1N1GA

Crystal structure of leishmania mexicana glycerol-3-phosphate dehydrogenase with inhibitor bcp
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
349
structure length
346
Chain Sequence
KDELLYLNKAVVFGSGAFGTALAMVLSKKCREVCVWHMNEEEVRLVNEKRENVLFLKGVQLASNITFTSDVEKAYNGAEIILFVIPTQFLRGFFEKSGGNLIAYAKEKQVPVLVCTKGIERSTLKFPAEIIGEFLPSPLLSVLAGPSFAIEVATGVFTCVSIASADINVARRLQRIMSTGDRSFVCWATTDTVGCEVASAVKNVLAIGSGVANGLGMGLNARAALIMRGLLEIRDLTAALGGDGSAVFGLAGLGDLQLTCSSELSRNFTVGKKLGKGLPIEEIQRAVAEGVATADPLMRLAKQLKVKMPLCHQIYEIVYKKKNPRDALADLLSCGLQDEGLPPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glycerol-3-phosphate dehydrogenase
publication title Anomalous differences of light elements in determining precise binding modes of ligands to glycerol-3-phosphate dehydrogenase.
pubmed doi rcsb
source organism Leishmania mexicana
molecule tags Oxidoreductase
total genus 128
structure length 346
sequence length 349
ec nomenclature ec 1.1.1.8: Glycerol-3-phosphate dehydrogenase (NAD(+)).
pdb deposition date 2002-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
A PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1n1gA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1n1gA01
1FDVA 4XR9A 1CDOA 3ZW9A 3AI1A 2IXBA 3ZWPA 1GY8A 4WLNA 2ZB7A 3V2UA 3U09A 3ZCXA 3EW7A 4J1QA 2V6FA 5B37A 2JHFA 3R6DA 2JFGA 5ILOA 1T2CA 1I5RA 4NFYA 2JD2A 1E7SA 1KC1A 2C5EA 3VDQA 3E1KA 5JBIA 3DAFA 5IAAA 5IDWA 1V9LA 1KEWA 1ADFA 1LDMA 4DBZA 4NR0A 4F6CA 4HV4A 1HT0A 5I7VA 2NSDA 5L45A 4XDZA 1LDGA 1VLLA 4BV8A 4N5LA 2JCVA 1MLDA 3OIFA 2OXIA 2O48X 8ADHA 2AQHA 4RV9A 1BW9B 1K6JA 1LLQA 5L53A 3KB6A 3L4BA 4AJPA 4CQMB 4K1LA 3AUAA 3B6ZA 3FTPA 3JYQA 4UUOA 4W9NA 4DA9A 4DIOA 2VHWA 3UVEA 1YB4A 3GZNB 4KZPA 2Q49A 1VPDA 1HSOA 1ZIDA 1PQWA 3ZZNA 5EMHA 2FN7A 4DMMA 1PSDA 3KO8A 2I76A 4XRRA 3AFMA 3W4KA 1LX6A 3VPGA 4IGFA 4RZIA 4DLBA 3RKUA 1M66A 4UVEA 4CM8B 1VKNA 2X9VA 4DREA 1VJ1A 1X7GA 1B3BA 4TVBA 3MOIA 3BMCA 1EK6A 3PJEA 1M2WA 4Z3DA 1E7MA 1NTOA 2Y99A 4H16A 5F5LA 1E7QA 3ZNNA 4BKOA 1DHRA 2QZZA 4WLOA 4A7PA 3R3JA 3RUCA 2QYSA 2Z1NA 3ASUA 2PKQP 4JBGA 1LSJA 1Z73A 3NV9A 2EP7A 5ICMA 2XPCA 1OOEA 5T6BA 1PS0A 2YDXA 4ALLA 4GX2A 1GV1A 3A14A 1MG0A 3FF4A 4CLRA 2O50A 3C7AA 3AJRA 4EJ6A 3JQAA 1GUZA 4IMPA 2OFPA 1I3MA 3QLJA 3CINA 2VYVD 4CL3A 2P5UA 4UVHA 4GX5A 4I8XA 2Y1GA 3RASA 4DQXA 5KJEA 5JXWA 1W8DA 3IS3A 2VWQA 3AOEA 1PL8A 2H5LA 1MFZA 4XJSA 3ST7A 2ILTA 3NJ4A 3Q9NA 4BQRA 4JXKA 1UP7A 4J7UA 4XIYA 4DLAA 3Q2KA 4EDFA 4DYVA 2PD6A 2VZ9A 3OIGA 3SEFA 1VJTA 1WMBA 9LDBA 2QYTA 3ICCA 3JQ9C 1BXGB 4CQLB 3IQDB 1OAAA 3WTCA 2VN8A 5L4SA 2C20A 4BNIA 3BZUA 2ZTUA 3RSHA 3G3EA 3GHHA 5ILGA 4YQYA 4BB6A 1HE2A 1P33A 3WJAA 4F3YA 5IN4A 2VOJA 4XYEA 4ZHSA 1LC3A 3GAZA 4DPLA 4UUMA 1E3EA 2RBEA 2Y93A 4CM5A 3H5AA 1QR6A 3EYWA 3WOHA 1JVSA 5A9TA 4Q3BA 5JMWA 4J2OA 2Q99A 4LGVA 3GGOA 4Q3EA 5DULA 3D64A 3C7CB 1EE9A 1Q0HA 4MVJF 2B4TO 5FEUA 3GPIA 1U8FO 5TJHA 3NJ8A 3WBFA 1T2EA 1NR1A 1DRWA 4QX6A 3ETGA 3FNEA 5C7OO 4XYLA 4BKQA 2EXXA 2QRJA 4O63O 3PHIA 1NBOA 4ZN6A 3U4CA 5H82A 1T2AA 4LSWA 2PKQO 3ZW8A 2R00C 1P77A 4E5NA 4EUEA 4E13A 4F6LA 2EKPA 3F6YA 3QJ5A 3OHSX 1LDYA 3ZWBA 3DOOA 1ZBQA 2UUPA 3EVTA 5HWSA 5A05A 5TJ9A 5K0ZA 4DLLA 2ZK7A 1VM6A 1O6ZA 4G65A 4KUGA 4DTIA 5C3MA 3B70A 5IJZA 3HDHA 5JAIA 1YJ8A 3K31A 4IJUA 4J6FA 2PK3A 1T4DA 3MWEB 4CM1A 2FWMX 1F12A 1E6UA 3PIIA 4JK3A 4RZHA 1KOLA 4MIOA 1T2FA 5H81A 2WWRA 2DC1A 3BMOB 2VRCA 3AM3A 4J1SA 2YV3A 4QEDA 1UUFA 4LCJA 3BHMA 3H9UA 3Q3CA 3DO5A 5A5EA 2AE2A 3VPXA 3JD3A 3DOCA 1JW9B 4YJFA 3WGHA 5THQA 4BOYA 4O59O 5CAEA 3I4CA 2JKVA 4GH5A 3NGLA 1QYCA 3JQBC 3PTZA 4TRMA 3TOXA 1R0SA 5DP1A 3T4EA 3F1LA 2J5QA 1XSEA 2ZYDA 3G17A 4A10A 4XDYA 2C0CA 4J43A 3H9EO 4BNTA 1Y8QB 2WMDA 2O23A 3HN2A 2NUAA 4FFNA 3ZU5A 2P9GA 1U2GA 4MDHA 4NFSA 5JNLA 2IRWA 1LQTA 3HSKA 2W8ZA 5BSEA 4U0JA 3R0IA 4E2WA 3NX4A 3GNSA 4L76A 3ZV6A 2AG8A 3BMNA 2GN9A 4YCAA 4ALMA 1L7DA 3ULKA 4KMSA 3ZNPA 5ER6A 4XQGA 1XLTA 3PDJA 1Y9AA 3RJ9A 1PS8A 4TRRA 1X1EA 1C0IA 2EHDA 4E4YA 1GEEA 5DN9A 2VQ3A 5F3RA 2ET6A 2G0TA 4D43A 3JQGB 4IS2A 2BMAA 4UVIA 3ZWXA 2EGGA 1EDOA 2CF6A 1DC5A 2ZB8A 3RC9A 1UXJA 4QXMA 1QV6A 1P74A 1KYQA 4B8ZA 2GR9A 3HB5X 1ZFNA 1YL5A 3FI9A 2GF2A 1Q0LA 3CH6A 3SBOA 3LF2A 5IDQA 3PYMA 4O5OA 1I30A 4UEOA 5C7LO 1GCUA 5KNLA 4YBZA 5I7FA 1Q2XA 1R4MB 2GDZA 1QLHA 2PZMA 3PEFA 3F9IA 5C7IO 3X2EA 4JN6B 2ZTLA 5ADHA 3ITDA 3GDFA 1ZK4A 4IINA 1JKJA 4GGOA 3ANNA 3GZNA 4FCCA 3T4XA 2DFVA 4IDDA 3QVTA 1PQUA 5MGBA 4CR7A 3ETDA 2E6UX 4PLPA 1V35A 1AN9A 4BGIA 3OA2A 2ZQYA 1PS9A 2P91A 2V7PA 1JAXA 4MKRA 3WLFA 2JAHA 4JBHA 4ITUA 1N8KA 2GYYA 2GGSA 1RM0A 2VHVA 1DIAA 2V65A 1KBZA 2ZTVA 1LDEA 2HK8A 3D3EA 4B79A 4J91A 1PWXA 3A9WA 1B3RA 5BNTA 3PQFA 4DPMA 4MJLA 4Y6PA 2BFOA 2O2YA 3WG9A 1YJQA 1FDUA 2A9FA 2J3JA 1KS9A 4WCFC 3TF5A 1ENYA 3M2PA 4AJKA 1N1GA 4YRAA 3ZGYA 2POQX 1UP6A 3H5RA 3HADA 1BXKA 4MVJP 4DXHA 4FC7A 1M67A 5BT9A 3LLSA 3NRCA 1C1DB 4IXTA 4PN3A 2GZ1A 3INGA 3GRPA 3G79A 3KXDA 4E32A 5L7TA 4O0LA 3WGOA 4DBVO 2VUTA 4YPOA 1OBFO 2YHIB 1E6WA 1GL3A 1LDNA 1ZUD1 4MO2A 4BNLA 1E1NA 1WDLA 4FW8A 2ZTMA 2NV6A 1Z75A 4R1UA 3DZFA 2O3QA 3EK2A 1R12A 1NVGA 2FZEA 4JJFA 5G0SA 4BNNA 1DRVA 3X2FA 4JIGA 1EEHA 3GY0A 1ZNQO 1K3TA 4EJMA 4UVGA 