEA 4NJMA 2AEJA 3FNGA 3JD3A 4NBVA 2XXJA 2P9EA 3E82A 4S3MA 3MOGA 4YA6A 4CLRA 2HMTA 4TZKA 3IAHA 1D3AA 1SEVA 4FOSA 4BNKA 3ROQA 3L6DA 1DC4A 2GCGA 3AI3A 3QIVA 4BMVA 4PFJA 2ZTVA 4JN6B 2SCUA 5I9MA 2C82A 1BTOA 1GEGA 2OP0A 1UZLA 2HDHA 4BHTA 4KUEA 4NPCA 4PLTA 4FW8A 1A9YA 2YJZA 5KVQA 3UFXA 1UDCA 2A94A 4AVYA 4AJ2A 1L7DA 2I67A 3PYMA 4RCVA 1E1NA 3GN1A 4IIUA 3L0DA 3V2HA 3U4HA 2P9GA 2FHSA 4U8GA 1E1LA 2Y1GA 1LJ8A 4XX0A 5B4TA 4Y6RA 1PL6A 5EJ2A 3BMQB 1Z75A 3NTRA 4W9NA 4PCVA 1N7HA 5I8ZA 2GD1O 4TRMA 1QORA 3G79A 1EVYA 3IQDB 1NFFA 2PKQO 3KYDB 2HRBA 5DCYA 5CDGA 1EBFA 1E3JA 4O59O 3DOCA 1PS0A 1N8KA 3KSZO 4Q3CA 1N2SA 3DAGA 4LRTB 1GUZA 3RC2A 4JLWA 3QY9A 4DPLA 3OQ6A 3WOHA 4LVUA 2BFPA 3LT0A 3NX4A 4ND1A 3GMDA 3UXYA 5HRUA 3I9OA 1BXGB 1JU9A 2E6UX 3F1KA 3TDKA 3BYZA 5I7FA 2EG9A 4BNZA 4Y9DA 5CPFA 3V8BA 1I2ZA 1B7GO 4BO7A 3KEQA 3QA9A 2OBNA 2JD0A 4LCJA 1GYQA 1HT0A 1MC4A 5LC1A 4CMGA 4E21A 1T2CA 1HEUA 3OEWA 4OQZA 3ANLA 1AUPA 4RPHA 4NZ9A 4XDYA 3VKUA 3ZHXA 1XR3A 5CEFA 2ZJ0A 3JQAD 4IZHA 1HSZA 3CIFA 2PGJA 3ZWWA 2GRAA 3IC5A 2GASA 1CERA 4UVDA 1EQUA 3JQGA 5I9NA 4ZA2A 1UXGA 4CMBA 1CEQA 2X5KO 2BRUA 3UGKA 2B0JA 2VWQA 2FPPA 2HCTA 3PIDA 2PWZA 3JD4A 1PTJA 3L4BC 3ZWAA 4ZGWA 4ZHSA 3ASUA 3JQGB 1NVMB 2E4AA 2RBEA 4OIMA 3WIEA 4O1MA 4QFDA 4G5HA 1PR9A 3PI7A 1E77A 4MPDA 4Z9XA 4P22A 1IPFA 3TOXA 3QWHA 3AK4A 3LLSA 3PTZA 3ZN2A 5L4NA 4M55A 4BKOA 4WLOA 5ENVA 2DLDA 3NJ4A 1KOLA 2DTEA 4XGNA 3GR6A 1DIAA 2Q1WA 4L0QA 3RIHA 3WGOA 1YQGA 4JK3A 1E7QA 3KEOA 2EHDA 1EVJA 3KHUA 4WE3A 4KQXA 1Z74A 2BFOA 5CP8A 4XR4A 4G2NA 2NU7A 4M8SA 4U6SA 2Y1OA 3VDRA 4EEZA 4XYLA 2Y93A 1PGQA 1JVBA 1X7GA 5L9AA 2H1SA 4XQGA 4L8VA 2NADA 3H9UA 4ZVVA 4CMEC 4L4XA 1PZFA 1ZXBA 1OC2A 1C0PA 4NBWA 4XJTA 1BSVA 3ITKA 1I5RA 3ZNQA 5C37A 1X15A 2V7PA 3SVTA 1EK5A 4LMPA 1XDWA 1IY8A 1J49A 4PRLA 1MGOA 4E31A 3ITDA 1TVEA 5DBFA 5F1KA 4E2YA 2HK8A 3UHAA 3ZU2A 2C2YA 3E5MA 4DPMA 5U1PA 4ALKA 2CUKA 2EEZA 4QO8A 4MDHA 5MDHA 4WJZA 4F3YA 1XQ1A 1HYGA 5IZCA 4HXYA 4OQYA 4J7CA 1RWBA 1JW9B 3DMTA 3INGA 1ZO8A 3JQFA 1XU9A 4CMCA 1GDHA 1QLHA 2DC1A 4DBVO 2VTDA 3O8QA 3FNEA 4GMGA 4YQZA 5FWNA 4BNVA 5BQFA 5TLSA 1X1TA 1OMOA 1O0SA 4CLXA 4E2XA 2PA3A 3FD8A 1NM5A 3MJVA 3VZQA 1G0NA 1NWCA 3K9QO 1PJCA 5L45A 4NBUA 1LI4A 1YOVA 1B2LA 2HAEA 1K5HA 4DLAA 3AOEA 4BB5A 5EMHA 4GX0A 2FR0A 3VZSA 5KTKA 4IXWA 4NR0A 4NNJA 1ISJA 4MP6A 4ALLA 2WYWA 1CJCA 4A26A 1JQBA 2ZTUA 3WWZA 1MC5A 4GVXA 4AJPA 4AJ1A 5G4KA 4WKGA 1GV1A 4TRRA 1X0XA 3JQCA 4LK3A 3PIIA 4YTEA 1BGVA 1Z73A 4MP3A 3KSDO 4ILKA 4JBGA 3U0BA 2WTBA 5BSGA 2DVMA 1G6KA 2V6FA 3QWIA 1DRWA 3ADPA 4XRGA 1E6EA 3VKVA 4M87A 1A27A 4IDFA 3ZWXA 4FB5A 1LLUA 2P68A 3KLPX 1AXGA 2OORA 4R9RA 1V3VA 4I1IA 3C7CB 2X8LA 1R4NA 2IDZA 4WASA 1VRWA 3ZNNA 4PLFA 5ENDA 4YPOA 5T57A 4YYZA 2OFPA 3Q2IA 3ZWCA 4JROA 1H94A 5L7TA 1JN0A 1RJWA 1WNTA 1TT5A 4IGEA 1ZEJA 1R4NB 4CM9D 3TNLA 5GZ6A 3GDOA 2IODA 3MEQA 3WIDA 1GADO 3N7UA 1TT5B 3JYQA 3Q11A 3BIOA 3RUFA 4OKNA 2ZB3A 4EYEA 2OZPA 4XQCA 3RFXA 1N9GA 2V6GA 3DB2A 4HFNA 4XQEA 4HFJA 1VE9A 3JQ9C 5H82A 2GUGA 4AJIA 1R0KA 2C5EA 2X86A 3KM0A 3RUEA 2PKRA 3SLKA 5JDIC 1NBOA 4MVJM 3KLMX 5HWSA 4I8XA 3WGYA 2DQ4A 4FGSA 4IM7A 2W8ZA 4R1NA 1I32A 1J5PA 1E7RA 4IBOA 3STHA 5JS6A 4D0RA 1ENOA 2VYVD 1PQPA 4R54A 2LDXA 3G49A 4D46A 1KIFA 2CY0A 2X9GA 4RPGA 1Y6JA 2UUOA 4CMHA 3LLVA 3ZW8A 3V1UA 1LC0A 3BTUA 4MIYA 2J6IA 2X0NA 3ZZNA 1HE5A 3IDSA 1YGYA 2ZKLA 3HE3A 2H63A 4GH5A 3D1LA 1XQ6A 4IINA 2I6TA 5HBRA 1GPJA 4EDFA 1YKFA 3VH3A 3KOUA 5EL0A 1PQWA 1P77A 2PKQP 1QMGA 4XR9A 2C20A 2P5YA 4B7CA 2WWRA 1PIWA 3HFSA 2VNAA 3OSUA 1KC3A 3RI3A 5IDWA 4R16A 3WQRA 5C7IO 1B8PA 4QXMA 1NQAO 1YXMA 2RHCA 2A35A 2O3QA 1HYHA 1UZNA 3I1JA 2WDZA 3JD0A 3VH1A 4E3ZA 3TFOA 5JYDA 1NASA 3GVXA 4WNCA 1ML3A 3AY3A 4YR9A 3UOGA 2CNBA 3M2PA 4AJHA 2Q2QA 1DB3A 4J2HA 1KVQA 2DBQA 1ZK1A 2GDZA 4YQYA 4TZTA 4GLOA 3HDJA 1JKJA 1ZBQA 1HLPA 4EBFA 2ZCUA 4E4YA 4XJSA 4TVOA 2WSBA 2B69A 3E6AA 5CFZA 3RJ9A 3DBRA 3UW3A 1UR5A 2DTDA 3W4JA 3V5NA 1YWGO 4BKPA 4OXNA 5B4VA 4KDFA 1NWHA 1NR1A 3MZ0A 3QWBA 5ICMA 1EFLA 5L7WA 1Y1PA 2HRZA 2UDPA 4YJHB 1GAEO 2UUPA 3BMOA 5JAIA 3SJUA 5THQA 1DJQA 1D7OA 1WPQA 5TS3A 1XYGA 3RJ5A 4BV8A 4G65A 1D8AA 3GRKA 1BRMA 1P3DA 4GBJA 2GLXA 3OECA 3C7AA 2BGLA 4MVJD 4U0JA 1UAGA 4HV4A 2UAGA 3K5PA 4WEOA 3ZV4A 4BO5A 4E0BA 2IEBA 2W2LD 4DIOA 1I24A 2OL4A 2VHWA 3WNQA 1ZMOA 1WLYA 1LBEA 1T4DA 9LDBA 4B3JA 1LLDA 