1N1GA

Crystal structure of leishmania mexicana glycerol-3-phosphate dehydrogenase with inhibitor bcp
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
349
structure length
346
Chain Sequence
KDELLYLNKAVVFGSGAFGTALAMVLSKKCREVCVWHMNEEEVRLVNEKRENVLFLKGVQLASNITFTSDVEKAYNGAEIILFVIPTQFLRGFFEKSGGNLIAYAKEKQVPVLVCTKGIERSTLKFPAEIIGEFLPSPLLSVLAGPSFAIEVATGVFTCVSIASADINVARRLQRIMSTGDRSFVCWATTDTVGCEVASAVKNVLAIGSGVANGLGMGLNARAALIMRGLLEIRDLTAALGGDGSAVFGLAGLGDLQLTCSSELSRNFTVGKKLGKGLPIEEIQRAVAEGVATADPLMRLAKQLKVKMPLCHQIYEIVYKKKNPRDALADLLSCGLQDEGLPPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Anomalous differences of light elements in determining precise binding modes of ligands to glycerol-3-phosphate dehydrogenase.
pubmed doi rcsb
source organism Leishmania mexicana
molecule tags Oxidoreductase
molecule keywords glycerol-3-phosphate dehydrogenase
total genus 128
structure length 346
sequence length 349
ec nomenclature ec 1.1.1.8: Glycerol-3-phosphate dehydrogenase (NAD(+)).
pdb deposition date 2002-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
A PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1n1gA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1n1gA01
1MGOA 4NBWA 1S6YA 5BSEA 5TLSA 4NU5A 4QTZA 2YHUA 4BGUA 4XIYA 4P38A 5FF9A 3GY0A 1R0SA 3BHIA 4YT2A 3GH3A 3ZHBA 3OHSX 4D43A 3UICA 2IZ1A 2YZ7A 3PQFA 2UDPA 3ROMA 1HE4A 4L76A 4R69A 5I8ZA 1LLDA 3ZU3A 3AI3A 5L4LA 2NVBA 3JQBC 4LVCA 1PX0A 4MP3A 3OETA 3RI3A 1E3LA 3GQVA 3QHAA 4J1NA 1P1IA 4WCFA 3CTMA 3WYEA 5G2OA 1JLLA 4P4GA 4PVDA 4QX6A 5CDTA 5DN9A 3FD8A 1C1XB 4U6QA 2BFOA 1RM0A 1SO8A 2DTEA 1J4AA 4BNXA 1PJQA 3UXYA 3EAGA 4WCFC 1FJHA 2R2GA 2NU9A 5IN4A 1P9LA 2PH3A 4AJEA 3LF1A 3ETDA 3OJ0A 1XEAA 3QA9A 1PIWA 3G49A 4DGSA 4DLAA 3MJTA 3ZWCA 5KVVA 1DIAA 4RVUA 3WGHA 3L4BA 2FR0A 5KJCA 2IEBA 3RBXA 1N8KA 3VH4A 1UP7A 1YKFA 4A27A 1QORA 3BZUA 4DLBA 1ML3A 1E7WA 4EEZA 3NGXA 5COQA 2YDXA 4IINA 4XYEA 2GLXA 1A9YA 1YL6A 3N74A 4WLNA 4D45A 4F45A 2DM6A 1JVBA 3KYCA 4FIZA 4EUHA 4BGEA 1EVJA 3U09A 1FDUA 1KIFA 1WDLA 4C7JA 4CLRB 3PJDA 1LLQA 5LDGA 1LC0A 4QSMA 1E1MA 5LDHA 4CM6A 3ICPA 1EVIA 4N5NA 4AJIA 1ZXBA 2CY0A 3GRPA 4H15A 2LDXA 4HP8A 3U62A 4H16A 1YO6A 3TF5A 4BO2A 4G5HA 3P7MA 3ULKA 3LSYA 1Y8RA 4EI2A 2OZPA 5A06A 2CSUA 2BGLA 1C0KA 3WYBA 3H5AA 3ZW9A 3QRWA 1K6IA 4M54A 4MVJG 4Q3EA 3PDJA 3DWFA 3EVTA 4FFOA 2NWQA 4M8SA 1R6DA 5AYVA 2H9IA 5DOVA 1DB3A 2NV6A 2YV1A 5TJ9A 3F46A 4ZQBA 3PWZA 4MVJH 3WGYA 1ZSNA 4E31A 1TLTA 2HK9A 3G1TA 4JLWA 1ONPA 3KEQA 4EEXA 5L3ZA 1FXSA 3GGGA 1KVRA 3WIDA 5TQVA 4TZKA 4EUEA 3L6EA 2NU8A 4B7XA 1NP3A 3JYQA 3DC2A 2GYYA 4CLHA 3GGPA 2I6TA 4Q39A 4CMKA 4PG8A 3WQRA 3ENNA 3RASA 2Q1WA 4AJKA 2C59A 5IXYA 2CF6A 1YJ8A 2I65A 3KVOA 3VOSA 3ZDFA 1PU2A 3UVEA 4BGVA 2RBEA 2W2KA 2JFGA 2D3TA 4RL6A 2I9PA 3W4IA 1E6EA 2C5EA 2BKAA 3OQ1A 2P4QA 3E9MA 2GGSA 2VWHA 5K6AA 4AJ4A 3E6AA 3TFOA 4M87A 4HKTA 5IF3A 2X7HA 3S55A 4CR6A 3O4RA 2W90A 1QYDA 2B5VA 3H2ZA 3HN2A 1NM5A 4J3FA 5B4TA 4XKJA 4D0SA 5JXWA 4R3NA 3OA0A 4DC0A 3JD2A 3KM0A 3BHJA 3F4LA 4DIBA 5DDIP 1O9BA 4YJHB 1E6UA 2IXBA 1QV7A 3ZWNA 1Z7BA 3IDSA 4BV9A 4N5LA 4HV4A 4ZHSA 3HWRA 3HJAA 3NTRA 5IG2A 5TSDA 1L1FA 2FWMX 3FNGA 1IOLA 3MEQA 2QZ9A 4IS2A 5A9TA 1NPDA 3G1UA 1PL8A 2JL1A 3UFXA 4YCAA 1LSJA 2H6EA 3DOOA 1LRJA 2DAPA 1NFRA 2O4CA 1LDBA 1CYDA 3RU9A 1O0SA 2HJRA 4B4VA 1ZIDA 1BVRA 4IDEA 2A4KA 5DBFA 5JPIA 4F3YA 4NU6A 3WTCA 4GH5A 2FZWA 3WFIA 1U7TA 3KSUA 4IIVA 4FD3A 4PLVA 2VWPA 1LX6A 1M76A 2DUWA 1PGJA 2VRCD 4FJ1A 1GD1O 2J3IA 1M66A 3H3FA 1ISGA 3GR6A 1P1RA 3E03A 4Y98A 1YB4A 4KUEA 4TWRA 4D46A 4GGPA 1HYHA 1DLIA 3Q2KA 4XDZA 