4ZQFA 4J9VA 3NTQA 5F5NA 1RJWA 3E03A 3GDOA 1DEHA 1LUAA 4AICA 1J4AA 1E3WB 5TQVA 2QG4A 4R69A 2AA3A 4BNJA 3GQVA 2GUGA 2J8ZA 3KVOA 5COQA 3BHJA 4UEKA 3AM5A 3HQ4O 4PG7A 2BD0A 1E5QA 2VWPA 4W7IA 4RPHA 3MJVA 3PHJA 5A9SB 3AY3A 4R68A 1Q7BA 5EQFA 3R3SA 1DLJA 2GN4A 3RFXA 2WE8A 4PGFA 5JO0A 2B83A 2C54A 5KIAA 1LXCA 4R16A 4CR8A 1G0NA 2JFFA 1GDHA 2X0NA 5I8ZA 2AQ8A 5DBGA 1A4IA 3JQAD 4ZICA 4UREA 2VRBA 3KRTA 4F46A 4GMGA 1HF3A 4NBVA 5DOZA 1I33A 3PYLA 2PV7A 3WWYA 1XU7A 3JD1A 1EK5A 4EZBA 2BHLA 3I52A 4DIBA 2HJRA 4M49A 2VT3A 4P8RA 3NTOA 3V8BA 3ROQA 3WQSB 4A03A 2B5VA 1RYDA 3PYXA 3VVCA 2E48A 4QECA 3DTYA 3GVIA 1QYVA 3NKLA 3UFXA 3W8DA 3ZHBA 1NQ5A 3PPIA 4CMKA 4BNZA 1U5CA 1T25A 2D5CA 3ZI0A 4Q3DA 4YAEA 2AQIA 4M55A 2ZB4A 3KYBA 3VTZA 3QVOA 4TZTA 3U4IA 1P0CA 3PK0A 2A4KA 1SC6A 4R3WA 1QYDA 5EESA 4A2CA 3S2EA 1BHSA 1EUDA 4CPDA 4E2ZA 3KUXA 5JY1A 2O7SA 1DFGA 3UUWA 3H9JA 3N7UA 2X23A 4MIEA 5JCJA 3DHEA 3U4HA 5JC1A 2B4RO 3AI2A 4MVJA 3VPFA 1SAYA 1V3UA 1SOWA 1QYWA 2UVDA 3GZ4A 1GTMA 4KUEA 3CMCO 1PJQA 3KYDA 4BB5A 1ZXBA 1BGVA 1Y7TA 3MJSA 3B20A 3OFSA 4I9HA 1DC6A 1Y6JA 2PKRA 5AXAA 1ZEJA 4CUZA 1UDAA 4J4HA 4FGWA 2RH4A 4D3FA 5BNFA 4DC0A 3BMOA 5HA5A 1K6IA 3I9JA 5DZSA 4AJOA 2FMUA 3ONFA 2B0JA 2BH9A 3I5MA 4RO0A 1IYZA 4XIJA 1M6WA 3OMLA 1MC4A 1DXYA 2V6MA 3RU7A 2HUNA 2NQTA 4QO8A 1GD1O 2VOEA 1GYRA 1U7HA 4YWJA 3FR7A 3A28A 3GRKA 3DBHA 4URFA 1CWUA 1FDTA 2VCYA 2I66A 5K6AA 3Q6IA 1BSVA 4RF5A 1DIHA 6ADHA 3PHLA 5ENDA 3U49A 3O03A 2OHXA 1JLLA 4BNVA 3SJUA 3TZ6A 3IL2A 2HU2A 2NU7A 1RM4A 5JY6A 1NFQA 4OOFA 1NQTA 4QO7A 4TQGA 4E5PA 1XGKA 4RQUA 4XD2A 5A06A 4E31A 3GA0A 3U9LA 2NTVA 3TL3A 4M86A 1UZLA 3MEQA 4A0SA 5MDHA 3DMYA 5T8KC 2VRCD 1DO8A 1PGNA 4PLZA 5DBIA 5TT1A 2Y0EA 3K9QO 1LLCA 3D0OA 3DZKA 4Q3NA 3D4PA 3ZWCA 4FOSA 2GZ3A 2PZKA 2C2YA 5CEFA 3KLMX 1CIVA 1H94A 2GZ2A 2YFQA 2HRZA 5HRUA 4LISA 3VOSA 3AY6A 1EE2A 2CVZA 2J5KA 2ZCUA 3FNHA 2PNFA 1A72A 4WGGA 3VZQA 2YHUA 1HYGA 1XDWA 1PR9A 4EUFA 3RIHA 2ZQZA 2Q4EA 1UXGA 5F1PA 1I3NA 2JD1A 1SBYA 1W73A 2HJSA 3KV3O 3KSZO 1LBEA 3OBBA 1P1HA 3JQ8B 3F46A 2EJVA 3DAGA 2Q3EA 1XHLA 4HKTA 4CMEC 3S2IA 3DBRB 3DQPA 1DLIA 4MVJI 1N9GB 4BO4A 3HN7A 3FBGA 2CUKA 3Q1LA 5JFOA 2WE7A 1KEVA 1UJMA 3JD0A 4D0RA 4S3MA 4LVCA 3OJEA 3LT2A 4GWKA 4FPXA 1HDZA 5KVSA 4KTVE 2YUTA 1ZSVA 4ILKA 1VC2A 4WOJA 4XX0A 3PLNA 3WJ7A 1TLTA 4B3JA 5A5FA 3VVBA 5I9NA 4WJZA 4FS3A 2NVBA 1LLDA 2IXAA 1BTOA 1BMDA 3V1YA 4YYZA 3QRWA 3SX2A 3IC5A 1GFSA 1E77A 2NM0A 1MFPA 3FBTA 5JDIA 1UR5A 1C1DA 2OP0A 2JCXA 4PLCA 4Z0PA 3DBLB 1FJHA 4NBUA 1LSSA 3KM0A 1M76A 4U7WA 2UAGA 4RQTA 4XYMA 2O3TA 3H3FA 2OO5A 1P31A 2ZYGA 4D46A 1D7OA 1VSVA 1K5HA 2NVUB 1GR0A 4BL5A 1HRDA 5ITWA 4RVUA 5CDTA 2WM3A 4J49A 4R54A 2RH8A 1TEHA 2ZJ0A 3GAFA 2RIRA 4FFLA 4CMIB 5FFFA 3LSYA 4KWHA 1HXHA 3JQDA 1EQUA 4CJXA 4L4SA 5U1PA 5CFZA 3G1TA 4FFOA 2HCTA 4J3FA 3BMQA 4PVDA 4Y6RA 4CL8A 2Z5LA 1E3WA 2CDAA 3U0BA 2UYYA 1EDZA 2X86A 2VUSA 3PXXA 4LMRA 5AVOA 1LJ8A 1F14A 3VZSA 4RF4A 5LC1A 3QWAA 1A9YA 4J1TA 4QT0A 2CSUA 2X0IA 1DIGA 1FK8A 5IG2A 2VWHA 5A9SA 5CDGA 3AUSA 1JKIA 2Y66A 3L4BC 3WQQA 1MA0A 1A27A 2O3UA 4AJJA 3ZWOA 4XA8A 3DBVO 5B4TA 1NXQA 3L9WA 4BNKA 1Y5RA 4KOAA 4NJOA 3SLKA 1AHHA 4GQAA 4ZA2A 2YJZA 3VHRA 1JWBB 1ONNA 3RKRA 1JWAB 1YVEI 2VTDA 4R51A 1A71A 4RJTA 2Q2QA 3S2FA 2HMUA 3UCXA 4Z9YA 5TIIA 1VI2A 4WASA 3VKUA 2W2KB 3KZVA 1SCUA 2BGKA 4TSKA 5CDSA 1BDMA 3DFUA 1FDSA 1Y5MA 4DGSA 3QIVA 4WNCA 4R9SA 4NI5A 5JO9A 2ZIZA 4U5QA 4BGUA 3HZZA 4HUJA 4WKGA 3V1UA 5BSFA 5TLSA 3T7EA 2IYPA 3UKOA 1N5DA 4RPJA 4L73A 4XWYA 1IB6A 2IEDA 3P2YA 1AE1A 2DFDA 4RVDA 4ALJA 1A7KA 3M2TA 3SXPA 4PVCA 4MPDA 1YBMA 1J49A 4PCVA 4M87A 3TWOA 4YTEA 1B2LA 1Y8RA 1ZJYA 2GO1A 2CMDA 3RUEA 4IJVA 4IJWA 2J5RA 3WDSA 4HY3A 4LCEA 3F3SA 1G0OA 4FQ8A 4U6QA 4YB8A 3DZGA 1R4NA 4PLVA 3RD5A 2D0IA 3INTA 4YDRA 6LDHA 1XWFA 3GK3A 4L74A 4BKPA 1H6CA 4MVJM 1P45A 3K2BA 2E82A 1U8XX 3PWZA 2CZCA 1X7DA 1YQXA 2GN8A 3H8VA 4II2A 5IZCA 3WMWA 1DAOA 5I9LA 1NQAO 2V6BA 1UAYA 3AOEC 4WUVA 5KJ6A 4WPGA 3MTGA 2FZWA 1OC4A 5KKAA 3RC2A 5DF1A 4CV3A 4D0SA 2DBZA 2LDBA 3CUKA 1E3IA 5LCXA 1YONA 2GASA 4ZQGA 3M1AA 4KP7A 4BO1A 3CMMA 4AJLA 1JN0A 4CM6A 4DVJA 2LDXA 4W99A 3PRJA 3ZH2A 1O89A 2PZLA 3KYCB 4GX0A 5JCJD 2O3SA 1U4OA 2Q1TA 4BO3A 3WGQA 2X4GA 1CERA 4MVJD 5A04A 3UCFA 4AJEA 4IDFA 1TB4A 1ZK1A 3K73O 1PJ2A 3GN2A 2JJYA 1I01A 3MJCA 4RPKA 1MB4A 1I2CA 4OMUA 2Y1EA 2OOSA 5IDYA 4FOOA 5DP2A 4MVJG 1E3JA 3NUGA 4YT2A 3OQ6A 3EAGA 1K6XA 2FRDA 2R2GA 3OA0A 5FI3A 3AUUA 3L6OO 1GAEO 3IJPA 3LYLA 5EL0A 1U2DA 4BNGA 2Z1MA 1HZJA 1U28A 4J0FA 2NWQA 2X7HA 2F1KA 1YQGA 4XEHA 4OQYA 3DDNA 2DUWA 3F5SA 3NTRA 4BGEA 5F1KA 3OIDA 4OQZA 1K0UA 3F5QA 5TX7A 3VKVA 3I6QA 2BGLA 2HDHA 2HK7A 1PZEA 1HE5A 4GVXA 1U3WA 2PWZA 2X5JO 3PFWO 5H83A 2ZCVA 1F8GA 3PLRA 2B4QA 2EKLA 2O3RA 4IGEA 4RORA 3BYZA 1TVEA 3LC2O 2C59A 4UEJA 3WX0A 4CM4A 3CKYA 3QY9A 4WEOA 4WLEA 5HTOA 1ID1A 1QV7A 4K28A 5J23A 4ESOA 2Q1UA 1ULSA 3JQ8A 2WDZA 2DKNA 1Z45A 3OJLA 1QP8A 1NX6A 4Y6SA 3K8ZA 4CLXA 3IMFA 2H1SA 3GNQA 1N9GA 5ITVA 1R37A 2DTEA 2VWGA 2P2SA 3COSA 4B8WA 1P1JA 2NQ8A 4ND5A 4ALKA 5ES3A 1HSZA 2DBQA 4HXYA 3NGXA 3H9GA 4JNKA 1V8BA 3TZHA 1EQ2A 4MP3A 5TNXA 4MVJH 1QLJA 1T2DA 4QFCA 1VL6A 3FRJA 3WFIA 2CF5A 1JU9A 1KEUA 1QRRA 3E9QA 2IZZA 3I3OA 1S6YA 2BELA 2NVWA 3ZU2A 