4QX6A 4TQGA 2OOSA 4MVJI 1BDBA 1XA0A 1XCBA 3H5AA 2VOJA 4W7HA 1SPXA 4C4OA 4LISA 4ZN6A 2EXXA 3MTJA 5TNXA 2YHIA 5G2OA 4IUYA 4CM7A 2VT2A 3DHEA 3ZW9A 3I23A 4OOFA 1R4MA 3W8EA 2POQX 1N1EA 3KUXA 1M6WA 1U5CA 2Q4BA 2GN4A 1VI2A 3WQQA 3A28A 4MKZA 2VYNA 4DYDA 4BNWA 3B20A 5JCJD 1SO8A 2PZMA 1H6CA 4Y67A 1QXSA 5KOIA 2ZTLA 1R4MB 1JKIA 1Q0LA 3Q9NA 2G82A 1D1SA 3D5TA 2YZ7A 3Q9UA 4D79A 4CM4B 2GPTA 3PWKA 4YT5A 4OOEA 5FEUA 3OICA 3GNSA 1QRRA 1JVSA 2GO1A 5ILOA 1K3TA 1N7GA 5CHEA 5TSDA 2ZIZA 1WP4A 1LDBA 1ZVMA 1N1GA 2RCYA 4W7IA 5JAZA 1HE3A 1P0FA 3L6EA 1F0YA 2IXAA 3AM3A 1GZ6A 1T2AA 3AM5A 2O4UX 1P1HA 4WCFB 5L3ZA 1LU9A 1PWZA 3AFMA 3SEFA 3RC9A 4E5KA 1KVUA 4B8WA 2Q1UA 4FFMA 4E5YA 2WE8A 5JSFA 2DT5A 1Q0HA 3JCZA 2FWMX 2VZ0A 3SC4A 5KNLA 3LZ6A 4ZQGA 4CQMA 1HL3A 1BXZA 2W2KA 2HQ1A 5C7LO 3HSKA 1ZZEA 2NQ8A 4HP8A 1FDWA 3I6IA 4ND4A 1NNUA 1JDJA 1PJTA 4JIGA 5EIOA 2I66A 2DU8A 2A92A 6LDHA 1XELA 1U3UA 1I01A 5G0UA 3VOSA 1FXSA 4NIMA 4O63O 3UAGA 4GSKA 1JKFA 3UCEA 1ADGA 4GGPA 3RSHA 4CLEA 3NGLA 3ZWBA 2R6JA 3S2EA 1I2CA 3ICCA 1ENZA 4FFLA 3TF5A 4DRYA 2FSSA 4UEOA 1IUKA 3JYOA 4R51A 4H3VA 2WEKA 4PZEA 1UXHA 2DUUA 1NPDA 4K26A 2P91A 3U4CA 1V8BA 3ROKA 3RVDA 2DBRA 4M54A 4WGGA 3KO8A 2Y1DA 1ONNA 3EC7A 1ISIA 3ABIA 2O50A 3H9QA 4CMIB 5ES3A 1EDZA 3GFGA 1R66A 2W4QA 1BG6A 4WOKA 4YAGA 3EHEA 2ZATA 2EKQA 3IUSA 2PTGA 1J4AA 4CV2A 4CUKA 2Z1MA 3KVOA 2VQ3A 2HK9A 2Y0DA 1UP6A 3WXBA 1G1AA 5DP2A 1XHLA 5G0SA 1E5LA 1QYDA 1ORRA 3JQ6A 4I9HA 3TWOA 2X23A 3HQ4O 1U2GA 1UZMA 1WAMA 4WLNA 3EY4A 3VH4A 3GAZA 3JV7A 1RPNA 3DTTA 4EGFA 3C1OA 3GG9A 1L1FA 1ZIDA 3B1KA 1PJSA 4AL4A 3BTVA 5KVVA 4PVCA 2AQ8A 1TLTA 4EJMA 4A5OA 2Y1FA 4D0SA 5THKA 2CMDA 3NEPX 4IQ8A 4O5OA 2Y67A 2VHVA 3FTPA 4EITA 5B12A 1DLIA 3JQAB 4ZD6A 3G3EA 2G76A 2GGSA 1E3WB 5HS6A 4XYBA 1GL3A 4KTVE 4BNGA 3F4LA 4R1UA 1HTBA 1YL7A 4R5MA 1A9ZA 3IKVA 4L75A 2GN6A 3CMCO 3FF4A 3S2IA 2P2SA 3RQSA 4J1QA 3NAQA 2H5LA 2VTEA 1LLQA 3C8MA 3KYCA 3OJOA 4JNKA 4ZICA 1TB4A 3PRJA 4J1NA 3DDNA 3DMYA 1CYDA 4KP7A 4Y8VA 3F5SA 5DNAA 1GR0A 2QZ9A 1DSSG 3KYCB 4EW6A 3GPDG 3T4EA 4RPKA 5A4DA 4IDEA 5FI5A 4RORA 3L6OO 4URFA 2HLPA 3ZU5A 1SMKA 2R00A 2HKIA 4BMNA 1UJMA 1ZNQO 2C54A 2NVUB 1Q1NA 2AW5A 3VC7A 3ULKA 1DRUA 4GL4A 5ITVA 1ADCA 1B16A 4XIJA 5A9SA 2PR2A 1ZUD1 3UKOA 3O26A 4K6FA 3SBOA 2Z5LA 3MTGA 1UXIA 3HHPA 4WLEA 1B8UA 2DKNA 1E5QA 1NHWA 4RLHA 4H15A 1ZK4A 3HFGA 1XU7A 3VH2A 3WR5A 3TZHA 3VVCA 4TSKA 5A9SB 4CUZA 4CR6A 3UF0A 3ICPA 3TZKA 2JJYA 3D3WA 3DO5A 3PFFA 4J0EA 3K92A 3OHSX 2FZWA 1UP4A 3WMXA 1E7WA 2Q45A 3F9IA 1WMBA 3ANMA 5L4SA 3DZGA 2VHYA 4Q3AA 4K1LA 1HDYA 1PJQA 3D3WB 2GSDA 3GFBA 4GPD1 1DO8A 1ZXLA 1Z45A 2EGHA 4UVHA 1EZ4A 1P0CA 3R1IA 5JMWA 1QR6A 1GQYA 4R69A 5DDIP 4PG4A 1XEAA 5JDCC 4B4UA 3N74A 4Z0PA 4WCDA 2GN8A 5CDTA 2NM0A 4J91A 4ZQBA 1CQJA 4IS2A 4BMSA 1AXEA 1E7SA 1FDVA 3ASVA 4KQWA 4J49A 2P9CA 3JQBC 5IDYA 4OHUA 4R4JA 4IDGA 4B7XA 1A4UA 1Y9AA 4LCEA 2HJSA 5A5EA 4R41A 5L95A 3SXPA 1UP7A 3L4SO 4CM8B 4L4RA 1ONPA 1B14A 4ALMA 1UDBA 2PH3A 2B4TO 4WK6A 1U7HA 3EZLA 1CF2O 1P1JA 4E2ZA 3E9QA 1O9BA 2NVWA 3BMQA 3P5SA 1I8TA 3O4RA 4B4VA 2EP5A 4RV9A 5H83A 3NTQA 2AMFA 3KYDA 2YDXA 1VL0A 2A9FA 3QW2A 4W4TA 4KUHA 5IDQA 1LDGA 1DOHA 1WW8A 1ZJYA 3DZIA 1DIBA 3ETDA 3K2EA 1O5IA 1LDMA 5TX7A 1P33A 2I3GA 3F46A 3AI1A 3WQSB 1KC1A 1OZAA 3MJSA 1KY5A 4FFPA 4ITUA 3IJPA 4DC1A 1BXGA 4HBGA 4MVJF 3GK3A 3RC7A 3GEDA 1PS8A 2O48X 4YVFA 1WWKA 2ZYAA 1ULUA 3DBVO 3FNHA 1R15A 4KZPA 1IE3A 2Y0CA 4Q3BA 2O7SA 1R6DA 2QYSA 3W4IA 3PQDA 4WNIA 4GKVA 5A5FA 5AXDA 1DFIA 1EQ2A 3GOHA 2FPGA 1ZSYA 5T5QA 1RYDA 5EQDA 1H9AA 2DAPA 4Q3EA 5CDUA 5BSEA 4BO9A 1NXQA 3S55A 4QECA 3GDGA 4MIEA 4BNXA 3PK0A 1LA2A 1XIVA 4CLDA 2VNSA 1PGPA 1ISHA 3A06A 2HMWA 3JD2A 3DZJA 1HE2A 4NI5A 4L74A 2VN8A 1Y9EA 4PG8A 4GWKA 2NACA 4K28A 3TRIA 3NTOA 3BHJA 3I83A 4GAEA 5AXBA 2D59A 4XIYA 4CMKA 3TPCA 1J0XO 4HADA 1V3UA 4WLUA 1XWFA 5IAAA 1QYVA 1VL8A 2QYTA 2YY7A 3K73O 4I9NA 1A72A 2QW8A 4YRDA 3A14A 4CMEA 1V35A 3HN2A 4ZQHA 1G0OA 3H5NA 3C7DB 3FRJA 1MG0A 3TZQA 4DBZA 4W9NC 4FSHA 4E5MA 3GVCA 3GUYA 2XF8A 3QWFA 2YYYA 2I99A 1GCUA 3C3XA 1H0KA 2PD3A 5T8KA 3DL2A 3WB9A 3QWAA 3NKLA 2WD8A 5L7YA 2I65A 2I5PO 1ZMTA 4BO2A 5A06A 4JJFA 4CV3A 4P38A 5ER6A 5K9ZA 5DN9A 3ROPA 3DFUA 1DFHA 4DC0A 1F8FA 4UVEA 5K0ZA 2AE2A 3PHJA 5ICSA 3G1TA 3JYLA 1ZJZA 4Z9FA 3DTYA 4MVJE 5KKCA 3E9MA 4M86A 3RC1A 1NHGA 2PZLA 3CEAA 3UUWA 4YAKA 