2VWGA 3DOCA 1J5PA 2CDAA 1DDOA 4YJHA 1R4MA 1XQ6A 1UP6A 3ICCA 4WLOA 3FF4A 4M89A 4O0LA 2D5CA 3GVXA 2V7PA 3UOGA 5C3MA 4MKXA 1V6AA 2X6TA 1NAIA 1B0AA 1H0KA 3DQPA 1YRLA 4NHEA 3VC7A 4CR7A 4PZEA 4E33A 4U8GA 4L75A 4ROSA 3HNPA 4GPD1 4FSHA 1Y6JA 3JQEA 1BTOA 2Y0EA 4XRRA 4YAJA 1UUFA 3WS7A 1EDOA 2OL4A 2BFMA 3LT2A 4D3SA 1H94A 4BO7A 2OORA 3Q3CA 2HMVA 3HFSA 3SJUA 4BNNA 2Q49A 2YQ4A 4PG7A 4KTTE 2I76A 5G0VA 2AXQA 3RUHA 1SEVA 4A5OA 5JSFA 4WCDA 1E92A 1HE5A 2NTVA 3C1AA 2GCGA 5CHEA 2ZYAA 4IM7A 3IL2A 1H2BA 2PD3A 4E5NA 2PZMA 4DXHA 3I83A 4TRNA 1ULSA 5A9RA 5IDQA 4P8RA 2PZKA 5A9SA 3HDJA 4B7CA 4B79A 2WWRA 5ICSA 3TN7A 1YONA 4NK4A 2W4QA 4ONEA 5I7SA 3C3XA 4LRTB 3OJLA 2EP7A 1Z45A 5JCJD 3JYOA 3DTYA 3QE3A 3NKLA 1GPJA 3WMXA 4EBFA 1PZEA 1YL5A 2DBVO 3QVTA 1NBOA 1B15A 1E1LA 3GEGA 3UGKA 4IQGA 4CMAA 1XELA 1YL7A 1YS4A 3LU1A 4E5PA 5DZSA 3D3EA 3OIDA 4RQUA 1R12A 3QW2A 1GCUA 5EPOA 1HLPA 1A4IA 1SB9A 3CIFA 4RGBA 2IEDA 1SZJG 2W2KB 5GZ1A 1NTOA 4CMBA 3P19A 2P9CA 2JKVA 5AXCA 1U5AA 4JGBA 1I3NA 4N18A 4RPJA 1H2HA 3U49A 1YXMA 2PGLA 1LNQA 3H4VA 2X5OA 4ALMA 3BYZA 1WVGA 3FNEA 1ZUD1 4KZPA 1O89A 2FSVA 2NACA 3HDYA 1U8FO 2VYVD 3KLPX 3ZV5A 3D5TA 1NFQA 3S2EA 4HX5A 4I5EA 1Q2XA 2PD6A 1BG6A 2C2YA 3JD0A 5T8KA 1ULUA 5BNFA 1WZEA 4JQCA 4P22A 2X0IA 5DCUA 3JTMA 5IAAA 2EKQA 1B8PA 2Y1FA 4MVJF 3GDFA 1HF3A 3U5TA 3JQAD 2ZQZA 1JAXA 5TS3A 3FN4A 4GI2A 2OBNA 1XQ1A 2B4TO 5ER9A 1VLLA 1ZSVA 3JD4A 3CPSA 2BRUA 2ZB8A 1HSOA 3RWBA 4BVAA 2Q1TA 1O94A 4RPHA 3TDKA 1U3VA 2X86A 1BWSA 2YJZA 4HNGA 4O5OA 1U4OA 1DFGA 5CP8A 3UW3A 5TX7A 1QSGA 4E12A 2D0IA 4Y67A 4R54A 3PEFA 4CQMB 5IZCA 2O3UA 3ITDA 2VT2A 5THQA 2PFGA 3PQEA 2YV3A 3D3WA 2VYNA 4NFYA 4OIMA 3EY4A 4XB1A 1PJ2A 1IL0A 1WNTA 4BMSA 3GDGA 1SEPA 3GMDA 4HUJA 4O63O 3ROQA 1GUFA 5JDIA 3ZI0A 3ZWBA 4ZD6A 3IS3A 4BNVA 4Q3CA 4KUGA 1Z73A 3PP8A 1PWXA 3Q1LA 5ADHA 2VTEA 5JDIC 4E5MA 4HFNA 4Y8VA 3LYLA 4DRYA 1UZLA 4RZHA 2C20A 1EVYA 2CD9A 1F06A 1WPQA 3C1TA 1I8TA 4U0JA 4CLOB 2JHGA 4LW8A 2J5RA 5JDCA 3B20A 3GGOA 2OUIA 4PG4A 1ZK2A 1XGKA 3KLMX 1NVTA 4UAGA 3G0OA 1GUZA 2AQHA 1HETA 3LVFO 4ZICA 1VJ0A 4K26A 2VQ3A 4WPGA 2DTXA 3AOGA 1LQTA 1MB4A 5BT9A 2Q45A 4FFNA 2G76A 2PZJA 3QWIA 4OSOA 4B7UA 5JO0A 2BFAA 3AFMA 1OC2A 2OFPA 2X5KO 1IPFA 4OKIA 5FI5A 2VHYA 3MTJA 1EZ4A 4OAQA 5I9MA 3TWOA 2B4RO 3TNLA 4D42A 4RZIA 2A92A 2FPGA 2FZEA 3Q2IA 3TSCA 3TQHA 3JQGB 3I4CA 2EW2A 4MIYA 1DIBA 3Q11A 2Q99A 4GGOA 1HT0A 3AFNA 1DLJA 4JROA 3TZCA 1MV8A 4BO0A 3GVIA 4W82A 1B8UA 3OQBA 4ND5A 3HUDA 1ADBA 1JTVA 5COAA 2V6FA 4PCVA 3U9LA 1PGNA 2EKLA 2FPPA 4B8WA 1MLDA 4NBTA 3DB2A 5CDYA 1WDMA 3ORFA 4AJLA 3CMCO 4RF5A 4RF3A 4RLSA 4J0FA 5KVQA 5KWEA 5KJFA 1M67A 4NH4A 3OBBA 4LSWA 4YAKA 2VZ9A 5KNLA 3ASUA 4OHUA 1DIRA 1ZSYA 2HSDA 1YB5A 2EERA 4J91A 5HS6A 2W98A 3QWBA 5J23A 4YPOA 4EJ0A 4DMMA 4ZN6A 5MDHA 1GQYA 4I9NA 1TT5B 1O95A 1B3RA 2LDBA 3S2GA 2B35A 1LC3A 3WGOA 5A04A 1I2BA 4GWGA 1YBVA 3IKVA 2B5WA 3ZN2A 3FNFA 4DA9A 1QR6A 3OMLA 4JK3A 5TRTA 4E2XA 4J43A 4IJWA 5EQFA 2XAAA 4PVCA 5HM8A 4GL4A 4Z0PA 3EGOA 5A3JA 1HKUA 3ROPA 2CUKA 2EKPA 5TC4A 4CMEA 4S3MA 1A27A 5L7YA 4W6ZA 4M49A 3BTOA 4MVJP 1NXQA 1NQ5A 3VPGA 2UVDA 1Q7CA 2WMDA 4DVJA 2CDBA 3I5MA 4BNYA 1CQIA 4HNHA 1X0XA 1E77A 3H6KA 1H9AA 4ND3A 3V1YA 5G4KA 2IZZA 1P0FA 5I8WA 2PKQP 5G0UA 4FFLA 5AQ1A 5KVCA 1UXKA 2X0RA 3DBHB 4II2A 1XHLA 4IMPA 2AEFA 4I9UA 3QSGA 4BS9A 4WEQA 5HTOA 3MJEA 4YRBA 5IDXA 4XZ3A 3WYCA 3GMSA 3VDRA 4BNUA 7MDHA 3KSDO 1B8VA 2PKQO 3KB6A 1HL3A 1U3UA 3D3WB 2O3QA 4P4NA 2WM3A 2HK8A 4RF2A 4CR8A 4R68A 3PWKA 2OP1A 3C7CB 3BHMA 1AGNA 1H5QA 1ZJYA 2EJVA 2Q3EA 3MOIA 4R5MA 4XYLA 1B14A 1E6WA 2G0TA 3CE6A 4UVEA 4O6VA 1P3DA 4LN1A 4Z9YA 3RKRA 