1HE4A 1YO6A 1SO8A 3QA9A 3GVPA 2EGHA 3ICPA 3FD8A 4CLHA 4E30A 2BGMA 4XGNA 3WGIA 2AQKA 1NFFA 5EERA 2VT2A 3F4BA 4LW8A 2IDZA 1O95A 2EKQA 4OOEA 5T64A 3MTJA 3LC1O 4BO7A 3JYLA 4IDAA 1YB5A 3D4OA 2BLLA 1U7TA 2NVUA 4N7RA 3QV1A 3U3XA 1PU2A 3B1FA 4LVUA 1UH5A 4WECA 1ADCA 3B1KA 5IZ4A 4IBOA 3C8MA 4Y8VA 5T5QA 3U62A 1Q7CA 3JQ7B 2PLAA 1G6KA 4Z3KA 2GLXA 3VH4A 4DQVA 1WDMA 3OQ1A 4CMBA 2PA3A 4R41A 1GYQA 1NPTO 1SZJG 2FSSA 3JYOA 1O0SA 2XOXA 4HADA 4PLGA 2D1YA 1T26A 3JQFA 3MOGA 1T4BA 4OHUA 3E8XA 5BSHA 1KERA 3TN7A 2QIOA 5KJ1A 3K96A 1L1FA 3RUDA 4H7PA 4GVLA 4RDHA 3R1IA 1UZMA 4YRDA 2D5AA 4R1SA 3FWZA 1KY5A 1YGYA 3W4JA 1MC5A 3HG7A 5DOVA 2Y1CA 1ENPA 3WIDA 1KIFA 3DOJA 1Q1NA 1R66A 3DL2A 1IULA 1LLUA 3VPHA 4TKLA 3P19A 4ZGWA 1PJ3A 4Q3CA 1DRUA 4WK6A 4ND4A 4BO6A 1X15A 4YAKA 5A03A 3NYWA 1ZCJA 3FR8A 1O94A 1PL6A 4PLHA 3G1UA 3EZLA 1I3KA 4R1TA 3DHNA 2PD4A 2Y67A 5HS6A 2RHCA 1E1MA 4K6CA 3DR3A 3MJTA 4YJGB 2A92A 1IHYA 4IM7A 1BW9A 3ANLA 3IDSA 4BNHA 4CQMA 2AEJA 2YQ5A 3L9XA 1MP0A 2QX7A 3F47A 4YJHB 1QXSA 3RCBA 2PY6A 2FHSA 1DB3A 3RBVA 1EUCA 4OKNA 3F4LA 3BXXA 2DBRA 4CMHA 2BRUA 3GG9A 1YOVB 4NHEA 1CJCA 1E3LA 1H9BA 3N58A 3WS7A 5CP8A 4CMGA 2J3IA 1DFHA 3FSRA 4JJGA 4YJDA 1NNUA 4B4OA 4CM8A 4LN1A 4O6VA 4TRNA 3CPSA 5FWNA 2NACA 1Q0QA 1PTJA 4J4BA 4UAGA 5GMOA 2V6GA 3D3WB 3OM9A 2H6EA 4GKVA 5L3ZA 4BNMA 5EIOA 2I9PA 3O8QB 4QFDA 3TL2A 1I2ZA 4FN4A 3QVSA 3WNVA 1C1XB 3PQEA 4ROSA 5KTKA 3TNLA 3OH8A 1Z7EA 1UXKA 1A7AA 4ZQBA 1V3TA 1I2BA 2VNSA 2Q50A 1GUFA 2OL4A 3OJ0A 3FCOA 3JQCA 1PJ4A 1B8PA 1DC3A 2I6TA 3MWDB 4AJ4A 3I6IA 3C3XA 4JQCA 1ORRA 4NFHA 5ER9A 3KBOA 2WYUA 3GF4A 2B35A 4ZU3A 4DUPA 4R5HA 3PI7A 3AU8A 2DVMA 3QP9A 4FJ1A 4NNJA 3I4FA 3A4VA 2H9IA 4WEQA 5HBRA 1EVIA 1HYEA 1H6AA 1BG6A 1OFGA 4KUHA 2DAPA 3KLPX 4Q39A 4H15A 3WMXA 1D3AA 1B15A 1O8CA 2BFAA 3TFQA 1EVJA 3MCVA 5B1YA 1R16A 1ADBA 1VRWA 1VJ0A 3W8FA 1IZ0A 1P1IA 1VL0A 3V5NA 1E5LA 2D4AA 2WTBA 4J7XA 3M1LA 4ZQEA 3WFJA 2O3JA 4AJHA 2X5KO 4EI2A 3WYBA 2QRKA 4MP6A 3UGKA 3ROKA 1BXGA 1P44A 4CQLA 3QW2A 2PH3A 4ZRMA 1ZSYA 1RKXA 1PR3A 1I36A 2WD7B 1E6EA 1FF9A 4D41A 3OJOA 3H2ZA 1O5IA 3WSVA 5EQDA 5CHEA 4TZKA 1IHXA 1UDBA 2XF8A 1WDKA 5DT9A 4Z9XA 5CDYA 3C1AA 2DUUA 4OSPA 4B3HA 5C5IA 4FFMA 1DPGA 3ADOA 1HDRA 5A1TA 3GG2A 5JS6A 3CTMA 1D1SA 3O4RA 1LA2A 2ZJ1A 3ASVA 1K2WA 3LU1A 1HDGO 4I1IA 3UH1A 4PG4A 4XQ9A 1NAHA 2FY8A 2YQ4A 4JLWA 4DC1A 4Y67A 3K2EA 1I3LA 3LT1A 4WLUA 5DNAA 1MXFA 4AJIA 1UAGA 1W0CA 1GADO 1Q7GA 2GSDA 2VUUA 1RM3A 4JP2A 3QWIA 4EEXA 3HB4X 3PJDA 4E3ZA 4M8SA 3GFBA 4RVFA 1I0ZA 2XXJA 4Y9DA 4UUNA 4OIMA 3CTVA 3ENKA 2G76A 4GPD1 3GGGA 2P9EA 1MUUA 4I5FA 1CETA 1EVZA 1HDYA 3CIFA 4YAJA 1HDXA 3JD4A 4R4JA 4BKRA 2YV2A 1JVBA 1NYTA 4IDCA 5AOVA 2G1UA 3PDUA 3LDHA 5KJCA 2O4CA 3VTFA 4R1NA 1WWKA 2C29D 4BGVA 4WOKA 4BNUA 1DC4A 3BA1A 3DC2A 4FFRA 1XG5A 2VYNA 1PGQA 2FR0A 5G0UA 4D3SA 1AGNA 1EFLA 1LSUA 3EGOA 4QQRA 5K6AC 2G5CA 4E5KA 1GCOA 3QHAA 4IUYA 2QRLA 4J16A 4CM7A 1J5PA 2W2LA 3E48A 4CV0A 4DMLA 2X0JA 2NTJA 2GNAA 3IP3A 3ORFA 2WJPA 4I08A 3ZNQA 5KKCA 5L40A 4HX5A 4OJNA 4RCVA 1I10A 3Q0EA 1KY4A 3I9KA 1XR3A 4X54A 1S7CA 1V6AA 5A9RA 1LQUA 1AXGA 2C7VA 4JP3A 3ZWWA 2JHGA 4IXWA 3BMCB 5TGDA 2EW2A 4OL9A 2DTXA 3PFFA 5B12A 2EP5A 4Z6KA 4TVOA 1Y8QA 3D5QA 2O2SA 1UZNA 1T24A 4S1VA 3WICA 4M1QA 4CR6A 3DZIA 5GZ1A 2WEKA 4J4TA 3L07A 3ZWMA 4WNIA 5CEJA 1BVRA 1HETA 1PEDA 1CRWG 1L7EA 4MP8A 1IE3A 3CE6A 4B7UA 2GN6A 1H5QA 3DONA 1E7RA 1NPDA 4RPGA 2YFHA 2NU6A 2B69A 4FBGA 3JTMA 2DLDA 4R5MA 4MVJE 1V3VA 1XU9A 3WBBA 2G17A 3ZNOA 1CQJA 3JV7A 1LEHA 3LZ6A 3JQ6A 1BWSA 3JQGA 3Q11A 4KDEA 1FDWA 4AFNA 1F17A 3FWNA 1WW8A 3U5TA 3WNQA 2EERA 3GH3A 3TZQA 4YXFA 4RLSA 1GUYA 1NP3A 4NJMB 3WGZA 4HWKA 2C7GA 3RQSA 1J0XO 2X5OA 4ZQHA 2VZ8A 1N2SA 2J3KA 2NADA 3DMTA 1SMKA 2NU9A 3G0OA 1C14A 4AJ1A 3GHYA 1XYGA 1YS4A 2DT5A 3K30A 2Q45A 1ONOA 3BTOA 4XYGA 4MINA 1R4MA 4XJTA 4INAA 1P1RA 3D7LA 1NHWA 2YZ7A 4DRYA 4CM9A 5CG1A 3RROA 2AW5A 1GV0A 1SB9A 3PHHA 4NBRA 3GOHA 4UUPA 3WR5A 2YYYA 1PL7A 2X9GA 5HS4A 1DJNA 3FN4A 3WGYA 1YOVA 4E5YA 3ONDA 3WGGA 3RUAA 2CFCA 4L0QA 5JDIC 1GYPA 1LNQA 5CPFA 5U9CA 4BKUA 4NPCA 1IOLA 5THKA 4C4OA 4IZIA 5LDHA 4ND2A 3ZWNA 3H4VA 1YDWA 2BFMA 3EVNA 4R01A 4K9DA 1JKFA 4HFMA 5T8KA 4GKBA 3D3WA 3PHGA 3CEAA 1ARZA 3OECA 4JGBA 3KEOA 4E21A 1GPDG 3O8QA 2OGUA 3RUHA 1H6BA 2F00A 3OQBA 3AI3A 3GUYA 5B4VA 2ZATA 2W90A 4FR5A 3E82A 1M75A 1WNTA 4TKMA 5JDCA 3RBXA 4CQMD 4FGSA 1LI4A 4NDNE 4GWGA 2AG5A 2QZ9A 3TJRA 3WTBA 4HNGA 4A5OA 2FSVA 4JX8A 2I99A 4YAGA 2NNLD 2CVOA 3M6IA 3LT0A 1VKOA 4B7CA 4CMJA 2YHIA 4YT5A 1E1KA 2DPHA 5DDIP 5DCYA 2BI7A 2EJWA 4NK4A 3KETA 4ONEA 4N18A 1B8VA 4AVYA 3E5RA 3VC7A 4ND1A 3MJ4A 3AFNA 4I5EA 4OXNA 3TPCA 1U4SA 4TMFA 4NU6A 3UHAA 5L9AA 3D1LA 5BR7A 2YV1A 4BNXA 1X1TA 3ZV3A 4CMCA 3I83A 1RYEA 1WZIA 1B8UA 1B0AA 1OZAA 1ZXLA 1I24A 1U9JA 4FIZA 4PZCA 4K6FA 5C37A 4RPLA 2I65A 5CDUA 4XR4A 1Z74A 3S8MA 3RFVA 1NFRA 4EITA 4XRGA 7ADHA 1IPEA 3FHLA 4GLLA 1NVMB 3QVWA 1PZFA 4FD3A 4YJFB 3ITKA 3G49A 4ALNA 3NT4A 4YR9A 1GQQA 4XYBA 3PJGA 2Y68A 1XQ1A 3S2GA 3WQRA 4PG6A 2BI8A 2IEBA 4UVDA 2PGLA 4P22A 4CM3A 4CLDA 5FYDA 2DM6A 4PG5A 1F06A 4W9NC 2QHXA 4ZJUA 2WSBA 1TI7A 4OSOA 3HDQA 5AXBA 1TA4A 1H6DA 1HE3A 4IQGA 4W4TA 5JAMA 1Z6ZA 4OH1A 1H93A 1QSGA 4D7AA 1T1RA 3KSUA 3QWBA 1N92A 