1MG5A 4BGIA 4JBHA 4G81A 1YDEA 4PG7A 4D7AA 1DAOA 2AQHA 3Q2KA 5A02A 1PZGA 3ZNPA 1FDSA 3GA0A 3OM9A 4PLPA 3E8XA 1ZCJA 1E1MA 4XDZA 3K30A 3RU9A 3GG2A 1J6UA 2Z1NA 1VL6A 4CL3A 4RDIA 3MJEA 3EDMA 2NU8A 4RVSA 1YJ8A 3RCBA 3C24A 4PLWA 2X9VA 3JQ8B 3E5RA 4IDDA 4KTTE 1VKOA 2WD7B 4GX5A 5EQFA 5ITWA 1GEEA 1MLDA 1UH5A 4LGVA 1MX3A 2CF5A 3LC7O 5KJEA 5BNTA 3FI9A 5I9LA 4EUEA 2J3KA 5DF1A 1M75A 4BKUA 3VTFA 2GZ2A 3O38A 4B4OA 2X5OA 2Q4EA 5AVOA 3W8DA 3RBVA 3R3JA 5KJFA 2VT3A 1FMCA 4QUKA 4R01A 3HB5X 1HZZA 1ZSVA 5ER9A 1T25A 5ILGA 5DOVA 2EERA 2EWMA 1NQOA 4FGWA 1MXHA 3OJFA 5BNIA 2BFMA 2AQIA 7MDHA 3QSGA 5EERA 1KEUA 2FZEA 1BMDA 4JQCA 1M67A 4E6PA 3LYLA 1UAYA 2WE7A 3KRTA 1XLTA 2VHXA 4CM5A 1K89A 4F45A 2NQTA 2OXIA 4DGSA 2ZB4A 1YBMA 4GX1A 5CAEA 2RH4A 1E6UA 2OMEA 2QHXA 1PEDA 5FF9A 3ZH2A 1LQTA 1SC6A 1TEHA 3LT1A 4WLVA 4E5PA 5LCXA 3D5QA 1GD1O 4BNLA 3CMMA 3JTMA 2GR9A 3D64A 3TN7A 4AJ4A 3HADA 2PH5A 5T67A 4W82A 4HUJA 3IUPA 3T7CA 2PK3A 4CQLB 4PN3A 3PHLA 3NT2A 4CR7A 1LX6A 3AUSA 3AU9A 4IJKA 2HK7A 2OP1A 5HA5A 3S1LA 4IZIA 2NWQA 3DMTC 5CEJA 1Z82A 3QV1A 3GF4A 4UEJA 4XCVA 2LDBA 3JQFC 1U8XX 4J6FA 1JAXA 3JQ7B 2JD1A 2P4QA 4UUMA 4XGKA 4RVGA 3T4XA 4DIBA 2PLAA 1PSDA 3FPLA 5KJ6A 5JO9A 4F46A 5IN4A 2Q2WA 2ZYGA 3G17A 2R2GA 4Y6PA 4B7UA 4YJGB 5K6AA 3K6JA 1WVGA 1ZK3A 2W98A 3G1UA 2J3HA 3W4KA 1YJQA 3HWRA 4RVUA 3AOEC 1YE3A 3GGGA 5JYEA 1IHXA 4GMFA 5AXCA 4EJ0A 3CKYA 2X9NA 1ISGA 4GX2A 1A7AA 3U4IA 4M49A 1K6XA 3K8ZA 3AI2A 3Q0EA 4XWYA 4IPTA 4HX5A 1NVGA 4MP8A 4XYGA 4CR8A 1M6HA 1Y81A 3GHYA 5BNFA 3ZWPA 4J2OA 3FHLA 4XB1A 3ZWMA 4BGUA 1HF3A 3TOZA 3GZNB 5EESA 3LF2A 4RLSA 2CVZA 3WS7A 5DCWA 1IOLA 2YHUA 2DBVO 2VZ9A 4BQRA 4II2A 1I3KA 4PRKA 4OSPA 1LQUA 1HDRA 1ULSA 4GSLA 3CPSA 3BMNB 2OHXA 1MP0A 1SBYA 5I7EA 1Y8RA 3PHHA 4DREA 4OAQA 5AQ1A 1F06A 3L77A 4NU5A 4BUCA 4TROA 1JAYA 2VCYA 3VDQA 2YV2A 5TC4A 5IN5A 1XGKA 3NT4A 1ISFA 1EMDA 3JYNA 4LW8A 1Y8RB 1E7YA 1M66A 4NK5A 3LT4A 2WMDA 1P9LA 3P19A 1KVSA 3OBBA 4RJTA 1A7KA 4RQTA 1GZ3A 4D3DA 1GQQA 1QG6A 1WDKA 3ZWYA 4PLYA 5J23A 4IY1A 2AEMA 3TZCA 4RZIA 2HMUA 4L73A 3P2YA 4ONEA 1I0ZA 1DRVA 4RF4A 2NTJA 4CV0A 2PGDA 4UUPA 4ND2A 5JNLA 1ZKMA 4B3HA 1GV0A 4K6CA 4YJFA 3AUTA 3VAZA 1Y5RA 4J9UE 4JJGA 1BXKA 5F1OA 4Q9NA 3BMCB 3I52A 4U0KA 3VPGA 5JBIA 2WJPA 1N5DA 1T24A 1QKIA 5KJCA 2HUNA 4YJFB 2ZQYA 1DAPA 3B1FA 1O95A 1LDYA 1P1IA 3DBHB 3D3EA 1C1XB 3DFZA 4YJHA 5L51A 4DMLA 5CG2A 2BFAA 4Q39A 3RUHA 1KEPA 1HZJA 3FBGA 4PLGA 1PL7A 2AG8A 3INRA 4BNJA 3L9WA 2FP4A 3RUDA 3FPCA 2NSDA 3DOOA 4DXHA 2UV8A 3HDHA 3QJ5A 3VPXA 2JCYA 2IE0A 4OKIA 1C3VA 1ADFA 4BO8A 2V6MA 1HETA 1PL8A 3FNFA 5DBIA 3GMSA 3B6ZA 4FS3A 3E18A 1K0UA 1WXDA 3AUAA 5DZSA 5K6AC 1QP8A 1ENPA 1VM6A 2CD9A 2J3IA 2NV6A 3EVNA 3WGZA 3OQ1A 3DONA 1QV7A 2J5RA 1A5ZA 2Q3EA 3U5TA 3HDYA 4RL6A 3NYWA 1SOVA 1H2BA 1NPYA 4ND5A 1P1KA 1O6ZA 2O7QA 3A9WA 4QFCA 4EUFA 4IS3A 4JXKA 1UXKA 3EVTA 5B37A 3WX0A 1DJNA 1KETA 1I36A 4N5NA 4R9SA 2VOEA 4RPLA 3H3JA 3ZI0A 3PGXA 1GTMA 5IZ4A 1UXJA 3W6UA 1BDMA 2NU6A 5COQA 2EV9A 4CLHA 3WLEA 2HMSA 4ZJUA 4J4TA 3P7MA 3AJRA 4PIVA 4RVFA 3U4DA 3VPSA 4CM4A 1B0AA 2IXBA 3DWFA 3OP4A 4HFRA 5G0VA 3WICA 2VRCA 1AHHA 1H6AA 1E92A 3I4FA 2NNLD 3OH8A 4BVAA 3MJCA 1TA4A 4BNNA 4ZRNA 4TRNA 2ZB8A 5G0WA 3PHIA 2V65A 1ZK2A 1P45A 1GYPA 1S7CA 3EK2A 4BNFA 3H3FA 1I33A 1LLCA 3IIEA 4WCFA 3LC1O 3ONEA 4HWKA 4YAEA 1K6JA 3RAJA 1NPTO 2IZZA 3TFQA 4ESOA 2OO5A 1I2BA 1GQ2A 3OIFA 3PPIA 2PV7A 4R5HA 3DC2A 3HJAA 3C1TA 1FF9A 4E2WA 1Y8QB 2BH9A 3F4BA 1NQ5A 1LSSA 5DCUA 3M2TA 4B4WA 4UVGA 4DQXA 1X7DA 1HDZA 2B37A 1DIHA 3H6KA 2GZ3A 3AUUA 5IDXA 4DYVA 1DHRA 3CXRA 1EE9A 3PLRA 4M89A 1W0CA 4MKRA 2Q2VA 3FSRA 1DC3A 3FR8A 4IDAA 2HO5A 3GHHA 3HDQA 3PWSA 3IMFA 5A9TA 1ZH8A 4WOJA 4FFOA 3SLGA 4XA8A 5GMOA 1C0LA 3TSCA 3UVEA 4NG5A 1U3VA 3VZRA 3PGJA 5TRTA 3GZ4A 3ETGA 2YV1A 5COAA 3GVPA 1GFSA 3FN4A 2IZ0A 3HB4X 3E48A 4ZQFA 4N5MA 3RKUA 4DPKA 3ENNA 3OMLA 4J1SA 2HSDA 1T4BA 2QRJA 3EGOA 3OIDA 3WTBA 4CPDA 3NJ8A 3NV9A 3H4VA 4CMIA 4MOWA 5TJHA 2DUWA 1P74A 4A10A 3NGXA 2FMUA 3V1TC 2GNAA 2PZKA 4ALJA 3DR3A 4NU6A 1PZEA 2J5QA 2O3SA 3H2ZA 2AA3A 3DQPA 2GF2A 4D41A 2VZ8A 4W6ZA 1EK6A 2P4HX 2C07A 1U4OA 3WGHA 3W8FA 2B4QA 2YQ4A 3GQVA 2NUAA 1LSJA 2C0CA 5AYVA 3R0IA 1JWAB 1EVZA 1I10A 4E33A 2ZQZA 4PZDA 2PD4A 1BVUA 4E5NA 3I9KA 4RF2A 1E3EA 1S6YA 5KKAA 3B1JA 1X0VA 1GPDG 2W90A 3JQAA 2VRBA 4J16A 3CZRA 1E3WA 1T2EA 1P44A 2C5AA 