2RHCA 1H6AA 1DFHA 5DBGA 4R16A 5JYDA 1BRMA 4MPDA 4Z3DA 1IYZA 3P2YA 5H83A 3T7EA 3UAGA 4BKQA 2DBQA 4YACA 1QP8A 3ZWPA 3DR3A 3F1KA 5CEEA 1DRUA 2C0CA 2X4GA 1QG6A 3GNSA 3AK4A 4P4LA 4XDYA 5JC1A 3K31A 1OI7A 4BNIA 3K92A 4YQYA 3ENKA 4FOSA 1UH5A 4J1TA 5DF1A 4J4TA 1I2CA 3DOJA 5C7IO 5LCXA 2ZTVA 2C29D 4XQCA 4CM8A 4LSMA 8LDHA 2O2YA 3FBTA 2JJYA 5T8KC 3VZPA 4JP2A 3WBFA 4FB5A 5JFOA 3LC7O 2EXXA 2GPTA 2G5CA 3OH8A 4XWYA 4RDHA 4E5KA 3JD3A 2YY7A 1WZIA 3IUSA 4OL9A 1ISJA 1XLTA 2G82A 1Q7BA 2PH5A 4CODB 2BI7A 3ANLA 2V6BA 3C1OA 1SC6A 4TKMA 3HFGA 4XB2A 3P2OA 4BO5A 4TVBA 1ZK1A 2OMEA 2YYYA 2VCYA 3PLRA 4FS3A 2OBYA 4J2HA 2O7SA 9LDBA 2C07A 1T26A 2I3AA 3EZLA 3GG9A 4PRLA 4F6CA 4QUKA 3QLJA 4AJOA 4J7UA 1AXGA 2OHXA 5AXDA 2C2XA 1P45A 5K6AC 3VPSA 4MVJE 3H9GA 4MOWA 4WGGA 5ICMA 3DBLA 2E82A 2Y67A 3LF2A 4LVUA 3AU8A 2BGKA 3ZNNA 4BNFA 2GO1A 2HO5A 3DAGA 1JN0A 3AI2A 1N7GA 4YRAA 1PGQA 1F8FA 2AG8A 4J2OA 4DBZA 3VVCA 3W6UA 1RM4A 4JJIA 3NGLA 1WXDA 1GFSA 4YJGA 2Y1GA 3HZZA 1OZAA 4B8ZA 3SXPA 2GNAA 1Y5RA 4QT0A 4AJJA 1MXHA 4F6LA 1PEDA 2NUAA 3IJPA 4YAGA 4XJSA 2NU7A 1L7DA 3GLQA 5DT9A 3D64A 2W2LD 4W7IA 3VPHA 4YT4A 2X5JO 1PJCA 1RWBA 1Q7GA 4MVJA 4RLHA 2AE1A 2NSDA 2VN8A 3SC6A 3I9KA 1SPXA 3DZIA 1T2FA 1Y9AA 1DAPA 2NLOA 3DZJA 3MWDB 4NIMA 3JQ9C 1OOEA 5JDCC 3RC7A 4DREA 4EITA 1ADGA 1UDCA 1J6UA 1CQJA 4BNZA 8ADHA 3TRIA 3K6JA 3HHPA 3GPIA 1UAGA 1E3IA 1BDMA 1EUDA 3AOEA 3JQ9A 4CM5A 3V2GA 4E6PA 4PRKA 1YJQA 5CFZA 3A1NA 5ENDA 3D4OA 3K30A 3WFJA 4AICA 1EDZA 1U7HA 4J7CA 3QIVA 3V1UA 4BQPA 3AOEC 1C1DA 2ZB7A 1I2ZA 3HDHA 4JBGA 2NVWA 2QZZA 4MIEA 3L77A 1MX3A 4IDDA 1W8DA 4C4OA 4GVLA 1M6WA 1OMOA 3E82A 4Y6RA 1HDYA 2DC1A 1NASA 4U5QA 1R15A 3DZKA 3FTNA 3ON5A 4YEDA 4CM3A 2HAEA 2QHXA 1P1HA 1T24A 1A7AA 1IY8A 1C1XA 4UUPA 3PJGA 3L4SO 4ALIA 3H9UA 5KJ6A 2VHXA 3O8QA 3VZQA 1C3VA 1P77A 4R1SA 5EJ2A 1KC3A 2PWZA 4WASA 1BSVA 2OXIA 4FCCA 4FBGA 4IDBA 4XR9A 1V35A 3F47A 2TMGA 3I9OA 3VH3A 4GX0A 4BIIA 4DQXA 1X0VA 2WE7A 3EZYA 3ST7A 3NT2A 5TIIA 3U0BA 4DL9A 2O3JA 1ENYA 3JQAB 4QXMA 3PYMA 1KS9A 5HBRA 4A2CA 2HMUA 3UF0A 2BFPA 2AG5A 2A9FA 2AEMA 5BNTA 3RKUA 4YJFB 3VH2A 1ADCA 2H5LA 4CMEC 2AA3A 3HADA 4IQ0A 4NJMA 1UXJA 3U3XA 5U4QA 2PD4A 2ZJ1A 2AW5A 4L8VA 2HUNA 2P9GA 2VOJA 5G4KB 4B3IA 1P1KA 3NT4A 5CAEA 2BH9A 2DPGA 3K8ZA 2QYSA 3ZNQA 1P44A 1ENZA 3MJVA 4EZBA 4FFPA 3SBOA 1XR3A 4CQLA 3BTSA 3HB4X 3UH1A 3L07A 2DQ4A 2EWMA 3OQ6A 4QFCA 1TA4A 1MFPA 2VUUA 4B3HA 2WYWA 3B6ZA 4TMFA 3BTUA 2Q2QA 2Z95A 3NRCA 5DCYA 3WJ7A 3FTPA 1GYRA 1NX6A 1DRVA 1WW8A 2B0JA 3VZRA 3OICA 4JNKA 5AVOA 4G2NA 4C7KA 1D4FA 3G17A 4N5MA 3WDSA 2X9VA 1E1NA 1NQOA 2PTGA 3FR7A 4J1QA 4LMPA 2QIOA 1BVUA 1PS8A 2B36A 1I0ZA 2VNSA 3GFBA 1EQUA 1K3TA 4UUNA 3VKVA 3JYNA 5GMOA 4I9HA 3CH6A 5I7VA 5LC1A 3CUKA 4PZDA 2X8LA 4ALNA 4FGSA 2VHZA 3E18A 3L4BC 5TF4A 3A28A 3DHYA 4CUJA 1QYCA 3H9QA 4NK5A 4YJDA 3PDUA 4QFDA 1HYEA 2NU6A 4JBHA 3OECA 1JDJA 1XSEA 2WDZA 4RVFA 4AJNA 1WWKA 4H3VA 3MTGA 2PKRA 1ZXLA 3D5QA 2O3TA 3NTOA 2NNLD 4RVSA 3R6DA 4CQLB 1F17A 1HDZA 2X0NA 5FEUA 2CMDA 3W4KA 1YVEI 1EMDA 5JBIA 1DRWA 5F1KA 4EGFA 1HE3A 2GN6A 3ZH2A 1DEHA 3AI1A 4HBGA 4QEDA 5B4UA 4CMJA 4E2WA 3WR5A 3M2PA 1ZMTA 2VZ0A 4INAA 4B4WA 4BNMA 3I9NA 3STHA 1WMBA 2ILTA 1FF9A 3FRJA 5KTKA 4WCFB 1PJBA 5L4SA 1VKOA 1U1IA 3DL2A 3NV9A 3TFQA 5ITWA 5JC8A 3WGIA 5G4LA 3JV7A 3H3JA 3EYWA 3Q9NA 2J5KA 2ZTLA 2TMDA 2Y1EA 2Y1OA 4PLTA 3WJAA 1E5LA 1KETA 1AUPA 2Q4EA 2JFFA 3GT0A 3JQCA 2DUUA 2FMUA 5B12A 4W7HA 4R9SA 2NQTA 2ZTUA 4TSKA 2BI8A 2O4UX 2DFVA 3KSZO 3F3SA 1A9ZA 1T1SA 2JAHA 5CEFA 5F5LA 4Y6PA 4G81A 4JXKA 3SLKA 3B70A 3PHLA 5G0WA 1BGVA 3V2HA 4BO9A 2PNFA 2VTDA 4UUMA 3WQSB 3FCOA 3SLGA 4ESOA 1EUCA 4U6SA 