5TRTA 2PH5A 1LTHR 4BVAA 5JAZA 1QMGA 1EBUA 1N7GA 1YWGO 2EIHA 2ZB3A 3GVXA 4XB2A 1U1IA 1DAPA 4L8VA 3PGJA 2C2XA 4J2HA 2SCUA 5B4UA 5A02A 2W98A 4IIUA 2Y1OA 2HLPA 4EW6A 1ML3A 4PLFA 5IN5A 2X0RA 1LRLA 3HJAA 2JL1A 3TFOA 5JMPA 1Y81A 5IZCC 4M89A 1GQ2A 3V2HA 4DL9A 1EUZA 1QORA 4I9UA 2CNBA 4GMFA 2HAEA 2C82A 1ISJA 2EEZA 3RAJA 2D59A 5CPBA 4EEZA 5GZ3A 3W8EA 4C7JA 3DB2A 4RVGA 1QKIA 4PZEA 1GPJA 3ANMA 1KVTA 4Z0TA 1YH3A 4Q9NA 1PZGA 3E18A 2C07A 3PIDA 3GUCA 5CEEA 4WE3A 1HDOA 2P4HX 2B36A 4GSLA 3VH2A 3IUSA 4HP8A 4R3NA 2EW8A 3ZV5A 1LSOA 4FDAA 3VH1A 1BVUA 3N74A 3HE3A 1KEPA 4L75A 2J6IA 1MV8A 2I67A 1ISMA 3JQEA 3LVFO 2GPTA 1BXZA 1QYXA 4II3A 5A4DA 4B4VA 5JPIA 2B37A 5L7WA 1EFKA 2I5PO 2VHYA 1SB8A 2AEFA 3P2OA 4NG5A 4W6ZA 2HRBA 1R0KA 4A27A 2X22A 3GT0A 1B14A 5F1OA 3KSDO 1ISFA 1P1KA 4XQEA 3WXBA 3ZHZA 4NU5A 4BO9A 2OP1A 2P4QA 2X9NA 2VYND 1C3VA 3VDRA 2JFHA 4NIMA 8LDHA 3I9NA 1PJSA 3L0DA 2JAPA 5L95A 3K6JA 2C5AA 3KEQA 3ADPA 2O7QA 3ENNA 5CG2A 3PZRA 4W7HA 3H65A 3OP4A 4L4XA 3JD2A 4DQUA 1ISHA 1NWHA 4C7KA 3I1JA 1MX3A 4BV9A 5A3JA 4BNFA 2W2LD 3HUDA 4FC6A 3L77A 3ZWYA 2VNAA 1YRLA 4P38A 5JSFA 3E9MA 1NHGA 3GDGA 4WCFB 4ZVVA 4HNHA 3QWFA 1N7HA 1ZJZA 4IQ8A 5EN4A 4U8GA 2FR1A 4BS9A 1UP4A 4NJMA 3FPLA 4YAIA 3GN1A 2P5YA 1IL0A 2D8AA 4Z0HO 4RL6A 1U3VA 2I3GA 2CVQA 3H7AA 2FOIA 1Y9EA 3INRA 3A06A 3BHIA 1ENZA 3D4NA 3Q9UA 3NDRA 1DDOA 3GC6A 4O1MA 4BMSA 1YBVA 3GEMA 3UW3A 1U3TA 4YT8A 4DIFA 1ENOA 3DBRA 4IIVA 3OICA 4DPKA 5ICSA 4B4UA 1BDBA 2WD8A 1XA0A 2PD3A 2QW8A 1JTVA 2BKAA 2P68A 2HMSA 3W4IA 3JQ9A 5U4QA 1A9ZA 3OEYA 5TS3A 1M6HA 5KOIA 1LU9A 2HO5A 3KOUA 3W6ZA 5FI5A 4JJIA 4D44A 1CF2O 5FF9A 3ZDFA 3PP8A 1TXGA 3PZBA 4Z9FA 5JYDA 1PGJA 1CEQA 2J3HA 3I9LA 4GGPA 3L6EA 3ABIA 2VTEA 4KDFA 3WSWA 3VAZA 1NPYA 3H3JA 3ZWAA 3QWHA 4PRKA 4GAEA 3JQFC 1ZH8A 3MZ0A 1EMDA 3RC1A 3DBLA 3SJ7A 3UICA 3ZU3A 4CM9D 1N1EA 1H2BA 1YL7A 1ZW1A 5TT0A 4YA6A 1KC3A 3P7MA 4YEDA 5EINA 3RU9A 2Q2WA 1HKUA 2OUIA 4IDBA 1KVSA 2VZ0A 1WZEA 1VL8A 1PJTA 2CDCA 3LF1A 1LDBA 3LK7A 4CUKA 1ONPA 2AMFA 2B5WA 2D3TA 2CY0A 1PJCA 3TZCA 3KYDB 2DPGA 4CLOB 4CMIA 4GSKA 1CYDA 3UN1A 1W4ZA 2FP4A 2GRAA 3RWBA 5HM8A 4WLFA 3P5SA 2IE0A 4BNWA 3IJRA 3RVDA 3HDYA 2R00A 4IY1A 5BNIA 2IZ0A 3EHEA 3HFSA 3S1LA 5EPOA 5I7SA 1DHTA 1F8FA 1YQDA 5G2OA 2IYOA 3JSAA 3LC7O 3SC4A 4HBGA 3RI3A 2NTNA 4ALIA 1PX0A 1TT7A 3ETEA 3BAZA 3VPSA 1YDEA 4BQPA 3WIEA 2VHXA 3CZMA 5JE8A 3QVXA 3HNPA 4KWIA 4QUKA 3CZRA 3DBHB 3OSUA 4IS3A 4E2YA 1P9LA 3E9NA 1GZ6A 3U4DA 1ZEMA 2DBVO 3RUFA 3C24A 4CUJA 4BNYA 1WXDA 3QQPA 1ZSNA 4AL4A 4OM8A 1CQIA 1HTBA 4JCOA 1OI7A 1EZ4A 5T57A 3FNFA 3H2SA 2HK9A 4I5GA 4FSHA 3BTSA 4G2NA 3VZRA 5G4LA 4BO5A 1DJQA 2Y0CA 3CXRA 4GI2A 2W2KA 3JQBA 4QSMA 4U6SA 1G1AA 3GMSA 1VE9A 1HLPA 3C85A 4FFPA 4K26A 1R6DA 4CMAA 5JYEA 1HYHA 3RC7A 1NM5A 4QTZA 4Q3AA 5COBA 3GEGA 4KQWA 1LRKA 1FXSA 5GZ6A 2UV8A 2H63A 1ZMTA 4W82A 5GY7A 4CLEA 2GERA 1B16A 5G0TA 3GVCA 1NWCA 5JAQA 4U0KA 5G4KB 2JD0A 3C1TA 4HFJA 1EBFA 2CDBA 4J7CA 4MOWA 3IUPA 4BHTA 5DCWA 3B1JA 4BO2A 1I32A 5JC8A 3QE3A 4OXYA 4R9RA 5IFLA 3V2GA 4E2XA 3ON5A 4FJ2A 4LSMA 1E1LA 4YT4A 4YACA 3WYCA 3HWRA 3SVTA 1OMOA 3PWKA 5IXYA 1PJBA 2CD9A 1TT5B 3O9ZA 5G0WA 5F21A 4CODB 3IIEA 1R0LA 1ISGA 1W6UA 4N5NA 1YL6A 3O38A 4WCDA 5TC4A 1NAIA 4YRBA 2EF1A 2BF7A 3DWFA 4OO3A 1KETA 3IKTA 1P3DA 3NEPX 3FTNA 2AHRA 5BQFA 4TROA 4IQ0A 3RBZA 1EVYA 4IJKA 1E3SA 4L9RA 5JW6A 4LMPA 4E12A 1U3UA 4IZHA 4Y98A 2Y1DA 4ZRNA 1E7WA 1WLYA 4NK5A 1PGPA 3GR6A 4ND3A 3KYCA 3UCEA 1D1TA 1HZZA 5EJ2A 3BTUA 1WAMA 3NDJA 4CV1A 4D42A 4GX1A 4XB1A 4PLWA 2Q1WA 4IDGA 4CV2A 3ZN2A 3RJ5A 1XQ6A 3IOYA 2RAFA 3UAGA 3DEYX 2GCGA 5KWEA 4NMHA 4B3IA 3AOGA 3ZV4A 3DHYA 3K5PA 1ADGA 1KVUA 4BIIA 4OAQA 4PG8A 3BIOA 4I5DA 4WCFA 5L51A 1X13A 1IY8A 2XAAA 3NT2A 3C1OA 1PZHA 4RGBA 4NBWA 1X7HA 1Z82A 1XELA 1C0PA 2X6TA 1Y1PA 4P4NA 2IZ1A 4D45A 2Q46A 4NBTA 1P1FA 1SOVA 3BMQB 1IUKA 3AW9A 5I9MA 3NDIA 4GBJA 4BO0A 1JDJA 2UUOA 2HQ1A 1SPXA 2W4QA 4NH4A 4HFNA 3EDMA 5ENVA 5IXSA 4GLOA 4D3DA 1BRMA 4RVSA 3EUWA 2UDPA 2Z95A 3GEDA 1GEGA 3OJFA 1ZKMA 3PJFA 3BTVA 1ZK2A 1C0KA 2Y05A 3OEWA 2EG9A 4IDEA 5L4LA 3EMKA 3A1NA 3I23A 5BSGA 3ZHXA 4YQZA 3EZYA 2OORA 2E4AA 2JCYA 3FNGA 4BO8A 4JROA 1DFIA 1GZ4A 4TRJA 5KVCA 3E6AA 4WLVA 1QG6A 1ZZEA 3AY7A 3KHUA 3JYNA 2D2IA 4FB5A 2WYVA 1MGOA 1PIWA 3ONEA 4XQCA 4LRSB 4XKJA 1ISIA 3AK4A 1YXMA 4J0EA 1X0VA 2OZPA 3H5NA 1SEPA 4XZ3A 2PGDA 3DXFA 2DQ4A 5I7EA 2G82A 5IDXA 3ZHYA 4NZ9A 3H6KA 2X58A 4BMNA 4IMRA 1RM5A 5KVQA 4LK3A 3ROMA 1OC2A 4OGWA 4J90A 3WYEA 2YY7A 2VYVA 3L6DA 3TZKA 1Y8RB 4P4GA 3C7DB 3RUIA 4M54A 4L4RA 4NQZA 3H9QA 1IPFA 2FPIA 2PGJA 4RDIA 4MIYA 2OBYA 3WB9A 1HDCA 3HFGA 4CLOA 5DBFA 5TF4A 1R4NB 3JQ7A 2FR8A 4MKXA 3TRIA 4UULA 5L7YA 5KJFA 2Y0DA 3W1VA 3TOZA 1C0LA 1DSSG 3L4SO 3EY4A 4E33A 3PGXA 1JA9A 1ZK0A 2PR2A 2FPGA 3RFTA 1R15A 4EYEA 1GQYA 1NVTA 3F1KA 2QQ5A 4HFRA 4XGKA 3K92A 2YDYA 3PQDA 3DMTC 5JCXA 3IAHA 3V1TC 1B26A 1MXHA 4E5MA 1PQPA 3GPDG 1KVQA 3GVHA 4AG3A 4ZD6A 3T7CA 4KTTE 3O26A 4I9NA 5KCZA 3EC7A 1GZ3A 4GL4A 3PVZA 3QSGA 4CLRB 2O4UX 3WLEA 1KVRA 3SLGA 3OETA 4B7XA 1ZO8A 1NR7A 1GU7A 2A35A 3JQAB 4PLTA 3ZWVA 1ZMOA 2GD1O 4TWRA 2Q2VA 3DZJA 1UDCA 4A26A 3LLVA 4PZDA 3SC6A 4BUCA 4EJ0A 4IPTA 2ZYAA 3STHA 2PTGA 4OKIA 2DTDA 1ZVMA 2WYWA 3IP1A 4N54A 4OYRA 2RHRA 