4KWHA 2BMAA 3GVIA 2EW2A 4D44A 4FN4A 2Z95A 3LT2A 4L4SA 2JFFA 4BL5A 1HKUA 1CRWG 2XPCA 4XYEA 4INAA 5JO0A 3WYCA 4KUGA 1V6AA 4FJ0A 4TMFA 1OBFO 3ETEA 2X7HA 4DUPA 2QZZA 4YAJA 3WGQA 5F5LA 3EAGA 4OMUA 1DEHA 5JE8A 1RYEA 2CVOA 4U6QA 4BB6A 1IULA 4BO4A 2O23A 1NP3A 5JC1A 1PJ2A 1VJ1A 4K9DA 4YRAA 3JYPA 5B1YA 3GNQA 2X0RA 2DTXA 1LSOA 4MVJP 4AJLA 3RWBA 1TXGA 1WZIA 4WPGA 2X0JA 4Y98A 4GKBA 1Z7EA 1IPEA 4ALNA 5A05A 3UH1A 3ANNA 2NVUA 4J0FA 1FK8A 4EZBA 3OJLA 4HY3A 3ENKA 1IL0A 4AJOA 1B15A 2Y05A 3F5QA 3FWNA 2JHGA 1NTOA 3W6ZA 1N92A 1TT7A 4GQAA 3OJEA 5CDYA 3D7LA 5JDCA 4DMMA 3LVFO 3EYWA 3GN2A 5G4LA 4NHEA 1SB8A 1TI7A 2FPIA 4YJDA 5DP1A 4YCAA 4UUNA 5F3RA 3OEYA 2EGGA 1QSGA 2BD0A 3KBOA 3WGIA 1OC4A 4Y6SA 5A3VA 5JCXA 1EFKA 3TJRA 2D5CA 3T7EA 4LMRA 3EZYA 1YBAA 2PZJA 4OXKA 1BHSA 2YDYA 3H65A 2D0IA 3RFVA 3U49A 4L9RA 1KERA 1VPDA 1VSUA 4CM6A 2VYND 3DHNA 1Q7GA 1VKNA 4BKQA 4CMJA 3GRPA 4KWIA 4J3FA 1RM5A 1H6DA 1VLLA 1DFGA 1ZSNA 4GVLA 3MJTA 1XKQA 4FC6A 1DLJA 1E3SA 1ID1A 4R68A 3ADOA 1PQUA 3S2GA 1ONOA 2FY8A 1GCOA 3FCOA 1JWBB 4PLHA 5DULA 2RH8A 5C3MA 1E6WA 1O89A 1PU2A 4IQGA 4CM8A 5F5NA 3GH3A 3HG7A 1MV8A 3ZU4A 5LDGA 5TF4A 2JFHA 4OSOA 4FJ1A 3GEMA 2R00C 4OH1A 1R12A 3RROA 3KETA 3KB6A 3I9JA 4YT8A 1F12A 4B8ZA 2QRLA 1MFPA 5I7VA 3ZGYA 2AE1A 4IMPA 4R3WA 4NJMB 2PFGA 3B70A 4TVBA 5EN4A 2NTVA 2VUSA 4BQPA 2Q99A 1KS9A 1SZJG 1VC2A 4CQMD 4CLRB 4ALIA 3QVTA 2NVBA 2WYVA 4FQ8A 5FYDA 2E49A 4WUVA 4MVJH 3QHAA 5IXSA 2X0IA 3KSUA 4WECA 4YXFA 1IB6A 1D1TA 3N58A 5I8WA 1SB9A 4J1TA 4BNTA 3PYLA 3QQPA 3WNVA 1X7HA 4FJ2A 3R6DA 1R37A 6ADHA 1ZW1A 4OGWA 4XRRA 3V2UA 1HDCA 4RVDA 3KYBA 4NBRA 1ZFNA 2E48A 3U3XA 1KY4A 1YS4A 2XOXA 3WSWA 4DVJA 3UCXA 3L4BA 4CM9A 2IYPA 2Y1EA 3PHGA 4BKRA 2EIHA 4NK4A 4EUHA 2X4GA 2CF6A 2HMVA 4L76A 3KXDA 3VPHA 1LRLA 1YONA 1NFRA 2VUUA 3GPIA 4YACA 2ET6A 1AN9A 4NFYA 3GDFA 2VWPA 2DFVA 4QQRA 1ZK0A 4FFNA 4MVJG 4CJXA 1U9JA 5EPOA 3TZ6A 1A4IA 1MB4A 3CTMA 3U09A 4MIOA 1LDEA 1WZEA 4IJUA 4DL9A 1LNQA 1DDOA 1X13A 1SOWA 4TWRA 3H9JA 3MOIA 2VYVA 3IKTA 4EEXA 4FD3A 3KZVA 2NTNA 3LDHA 5JAMA 5G0TA 2I3AA 4B3IA 3PEFA 3PJDA 5ADHA 3CZMA 2ZYDA 1LXCA 4BOYA 3OIGA 4PG5A 1RM4A 5JW6A 2B83A 4TRJA 4Z9YA 4E12A 1IYZA 3MJ4A 5F1PA 1T2FA 4OM8A 3GC6A 4HKTA 3DBLA 2EKLA 3PVZA
chains in the Genus database with same CATH superfamily
1WF6A 2V6BA 1OWMA 2H7CA 5K3FB 4C3VA 3QTTA 3JATB 5CNIA 3ZK7A 1ZD5A 3LC0A 5C51B 2DFDA 5DGXA 2XMSA 1VIMA 1NVTA 2PEYA 2YWBA 3RGWS 5KYWB 4RK5A 1BKDR 3QVMA 1Y9ZA 3KZMA 2ZANA 4QODA 5KBYA 2XMZA 3AW8A 2REQB 4QWWA 1TUIA 1VMDA 4A8JA 5ITSA 1O8CA 4TUYA 3CNBA 4JOQA 3PXEA 1TX4B 3THYA 5DLYA 1C1DB 5A03A 3KQHA 3COZA 1VJDA 4GLFA 3DZFA 1PR3A 4I81A 4WZAB 3I1IA 4DMCA 4HEA1 3ILSA 1BE1A 3JQ8A 1QDLB 2PKWA 3WGKA 3NVMB 4JX9A 1XZQA 2ENUA 3FKSD 3NGMA 3WAGA 2HPVA 2XNSA 4ZVNA 2VHZA 3CX8A 1E3IA 2ZU0C 4EMUA 3JSAA 5FLEX 3PJGA 1CULC 5A3RA 4P0PB 3X1DA 4EO9A 1F2UB 1HMYA 1HRDA 1CRZA 1U1IA 3EMKA 3KTOA 4IXDA 4MRMB 4BJ1A 1SD5A 1SC3A 4F2PA 1XTVA 1UDXA 2JZOA 1NBMA 4KZKA 3WJ7A 5BSFA 3IAUA 4XSGA 3B82A 3O03A 3DE5X 4B84A 4OV6B 2PX6A 2WP8J 1RQLA 5H9VA 4UHEA 1J23A 4IMRA 3WB2A 1U04A 4LSZA 3NTLA 2NPOA 3H6HA 1M2VB 1FU7A 1I4WA 4NCIA 2YXDA 3PZRA 3D6JA 2YMLA 1RLJA 1U2DA 3ASZA 5DT9A 2RGDA 5CXQA 4ZTUB 1QLJA 3I01M 4QZVA 1CQZA 1TKBA 7MHTA 1BWRA 3DZBA 3M3DA 2J9FA 4HNGA 3BTSA 5JQGF 4F06A 3ZE0B 1B00A 2NUTA 3B6KA 3EARA 3G8YA 3WMWA 1JT9A 1IHOA 1K5PA 1QTNA 1T5DX 3NP7A 5BT9A 2C00A 4PGHA 4FIZA 3BD6A 3PX3A 1KSGA 3VPAA 1YKSA 4PBSA 4C30A 3GEHA 4UTVA 1J1IA 3AHFA 2P9BA 3ZH9B 2HNKA 2JK1A 2F3QA 2WWHA 1ZONA 2EDAA 1EUDA 1CQPA 3N8NA 2AEFA 3CCCA 3T9EA 3LHSA 2I6FA 4FOOA 3E2IA 4MTLA 4UHHA 5ALUA 3DE2X 2H2DA 2WM2A 4CL8A 3FTNA 1N6LA 1ZM3A 2JRLA 2NPIA 1W0JA 1CVRA 1UADA 2WFLA 3EQ6A 5F4BA 5IVIA 4TV9B 3WTCA 4ASUA 3N2NA 5DBHX 3UHJA 2MIIA 5FLKA 3ZDBA 3ZI7A 4DQUA 5AW4A 3GJ6A 1BYUA 3X3HA 3TGLA 2HXYA 3GP8A 4HQNA 3DE4X 1QPGA 1Q50A 1S5PA 3EXHB 4MEJA 3CR3C 3ZV6A 4LF4B 4N7RA 3L5OA 3TQTA 1G3IA 4W1PA 1H2WA 1I1QB 1IOWA 1N7IA 3D4PA 3QLJA 5JDIA 1R18A 1JAHA 4ZP1A 4B83A 3QRWA 3C14C 3EPPA 3Q6IA 4Z0TA 4D8XA 1KJYA 4KMSA 4BMOB 4OI0A 2CLLB 1ZHOA 1Q84A 2DJIA 1H6BA 5B4UA 1LW6E 4N40A 4RCYA 1AA9A 1RQPA 1M8JA 2DERA 4NPAA 1GGJA 1L5HB 1UPBA 3M1IA 1G3MA 2PKCA 3DUFA 3K94A 2XXBA 1XUOA 4KIFA 2FZKA 2BM1A 3MBKA 2QIOA 4LDNA 2JFBA 2ZCVA 4ODIA 3KOXA 1XCMA 3RASA 3IBCA 3PUVA 2J59A 2O4CA 3QZUA 4I5EA 5DLDA 