3CSDA 4Q3BA 3L6OO 4ZA2A 3TPCA 3ONFA 5T64A 1PL6A 5F1PA 3NAQA 4IDAA 2OP0A 3VKUA 1SMKA 1E0DA 4DYVA 3LT4A 4MP6A 4NPCA 3DHNA 1U3WA 1MFZA 4Q3NA 4BL5A 4I5DA 2B4QA 2FOIA 3I9LA 1P33A 4R3WA 2Y99A 3U4CA 4YVFA 4HADA 4CL3A 5IDYA 3KHUA 1NVGA 2NM0A 3EK2A 1IHXA 2B83A 4D7AA 1PZGA 1YB1A 3WG9A 3UCEA 3ZNOA 5TJHA 3L9XA 3VTFA 2DTDA 5CG1A 4DUPA 3GNTA 2EGHA 1N1GA 4MKRA 1YE3A 4XGNA 2J3KA 4BNTA 3E9NA 3RQSA 2VRCA 1GUYA 2YHIB 5HA5A 1LDGA 4DBVO 3RJ9A 2QRJA 4CJXA 4KWIA 4FFMA 4NZ9A 4E30A 2FR1A 1UXIA 2UAGA 4N7RA 2WTBA 4PLFA 4WK6A 2RH8A 4IJVA 3GNQA 2BGMA 3K96A 3DHEA 1ONOA 4PFJA 5JAIA 3ZW8A 2J6IA 4IGEA 5K9ZA 4L74A 2C82A 2SCUA 5B1YA 2D4AA 3GPDG 4OXKA 1BXGB 3DTTA 4DIFA 3FHLA 5HS4A 4M1QA 2X22A 3ZU2A 3CZRA 2R6JA 3M1LA 2Q1SA 1Y8QA 3NDRA 4Q3AA 4K9DA 4FW8A 4ND2A 2CZCA 2HLPA 5CDSA 1DIHA 1IPEA 2IZ0A 1EVZA 2PR2A 1H6BA 3FNHA 2UUOA 2EF1A 5AXBA 2BELA 5FYDA 1DJQA 1HYGA 3I52A 4OQZA 5G0SA 4GLOA 2PLAA 3OFSA 4CMIA 3A14A 3WBBA 3O9ZA 3PQDA 2E4AA 3F6YA 4BNJA 3WTBA 2QRKA 2WD7B 3GHHA 1DXYA 2QRLA 3ZCXA 3DONA 4Z0TA 1YOVB 2NVUB 1KVTA 4E2YA 2Q2WA 1XIVA 5L45A 1NYTA 4PGFA 4W4TA 1QV6A 5BSFA 3EVNA 1C14A 3DBRA 4QECA 1HEUA 3AWDA 3GVHA 3BMQA 1I3LA 3TZKA 2P4HX 2DPHA 4WEOA 5BR7A 5BSGA 1WP4A 3TZQA 1I24A 4TZTA 3H2SA 3OEWA 5F3RA 4RVDA 2C7GA 1I10A 3AM4A 4Z9XA 3MJ4A 4UEJA 4B4UA 4WLVA 1XG5A 4KTVE 1R0KA 3AM5A 5IN5A 2D2IA 3RU7A 3WICA 4CM9D 3WNQA 1PGOA 4R41A 2B37A 4JP3A 3GUYA 1IB6A 1UJMA 4HFJA 4O1MA 5A3VA 3RUEA 3RC2A 3RFVA 3ANMA 3X2EA 2YV2A 3DBLB 3WLEA 3CTVA 1KEPA 2NTJA 4YB8A 4XYMA 2Y68A 1HLDA 2GRAA 4GX2A 1RYEA 4PIVA 4A03A 1LDNA 3FWZA 3NTQA 4TQGA 3VHRA 1GL3A 4KMSA 3TL3A 3NJ8A 2ZJ0A 1TEHA 3KTDA 3PZBA 4QO7A 1QLHA 4CMGA 4DIOA 1N9GA 1UP4A 3ASVA 1RPNA 4AG3A 5C37A 4UULA 4FJ0A 1V0JA 4R01A 2POQX 4ZQFA 2FPIA 3PHJA 1C0LA 3A9WA 2GERA 3TOXA 4DWVA 4D0RA 1Q0LA 5IXSA 1OAAA 1SAYA 3RVDA 4O59O 3FPCA 4IPTA 5EMHA 3R0IA 3WQQA 4UREA 3OJOA 3AY6A 1SOWA 3PFWO 1YWGO 1CERA 4UVIA 1CWUA 1RKXA 3I6IA 3E5MA 7ADHA 5C7OO 2VWQA 1BW9A 1P1JA 4URFA 3KUXA 1D1SA 4CM4A 2AE2A 3RC1A 2PGJA 4JCOA 1PL7A 2CVZA 1YQXA 1JA9A 1ID1A 1Y1PA 1R4NA 1EE9A 1BXGA 1JWAB 4WECA 3U4DA 1PTJA 1ZVMA 2PA3A 2VYVA 3TL2A 4B3JA 5L4NA 2GR9A 4ZVVA 4DC1A 1VJTA 1XA0A 1GU7A 3RBVA 3JQFA 4FN4A 4E5YA 1WAMA 3ABIA 3JD1A 3PJEA 3EDMA 4TKLA 3KYDB 3H65A 4GX1A 3FSRA 3LK7A 3M1AA 1T4BA 4BO4A 1NHGA 4R1NA 3O26A 4IBOA 9LDTA 1I32A 3HB5X 3GF4A 4JX8A 3IOYA 1LDMA 2ZQYA 1UR5A 3NDIA 5KOIA 4CV0A 1X15A 3KYCB 3PVZA 2Y0DA 2NQ8A 5ER6A 1MXFA 1DHTA 2I66A 1GAEO 1JKJA 2DU8A 2P5YA 2J5QA 5F5NA 1NQAO 3ITKA 1ZEMA 3DFZA 3WGZA 4EJ6A 1A7KA 1KEWA 4CM8B 4LMRA 4J0EA 5T5QA 1EK5A 4R1UA 1DAOA 1CEQA 1M75A 5CEJA 2Q2VA 1LUAA 3WB9A 4XRGA 4FOOA 2OGUA 4PLPA 4CLDA 3F1LA 2W8ZA 2GD1O 4KUHA 3KOUA 4K28A 1JW9B 5EERA 1KERA 1K89A 2GDZA 1NVMB 1SCUA 2Z1NA 4ALJA 4OQYA 3I4FA 3GVCA 1A71A 3N7UA 4MJLA 4I08A 1GTMA 1NR1A 2VOEA 4LK3A 4KWHA 1JWBB 1ISIA 3ZNPA 2Y1CA 3KBOA 1G6KA 1X1TA 1ISFA 1MP0A 4JIGA 1GPDG 1PJSA 3ETGA 1GADO 3GZ4A 3H9EO 2VYND 2NTNA 2WE8A 3JQDA 4XQGA 3WWZA 4EYEA 1ZBQA 3OF2A 1UXHA 3FR8A 1LXCA 4NFHA 3ZU4A 4L4XA 3PI7A 1ZFNA 3CINA 4IMRA 4F46A 5ES3A 2AMFA 2J8ZA 1U2GA 4FPXA 3GDOA 2X0JA 4M55A 1Z7EA 1ENOA 4WNCA 4K6CA 1N5DA 5HRUA 4UEOA 1ZJZA 1H9BA 3JYLA 2AHRA 3PPIA 1E3JA 1N1EA 1LLCA 2QG4A 4Y9DA 3SX2A 1DOHA 2EEZA 3R3JA 4KDFA 4LISA 4CUKA 1QLJA 2I5PO 1T2AA 4IDGA 2Y66A 3RUCA 3DMTC 3KRTA 4PLWA 3I23A 2FP4A 1ARZA 5IFLA 3RAJA 2F00A 5DOZA 4WJZA 4XYGA 1M2WA 3F9IA 4NQZA 3KZVA 1IUKA 1YBAA 4ND1A 2BLLA 5EINA 2BF7A 2WJPA 4RVGA 3GK3A 2Y1DA 4IDFA 3RUIA 1LDYA 1LJ8A 3E9QA 1HXHA 3H5NA 3RD5A 4HWKA 3WGTA 3CEAA 2GASA 3AJRA 2JCXA 5FWNA 4XGKA 3S8MA 4YYZA 3PJFA 1XU7A 3LC1O 1J49A 1WMAA 