1X14A 2Q4BA 4MKZA 4H3VA 3DZHA 3JCZA 1A5ZA 1X0XA 1FMCA 1WPQA 3D5TA 3TDKA 9LDTA 4YJGA 3IKVA 1PWZA 1B7GO 2VHZA 2I3AA 4YJHA 2HMTA 1XEAA 4BMVA 1YKFA 3AWDA 3NAQA 4RLHA 2HKIA 3ZU4A 4D79A 1LC0A 1D4FA 1YE3A 3AU9A 1SEVA 3GGPA 2A94A 4KQXA 2XXBA 1JAYA 4XCVA 3VH3A 4B4WA 1I8TA 3UF0A 4ID9A 5KVVA 3UOGA 1RWBA 1O9BA 1V0JA 1E92A 1DIRA 4XGIA 5JDCC 1AXEA 2HMWA 3I9MA 5G4KA 1P0FA 3LT4A 5G0VA 2IODA 1XIVA 3LQFA 4AJNA 4CM4B 1XKQA 2TMGA 1RPNA 4EUHA 1PGOA 3AUTA 2R6JA 3ROPA 2Y1FA 4A73A 4DYDA 1TT5A 3FPCA 2P9CA 3I9OA 5T67A 1LRJA 3VZPA 1C1XA 3NT5A 2OMEA 5AQ1A 1UXHA 1ZK3A 3AM4A 3WWZA 1VSUA 1F0YA 3KTDA 4FJ0A 5COAA 1ULUA 5AYVA 2FPPA 2HSDA 3DTTA 4PFJA 1DOHA 1H2HA 7MDHA 5A3VA 4P4LA 5DCUA 4AJ2A 3UXYA 2NLOA 1T1SA 4RF2A 4YVFA 1XCBA 1HWYA 1E0DA 1HL3A 1SNYA 4E6PA 3TQHA 4EBFA 1NQOA 4EGFA 4CMEA 5I8WA 4N5MA 4OXKA 1K89A 2AE1A 5JLAA 1NASA 3DFZA 5L4NA 1D8AA 2AEMA 5TSDA 5K9ZA 1H0KA 3GNTA 2YW9A 3W6UA 3TSCA 1PJLA 1J6UA 2EV9A 5LDGA 1MG5A 2NU8A 3DZBA 1JQBA 1WMAA 3GLQA 1YB1A 1Z7BA 2HMVA 3JYPA 4LRTB 4F45A 4J9UE 5IF3A 3HDJA 1AHIA 2WD7A 4PIVA 1HLDA 4PLYA 2Q1SA 2ZKLA 4RVHA 3HHPA 3PWSA 1A4UA 3MJEA 4PRLA 3OF2A 2X8LA 5AXDA 3CSDA 3DAPA 1WP4A 1YBAA 2EWMA 3GMDA 4RF3A 3S55A 3WGTA 2PFGA 2E37A 2RCYA 1WVGA 1UXIA 2TMDA 1DIBA 4G5HA 4G81A 4DWVA 3Q2IA 1AUPA 1H9AA 2E49A 1HEUA 1DBVO 1U5AA 3E5MA 2DU8A 4JBIA 2PZJA 2OBNA 2X1HA 3BMNB 2BFPA 3GFGA 1IZ9A 1E7YA 4E0BA 2AXQA 5AXCA 4J1NA
chains in the Genus database with same CATH superfamily
4O4HA 3TB4A 7ABPA 2MR6A 3KPWA 4HMQA 2IA5A 2IXBA 3PFKA 4HEJA 3N8HA 4WLNA 4MEJA 1XTRA 2QTAA 4JMLA 3V2UA 1ZN2A 5IANA 3ZCXA 2QVXX 5FV7A 2JHFA 3HCBA 3QBVA 2I7TA 5ILOA 2C4HA 4BQEA 1I5RA 2PO5A 4C2UA 2JD2A 1E7SA 3A4IA 2P6UA 1KC1A 3R5KA 4GMXA 1EXDA 3E1KA 1JIUA 4K9NA 1M6NA 4GZMA 5K3OA 1P81A 4HVAA 5HMMA 1Y5NA 3K6SB 5BN4A 1BGWA 1LF5A 3ZBQA 1VXRA 3WIUA 4EHLA 2IZOA 1Z6XA 3EISA 2V1XA 4HV4A 4C87A 3ZHCA 4PX2A 2NSDA 4X8LA 4ZAVA 5I7VA 1N5MA 4KRXA 2VJMA 2ZUVA 2PKWA 1DAHA 1VLLA 4FP9A 4LJ8A 2JCVA 1MLDA 4N5LA 4OATA 2O48X 4W1RA 1A0OA 2XE4A 3L0YA 4RV9A 5HKOA 4AS1A 1C0EA 3FF1A 4C0JA 5L53A 3FRHA 1NX9A 3FGOA 4AJPA 4CQMB 1AZWA 1J33A 4IHKA 1PD0A 4UUAA 2O0KA 3S1AA 4D9KA 1ZN9A 2JLVA 3B13B 3W5VA 4DIOA 2VHWA 2UYOA 4OQXA 3T5PA 1JIKA 1VPDA 2D0OB 1Y33E 1MB3A 4I6EA 1U99A 3JAWA 1ZIDA 3AETB 5EIFA 2OYRA 4E07A 2WJJA 4L6AA 4KQIA 3F2VA 2LNDA 2RCNA 2BBTA 3LDUA 3LL7A 4IEIA 3SIRA 4BP9A 2I76A 1N6LA 1VBMA 1VGVA 2B9VA 4JOCA 3ZQUA 1LX6A 2CUNA 4HQKA 2P8JA 3SE7A 4DLBA 4LF9B 3OCXA 3B8HA 3R0QA 3RKUA 1GZSA 1VKNA 3B51X 3VYUB 3W7BA 4G4SP 4REQA 1UJNA 1YA8A 4TVBA 3ZZTA 4PYRA 1L4YA 3EGWA 3MOIA 5J2TA 4ZU1X 1EK6A 5GADl 4DNFA 1A5AB 4UJ5A 1V7ZA 3E81A 4UXIA 2LCQA 1FQKA 3WHIA 1UPBA 1VGRA 1KH2A 4LGYA 1FDOA 2Y99A 3STUA 3O3OB 2WB4A 2IC5A 3I2KA 2QYSA 2Z1NA 2PKQP 5FD8A 1DBPA 1RLJA 4AIIA 5HRAA 3QTLA 1Z73A 4O4JB 3PFCA 4HOYA 3Q8MA 1UODA 1F8XA 1OOEA 2EZ4A 3DE3X 2WFAA 3DE7X 4BEWA 1NC1A 2WIAA 5HKKD 5HZMA 4GX2A 1AH2A 1MG0A 1T4GA 2HDOA 1WMDA 5AUNB 4W5NA 5A4FS 2CD7A 4QJ5A 1Y63A 2G06A 3ELYA 4HGQA 4QPCA 5GINE 2I4IA 2Q6OA 1I3MA 1AS3A 2FPUA 1YASA 2ES4A 2H2IA 2V7EA 4IIHA 5K3FB 3H0CA 4NQRA 2Z9BA 3H4IA 2GCPA 1JJFA 2PL3A 1OYYA 2Q3FA 2X40A 3F5FA 5EEHA 3U1VA 4BFUA 1CZOA 3RASA 1SGWA 1QIDA 3LHIA 3RNOA 5KJEA 4DDMA 5JXWA 2WKSA 1VLMA 2H5LA 4U7DA 2P6MA 2YBEA 1H4TA 4D0NA 2JGDB 2OO3A 2OV8A 1O03A 1RLMA 3Q9NA 1V5FA 4XIYA 4BQRA 4EDFA 3HRKA 1S89A 4N0PA 4CN8A 3CH4B 5ECDA 1YHYA 3OIGA 4DYVA 1VJTA 4H77A 2WHRA 4BTLA 3ICCA 4IIJF 1BXGB 2FHPA 4CQLB 3IQDB 1OAAA 1QQTA 3WTCA 3Q8WA 1A8SA 1L7BA 2ZTUA 5B3KA 3GEEA 2P77A 1TU3A 3CCFA 1HNXB 1GXSA 4NJEB 5DM70 1EHCA 2JA2A 2M2IA 4G01B 2QPAA 3QY0A 3O0DA 2CLLB 2WUVA 2E4WA 5HJ7A 3WJAA 1HM5A 1EP3B 4LZNA 5ALWA 5HCNA 3IGFA 4UDOA 2J33A 4LDZA 2OSVA 3DT6A 4RGVA 4BFSA 2Z9DA 4I1UA 4DPLA 1VZ3A 2RBEA 4CM5A 3H5AA 1QR6A 3WOHA 1JVSA 3QU5A 4UZFA 4EH1A 1PLKA 4XUCA 1OR8A 3ZGLA 1IWPB 2Q99A 3NWOA 4LGVA 3WQHA 4JB0A 4Q3EA 5DULA 3D64A 3THXB 3IH5A 3VO1A 2W6MA 3KYJB 2B4TO 1YRYE 2FFBA 2OCGA 3IO3A 4MVJF 3OE7A 4PNPA 5ALEA 4JSYA 2IPMA 1AF4A 1T8YA 3FFWA 3BCSA 3F8SA 3UJAA 4B45A 4F0JA 3K71B 1FJ2A 3NJ8A 2V3CC 1L6IA 2JEYA 1MAAA 1NR1A 3HXPA 1QO7A 2GZHA 2RJOA 3CWQA 4ZCPA 2PS1A 5C7OO 2IXEA 4BKQA 4TXNA 1WKBA 5ETJA 4EFNA 5EKUA 4LEIA 3T54A 2CKDA 4GRIA 1LBSA 3PKIA 3U4CA 2KPOA 4LYDA 5ES4B 1A9SA 4U02A 4QM7A 3WLJA 3R0VA 3ZW8A 3L3BA 1DC8A 2Y2UA 1H5UA 1PUIA 4ZEOA 4W9RA 4EUEA 3RSQA 5AVWA 1ZMBA 3ZWBA 2G9ZA 4LA4A 2UUPA 4HGYA 5HWSA 1B6TA 3KQSA 1TTHA 4ECAA 1Y1QA 3NHJA 5K0ZA 2OHJA 3L8EA 2OC9A 2IDMA 4N03A 1E1RD 3WISA 1OFHA 4HVLA 4KUGA 4DTIA 3F6CA 3PXGA 3B70A 3OKAA 2Z8ZA 4F2PA 3MA0A 3RQIA 2GRJA 3QVGA 2PU5A 4OQEA 2PUAA 5E7MA 3PNMA 3EGDB 4IJUA 3PNLA 5MHTA 4X1KA 5T3UA 3FYDA 2CL0X 1KI2A 3QXJA 3IV9A 5J58A 2FWMX 4YMIA 3NIWA 4RTRA 1USWA 1SBIA 2VAWA 2ZJ6A 3PIIA 3DKIA 4HJXA 4WV3A 2MR5A 4MYHA 5ALUA 3MLBA 4MIOA 2O8BB 1HFWA 2DC1A 2QUJA 4OB7A 2HA0A 3T9BA 2Z98A 3WY9A 1UPTA 4J1SA 3WK5A 1URPA 2VDQB 2BM1A 3IILA 3ELDA 5IYZF 5LLDA 1G38A 3T5DA 2AE2A 1UEIA 2XOKD 3IIIA 1X70A 2YVLA 3K70C 2XMRA 3NHBA 1OTXA 3WGMA 5THQA 3CYFA 3O94A 4EBBA 4O59O 5CAEA 3I4CA 2CJWB 3GGJA 3KZCA 2JKVA 4LJLA 3NGLA 4Q3LA 5LOVB 4DKJA 3L79A 5FLYA 4QXRA 1R0SA 4MCAA 3TOXA 3GARA 2BTOA 1Z4OA 2GWRA 2Q9AA 3PEUA 3K5WA 3WAJA 2CL6X 4BMYA 