5KMGA 4OSEA 4PZAA 5IX8A 5ESWA 2VF8A 3T9FA 1T3HA 2ZETA 1DCFA 3SYKA 4F5DA 5LQUA 3V8QA 2NOAA 5JANA 3CH5A 4MEBA 3W2GA 1FOEB 2A4KA 1IJBA 4B6PA 3RUCA 4ZOLA 1XLTC 2VO1A 2O2SA 2BMWA 1H2HA 3EFHA 1P4HA 3ZHZA 3QVJA 5JNRA 3NRJA 4URUR 2I76A 3I6BA 1R0SA 1YNOA 5IW8A 3FA2A 4EW2A 4X20A 4ZOEA 4HGOA 5I7HA 4TKUA 5EMMA 3QPBA 1D4AA 1YRHA 2EC5A 1TCBA 4X8HA 1P75A 4YWJA 1NQTA 3A4LA 5DHQA 2Q3MA 1POWA 3BMNA 4KO1S 5H1YA 1ZGAA 3CLUC 4CDMA 2I3BA 1E61A 4XD7D 1DQPA 3SQOA 4RTKA 1XEWY 2VUTA 2JEOA 3RIEA 3VTZA 1K97A 2FR1A 2XGOA 1I3LA 3TQOA 4DWOA 1KVTA 2ZBDA 1FTNA 3IMKA 1ETHA 4AZ3B 4DZTA 2Q8PA 2W6ID 4GPIB 1P0QA 4L6AA 1FYWA 2E21A 5IAKA 5L53A 4J94A 2FCRA 5ALOA 2D3TA 1VHDA 1DZ3A 4OX9Y 1M8GA 2CVQA 2GYYA 4WZBE 1DDIA 1H93A 3PSHA 4EHJA 2GN9A 1J8QA 2AFIA 2QRKA 4HL6A 3DLBA 3HUDA 2VAXA 2ZK7A 3EB9A 4JI1B 1QHNA 3AEUB 1CUBA 4TXMA 5COBA 4KXYA 3LUJA 4IXNA 1OAOC 3C3YA 4RYDA 1PZHA 2G07A 3HL4A 3R77A 3NYQA 1T9CA 1AHIA 3GGJA 3QBEA 4AJKA 2VPZA 2H1IA 2QQEA 1OFVA 2GEUA 2F9FA 3QI2A 1T26A 1U8FO 3KUUA 5JEEA 3GGPA 4MNTA 3SF8A 1CETA 1X1BA 4Q3KA 5TPZD 2D4HA 2QR5A 5IT9A 5FV4A 2CHVA 3LUFA 1ORVA 2IOHA 1OXUA 3GNTA 4E51A 1OV4A 1THZA 3DAHA 3WJAA 2EARA 3EODA 3JQDA 4G37A 4Y0VA 5B7GA 5HUJA 3ZV5A 2H6EA 1UWCA 1W96A 3DL0A 1H65A 3BBLA 3FWZA 4WBXC 1GN8A 1NAHA 3NBMA 1OOEA 3IOMA 3EGXB 2W42A 4XUCA 4Z86A 1D2GA 1NUAA 2Y68A 4YP7A 2BCEA 4PNPA 3HUFA 1W46A 4MO2A 2IRWA 4C2TA 3D4IA 2CE7A 3IHWA 4C4ZA 2ZPTX 1SHTX 1NVAA 3QK7A 1N78A 2VDNB 3JS5A 1NV8A 4B4KA 1D4FA 4LI3X 4RF3A 3UAXA 2JGDA 5BORA 2QT9A 1KEVA 3H9CA 3L49A 1Y80A 4UEWA 1YBVA 3WGGA 1EFTA 2O2ZA 4JWKA 4YRLA 4DWJA 1A8HA 1L1RA 1JJFA 1QBGA 4M60A 3LQFA 2XUJA 5DTMA 4D9JA 1F6DA 1TPZA 2HF7A 2H54A 1S9HA 1KFKB 2MSNA 3MWKA 5AJYA 4UHFA 2K7FA 3FHOA 3HUTA 4M1TA 3JAWB 3N39C 5LA6B 2DBZA 4UDOA 2X1LA 3LMKA 2Q5QA 4FMDF 1U99A 1VLZA 1QHEA 3LD9A 5FFFA 2G4LA 3CRRA 1JAZA 4A03A 2C1EA 2CB0A 3IP6A 2I7XA 4LDJA 4P36A 3TCXB 1PWXA 3PLNA 4Z1OA 3OOWA 2R8XA 1J2JA 1ZX1A 5AKGA 2WSYB 3WLQA 4ZQCB 5DKFA 2JGKA 5HM6A 3DBRB 1MORA 4UTZA 5EIBC 2J32A 3REQA 1X14A 1RXYA 3M8KA 3WGTA 4YP5A 2OHFA 3EG9A 4QG7A 4B6EA 2WSSD 4ZI3A 3UZUA 5CFLA 5IG2A 1JEYA 2NLOA 2K5UA 4GUAA 5CEEA 3DL4A 3N0TA 2JFWA 5HK8A 1K8QA 3BMOB 4ZOBA 1QRUA 2QVLA 1TAQA 5HX7A 3KZCA 3BZUA 2PN1A 3VPFA 5AW2A 3ZZUA 4DUGA 3SBXA 2ZBGA 2B5VA 2WJIA 2JJMA 3F1LA 4JB0A 4B9AA 2JC3A 4UUOA 2HSJA 3AVXA 5F35A 1ECPA 4I8IA 4J9VA 1JR4A 1EE2A 3AZOA 3DOJA 3NUGA 2QXTA 3A11A 5HF5A 1Q2UA 1C3LA 1U94A 1U8TA 4RZXA 1ESCA 2WBLC 2XYHA 2GN2A 1JSZA 5HDQA 2KQUA 1N3BA 4CN8A 3PC8C 5KJ1A 4EPTA 1GYRA 5IBRA 2EIXA 5HM8A 5MHTA 5TJ9A 1QGED 2EKZA 3D6MA 4FR5A 3KHSA 3O4GA 4NJOA 2RHRA 5F23A 3ZX5A 1RR6A 4ZU3A 2RKOA 3QVSA 4KXFB 1Y8QA 1O2DA 2IW3A 4TSRA 2BKLA 2GERA 3UAZA 4YHHB 3C5HA 3UMGA 5KOHB 1Z6PA 3AKCA 5F9FA 3TRKA 3ECCA 1ZBDA 2AK3A 3LFUA 4WK2B 4EBBA 2GVDC 3LU1A 2OEPA 2Z2IA 1NOKA 4KLNA 4R1TA 2ZIEA 3UB2A 1TLLA 2I9PA 1X38A 4R9VA 3VC3A 3ZHYA 2QLFA 1T4GA 1YQXA 1ZJ4A 1EVIA 2UVQA 1K4KA 2WM9B 3A0UA 4PVDA 4TS3A 3VHRA 4EHAA 3SR3A 2NP7A 1GOTA 5HF8A 4GLLA 3QKIA 3QYJA 4QBFA 3RG2A 5DM70 5F7JA 5A1TA 2QGFA 1TVCA 4YRFA 4DA0A 1H3EA 3RT7A 5A9RA 2Q0QA 3Q3GE 4Q16A 4B40A 5ALTA 4D43A 3E03A 3QJGA 3V4ZA 4ZVMA 1YS9A 2QDKA 4OH7A 1Y4SA 5TQJA 3PA6A 5K2OA 3IV7A 3S8MA 4XTRA 4P4NA 4LJ6A 3LC2O 3EMVA 4G63A 1RJDA 1XXHA 4YCSA 2HFJA 4CDGA 5BQ5A 2OXCA 2WZDA 3N0VA 3RWOA 3NEAA 4Q21A 1ODTC 3MIIA 4IGIA 1MJ5A 3AONB 5L8VA 1GU7A 1UBEA 3IODA 3M5DA 1V9LA 4GUDA 2XNKA 2GLUA 1U0GA 1H0SA 2WT4A 2PLFA 4R1PA 4V39A 1O6GA 1KAEA 1VRVA 3OOYA 4DMRA 3SS7X 4NATA 3WFIA 2YW9A 3OX1A 3O94A 4WJKB 4EUNA 4HDKA 3S5JA 4QM6A 3ZWVA 2G0TA 4KFCA 3WWPA 4FIDA 4PAWA 4PIMA 5DLPA 3T1NA 3LK7A 1N6OA 3BSWA 1X39A 4M9XA 4QQ8A 1BHO1 3N87A 4YV0A 2WUWE 4OL9A 2YN4A 4U5QA 4C0SA 4CLOB 2XA1A 2C4VA 4RFSB 2DSNA 5DNWA 1LC3A 2EP7A 4RKQA 1X1EA 4I3HA 4JKOA 4X8MA 4ZT6A 1ZL2A 3Q3CA 1C0IA 1MVLA 3TL2A 2DG2A 5AKJA 1BW9B 4PGFA 2QRNA 1ENYA 2X58A 1W59A 2BFFA 1UZUA 4QOHA 4GXRA 3UT5A 4CEIA 1UZAA 3O4IA 4EZIA 4W5QA 3WDSA 2A88A 3COWA 4ACAA 5JARA 1AOXA 4NYMR 1KK0A 1A95A 1IXZA 3DKIA 4CZ2A 2ZB7A 3FB1A 3M6AA 5FNVF 1OA0A 2WLSA 5CDSA 1QGOA 2JH9A 4FGJA 1LJLA 1QS0A 4UQOA 3ZHCA 5FWXB 2PLWA 1SBHA 3A4VA 3BTOA 3HA7A 3IBGA 3KEFA 3KPWA 3OJWA 5DHSA 1QFJA 3NNDA 1RLUA 5FJIA 1VHWA 5FV7A 4QT0A 4BNMA 1JBKA 1D5WA 2OV4A 3B7PA 3IIIA 3U9TA 3OZFA 1IQUA 2GYVA 1DDGA 3VNBA 1XHEA 1HGXA 3JXEA 2B82A 