5L53A 4XA8A 3RIHA 3RC9A 4BO3A 2YHIA 5L51A 3X2FA 4JJFA 3UCXA 2IYOA 4TRJA 5FFFA 4UVGA 4DPKA 5MGBA 3BTVA 4Z9FA 4OO3A 2OO5A 1Y81A 2CDCA 4JJGA 1IULA 1I36A 1NHWA 1AN9A 1BXKA 1YQGA 1O6ZA 4WLUA 5DCWA 1R4NB 3GC6A 4BO6A 4A7PA 1CDOA 3H7AA 3ZHYA 2YW9A 5A5FA 4CLEA 5U1PA 3HN7A 4OM8A 4QO8A 2FY8A 1T1RA 2VZ8A 1GYPA 1K6JA 1PJLA 2NADA 5BNIA 5I9NA 3HDQA 1CETA 2EP5A 1X13A 4I5FA 1AHIA 1VM6A 5H81A 3DDNA 2XXBA 5KIAA 4CMCA 3CMMA 5T57A 2YUTA 5H82A 3WSWA 1H6CA 2WD7A 1Y9EA 4B4OA 4XQ9A 3S2IA 1NFFA 4DMLA 1EE2A 3TOZA 2J3JA 1VSUA 4BV8A 1K0UA 4RPKA 1VKNA 4E3ZA 4J4BA 1SBYA 1WLYA 4FR5A 5JNLA 4ALLA 4BKPA 4WOJA 2RIRA 5A02A 5TNXA 3EMKA 2O50A 1M6HA 2I3GA 2DBRA 3RFXA 3A4VA 1HDGO 4PLGA 3GN2A 5L40A 4MO2A 4R9RA 2ZIZA 3KV3O 1T2DA 3WSVA 1B7GO 1D1TA 4OJNA 4NBVA 1SB8A 1NPTO 5A1TA 5KVSA 5G0TA 3DFUA 4IXWA 4EDFA 4E13A 4PG6A 2JCVA 3GUCA 4L9RA 4XYBA 1VPDA 4OOFA 1B26A 3GVPA 2UV8A 3PWSA 4D44A 1EQ2A 1Y5MA 2JAPA 2P68A 2GN4A 6ADHA 2O3RA 4OXYA 4U7WA 2A35A 4GKVA 1EFKA 3RJ5A 4DPLA 4MINA 4J9UE 5T6BA 3DZFA 1VJ1A 4BB6A 5A05A 3BMCB 2AEJA 3ZWOA 3I3OA 1U9JA 4GX5A 3ZWAA 2DLDA 1HDOA 1R0LA 1VC2A 4GWKA 2HMSA 4OGWA 4D41A 1ZW1A 1AXEA 1KY4A 1MUUA 1NNUA 1WDKA 4BHTA 4E32A 1G1AA 5ITVA 4CQMD 4RPLA 1E3SA 4NMHA 5KJ1A 3W8DA 3PK0A 4RF4A 3W4JA 3V2UA 1O8CA 3QY9A 3MWEB 4GBJA 2DKNA 1G0OA 3JYPA 2YDYA 4Q9NA 4D3FA 2JD0A 2CNBA 1VE9A 3DEYX 1NPYA 4W9NC 2JCYA 4LRSB 2J3HA 1QXSA 1I01A 5JY1A 4A10A 3LQFA 2HQ1A 5BSHA 2D1YA 3W1VA 4EUFA 5IZCC 3HSKA 4MIOA 1E7YA 1PQWA 4E2ZA 1I3KA 4YAIA 4W9NA 4J16A 4IZIA 3OP4A 4XR4A 1U5CA 4A26A 1LQUA 1NQTA 1UZNA 3ROKA 4I5GA 4J7XA 4E0BA 3QWHA 2X9NA 3I1JA 4CM4B 4D3DA 4ID9A 1FDTA 1ZNQO 3QVWA 4BKRA 5A5EA 1Z74A 1JKFA 4J6FA 5JAMA 1ZH8A 4GSKA 1XYGA 1ZZEA 2HKIA 4BQRA 1ISMA 1NWHA 3OEYA 5U9CA 1KOLA 3S1LA 2QW8A 5JE8A 1VL6A 5JMPA 2DFDA 4IY1A 4LCEA 5CPBA 1VRWA 1Q1NA 3SVTA 1TVEA 2VHVA 3AW9A 1FMCA 4NI5A 4OMUA 3JCZA 5AXAA 3I9MA 1EUZA 4GQAA 3AUSA 4EJMA 4Y6SA 2P91A 4J4HA 3VPXA 2GF2A 4BMNA 3INTA 4HY3A 4NJMB 1PR9A 3WIEA 4BB5A 4G65A 3WXBA 5JS6A 4CV1A 3QV1A 2ZB4A 3PHHA 2RAFA 1GQQA 3NEPX 1E3EA 4IQ8A 2Y93A 3JQAA 4NBUA 1F12A 5F21A 1T2CA 2ZCVA 3SEFA 3AUUA 3OJFA 1HDCA 1XKQA 1PR3A 4YR9A 4NBRA 1ZCJA 2D8AA 1I3MA 3P5SA 3D7LA 3M6IA 2RHRA 3PFFA 3PGJA 4PLZA 2E6UX 5KKAA 3WX0A 1N7HA 1UDBA 1Z75A 3IMFA 4CMIB 4PLHA 2GZ3A 1ADFA 3ONDA 3BA1A 1FDVA 2IXAA 4K1LA 2PY6A 3TJRA 3VVBA 3OSUA 1F8GA 3TZHA 3PYLA 4ZQEA 1E7QA 2QYTA 4GMGA 3ZWVA 3KETA 1H6DA 4YWJA 1OFGA 2ZKLA 4FFRA 3DAFA 3GHYA 1U3TA 5I7EA 1W4ZA 2P5UA 3H5RA 1X7GA 4FGWA 1VL8A 3D4NA 3GZNB 2VT3A 3VH1A 5GY7A 1P0CA 3L6DA 1JU9A 3UCFA 2H1SA 3PYXA 5FI3A 2UUPA 1LLUA 3AY7A 1DHRA 2CVQA 2EIHA 1GV0A 5A9SB 2YFQA 1QYXA 3OM9A 1IHYA 3JQ8A 4OXNA 4RQTA 2ZYDA 2GN9A 4S1VA 1EK6A 4KOAA 3DZBA 2Y05A 1VL0A 3V5NA 1KVQA 4MP8A 4CL8A 4RCVA 4Z6KA 3PIIA 4XD2A 4YDRA 3BMOA 1KYQA 4BNHA 5JMWA 3SC4A 2G17A 1EEHA 1YGYA 2WEKA 1N9GB 1HDXA 3DAPA 5B4VA 1U28A 1DIGA 4Z3KA 1E1KA 4RPGA 1T2EA 3JSAA 3NYWA 5EQDA 1LEHA 3BMOB 2IODA 3KO8A 3PXXA 1F0YA 1E7MA 1Y8QB 4YT5A 3DBHA 2X1HA 4TROA 4RVHA 1CJCA 3LLSA 4XX0A 1E7SA 3NT5A 4R5HA 3Q6IA 3ZZNA 1DC6A 5ILGA 4JBIA 4YRDA 3RCBA 4CMHA 2XOXA 2ZCUA 1UZMA 4GSLA 4DPMA 4CLRA 4OSPA 5EN4A 3EW7A 4NR0A 5TT0A 3DMYA 3I6QA 3CKYA 3AU9A 3G79A 1O5IA 4DQVA 3IAHA 3LT1A 1GY8A 5BQFA 3GZNA 5JW6A 3GA0A 1ISHA 5AOVA 1PZHA 4L73A 3HG7A 1HZZA 1GEEA 3PIDA 1KEVA 1LI4A 2Z1MA 3L0DA 3C8MA 4XCVA 3U4IA 1IZ9A 4HFRA 2ZK7A 1Z82A 2AQ8A 3HE3A 3PTZA 3VPFA 2ET6A 1TT5A 2Z5LA 1V3UA 5CG2A 3LDHA 1U8XX 1RYDA 4CLOA 1T4DA 3IJRA 4MVJD 1ZKMA 4XIJA 2FSSA 2DBZA 1LBEA 4ZU3A 1UDAA 2H63A 1D3AA 2GUGA 1ZO8A 1LSUA 4YAEA 1W0CA 1RM3A 1MG5A 3K9QO 3O38A 3NDJA 4HFMA 2E37A 3E1KA 