3CJRA 2HU7A 2GOYA 3MXOA 1D8TA 1X1CA 4HWOA 3HN2A 1RRFA 2NUAA 3CBQA 4ES6A 1QHEA 2CJYA 2GVZC 1DINA 2AMLA 3BICA 3FETA 4H9GA 4IDOA 2W8ZA 3BB4A 3N7AA 5BSEA 5EE9A 4U0JA 4B3DA 3GNSA 4L76A 3PXAA 2H7CA 4ETIA 5FA6A 4ND7A 1KYVA 2AG8A 2ZPUA 4XSGA 2VDWB 3GPBA 1RRCA 1CHDA 1HI9A 1JYSA 3KQYA 5LWQA 1JFSA 1UT8A 3GJ5A 3LUHA 4FEGA 4NEQA 1AV6A 4AC9A 3OFND 1Y9AA 4DUZB 1QOQB 5DJ5A 2EHDA 4E7OA 1GEEA 2DUMA 2PX6A 3AIOA 3CBGA 1R0XA 4IEEA 3I5UA 5FWAA 5BPHA 2X41A 1NT4A 2WKPA 2VQ3A 5KOJA 1L5HA 4AU1A 3JQGB 1JQLB 1GKIA 4GP9A 3DGFC 4HEA1 2A9RA 1T3TA 2BMAA 1GA4A 5AP9A 1L7AA 1O97D 1DC5A 3O8RA 4JL6A 4GQBA 4Q9KA 1KYQA 1KI9A 1HFKA 1QH0A 1ZFNA 4Z86A 4D56A 2GF2A 1E61A 3MMZA 3QH4A 5FRDA 3LF2A 3PYMA 1SOUA 2AK3A 3EWIA 3W0LB 2NU9B 5KNLA 2VDOB 4FMCF 4YBZA 3PL5A 4F3TA 3F97A 5IWCA 2V7GA 3FDZB 2P65A 3HN6A 4E22A 2PZMA 4IRXA 4GXQA 5KWSA 4JN6B 1Z0FA 2ZTLA 4IINA 3MSCA 1JGTA 2BSAA 3M6LA 4MRRA 3GZNA 3GLIE 4M0EA 4A4DA 5D01A 3TUIC 4V39A 5IDVA 3QVTA 1PQUA 2V54A 1E1CB 3E4CA 4QOGA 3DPSA 4CG3A 4CR7A 1JDNA 5AI9A 4D8WA 1TADA 3IXMA 4DNOA 3RK4A 1IN8A 3NQ41 3KKZA 1PS9A 2H11A 3UJPA 2XRYA 4RTQA 5FB3A 1JAXA 3ZLTA 4MKRA 1S9HA 2FCAA 2PUDA 2JAHA 1T43A 3LWZA 2NTYC 4ITUA 2ZI3A 1SVOA 1RM0A 1N5IA 3AF2A 1KBZA 1WXQA 4BDTA 1LDEA 2NYRA 2HK8A 3C8HA 4II7A 5KQGA 1B3RA 3OWXA 1MB9A 1S96A 4MO9A 5KHLB 4GOKA 1MJFA 1EAMA 4DBLE 1YJQA 3PE3A 3RK0A 5C8DA 2N47A 3A3YA 2GJ9A 3IVCA 5SYMA 4WN9A 4QSHA 4BCDA 4AJKA 4MIKA 4AG6A 4HWRA 2X4DA 5JARA 4Q9IA 1T9ZA 2GX6A 2POQX 1NMEA 5BT8A 1U7DA 1W88A 1E8NA 3IB3A 4B3SB 1ZGBA 3T3DA 4B84A 2W42A 1C3JA 3PDWA 1U8TA 1K27A 5A4AA 5CYGA 2AI1A 4HR7A 3KXDA 4D4LA 4E32A 4MRAA 1HYBA 5L7TA 1S1MA 4DBVO 1XDDA 4LY9A 2BL4A 1M2OB 3LX4A 5IAKA 5G40A 3H19A 3W7VA 2KMLA 2HSZA 3KR2A 1E6WA 3ND6A 4TWAA 3RVSA 4Z4FA 1LDNA 3K6SA 3LBFA 1V96A 1KEEB 1E1NA 2N46A 2PVPA 1HDIA 2B7LA 2IXFA 2O2CA 2ORWA 3GOQA 4R1UA 3U19A 3PGKA 5NULA 1R12A 4LV5B 3K4QA 4BNNA 1T1IA 2G72A 4K03A 2IPAB 2WAYA 4GIBA 5TGTA 4W5RA 3W04A 1T5IA 4LECA 4QHYA 2QL5A 3WLIA 5JXIA 1K3TA 3IUJA 1K9SA 1QHGA 2H3EA 2A7QA 3D8NA 3IOCA 4UVGA 4LPKA 4ZQFA 1K88A 3RLFA 4K87A 3NTQA 4L4UA 5EPUA 5ICFA 5HUQA 5AJTA 2DR2A 4PQGA 2WSIA 4PTLA 4QDZA 1DEHA 3V34A 4OBXA 1J4AA 4F11A 2IHNA 1UJ2A 1MJ5A 1GJRA 3CT4A 4Y2SA 2GF9A 2VDJA 2JANA 5LQSA 2L0XA 3B7GA 4AWXA 4B83A 5J4KA 4FQ5A 4R69A 1LD3A 1JEQA 4M83A 1OLOA 3VI4B 3R0JA 2GUGA 3KVOA 5COQA 4FT4A 4UEKA 3GBSA 4UBNA 1ABBA 2BD0A 3OY7A 3JZIA 1Z4NA 1E5QA 1MB2A 2A8YA 4W7IA 1E94E 3V8PA 2ZTSA 3PHJA 5K0CA 1Q7BA 5EQFA 4PRYA 4DT1A 1N6PA 1DLJA 3KDAA 4GI1A 4IFEA 2WE8A 4DW8A 5JO0A 2Z04A 3ORQA 1LXCA 4EQ6A 3AY0A 5GV7A 4CR8A 1GDHA 3IQEA 1GPLA 2O5EA 1QOPB 4DABA 1AHPA 2XB2A 3GJRA 1W47A 4GMGA 1HF3A 1GPH1 5DOZA 1PDVA 4XI9A 2PV7A 3WWYA 2P3SA 4EL5A 1X87A 1DBRA 1XCMA 2ZWMA 1W76A 2OKCA 4P8RA 1KJWA 1AK1A 4BN0A 3MRVA 2UKDA 3OOWA 4Q4HA 3V8BA 5C8ZA 2B5VA 1RYDA 3BWCA 3CKMA 5JNTA 3T99A 4DLPA 3DTYA 3QPVA 5TEWA 2C9CA 1QYVA 1TRKA 4UU7A 4A1OA 2FW1A 3GGDA 3FYHA 1KP9A 2C58A 3O7MA 2YICA 1UQUA 3OLXA 4LXXA 3UMFA 4UM9B 1IRXA 3ZI0A 1WXWA 4YAEA 4CN9A 3SSNA 2ZB4A 5C5CA 1IMOA 2GD0A 3DKRA 4LCBA 4ZI7A 4A6XA 3A9UA 1P0CA 3R09A 4R3WA 1NLYA 1SC6A 4RH0A 3OTOB 2WINI 3OOYA 3Q4GA 3BQMB 1NDHA 1VZ2A 3OZAA 1B74A 5H4GA 1GWNA 2BMDA 3KUXA 4O2BB 1P6QA 2O7SA 4NATA 3DLTA 3H9JA 3N7UA 3UUWA 1WXFA 2WYIA 4S1TA 1EHYA 1UQTA 3AI2A 3HZOA 3SLRA 4MLDA 3TLMA 1V3UA 3VPFA 3ZCTA 5SZJA 3SI7A 1NLMA 2UVDA 3RYFB 4DFDA 4EW1A 1KYWA 4EA6A 1WSBA 4DRZA 3BRSA 3R6TA 1OX5A 4KN5A 1DMSA 4KLRA 3T9CA 4KO3S 1YT5A 2C97A 4HDAA 5IMSA 1VLZA 2R1TB 1TTPB 3P9XA 4M0PA 5JQWA 1Y6JA 2FOLA 3BL5A 5DCUA 3H75A 1KGSA 5AXAA 3GFRA 4FHFA 1CBUA 1HLGA 4CUZA 5BNFA 2BMVA 4D3FA 4JENA 3DTVB 3HUTA 3LLUA 4UPDA 3IAFA 4YCJA 3IQGX 2J5BA 8OHMA 2UZ4A 1DO0A 4PWYA 2NO0A 4JODA 2BH9A 4TL8A 2CYAA 2PT5A 3FYUA 5F2NA 1DWOA 2G7ZA 2XA1A 4C7OA 2AKAB 4N48A 3I5MA 4RHYA 3GBPA 4KR0A 1IAVA 4P0QB 1O54A 4XIJA 4IUCS 4XPIA 4ZAFA 1SQ5A 2BMWA 3VO9A 1DXYA 4ZIRA 2E6KA 4H6XA 5B58C 4BGDA 3T3EA 2G40A 2VOEA 1R6TA 4MI6A 3U3DA 2BEVA 4AZ0B 1LBQA 4PFKA 4BX3A 1KSHA 1U7HA 2EFJA 3A28A 3FTCA 4QUIA 5EJMA 5FAXA 4YWJA 2EKZA 1JSCA 3ELBA 3ADCA 4F4IA 3ZVNA 4O4IF 1CWUA 2VCYA 4FLFA 2PBLA 5HE8A 3FCUB 3TTYA 3Q6IA 5K6AA 1G7RA 1UWCA 4CKCA 3O2JA 3U49A 2Z2KA 1X2EA 3Q6NA 4IR7A 1MORA 1CUJA 1YS6A 5TVGA 4DCGA 5JZOA 2OHXA 1RI5A 2CXHA 2FJUA 3NR2A 3TW8B 1M1NA 3IB6A 1BMTA 4G9BA 2J6HA 2WJGA 3LY7A 3PWTA 4OOFA 1RMYA 2VATA 4QO7A 1XGKA 3THRA 4AECA 2PEZA 1BNCA 4G24A 4RQUA 1W4AA 4XD2A 5A06A 2A5FA 5CCBA 2FNAA 1VB5A 2JLCA 2OQ2A 3IR7A 2V3WA 4M86A 5BY2A 1BCRB 1V47A 1JJ7A 4ZALA 3DMYA 3K32A 2MINA 1DO8A 2GCNA 3O93A 3LW8A 1P8JA 5FL3A 3V55A 4C3UA 5J59A 1Y1RA 4GVPA 1GTL1 4Q3NA 1TCVA 3D4PA 2R6AA 5A5VA 3WLLA 1P39A 2O2JA 5E4JA 1SBNE 1PUXA 2XNHA 4LZZA 1D5WA 4TMYA 3SS7X 2XCTB 4MPJA 4PYOA 4P84A 4EYGA 4KVAA 1XFDA 2HRZA 4G89A 3PKJA 5HYVA 3V6LA 2WQ7A 2ZYHA 5LM3A 1SHTX 1A9RA 1JEEA 5JFGA 4P3XA 1QQ5A 3ZDZB 2C5BA 3AY6A 2JG3A 2EU8A 2CVZA 4IO0A 5KQMA 4KBGA 2G9UA 1X80B 1L8QA 3CNLA 4TT3A 3R7NA 3BJMA 1WUKS 1J24A 4HCJA 2VQEB 1XDWA 2M6KA 1UPXA 3RIHA 1A82A 4HDRB 3CVJA 4X63A 5C0OE 1EM8A 4E70A 1TM5E 2DGDA 1H3EA 2X19A 1IZZA 2AC2A 3M82A 3UK0A 2H4WA 4AKTA 4C3ZA 2PBZA 5KEIA 4MHTA 1JH8A 1VI5A 3S2IA 4LXIA 5JSZB 3G2KA 4R1LA 5DB4A 5CB8A 5JT1A 