3H75A 1ZS9A 2IOQA 3I42A 4QOSA 1JX6A 5EIBD 1MTZA 1SKYB 1QIGA 2GEJA 2QJWA 3ICEA 4IRUB 4HDMA 4UXIA 2RI1A 3IEUA 4KFSA 3EXEA 4TLAA 4OHRA 2J31A 1NXPA 4KQKA 1UBKS 4F38A 2YUTA 3E2PA 4MKGA 4EJSB 3BAZA 3LUCA 4N12A 2WZQA 5B3KA 2XH8A 3EGCA 4W8OA 5DE3A 1JR6A 3GRCA 3IIJA 3E53A 3C2QA 5A3JA 1UBFA 1MENA 3LXXA 2HLHA 3GLGA 5TT1A 3OI7A 4Q1FA 4F9TA 3CM0A 5HK9A 3GFFA 2FWIA 4GP9A 3MQ4A 2O9JA 2BFEA 3D8HA 3DGFC 4XWOA 4BLVA 4C6HA 2QW0X 2RAUA 2SICE 2IH5A 1RKBA 4Y1RB 1PFKA 4JR2A 3IA2A 3TJZA 4JB2A 3L46A 3ROMA 4I1SA 3M49A 1N32B 1YR8A 3R3SA 1OWPA 2H1VA 1HSOA 4DMFA 4I4TF 4BO0A 1HPLA 4RJIA 1DXYA 3RBXA 5JZ9A 1Y1KE 2ZCJA 1L5MA 3NORA 4KXVA 5B6PA 2GARA 4MRAA 5CPBA 3CJTA 3CS3A 3CT4A 3O31A 3WKAA 2LRHA 1XPUA 2F00A 1W1WA 3M6IA 3B9PA 1JYSA 4CHGA 4F4DA 4ZYZA 1G2OA 3KZNA 2C03A 6YASA 4D02A 3I76A 4E32A 3BPSA 4XD2A 4QTYA 5JXWA 3A9RA 5TPWA 3CSSA 2VCHA 4BGVA 4YPVA 5BVGA 2R8OA 1UOQA 2WAOA 2O5CA 1UPCA 1L5LA 3ST7A 2B5WA 5K3OA 1LVHA 4Q9IA 4TKLA 4QAJA 2A1UB 3MWEB 4O4LA 1XNJA 2PA0A 1VLHA 3Q10A 4WVFA 1M73E 4H7EA 4HXGA 3GELA 1JYEA 2ONCA 3ONDA 4HYQA 2ZJ8A 3SQMA 3ACBA 3INYA 3OPXA 4DJTA 4GU5A 3IE0A 1OIVA 3U13A 2XQGA 5C81A 5F7OA 2R7NA 3KJHA 4O4HA 2O3UA 3QVWA 3VHXA 2EJVA 5TIIA 1HQYE 1EGVB 4LVCA 3RYHB 4DIMA 2Q50A 3MUEA 3V8EA 4N8SA 5KC9A 1UK7A 5LD2C 4X95A 5CVDA 2Y0PA 3V80A 4YDQA 2X8BA 4X1YB 4A2CA 3NDIA 1OGJA 2FLKA 1P17A 2X6TA 1XMOB 2GZ1A 2IU4A 2DPGA 4HNUA 4HH0A 3VU0A 5AIAA 2OGSA 2QQFA 1ADBA 4ZO7A 5H3HA 1T6YA 2BZ0A 1NMEA 2YINC 3AWDA 1UKAA 3Q8WA 1Z12A 1N2CA 1XA4A 1XVUA 1QAQA 4MQBA 1QP4A 1G7SA 1NVEA 1YL5A 3F6RA 1WUYA 2GEDA 1VHTA 3P0EA 1F0KA 4I3GA 2C2MA 1JLLB 3IIMA 4LYGA 2ZRNA 2YMQA 3TTYA 2BGKA 3A6HA 4K9OA 5JZVA 5CH3A 1YO6A 4UVIA 4ER0A 5JFGA 3S2SA 1JGTA 2OBYA 4YJ2F 5CX1A 1NQVA 1FYFA 2CJFA 1SUBA 5DNUA 3FYHA 1M2FA 2Q0SA 4JC4A 4FDAA 2GO7A 3IV9A 1DTWA 4Q4JB 5HF9A 4NJMA 2AEJA 2HYDA 2XXJA 2P9EA 2BSXA 3VV3A 3ZY4A 1G9SA 3MOGA 3K09C 1TF5A 4GEGA 4Y9SA 3TUIC 2HMTA 4MI9A 3IAHA 4IUDS 4MPJA 4UPDA 4CLRA 1SEVA 4R0MA 5AVRA 2J67A 4L6IA 5DNYB 2IS4A 5E3HA 4MUEA 1BCRB 2ZBUA 5CBPB 4JI5B 1V39A 2TS1A 3HSYA 3H97A 2CNWD 1TM3E 2J9ZB 3QIVA 1RRPA 1ZW6A 2E85A 4LY0A 1P6XA 1OBHA 1TKCA 1LBSA 3KCNA 4QUBA 3UO8B 1GEGA 5AK0A 3QXCA 1JG3A 3W5JA 1CPYA 1EM6A 4M1MA 2ADFA 2O07A 2V9ZA 2HDHA 4OHVA 4KBYA 1L7AA 4HRYA 4NPCA 3B6JA 4AROA 4ZK6A 2YJZA 1M1NB 2P4EA 1TGVA 3FUUA 4BQSA 1UDCA 2BVNA 1LBHA 2J7KA 1E6CA 3OESA 3WIBA 2OQRA 3R7LA 4US2R 1NRJB 1H8HD 1FPQA 3A1SA 4AJ2A 1VE1A 4C89A 4JLNA 1LKZA 4RCVA 4RTOA 3GN1A 2P30A 3IUEA 4JC8A 1TM1E 4U8GA 5GONB 1E1LA 1KU6A 3H05A 5ALLA 1UPFA 2IUSA 5EZ6B 4LNUA 1PL6A 5EJ2A 1Z6QA 3NTRA 3REGA 3MLEA 1N7HA 1USUA 5I8ZA 1A9XB 1QORA 5KQRA 3G79A 3KYDB 1NFFA 1NW9B 4NP6A 5M29A 3K8QA 3RRYA 1IBRA 1EBFA 4O59O 2M98A 1KQOA 1N8KA 2ZBVA 2OYRA 3VR4D 4LRTB 5BRNA 4BZWA 1I2AA 3EPHA 4KX5A 5A0VA 3S3TA 2FSUA 3BC1A 2ZITA 1P2UA 3OQ6A 3VR3D 4L1KA 1RPTA 1NJGA 1GDDA 4AP5A 1DRJA 1M6VA 3BM5A 3HV2A 3I9OA 3VYRB 2Y92A 4EB0A 5HRUA 3F1KA 2FK8A 1LZKA 3FFAA 4N5IX 4R8KA 5ALFA 2HREA 1WRBA 3P8ZA 4MZXA 5DX1A 3BYZA 4UM5A 5BYBA 5DM1A 2ZJOA 3QFCA 3UV3A 2EG9A 3V8BA 1NN5A 1P80A 2FUCA 2ZSDA 4BO7A 2P5SA 2B8TA 2QRUA 3CWQA 4FMPA 1NTRA 4YUXA 1MC4A 1BA2A 3NHFA 5LC1A 4ZVLA 4CMGA 4TQ9A 4TT8A 3F3YA 4RPHA 4OQZA 2PS1A 1Q17A 2FPGB 2ACWA 4G9BA 5CEFA 4BDTA 3EEYA 3SXUB 2P2GA 2JIRA 3HBMA 4P7FA 1A96A 1EQUA 1G5PA 3CLVA 3K9BA 2QAGC 4NULA 4DUYB 1JI0A 4CMBA 4FDTA 1YS1X 4LZPA 5BV7A 3UGKA 1FRFS 2B0JA 1ISRA 1KK3A 2AJ8A 3E81A 3QUSA 2FPPA 2RGUA 4G1VA 2PWZA 3PIDA 5JU6A 2BCGY 3L4BC 4GNKA 2OSVA 4ZGWA 4DCVA 3TB6A 2E4AA 4JLDA 3IJ5A 2QN1A 3ILVA 3NYIA 3Q8XB 4OIMA 4YFVA 1ZQ9A 4QFDA 5K6RA 4CQNA 3ESCA 2WUGA 2CSXA 1E77A 2DCUA 4TKZA 3T7AA 3V8VA 3TOXA 1IPFA 1QF9A 3LLSA 4LJ4A 5AM2A 1RLTA 1AF7A 1TU3A 7REQA 4BKOA 3CUVA 1RJFA 1B1AA 4WESB 4DEYA 3O95A 3L8ZA 2DTEA 4YJ2A 2Q1WA 4JC0A 1B93A 1MB0A 4NENB 1EVJA 4E94A 2BEUB 4KQXA 2N3ZA 4UXHA 5LFAA 2JKZA 1SUCA 4NVRA 4XR4A 4EPVA 3F8TA 2NU7A 1QHHB 2ZS7A 4M8SA 5HW0A 1TLFA 4EG1A 1FDIA 2OV3A 2ZT6A 2C7OA 4XYLA 2Y93A 1PGQA 4MW0A 1EFRD 4BE7B 1UK6A 1JVBA 4OX9B 2AOUB 4GXTA 5AKYA 5L9AA 4OHCA 2WKPA 1XXLA 2H1SA 4ZANA 4RHTA 1PZFA 1C0PA 2QTBA 1CUEA 4XJTA 1BSVA 2XECA 4KKVA 1I5RA 1HNWB 2DWCA 4OJQA 2V7PA 1ZI9A 3KJGA 4LMPA 1Z17A 1XDWA 3T52A 1IY8A 1Z6GA 2PUTA 4S2UA 5EZYA 1UOEA 2YXEA 3VSEA 1TVEA 3WRYC 5DBFA 4E2YA 1YVRA 5B36A 3BRQA 2HK8A 3O91A 1WXHA 