4PLCA 3V8BA 4H7PA 1PSDA 4GKBA 4QQRA 1PJ3A 5JCXA 1GZ3A 1HRDA 1VI2A 1X7DA 1LRKA 2FR8A 4RO0A 2XF8A 1D7OA 3E5RA 4AVYA 1B3BA 1CRWG 1Z6ZA 1DBVO 3ZV4A 4AFNA 1DSSG 2QQ5A 5GZ6A 3B1FA 5JCJA 1P31A 2EG9A 2IE0A 4NNJA 3F4BA 5CPFA 3W8FA 1Q0HA 4AJPA 1ENPA 5EESA 2QX7A 1V9LA 1E5QA 1MG0A 4OH1A 2PK3A 4GVXA 2C54A 1T25A 1JQBA 3U4HA 3JQGA 3QVXA 4NG5A 4X54A 3ZGYA 4PN3A 3CXRA 1DJNA 3D1LA 4R51A 4DLLA 1XWFA 4UVDA 1C1DB 1X1EA 6LDHA 1GZ4A 2AQIA 3PRJA 5ILOA 1KVUA 1C0IA 1GR0A 4RORA 5C5IA 5JAQA 2ZB3A 2ZATA 1PQUA 1OBFO 2HRBA 3WNVA 4IGFA 4UEKA 3QJ5A 3ZHZA 3OIFA 3IQDB 1HTBA 4U0KA 2FHSA 1BDBA 2I67A 3WGQA 3O8QB 3GG2A 4FDAA 5DP2A 2X23A 4BUCA 1MC5A 4MVJM 3NX4A 4BGIA 3M2TA 3ZU5A 1BHSA 1UXGA 2DVMA 4Z0HO 3BMCA 2WYUA 3OJEA 4PLYA 1GQ2A 1R4MB 4TRMA 4RDIA 3I9JA 4J49A 1HSZA 4GLLA 1W73A 4GMFA 2PV7A 3CZMA 4DTIA 2YQ5A 4WKGA 2C7VA 1BMDA 1CIVA 1A72A 2X58A 3KXDA 3O03A 4MDHA 3C7DB 2CFCA 1V3VA 2F1KA 2HMWA 4RV9A 4LGVA 1OC4A 2EW8A 2Y0CA 1KEUA 2EHDA 1F14A 4CQMA 1XDWA 2HU2A 2O3SA 3VDQA 1HZJA 4YT8A 2A94A 4FC6A 3GRKA 3GOHA 1K6XA 2BMAA 3AUTA 3W6ZA 4A0SA 3INGA 1G0NA 1GDHA 4IJUA 4ITUA 3RBZA 3GFGA 4ALKA 2Q1UA 1IE3A 5DBIA 4IXTA 3JQ6A 1I33A 1EFLA 1PQPA 2YFHA 3C24A 1U2DA 3DBRB 1QMGA 1LSSA 2P2SA 4XJTA 2ZTMA 3DZGA 2P9EA 4UVHA 3S2FA 3UKOA 5DNAA 4ND4A 4EW6A 4XQEA 2DT5A 1QYVA 4IIUA 3FI9A 3NUGA 4JN6B 3H9JA 1PS9A 1U4SA 4MKZA 1ZEJA 2EGGA 5GZ3A 3JQ8B 1FDWA 1YDWA 5EIOA 4DYDA 1A5ZA 3IP3A 3OIGA 4BNLA 4E21A 4KQWA 1YBMA 4I1IA 1DC5A 3R1IA 2HJSA 4R4JA 3D0OA 1GCOA 1R66A 5I7FA 2GSDA 2V65A 4BO1A 5C7LO 1E7RA 5TGDA 4BNWA 4RJTA 3E48A 1SNYA 1JKIA 2HK7A 1VSVA 4NFSA 4YXFA 1QKIA 3K2BA 1AE1A 2G1UA 3INRA 4YA6A 3G3EA 3L9WA 2WYVA 3ZHXA 3PGXA 3ADPA 1YH3A 3A06A 3DXFA 3JQBA 4CUZA 3H8VA 1ZK4A 2E49A 3MJCA 3PHGA 5A4DA 3MJSA 5ENVA 3N58A 3LLVA 4AJ1A 5IJZA 3E8XA 2O48X 3EC7A 4J9VA 1MA0A 4FQ8A 4IUYA 1UAYA 3DBVO 3WGGA 4W99A 2HDHA 4CM7A 1E3WA 3HQ4O 4J1SA 1DC4A 1K2WA 4PZCA 1QYWA 3WOHA 4N54A 5JLAA 2FRDA 1B16A 1Q0QA 5L7WA 4HXYA 4AJ2A 3QP9A 2IRWA 1K5HA 1EBUA 1BXZA 1C0PA 2V6GA 3RUAA 2C5AA 4WNIA 4CLXA 3IC5A 3PLNA 1Y8RB 1PGPA 4BNKA 3IKTA 2EV9A 2R00C 4ZQHA 2JFHA 3ZWWA 3K2EA 1X14A 2VUTA 1KVSA 3JQ7B 2HCTA 1QRRA 1H93A 1DC3A 1S7CA 3VTZA 4ILKA 4BMVA 5HWSA 5JO9A 2GN8A 3ANNA 1GZ6A 2R00A 1NAHA 2BD0A 3MZ0A 5EL0A 1FDSA 2XXJA 2JD1A 3V1TC 4Q3DA 1PS0A 5IDWA 1LRLA 3QWAA 5KKCA 1L7EA 1TB4A 3WWYA 3IP1A 3K5PA 1J0XO 4IZHA 3C85A 4OOEA 1YQDA 1LDEA 3BMNA 2EJWA 3D4PA 2UYYA 2I99A 1DPGA 3GN1A 4DQUA 2E48A 2IDZA 4J90A 4TVOA 3TZ6A 1ONNA 1I5RA 4BKUA 1LU9A 2V6MA 3KEOA 3T7CA 3KYDA 5T67A 2XPCA 1NWCA 5A03A 2Q4BA 4WOKA 4NJOA 1YOVA 2NVUA 3VAZA 4A73A 2VNAA 3RSHA 1JAYA 1I30A 5COBA 2VRBA 1LA2A 2D59A 2O2SA 4FC7A 1PZFA 4D79A 1N2SA 3QWFA 3ADOA 1Y7TA 3FPLA 2AQKA 2CVOA 2Q50A 1SOVA 3K73O 2IYPA 1E3WB 4CM9A 2PZLA 2WSBA 3LZ6A 2WD8A 4II3A 3EUWA 3B1JA 3R3SA 4MVJI 3COSA 3PHIA 4ZJUA 1ORRA 4YBZA 3MOGA 4XEHA 1KC1A 4OYRA 3EHEA 3WMWA 4BO8A 4ZRNA 2ZYGA 3RUDA 1PJTA 3QVSA 3JQFC 4BOYA 3ONEA 3SJ7A 4WLEA 3Q0EA 1V3TA 1LTHR 2JD2A 1HDRA 4KP7A 3LC2O 3IUPA 1TI7A 3BAZA 3MCVA 3QQPA 3ZWMA 1RM5A 1XCBA 1DFIA 1ZK0A 2CF5A 3ZV6A 4ZQGA 1IZ0A 2GZ1A 2HRZA 3Q9UA 5KCZA 4M86A 3OA2A 4FJ2A 3RROA 4CV2A 1PWZA 4CV3A 3RUFA 3T4EA 3C7AA 4BNGA 2PGDA 1TT7A 3DO5A 1GV1A 2VHWA 1RJWA 4NDNE 3PZRA 3GEDA 1P1FA 5JY6A 3BXXA 5JYEA 3NJ4A 5IZ4A 3GAZA 4CPDA 5DP1A 4UUOA 3F5SA 3RFTA 3LT0A 3UHAA 2RH4A 1ZMOA 1R37A 1CF2O 1JVSA 4YTEA 5THKA 5B37A 4AL4A 4L4RA 4CM1A 1LSOA 4IDCA 4E4YA 5JAZA 4IS3A 2RCYA 1BW9B 3BIOA 4ZRMA 1W6UA 3ETEA 2OOSA 3F5QA 3KYBA 4AJHA 3GEMA 1ZK3A 4KDEA 4L0QA 3BMQB 1YDEA 1A4UA 4KQXA 2GZ2A 4YJFA 1HWYA 3AM3A 3IIEA 3W8EA 4WUVA 3DZHA 1N92A 4YQZA 3ZWXA 4BKOA 2X9GA 4K6FA 5TT1A 2W2LA 1KBZA 1P74A 1PJ4A 2B69A 5F1OA 3ZWYA 4IJKA 2D5AA 2Q46A 4LCJA 1MC4A 1GYQA 4PG5A 1HE2A 3QVOA 1R16A 1X7HA 3ZV3A 2O7QA 1KY5A 4WE3A 5K0ZA 4I8XA 3JQ7A 4R1TA 2VUSA 3AUAA 3T4XA 3VZSA 5CDGA 3DMTA 4OKNA 4ZGWA 1TXGA 3GAFA 5KJEA 5L7TA 3FBGA 3B1KA 1XU9A 2HMTA 2JHFA 3AY3A 4XGIA 1EBFA 4WLFA 2BHLA 3UUWA 2O23A 5CDUA 1GEGA 4TRRA 1DO8A 1D8AA 3WLFA 5L9AA 4L4SA 2FN7A 1FK8A 3BMNB 3UN1A 5DULA 4YJGB 1AHHA 1B2LA 5I9LA 4GAEA 3FWNA 1NR7A 5L95A 1V8BA