3ET5A 4YCDA 2I6XA 5AH0A 1Y9DA 1JALA 2MIIA 2Q5OA 4E4TA 4C89A 1E6KA 2QEQA 3KLOA 1M5RA 1QPBA 1CUFA 3CEMA 4IHQA 2R6R1 1TW3A 1PT8A 2F3TA 4LJ7A 3T7TA 4D0RA 2GTHA 3QBJA 4MV8A 10MHA 2I29A 4KIFA 1T9DA 4WZBB 5CB6A 1EJ2A 2A5GA 2CXSA 5KVSA 4CEHB 1SUDA 3HCCA 3FDFA 2F43A 2D0DA 2PSFA 4ZV9A 2V4MA 3RFUA 1JHRA 1GGKA 1KJJA 3LUCA 1E79D 4N3CA 2WF9A 1Z3IX 2ONYA 3G23A 1LLDA 3NCTA 1YSCA 5I4KA 3QXSA 3ODGA 3V1YA 3PXDA 3NM4A 3QRWA 1E77A 2HXYA 1FP1D 2NM0A 2YZKA 4WOCA 1OA1A 1XMJA 5KI6A 1XZCA 2ZT7A 4JEIA 2OP0A 3GLUA 2QR3A 2E2WA 3T34A 3OPYB 3MHTA 2JCXA 5DX1A 2ZRJA 1FJHA 3OF3A 1LSSA 1H85A 1P8AA 3KM0A 4NBUA 3AUXA 3FOWA 4B33A 4ANFA 4XYMA 1K7SN 4P2GA 2YS7A 5BV8A 1UF9A 1HO3A 2FEMA 1VSVA 2IZ5A 2WDPA 3S2SA 1BEUB 3IEKA 3SOZA 5CDTA 2ZBUA 2BMEA 4J49A 2BTQA 4L5IA 5FBRB 4G0WA 5EUBA 1G60A 3UGJA 2VJYA 2KLHA 1H2XA 1XTJA 3HGMA 4QREA 2RGNC 2Z2XA 4NULA 2D4HA 2Y1LA 4QYTA 4TGLA 4V0ME 3U44A 3STTA 1S4QA 2D1QA 5JSHA 3K09A 1CS0A 3NHPA 1RWVA 2A9PA 2W48A 3PNYA 4L3VA 1WTCA 1RFLA 4L4SA 3HKEA 4JLBA 4MJ7A 1SELA 4YRNA 2C78A 1IY0A 2HCTA 3G1TA 4FFOA 1ZJ5A 4PVDA 3D5EA 4Y6RA 4CIWA 2BCJQ 3DPUA 4B75A 1SUPA 2C5FA 4KO2S 2P9BA 5TQ2B 4BFCA 2HU5A 1N2XA 2CDAA 5ERYA 1PW7A 3NLLA 1WZ2A 3AM1A 3PXXA 2BUBA 2J09A 1C9DB 1LJ8A 5CLIA 3R44A 2WABA 1KJ8A 3H86A 5DI3A 1QGDA 4RF4A 2ACWA 2EFDB 4J1TA 4MUKA 2JFVA 2X0IA 2E4YA 2G28A 2XUAA 2VWHA 3QKUA 4DCCA 5A9SA 1CV2A 2FUEA 1V16B 2RBKA 3U7QA 5CDGA 1JKIA 3DMDA 4KQKA 5BORA 4DA8A 3L4BC 2G09A 4RD3A 3JVEA 3PU6A 1W94A 4L2IA 1A27A 2O3UA 4OFZA 4V0QA 4AJJA 1A1SA 2L42A 2WPDD 3IDQA 3VU8A 1YC2A 3DBVO 1NXQA 4G0UA 2Q3HA 1GKLA 3N2IA 2XGJA 5JH7B 1Y5RA 2LE0A 2FAXA 3PKZA 5DRYA 3SLKA 3RYCA 2HF8A 4HZUB 5AMXA 5T3YA 3TGWA 3EXHA 3WL4A 2ZDQA 1YVEI 2H0QA 3DZDA 3H5VA 4RZXA 4Q1AA 5MN6A 4LY6A 1EKXA 1L1QA 2HNKA 3K8OE 3S2FA 5J43A 3SS9X 1PI3A 1WR8A 1JECA 4C22A 5TIIA 2OCAA 2W11A 1JFRA 1VI2A 5ITZB 1H2RS 3BXZA 4IUBS 1DQNA 4UHFA 2W2KB 4IVPA 4ZOEA 4BECA 4EG7A 3E84A 1SCUA 3K0KA 1Z29A 2KHZA 2RGGA 3KWFA 3EC1A 4GD3Q 5LP6B 3FYSA 3ZCSA 5DU2A 5EXPA 1BDMA 1QQAA 2HLDA 5FR1A 3I04A 4FYPA 2EOAA 4MR9A 1GPNA 3E8SA 3AHCA 4BVEA 1DAFA 1COWA 4K81B 3V1UA 1EWTA 1N5DA 5JISA 2IYEA 1WXGA 2GFIA 1OFIA 5DTJA 2HW8A 1IN5A 4RVDA 4ALJA 1YIAA 4X1YB 3N0XA 2HPHA 3NKFA 3PEVA 3B5IA 1G55A 1Y8RA 3HJGA 4KG7A 4MK4A 1XLWA 4M7WA 4YTEA 3TLGA 5AJUA 5YASA 3AF5A 5E0KB 2R8OA 5L3SB 3T7SA 4I1VA 5BO5A 3WDSA 3L4EA 5CLJA 3F3SA 3B3GA 1HT3A 3ZE6A 1YR1A 4EGCB 1B73A 4HL6A 1TW2A 1YQTA 1Y4AE 4PLVA 1QC5A 2D0IA 1J2TA 3INTA 5FJIA 3Q1KA 3QEMB 6LDHA 1DCMA 2EJCA 2Z2JA 1RHQA 3R3WA 4JYCA 4MVJM 5C35A 4KFUA 4KL8S 2CZCA 2GN8A 1YQXA 3ZDRA 3QFRA 1XMXA 1KHHA 2YJ5A 3P9ZA 2P2DA 1R3DA 2IF2A 1B1AA 1II0A 4RAQA 3WMWA 5EMNA 4P53A 4ZT6A 4DMHA 1NQAO 3FPSA 4JT2A 4RY8A 4WUVA 4DEVA 5I9LA 2BDUA 3HB0A 1FSZA 3RTDA 2FMFA 4EKYA 1H1LA 4HS4A 2CZGA 4MPTA 4TV8B 3CF4A 1AC5A 1ZR4A 5LCXA 4XSVA 3VISA 3WGJA 4U2BA 4OGGA 1K8XB 5HKLA 4MV4A 3PDHA 5LYYA 3SZGA 1W19A 4H1VA 4RD6A 2Q28A 1Z34A 1PDWA 1Y98A 1JN0A 2G8LA 4U2GA 4CM6A 4QOSA 4F5YA 3S2ZA 4ED9A 1O89A 2ZR9A 4P5DA 1YC5A 3V8MA 1IXRC 1U4OA 2I2FA 2Q1TA 2TRSB 3BKWA 3FPBA 4WQMA 3WGQA 1CFZA 4B73A 5BUQA 4RTKA 1L4BA 1QGUA 4CEIB 3L7DA 4IDFA 1TB4A 1GA1A 5EA2A 4LXGA 4I66A 3K73O 2P79A 1VG0B 4A0QA 1F38A 1PJ2A 5BMVB 2JJYA 1I01A 2QENA 3MJCA 4Q93A 5CTAA 5E1BA 2WTUA 4W8HA 1WHSA 2OOSA 5FPSA 4ZHQA 3ETCA 2PTHA 4HH3C 1E3JA 3B1WA 2HPAA 3OQ6A 1WF6A 3T5MA 1K6XA 3O8NA 3OA0A 1AKVA 3AUUA 3BJZA 4F6RB 3IJPA 3LYLA 4NYMQ 3JAMA 5DPMA 5HDBB 4N39A 4BNGA 4NV1A 1D9XA 2NWQA 2F1KA 2QLLA 4XOUA 2V6IA 3BXPA 3M8KA 5DYWA 1NW6A 3ITEA 4XEHA 1JQ3A 4OQYA 2IHYA 3I2FA 3IDZA 5F2KA 5BSVA 3VKGA 3DOHA 4J0DA 3RT9A 4RL4A 4HRXA 3SICE 2YMPA 3NANA 5TX7A 4F86A 3OJWA 3SK0A 5G41A 3P26A 1TPZA 1RYNA 2X9LA 4NCXA 3PTLA 5CVUA 5FV4A 1DXOA 3EY9A 3L7BA 2HDHA 2HK7A 3QF4A 4BX8A 4YS6A 3EUEA 4GVXA 5CW1A 3QKTA 4LUCA 5KYUA 2VP0A 1ETUA 4C30A 1U3WA 2HBZA 1T9AA 5H83A 3PRHA 4NH0A 2EKLA 1XD9A 2VHTA 1TJ5A 3D02A 3LC2O 1CIJA 3CKYA 1RQNA 3TVTA 5A7FA 4Q6WA 2IU3A 3OCYA 5HTOA 5CNKA 2DPXA 1MO6A 5CT5A 3A37A 1RDFA 5LQCA 1DRKA 2CV2A 4D96A 5CBPB 3A9CA 2WDZA 2OZKA 1L5ZA 3JQ8A 2J4DA 4FT2A 4MWGA 4TLLB 3SBXA 5FUQA 1QP8A 2AVDA 2XMDA 3OPVA 1YQ9A 1NBAA 1ODFA 3MFYA 4JBXA 2O8FA 1TGYA 1BVHA 2QRPA 2P67A 1F3LA 2AFHA 3GJ0A 2CMKA 4FHZA 1RS0A 2DTEA 1M2VB 2R8YA 2P2SA 5FFNA 5ITVA 3OX2A 2HHLA 4TV9B 2NQ8A 4PYJA 5C18A 4ND5A 1T6XA 2WNHA 1SQ0A 2PLFA 2FFJA 1THZA 5ES3A 2ZULA 1YZNA 2DBQA 4EA8A 2QS9A 4HXYA 4Q5IA 4D9NA 1P19A 2J0SA 1C8BA 1IVNA 4HAVA 4H7HA 4NE2A 2IYTA 1KWKA 4X60A 1E58A 1EQ2A 3L0SA 4XD7D 3TZHA 3DH0A 2O7RA 4ND8A 2P2CA 3NYQA 4DIEA 1XTQA 4GDMA 4UU0A 1SC4A 3BIFA 2EVWX 3MS7A 3ZR4B 4KH1A 5KX5B 2FWJA 5JAPA 3B3JA 3E9QA 1X7WA 2QX8A 3I3OA 3RF6A 1RC8A 1Q57A 1QDEA 2BGTA 1KQFA 1CUXA 4E30A 1QV9A 2EGHA 3FD8A 4JWKA 3IP8A 3WGIA 4M9ZA 1AN0A 3NTXA 4Q4DA 2HXGA 2VT2A 1IH8A 1XRNA 3BFVA 4LW8A 3DUFA 2ZANA 3AV0B 2VSXA 4FZ5A 4UD2A 4R05A 5JAOA 3RVRA 1VCHA 4NPAA 3AQ4A 4PM4A 2GXUA 5DIFA 3R5XA 1P5ZB 5BOVA 1GTSA 3E8MA 3NASA 3D4OA 2BLLA 2NVUA 4ARUA 1YS7A 4G0YA 3ESCA 3I2HA 3LHKA 1MQSA 4K9RA 3LXXA 3U3XA 3DAHA 4TYMA 4DR6B 2IYVA 2RGXA 3B1KA 1G3QA 4MWSA 1PFKA 3MRTA 3GWGA 5C1PA 2P41A 4JY7A 1G6KA 3IBGA 1CD5A 2WZCA 4F2GA 1Z2EA 1E4EB 3PQ5A 3OQ1A 5HTKA 1X1RA 2PA3A 3QUSA 