3UHAA 3E5MA 3LXMA 5U1PA 4JFAA 5L3RA 3UK6A 5E9AA 1T9GR 4QO8A 5HJEA 2X9LA 1BFUA 5AIBA 3FGNA 1HYGA 5IZCA 4J7CA 2UXBB 4EFKA 2O57A 4X64B 2CNLA 4DA4A 4HQRA 4IOJA 2IHVA 3U4AA 4EGQA 1APBA 2IOFA 2EJCA 1QU3A 3WYNA 1I5EA 3INGA 5GADl 4BAUA 1XU9A 4CMCA 1X3LA 1Z5UA 1OXKB 2YVAA 2GNPA 3IKJA 4JS0A 3SLRA 2J08A 5IK2D 2JW5A 1CYEA 1L3BA 2VTDA 4YQZA 3FNEA 3LVBA 1CNEA 3NAGA 1X1TA 4JYAB 4E2XA 3GGCA 3MMXA 1PFYA 1UBUS 2PA3A 2X1MA 3ZLTA 2Q5IA 3NC1C 2JFPA 3VO1A 4HAYA 3EIHA 3Q0IA 3TCNA 4Z4HA 5EJ6A 5L45A 1LI4A 3AL2A 4DLAA 1K5HA 4GW3A 2DWPA 4YMHA 2BZGA 1NJ5A 3AR9A 5HEKA 2PSDA 1PT8A 1E1YA 2P9FA 4R8VA 5EMHA 1L4YA 4C21A 1K5GA 2FR0A 4GX0A 4IL5A 5F5XA 2BGIA 3G0GA 2DXIA 3QEAZ 1ISJA 1H22A 2C9BA 1OYVA 2FFRA 2PPLA 7GPBA 4LOJA 1ZH6A 3O8LA 3SY8A 1SHZA 3DBOB 5BVHA 4KPEC 1GL7A 2ZTUA 4U7TB 2G1KA 5E6RB 1MC5A 4GVXA 3FKJA 1GFIA 4R1OA 4DLZA 1C8VB 2C3OA 2VHCA 4AJ1A 5G4KA 3I62A 4NZNA 2FRVA 1ZJ5A 2WNHA 3ANSA 4TRRA 1X0XA 5F9MA 2X0DA 2D1TA 2NO5A 3I2IA 3PIIA 4YI3A 4M0MA 3WL8A 4MP3A 4ILKA 4JBGA 5CT8A 3U61B 2GESA 5K4GA 5BSGA 3GAMA 1JIXA 1G6KA 1QG4A 1XZNA 1NNI1 4NAUA 3PWTA 3UJDA 2GOYA 3WGMA 5JRJA 4MRPA 2H92A 4BRUA 3CH7A 4M87A 2ZUCA 4Y2YA 1KQFA 1YI8A 3LV8A 4IDFA 2Q5FA 3HB9A 1TL7C 3ZWXA 1I51A 4FB5A 3BZWA 2L69A 3KLPX 1JXQA 2CDNA 4M1SA 1MRNA 4MH0R 4N3BA 4R9RA 4MK4A 3C7CB 4WASA 5B7PA 4N8DA 4PLFA 4LECA 2PKYX 4DT1A 2YN0A 2G09A 5ARDA 4YPOA 2WOJA 2O8EA 4F3NA 2G5TA 4JROA 3W6OA 5L7TA 1RJWA 1E2MA 2WV7A 4R2XA 3J80A 4O08A 2GZHA 4MWZA 4ETIA 4HTAA 3HRIA 1ZEJA 2G77B 3FDFA 4CM9D 4ESVA 5GZ6A 1A4RA 1G8AA 1D4ZA 1ZNYA 2C96A 4MHOA 3QXSA 3U48A 3GJXC 2IHYA 5EVCA 1NUQA 4PYQA 4ZARA 3TDNA 4A6EA 5JLJA 1V4BA 3AF0A 3H13A 1EX9A 4TV8B 2QD2A 4LHEA 4ZO8A 2NV0A 3WIDA 4B2LA 1GGMA 4WKBA 2JLYA 3Q11A 4OQQA 3BIOA 5HE8A 3HB7A 3RUFA 5FBQB 2ZB3A 2OZPA 3WE7A 3W3AD 1DE0A 1DWPA 2ZUSA 4HFNA 2ZSIA 2Z2JA 3KVVA 5G3YA 4R1LA 4CTNA 4HFJA 3CLRC 4IG9A 2H2IA 1VE9A 3S2ZA 4I2NA 1B1CA 3TSOA 3RAEC 2FPMA 1R0KA 1N6KA 3KM0A 3N76A 4HDSB 3RUEA 1UBTS 1U8EA 1VMIA 3A8TA 3SLKA 4PCUA 5J2UB 2FJ0A 2O06A 1NBOA 4YAEA 1NXOA 3KLMX 4IJQA 3WGYA 3JWPA 2VYQA 4FGSA 4R1NA 1GPLA 2XUOA 2FCAA 3KJFA 5C5EA 5LU8A 4D0RA 1WY7A 2VYVD 1WB6A 4GOND 1A7JA 1D6JA 1JYFA 3OUUA 4M7WA 2LDXA 3G49A 4GOLD 1XBTA 1SCQA 2CY0A 2X9GA 4I1UA 1P2GA 4K87A 5FPKA 3H5TA 2OKGA 4UBNA 3RTGA 3ZVKA 4FCVA 3VR1A 3V1MA 1ZOLA 2XTJA 2YRXA 3T99A 1PV2A 4I1YA 4U2EA 2A5FA 3L18A 4B6OA 3ZZNA 1GITA 3MHTA 3HKDA 4FINA 1T8RA 4MV7A 4GH5A 3MVEA 5AUPB 4IINA 3IEIA 2I6TA 4AO6A 5IJ9B 1V95A 3AJDA 3VU1A 1PHRA 3T7DA 2GCEA 1R3UA 4OP1A 1R8XA 1YDFA 4N65A 1PK7A 2PKQP 3IFSA 1QMGA 4XR9A 4CG2A 5JMTA 3B7GA 3NOVA 1U31A 3AHHA 1CUIA 2C20A 2QL9A 4KXLA 3HLYA 2DETA 3PEYA 1T2UA 4OLAA 1WW3A 1JZQA 1USVA 2XMCA 1KC3A 5IDWA 3A9CA 3WQRA 2H00A 1O97C 1B23P 2WWXA 1CR1A 4GLJA 2QLNA 4FZVA 2XWQA 5DH9A 3R0XA 4CTMA 1UZNA 1ZICA 3AUKA 2HCBA 1SBTA 5KPJA 3PD0A 1JPVA 5FOWA 3QXJA 3ONNA 4WNCA 2VNKA 4A6DA 3GYGA 5K09A 4O2RA 1FFCA 3M2PA 4DDMA 1JJ7A 3HU3A 2COKA 2Q2QA 3O8BA 4RHYA 5FAKA 4JI7B 3T95A 5BT8A 4NY1A 4HMOA 1S3FA 1DU4A 3NW9A 1OASA 2RBGA 4XJVA 1RXCA 3E5HA 5LUBA 1E2GA 5JHHB 1WVMA 1A69A 1G5IA 3OCUA 3UKJA 3FKQA 4HDQB 1DBPA 1JS1X 2ASVA 1ZBQA 2AFHA 1F1BA 2OLKA 3PR3A 5DFAA 1C9MA 1MO3A 2P8SA 1L2TA 3IXLA 5CFZA 3N8IA 3UW3A 1UR5A 2DTDA 4ARCA 4JLSA 4OXNA 3F7OA 3SBEA 1JKJB 2I80A 1A3CA 1X7XB 3MAAC 3TM4A 3VRHA 2G6TA 1NR1A 4BMPB 4CU5A 1NI4B 4BFLA 1YHZA 2XLBA 1WCXA 5ICMA 1GQSA 2IUYA 1Y1PA 2VZEA 2WLTA 3BRSA 2J0UA 3F49S 3T3IA 4YJHB 3VO8A 5DK6A 2Q4OA 3K70B 3RS8A 2UUPA 1KIAA 3CX7A 2YWJA 4JHXA 2PUGA 2VDLB 3SJUA 1DJQA 4EVRA 1WPQA 3L7AA 4JSRA 4U2CA 5TS3A 4Q9KA 1Q1EA 3RJ5A 3T8YA 3BORA 3QEKA 4R31A 3GRKA 5EA2A 2EAUA 1P3DA 5ES4B 1CZLA 3LQQA 3VNSA 2BGLA 3EASA 5IF9A 4U2GA 4TLLB 3RC3A 2CNNA 4BO5A 4E0BA 1CE8B 4QPNA 1ZMOA 2IHKA 4RA9A 1WLYA 4Q7LA 5D3ZA 3TRDA 4CKXA 3FOAA 4MVJI 2F2TA 1BDBA 4RSHA 4WXRA 4WNAA 2EATA 3U1TA 1QTQA 3DEZA 2X19A 1D0IA 1CW2B 2IP2A 4F8JA 1SPXA 2C1ZA 1H3FA 2OPBA 3F8SA 3OLXA 3OPYA 4LISA 1MBZA 4O4IA 4CKWB 3FXAA 4X8OA 3WK7A 5CA0B 2AI3A 3RVMA 1K7XB 1FXWF 2RB5A 1XB2A 3KVRA 4J07A 4QGAA 5ISMA 4OQFA 1R1DA 4Q66C 3I23A 4OOFA 4U5XA 2JS7A 1VP3A 2PV0A 4PC2A 2NOGA 5DEOA 1Z08A 3KQLA 1M6WA 1WUHS 3AVTA 2GN4A 2C7BA 3CLRD 3EVDA 4EHDA 4MKZA 4O2BB 1ZLXA 5KTYA 4DYDA 1XVTA 3U81A 5GOTA 1M10A 2PZMA 3DWEX 1L5GB 3FUWA 1N1DA 2PRYA 1QGUA 4Y67A 1JKIA 1Q0LA 1AQUA 1KFBB 5EP1A 