chains in the Genus database with same CATH superfamily
1XEWY 5C8YB 3PGVA 1SQ6A 5K0CA 1EJ6A 1JKJB 1W2WB 3TEJA 2XDWA 2N47A 4XIYA 4BGUA 1DBQA 4TXHA 2OOKA 4OREX 5FF9A 5C1IA 3TRHA 5M5BA 3O8CA 5DIFA 4Y1FA 3I01A 2HU5A 4A1FA 4F56A 1G21B 3VSBA 4BN0A 3O4IA 5FP0A 3OSZA 1BVYF 3A4NA 1Y3HA 3BXHA 2UDPA 3GWZA 3ROMA 5KHLB 4L76A 1DG1G 3IQEA 1N5LA 1E2UA 1ZYUA 3ZU3A 5L4LA 5EP2A 3UJDA 2NVBA 1DJMA 1JALA 5DNVA 4C4ZA 3GD7A 2CN1A 3OETA 4PINA 1N5OX 3RI3A 3FHJA 1JLSA 4HYEA 4J1NA 2V03A 4QPCA 4Q24A 5JJKA 1CS0A 4DA4A 3CT6A 1OFUX 4P4GA 4HEA1 3QBDA 2BFOA 2ZUSA 2I62A 2NGRA 3G7NA 4NG4A 4XUCA 5F7ZA 2VYFA 3C3CA 3LLCA 3UXYA 1LBIA 1Z4KA 4KFSA 3B1XA 2RAUA 3JU3A 4EKGA 3A4IA 2QW1A 2R87A 4X97A 3U81A 5IN4A 3QUQA 2F17A 4FHFA 3EGWA 3LRPA 2QRPA 1QMPA 2ZE7A 3OJ0A 3KPYA 1ECBA 3ZDDA 2WWGA 4CEHB 4DGSA 1CZUA 1QWSA 3NMUF 4QTYA 3FDJA 5DN6A 3MWEA 1UCFA 4MQ5A 1SURA 1XRMA 3TD2A 3W9UA 3PQ5A 1FTSA 2HPZA 2PAAA 3L4BA 2A84A 4ACBA 3O93A 3N2GB 1PD1A 1TUIA 2P3QA 1POXA 1KK3A 1UP7A 3K0AB 1YKFA 2Q28A 3BZUA 3ADKA 5EHXA 4TV8A 1BU5A 4ZAZA 3A26A 1E7WA 3ODGA 4IV0A 1SUCA 2EL9A 2IL1A 2YDXA 4XYEA 1DTSA 1Q92A 2GLXA 3BEDA 4NHOA 4NYJR 2ZAMA 4PX3A 3SBEA 3DFMA 2JFXA 4LTNA 4O4JB 2SKDA 2WKWA 2ZBFA 5LZ2A 1KRXA 4BGEA 4LF8B 4D9JA 3UBTA 1US8A 4OL0A 1DWOA 4QWWA 1WDLA 3MT9A 2K2WA 5CJ2A 4OGLA 5JHHB 4J0HA 2HMAA 5HIMA 2QL5A 5EAIA 3TOCA 4QSMA 5LD2B 3AR3A 4CM6A 4IMJB 1OV6A 5EIBD 5LDHA 2WIGA 1IN5A 4GSYA 3ESBA 4TYYA 4H15A 2FSGA 4O33A 3KXLA 2I4TA 1ECPA 3A1WA 2D2VA 2Y1LA 2QZ4A 1RI5A 1TIBA 1JEAA 1XZNA 4HEJA 4ADSG 3CUUA 4G5HA 5K01A 3ULKA 5HF9A 3UW1A 1YVPA 4IIXA 1TNDA 1EG2A 4JITA 3MCAA 2W93A 4ZV7A 5CLLA 1C0KA 2VHUA 3MWYW 5CB4A 1EK0A 4WKPA 2UYHA 1YTUA 3OLXA 1MVLA 3KALA 1PR1A 3MMXA 4RENA 5HMLA 5JH7F 3PR1A 3DMDA 2GXAA 3LL7A 1JLLB 1R6DA 3D3JA 2H9IA 3FUCA 1DB3A 2ID4A 5DOVA 5B3JC 3AIKA 2D1RA 2JIBA 3E35A 3I30X 3HGMA 5EYPA 1H0HA 2QM7A 2YOFA 3FZEA 3VR4A 3VJLA 3BT7A 3FTCA 3I12A 4UCQA 1H2XA 3G1TA 5F5XA 1UBMS 1ONPA 3ESCA 4KVFA 3QVVA 5LOVB 4IYRA 1C30B 1F9AA 3HZHA 1M34B 4QOFA 4EI9A 4K1XA 5C46F 4DR7B 1KVRA 5B3JA 2CHQA 3L6EA 4MAMA 5SYAA 3KTOA 4CVNA 4KITB 3CU5A 3JYQA 3V7WA 5JALA 4EEKA 1WDWB 3EYAA 1ZUHA 1LJUA 2OQIA 3ZX5A 4LJKA 5DMXA 2B0CA 3GGPA 4Q39A 5CGZA 4QM7A 1Z8DA 1S01A 2OUKA 3ELYA 3ENNA 1XVVA 3NBZC 3S4YA 1DTWB 2Q1WA 4J16C 3T99A 4JQSA 3BDIA 4B71A 2VJYA 1ZWKA 1OLXA 5LZ8A 4AI6A 3CX4A 3D6VA 1KFCB 2J7PA 1EFVB 2JFGA 5DIZA 3W4IA 4A8JA 5F23A 1E6EA 2BKAA 1MW8X 5LP6F 3U7JA 4PAMA 1QX3A 1CE8B 4PICA 5K6AA 2JGLA 3TD9A 3E6AA 4M87A 1K5DA 4HKTA 1E1QA 3SS9X 1QYDA 4QTUB 3UJ9A 1A04A 1TUBA 1YTLA 4J3FA 4D0SA 1RWPA 5PNTA 5K6RA 2QJFA 3KM0A 2PRJA 3BHJA 3F4LA 5CYOA 1IK6A 2D06A 3H5TA 3X1MA 2AFVA 1E4OA 1O9BA 1UPFA 3BERA 3HB9A 1ONSA 4L08A 4YS6A 3ZWNA 5L3SB 1GJRA 3IDSA 4DCVA 5B2FA 2HA4A 1I0IA 2QK4A 2NSHA 4BPBA 4EKIA 2ZJBA 1TO2E 3GFPA 1HORA 4KNWA 3GXOA 1UOOA 2FQWA 2RJOA 1N3IA 4X8LA 5IG2A 1G9XA 2F3RA 3RIGA 4YRLA 2PFKA 3IQGX 4LWPA 4TL9A 1IOLA 5K8LA 2QZ9A 5AI5A 5CM9C 2EHJA 3LA6A 1NPDA 1GPMA 4OY3A 1U8ZA 2JL1A 4W5JA 5F4ZA 1DOAA 1W94A 3R7DA 2F1RA 4M1OA 4LZLA 1NFRA 5EQTA 2BJWA 4KAJA 3DDHA 3OQVA 5I3ZA 3RU9A 1R1DA 1OXTA 2Z2JA 4IDEA 4ZEOA 5SZIA 3QNUA 