3T38A 3Q8KA 1NPTO 1VE6A 1IG0A 5CA0A 4HT3B 1KZ7B 5K45A 2P90A 3GJZA 1IVYA 2ZRMA 2V98A 2MOKA 3LUKA 1KERA 2PUCA 2B2CA 1RP1A 3A4YA 1LPMA 2P4UA 5KJ1A 2BISA 2QU7A 1IBLB 4MWZA 4H7PA 1I2AA 1NZFA 2VG8A 4MLZA 4DCPA 2JI4A 4R1SA 1K8ZB 5DT2A 1XC7A 3CR3C 3W4JA 3HG7A 2EDAA 3CF0A 4AKEA 4CVNA 2PUBA 2IP4A 1C41A 1KIFA 3B3AA 1R66A 2QE7D 1MDFA 4P6VF 4BRSA 3DL2A 2PWBA 2C5GA 4H3SA 1E9EA 3I9V6 4OSEA 2CZQA 4JUAA 5I8PA 1KP2A 4WBNF 3IUNA 1DRUA 3A1VA 1I1QB 3DTNA 2HFKA 3QMPA 4WK6A 4ZVMA 5FL7D 1TO6A 3LXUX 4DLNA 1ZR2A 4A0HA 3OTIA 3UMGA 2D7CA 4RD1A 4YAKA 1LS6A 1ZCJA 2LWIA 1IQ0A 3FR8A 4C6HA 4ZOQI 4QULA 2OHVA 4Z7NB 3O4GA 5EWJB 4JI3B 1QIFA 3IVXA 1I3KA 3SGLA 3F7OA 3MJRA 2AN9A 3QPAA 4IGIA 4J6EA 1DEKA 2C7BA 2PD4A 4O1HA 3WFZA 5I45A 5U4XA 2C0PA 2IDKA 2W6CX 1EUQA 3DR3A 3KG2A 2PRZA 4KN8A 1SUBA 2A92A 2GCOB 4IM7A 1XN1A 4BNHA 2FU5C 4O4LA 1PWYE 3L9XA 1B4DA 1MQ9A 3O95A 4JYBA 4P5PA 5CLHA 2BGJA 1QXSA 1ZAYA 1C9EA 1V7PC 2FHSA 1HNZB 1QE3A 4IIGA 1EUCA 2WJHA 3F4LA 3FTEA 4GWLA 1SG6A 3BXXA 1TQ8A 2DBRA 1KJZA 1ZH4A 4WVLA 3GG9A 1JIVA 2H4JA 1IONA 4MCIA 4BQNA 2CNWA 3PB3A 4ML3A 1F2TA 1S1CA 3IAUA 4G86A 2FUG1 4X7PA 4HLNA 1L7PA 1H9BA 2XA9A 3DCNA 4LK2A 5JCOC 1TCUA 4CMGA 3FSRA 2DJIA 3P0RA 4L08A 4LC0A 4YJDA 3IJEB 3Q3HA 4ZT2A 4CM8A 1EJ6A 4TRNA 2QV7A 1GZ7A 5HZKA 3M5CA 2IPLA 5FWNA 1P61B 4J4BA 4KXQA 3RK1A 5KREA 1JBEA 1QGOA 4GKVA 3ZXUB 4F21A 5EIOA 2I9PA 4C0BA 3O8QB 4JBWA 1FNMA 1MOZA 3ZHRA 1U11A 3OZGA 3QVSA 4LF4B 1C1XB 2QD4A 1WV0A 4QU0A 3ZQKA 2UYCA 1UXKA 3MQFA 1I2BA 1V3TA 2HK6A 1H4VB 4PS0A 2CV0A 3HWX1 2PCLA 3AKDA 2PX8A 3FCOA 3K72B 3OJ0A 1YDHA 1DC3A 2I6TA 3U40A 1P7WA 3L05A 3I6IA 3C3XA 4JQCA 4MV0A 1T1EA 3QLUA 2OB2A 3WWPA 2WJZB 5BSWA 3BGDA 2Q21A 3TW6A 4ZU3A 4DUPA 1KWGA 2VKQA 1OLSA 3LRTA 3OQIA 2H2FA 1L5GB 1TZCA 3AU8A 3W2TA 2A9QA 5GAJA 5KYWA 3AQIA 2G04A 3D4BA 3I09A 3QUAA 4JR2A 5CR9A 1T6ZA 2EFHB 4WEQA 4D6XA 5B36A 2IIPA 4JT8A 1Q0UA 4BAGA 5J4YA 5JVDF 1UDXA 1BG6A 1OFGA 2DAPA 4I4CA 5GOTA 4A8JB 3WMXA 3ZE0B 3AO0B 5C8XA 1I1OA 2BFAA 4CCYB 3M4ZA 1D2MA 2I2CA 5ECWA 5K8CA 2A1IA 1VL0A 4RZQA 3V5NA 3G9TA 4M9QA 2GKOA 2UXCB 1E5LA 3M9XA 2WTBA 3OP1A 1C7ZA 1GQSA 4EI2A 3WFJA 2FDCA 1OT5A 1GSIA 4MTCA 1LB1B 2QRKA 4GZLA 5LLSA 3UGKA 3WYBA 3ROKA 4DSAA 1NOJA 2Q6LA 1RKXA 3FWHA 2PXAA 4PAMA 5KDDA 1I36A 1HOTA 2AN4A 3CLRC 4ZKEA 4HNAB 2QTLA 4I50B 4IL5A 1YFZA 3VR4A 3OJOA 5BWOA 3TL6A 3RG8A 2ZWVA 4LF5B 2H4HA 2Q41A 4EJ6A 4LXYA 2YOHA 2Y4NA 1RZRA 4NYJQ 4RJJA 1QWSA 1NMSA 2O14A 3D43A 4KO1S 3Q7SA 4ZP1A 2R0QC 1KRXA 5CDYA 4IV0A 2QX6A 5A3RA 4WACA 1CVLA 2HX1A 4B3HA 1ZCBA 5C5IA 1I6LA 1DPGA 1QAQA 2WTMA 2XUKA 3ADOA 4FFMA 1MJHA 3RW9A 2VUHB 3WLSA 5A1TA 1DMRA 1D1SA 1ZLXA 1LA2A 2WU3A 1ZDMA 121PA 1K2WA 2ZSAA 3VU1A 5LMNB 5EIEA 4BBPA 1NV9A 1JLKA 5LQDA 3UH1A 3ILXA 4JLWA 2DOKA 4PTYA 3JATA 3QPBA 4O4HB 2R8PA 4GXNA 4LX0A 1MXFA 3G9UA 3RIEA 3QEOA 1KFJB 5T4EA 4LXQA 3TD9A 4F5ZA 3MWLA 1GADO 5HF6A 4DAEA 2GSDA 3OIVA 2GILA 2VUUA 3W7AA 1RM3A 4R2MA 2PNJA 3W06A 3T5GA 3K1AB 1AQJA 3KU1A 4HB0A 4RAOA 3AVYA 4XWOA 5JANA 5BRNA 4QM6A 1I0ZA 5E7QA 1DQPA 1BXRB 2FUNB 3AWIA 4WY2A 5AM3A 2YV5A 4GPD1 3GGGA 3X44A 1MUUA 4KBFA 4KFRA 4ZOAA 5BN4B 1M73E 2WW8A 5DFAA 4B6RA 3GZJA 1HDXA 3G8AA 1MF7A 1ZNZA 4RK5A 5AOVA 3O9MA 1GQOA 3U3KA 2G1UA 5BYAA 4IHJB 2BDTA 2EG5A 3LDHA 2VJMB 4YP5A 1F0NA 2VJAA 3B1ZA 2ZLBA 1RPAA 4G0XA 4A2QA 4UE6A 1GRCA 1U9CA 2CB0A 4EMBA 3DUWA 1FFAA 5F2OA 5K09A 1Z07A 3G1WA 4H6PA 2OM6A 4LAFA 2VYNA 3R7AA 4V0RA 5AO9A 5DX0A 1XZNA 4B40A 3TLKA 1NVUQ 3UJ7A 3AVQA 2QPTA 3D8BA 3AJ8A 4RLQA 3S99A 3LPNA 3V4OA 1KNXA 3Q7RA 4FDLA 2G5CA 4PX3A 1GCOA 3JAWB 4TUYF 4ZYVA 2QRLA 4D6YA 1J5PA 3AJEA 3U5ZB 3LJKA 1QAOA 2X0JA 2ECPA 2Q8NA 2R8RA 4I08A 5G1OA 4IQFA 3RF7A 4ENUA 5KKCA 5IT9A 1V9CA 4IOKA 4D4GA 4PZPA 1I10A 2I1LA 3Q0EA 2IY9A 2HM7A 3LL4A 1S7CA 2EJBA 4UXHA 3QPUA 2XQJA 1QTRA 2QI9F 2DUNA 3GW8A 3REQA 4QTYA 4YV2A 3EC2A 2C7VA 3FLBA 2R65A 3ZWWA 4LQ4A 2IH5A 1ZOOA 2ZETA 4IY1A 2Y92A 5J2TB 1R3UA 2AOWA 5F3WB 3KPUA 1MW9X 4OL9A 1JYFA 3PG5A 1E2BA 1Q1GA 5IJAA 4Z6KA 5JI2E 2J07A 1D7AA 2YW2A 3D5QA 3OQHA 1G5TA 1UZNA 3GX1A 4KIUA 4UNNA 4M1QA 3VNRA 3LCRA 4CR6A 1QAMA 4TWIA 1DGQA 1JHAA 1L6RA 4FM9A 3CLTD 4YMWA 1L5YA 3ZWMA 4KQCA 1Z6PA 1BVRA 4BJ6A 2QNRA 1CRWG 3KOZA 1J2YA 1RRMA 1UZAA 2N1MA 2YS6A 2QTHA 2ZBFA 3CE6A 4MV5A 3H83A 4NSNA 4AQDA 2FQYA 1NKSA 1XBTA 1OKKA 1H5QA 3WGLA 3GNLA 1Z0ZA 2J4CA 3VKFA 5IHPA 3AONB 3TD2A 1M2GA 2NU6A 3KTFA 3I05A 4PZZA 5K4AA 5CYPA 1AKRA 5KOHA 4FMDF 4CTKA 4WFKA 2XT6A 1KO1A 1V3VA 1XU9A 1Y5LA 3WMGA 4BBJA 1CQJA 1FRQA 1M6VB 3ZLBA 1LEHA 3LZ6A 3V3TA 1BWSA 1P7YA 3Q11A 2JEZA 1AS0A 1HG0A 2OSBA 4M60A 4UDNA 1FDWA 4TT8A 4MKIA 1Z2PX 5TPZA 5TMDA 5BXQC 3ADDA 2CCJA 3WNQA 5JEDA 4GL2A 3D7MA 4RLSA 1OZ0A 3UY4A 1YVRA 3OX3A 2HJHA 4IAOA 1J0XO 3DDCA 3JWGA 3WRXA 5MFZA 1NDUA 5J2UF 1K4MA 1XYGA 2DT5A 2D3WA 1UPAA 2R62A 2YXDA 4RM3A 4RY9A 1TUEA 1K8RA 5C8YB 1E4VA 3BTOA 1D2NA 3KXLA 4MUJA 1XROA 4MWOA 4PTZA 2H7YA 5AK6A 2JK0A 4XJTA 4INAA 4X20B 1P1RA 4FR0A 1OX4A 2NUBA 2OPBA 3DDSA 1NUHA 4Z53A 1GXSB 1ESEA 4CM9A 2PGOA 4B3BA 3N5KA 3WR5A 2GAAA 3PHHA 4NBRA 4A36A 3WB0A 4YCNA 3J80A 4PC1A 1FX0A 1HFJA 5HS4A 3OHMA 3L1HA 1CF9A 1YOVA 1PT7A 3PS9A 5CMLA 4GZ5A 1JDUA 3N87A 3OZDA 4XWKA 2CFCA 4Y1RA 5JDIC 3B52X 1V6SA 4EY8A 5CPFA 2Z6AA 1E0AA 3S1SA 3O82A