1XMQB 1IZ8A 1G1MA 1WCIA 2OHGA 5BR8B 5JZOA 3EDRA 4G2TA 4GDFA 2Z8ZA 4G4GA 5NLLA 3PWKA 1J2TA 2CXSA 1Y4AE 2WSLA 4HRXA 5ED0A 1C29B 2XUIA 1AS3A 3LKZA 3L6CA 1N7GA 2ZIZA 3EIXA 5MF6A 4A36A 1LDBA 1N1GA 1POXA 4W7IA 3ET4A 5JS1A 3IERA 3MJDA 4TXLA 5DM2A 1HE3A 3H17A 4XX1A 4L28A 4MGZR 5LJLA 4AKIA 1NBAA 5B1DA 5ECDA 3TIIA 5BRAA 4EMBA 1PWZA 4E3WA 2QT0A 5IH7A 3Q5DA 1KVUA 4BZZA 2E5FA 2ZWAA 2WE8A 2FI1A 4F71A 2EFJA 5LQSA 2X5NA 2QNIA 1Y82A 1YZFA 5C7YA 1ECCA 1WS6A 1Q77A 2RHOA 4NMWA 2C3UA 2FWMX 3JCZA 4TTPA 1DAMA 2VJCA 4AWAA 5K01A 2ZIGA 2AXEA 1O97D 4ZQGA 2IS6A 4CQMA 2VH5R 4YUWA 1HL3A 1DAEA 2G9RA 3FYCA 5JFTA 3EPJA 4RE6A 2HQ1A 3N1UA 3T0GA 3CUYA 5C7LO 1HQDA 3DT9A 1ZZEA 2MT9A 2NQ8A 2Z2XA 4NZYA 1YZLA 2HB6A 3KDAA 3WO0A 3HXKA 1MABB 4KW7A 5GJVC 3A7DA 3VGPA 2XCOA 2W6JD 4FX5A 1Y6ZA 3N7AA 5FUWA 4P5EA 4YLGA 3VOSA 1QZZA 1BS2A 3L4EA 1EHCA 3OBIA 3OQNA 2V0NA 1FFWA 3FW1A 1ADGA 4GGPA 2HX1A 3Q7SA 4ISBA 1J8YF 4PR3A 3FRHA 3QFHA 2H8GA 3SC2A 2DYKA 3HI4A 4KE9A 1ZI6A 4RX1A 1O77A 4AKSA 2FSSA 2XW6A 2CYCA 4CIWA 3QELB 2ZSFA 3TTXA 2QZSA 3LWDA 4R51A 4H3VA 5IFKA 1UXHA 1Z4NA 2DUUA 3SNHA 1M1YE 3E8MA 4K26A 2P91A 2WOOA 3ROKA 4KVAA 3U40A 1R4AA 1MN6A 3DWGA 1MNAA 3PEUA 4E5SA 2BMEA 2ONZA 1UBHS 1YI0A 2UYQA 3ABIA 3WNDA 3AR3A 5C80A 5FI0B 5ES3A 3FVRA 1R66A 5JNWA 4ENPA 3D54D 3HKEB 4HUQB 4WOKA 4YAGA 2OCPA 2M6LA 5DYTA 3U4GA 4YMUA 4Q9DA 2YNMC 3GLUA 3H5LA 4EX7A 1VDMA 3N0WA 3KVOA 3TGWA 4Y9RA 2Y0DA 1UC9A 2H18A 2R7LA 5ALWA 2CXOA 1ZM2A 3O82A 4GSYA 4EPYA 1U0RA 3P4XA 2IZ6A 1XHLA 4MV9A 4ACBA 2E55A 2VHTA 3JQ6A 3AERA 4ZC8A 5K3AA 4LHVA 2X23A 3R6LA 2Q7XA 3HQ4O 1U2GA 4H2DA 2NT3A 4YNBA 2Q62A 2UXCB 2ZWIA 3DTTA 2I29A 3IAS6 2D2EA 3KHTA 4JL6A 4ZT3A 3GG9A 2NUAB 5LYJF 1ZIDA 1Y34E 2C83A 1Z0JA 4BV2A 4MCIA 3VYUB 3L7DA 1LNZA 2ZAOA 2C9YA 2YOHA 3VC2A 4ARZA 4PF1A 2L42A 4K0RA 5FWAA 5KVVA 2BHNA 1NNSA 2IEYA 5EE1A 2ZBPA 4EJMA 4PYMA 4A5OA 3GLFA 5HZMA 4QL3A 3NEPX 2PUCA 2HZ7A 3G5TA 2Y67A 3CEMA 2VDWA 3JQAB 1TTTA 2IHZA 7YASA 3I1YA 2ZP1A 3U80A 1OY1A 2GGSA 1I2DA 2IXTA 1X92A 4IZOA 3GV0A 4MAFA 3DDWA 4ZAGA 4ER7A 3DMFA 1DV1A 3ILHA 3BGWA 1V5WA 4CF3A 4LE2A 2ZWPA 4GZ5A 4R1UA 1YL7A 3HYNA 3TW0A 4GHWA 4M83A 1M2OA 1M1YB 4OFXA 1MQAA 3U4QA 4I3FA 3ENVA 4G01B 2PJZA 3ES9A 4Q5IA 3W3AH 1Y9JA 1DI0A 2GFHA 3HJBA 4NV3A 3OJOA 3ZCQA 4YRKA 4DIDA 3ZJUA 4FKMA 3V42A 3NBZC 5D85A 1BJKA 1P2FA 5DGIA 1OJ7A 4KP7A 1RXVA 5DNAA 3IILA 5AHXA 3KWMA 4EB6B 5FA8A 3H84A 4TMZA 1V8OA 4KN9S 1EGQA 3SP1A 1EJ6A 3NHWA 3GPDG 4Q48A 3KAQA 4B74A 4CVNA 2QRHA 3OPVA 3QOWA 1N6RA 1ZM9A 3IYLW 4RPKA 5JVDA 2I4TA 3L6OO 2HJGA 3AUXA 4CU2A 4R8MA 2ZAMA 4URFA 5IP5A 3STVA 1JIUA 4BMNA 1UJMA 1CJUC 3GEBA 3IP5A 1Q1NA 2OLEA 3A6JA 4UNQA 3ULKA 1DRUA 5BO5A 3W6PA 1JHZA 1DCTA 4AUNA 2XOEA 1QNFA 1AHNA 2XT0A 2Z5LA 3T9BA 4B81A 3MTGA 1UXIA 4WLEA 1IBSA 2WIBA 2OHIA 1G9XA 1WCV1 1W36B 1T8UA 2E87A 1LTQA 3NASA 2OFFA 4QUJA 5A9SB 2C5FA 2WK1A 1J1ZA 2YUIA 3MRXA 3AJ8A 4JL8A 2H0QA 4LHZA 4CEHB 1UWKA 3UF0A 1PYGA 4FOTA 2NZVG 1G38A 3OHSX 3QXXA 5KX5F 4UNRA 4C4TA 4HXFB 1FSFA 1K86A 1NN1A 3U31A 3PBKA 1E7WA 4WN9B 1JQ3A 2Q45A 5FUVA 4G5GA 3GT4A 4NFLA 5TV2A 2QX4A 4QVGA 1QYRA 5L4SA 4ZCQA 2BEVA 1O0CA 2E2WA 2ERXA 1HDYA 3D3WB 2F3TA 3GFOA 4XUDA 3L04A 4XVQA 1T5SA 4DR5B 2OBFA 3G8AA 1IQ0A 3FLEA 5IBPA 3CC8A 1NXVA 1IAVA 5GIOE 1DO8A 1Q6ZA 1ZXLA 2EGHA 3FJOA 1YVUA 5K5EA 1EZ4A 3TZLA 4Q82A 5F51A 2QK4A 3E0XA 3OX4A 1BOFA 3WYAA 3TOVA 4I5IA 4JSYA 1F2TB 4WCDA 4TS9A 1KOFA 4JH0A 4TXHA 3P9ZA 1U2EA 4TMTA 4UCQA 3DLCA 5AK3A 5AVUA 2QTAA 2AJBA 4BMSA 2LCIA 1AXEA 1YQQA 3PCXA 3V4VB 3ASVA 4TMVA 5IYZF 3I5YA 5IDYA 4L8FA 4CDRA 4R4JA 4B7XA 4B3FX 4KNVA 3GEIA 3TOSA 3EOBI 5L95A 2ZRDA 1VMEA 4L4RA 4TMYA 1T3ZA 4X93A 4XFKA 1UDBA 2YNMD 2PH3A 5C9ZA 6PFKA 2JJ1D 2WHRA 2GXUA 1U7HA 2J09A 5T4FA 5SZHB 2Z3ZA 4E2ZA 5CGZA 4H7FA 4RY0A 3A26A 3P5SA 4IDHA 4TYYA 1JEEA 1TO1E 3NTVA 1RIIA 4B4VA 4DARA 2EP5A 2RGWA 3K9FC 1EFHA 4RV9A 3NTQA 1F3LA 3C6QA 2Y9PB 4P7GA 3M1YA 2A9RA 1VL0A 3QW2A 2PRJA 3RRXA 4NCJA 5IDQA 4LHSA 4WIAA 2QDXA 5FHQA 2FB9A 2P2CA 1LDGA 1ZJYA 4L51A 4UNIA 3ETDA 3L82B 3FPEA 3IVMA 3QBTA 4MUKA 3U7QB 1MHTA 2QSYA 3KAJA 1D2HA 3HABA 5GJWC 4BLSA 2XEDA 1P33A 2NZWA 1OX4A 4PQGA 5KSOA 2QUJA 2NYVA 2DWOA 3PKJA 4YV7A 5T3UA 5C8ZA 3F5DA 4IWXA 5LR6A 4U7HA 1D9ZA 3THWA 1Q11A 3NM4A 4KH1A 1F5NA 2P4SA 3KKKA 5C46F 4KZPA 2QUKA 2JAWA 4AXBA 1R5JA 2JJ2D 2B2CA 2PGXA 2Y0CA 4EKYA 1R6DA 1SQ6A