5JSQA 3KZMA 2OHOA 2ZWMA 3CF4A 3FH0A 4K9MA 4BRZA 3THXA 5HIJA 5IBRA 2PMEA 3FFTA 3WIBA 3P4YA 1AD2A 3T1OA 4IAOA 1RAHA 2FZWA 1DRKA 3TW8B 4D8TA 1VDMA 4FD3A 4C6HA 4FHGA 2AC2A 2VWPA 1M76A 1I6LA 2DUWA 2H5IA 2HUPA 1NN3A 2VRCD 2J3IA 1XRPA 4C0LA 4KNVA 3BSYA 3GR6A 4HUTA 4Y98A 1CU1A 2WWXA 1KI3A 4TWRA 3ZU6A 4D46A 1DUIA 4GGPA 3S1AB 3R9XA 2GAIA 3V7NA 4Q4AB 4V0NA 3LFHA 3DOCA 1YS9A 2C4UA 3M1IA 3WL5A 2O8NA 4BLUA 5HSGA 5JARA 2QZSA 2FEPA 3ICCA 4WLOA 1RFLA 1PR2A 1U0JA 2V7PA 2NTYC 4O4IA 3BL6A 4URUR 4X3OA 5SYNA 1CQIB 3HP7A 5F9MA 2H1HA 4HNUA 1B0AA 4XQ0A 2HL6A 1JEQA 1G291 2VXYA 4MS4A 2JG3A 1H0KA 1Z2OX 2CLKB 3EF3A 3LM8A 5AI4A 3ZXIA 1BH6A 2ZQ5A 4L75A 3J81A 1U02A 2XE7A 4FSHA 2XMBA 4O4LA 4GMKA 3K94A 3PNMA 1EDOA 5E6SA 1JYEA 1N6RA 2FMHA 4YY3B 2XUJA 4YH1A 2IH5A 2OORA 2XSZD 3EG5A 1UC8A 3HMKA 3JW8A 2EZ4A 3L7AA 2WYHA 3B38A 3J81k 2R6DA 2Q49A 3ELDA 3C6BA 4L3WA 4PG7A 3EQ7A 1F2TA 3IAM1 1Z4IA 2QQ0A 4AF7A 4FNAA 3GAAA 2JRLA 5FWYB 5M29A 5BPFA 4C7VA 4N0DA 4WCDA 1V4BA 3C1AA 2NTVA 3ZCQA 1X7WB 4QDZA 2GCGA 1DT5A 5DSTA 3VTKA 1H3EA 2MYTA 1U3FA 5DJ5A 2DYKA 3T38A 2I3BA 3IL2A 2ASVA 1E9RA 4O3FA 4E5NA 2JZCA 2PZMA 3Q2OA 1YFJA 4OYLA 2OV1A 2ECFA 5A9RA 1YACA 1YI1A 721PA 2YVLA 3ZD9A 3VKWA 3IUYA 2WPDD 4B7CA 2JCGA 4BECA 2FCAA 3ROXA 3JY6A 4WNYA 2AVDA 4NK4A 2QVLA 3CPEA 4HG2A 2UZ4A 1J33A 1Z0ZA 2ZXEA 3H75A 2AN4A 4HWGA 2YV4A 4BUZA 4BQIA 621PA 2BCJQ 4Z4IA 1Q6ZA 3OJLA 5FRDA 1ST3A 1TJ3A 1Z45A 4M1EA 2WUVA 3NKLA 3ZGVA 4YRZA 4M1TA 1YL5A 3KLNA 3VGPA 4RL4A 2ZR0A 1DO0A 1K7XB 3DJYA 1KGSA 1I5OA 1LVUA 2DBVO 1L8AA 2V7TA 3QHQA 1N0IA 1NONA 2OECA 5AKZA 3UGKA 3EOBI 3C97A 1HGXA 3V8MA 1USKA 1VMDA 1J0CA 2WG0A 3OIDA 3V8VA 1UBSB 1Y1SA 4AIRA 2Q0QA 4UM7A 4OXRA 1A4IA 1PDOA 1VPLA 3RAFC 5JBQA 1Z7WA 4B3MB 1KSJA 4UMFA 4QPJC 2OHHA 4C4TA 3ONNA 3CIFA 3ITEA 1SA0A 6Q21A 4B1FA 2W2KB 1GRVA 1Y42X 3PFGA 4DCJA 1GKUB 1NTOA 1J2RA 1P4SA 4DHWA 2DHEA 3N53A 5B3LA 1PYOA 3CZ9A 3ZGNA 3SYMA 5BV2P 4RPJA 1H2HA 3R5XA 2QLMA 2XRZA 1P18A 4TMKA 1YMVA 2BZSA 4FZVA 1QH9A 5BPHA 4LRUA 1DARA 1SIBE 2C99A 3BYZA 4O1IA 1VYVA 1N8TA 3KKEA 3GW8A 4MSUA 2VZEA 1N0VC 1J8QA 3E9RA 4ZYUA 1L5RA 1M74A 2H18A 3P9XA 1VZ3A 1OFHA 3GGJA 4I5EA 1Q2XA 1Y63A 3FX2A 1ICEA 5ELLA 2X19A 3OFKA 5LQRA 2C0QA 3JD0A 4YUZA 2AI2A 4EGJA 4EMSA 5HX7A 4I99A 4B4DA 2G36A 4Z4CA 4B9EA 2C2MA 3H2IA 1UMBA 2X0IA 3LKVA 4DBLE 1JAHA 1ZQ9A 3U1VA 4RGVA 1X80B 1OD6A 1XZIA 4MVJF 1V5FA 3D8TA 3GDFA 1A5SB 1NMEA 2ZQZA 3JQAD 4FFSA 1CP2A 2ZJ7A 3EZ7A 3H8WA 4KRYA 4MQ6A 3DLTA 3MPUA 3EDCA 1AKEA 1J25A 4WK0B 4N49A 2FW7A 4FONA 4HDRB 2G83A 4AO8A 3OHPA 4EG5A 5B6JA 4H3HB 3TCXB 1EZ1A 3CPSA 4RHXA 1EGVB 3LMKA 4K3UA 3I42A 2GEBA 4BEBA 3QUTA 5B6PA 4C4AA 1IBLB 3NATA 3GH1A 1U3VA 3ZCRA 4F71A 4S1TA 5KYNA 2GEUA 2J9XB 1V2GA 1JR3D 1UT5A 2YJZA 5IT4A 3RYIA 4XIFA 1MJNA 1EGQA 5K0LA 4HJXA 4B33A 1DFGA 1Q2UA 1KMHB 4YV0A 5AVTA 1XJQA 1WHSA 4R0NA 3RTBA 2PUBA 4IWNA 2A9KA 4Y67A 3W9YA 5GVSA 1KFKB 4A15A 2ZR8A 5FO0A 5THQA 5KQGA 3PQEA 2YV3A 1G16A 3D3WA 3DOHA 3FF1A 3OU2A 4JI2B 1ACJA 4EKYA 3OY2A 1IN8A 2X6RA 4XB1A 3GEIA 3RS9A 2Z6UA 1IL0A 5LB2A 2PCJA 1A95A 2HPAA 2CJPA 1TMGE 1P7VA 4PYNA 4O63O 4KGVA 2XT6A 5CT6A 3ZWBA 1YNOA 3ZI0A 1MO2A 2QVCA 3H8JA 1RLIA 2GFIA 2QZJA 5LMUB 4G97A 4FM9A 2JGKA 3PP8A 1PWXA 4FLFA 4E94A 3D31A 2QAGC 1K7EB 5IM4A 4Q93A 5CA0A 3W9BA 2XRMA 3AV0B 3C5EA 4HFNA 3UB3A 3AINA 4LHEA 4Y8VA 4LQLA 1NUHA 4OHMA 4DRYA 1UZLA 3WZLA 4Z7QB 2C20A 2XNDD 4JOBA 2GJ8A 2QR3A 3VSCA 3BFVA 2R65A 4C14A 1F06A 2P6RA 3VR6H 1WPQA 3C1TA 1KWGA 4GIBA 1NMQA 1V8OA 4B5LA 4U0JA 5F7JA 2CXPA 5GVRA 3P0HA 4LW8A 5CB4F 5JDCA 2OUIA 3BX1A 3RRYA 1T8YA 1K86A 4P3PA 3DF9A 3N6VA 3PHCA 4IH1A 2AQHA 3VU1A 3LVFO 4S1NA 4K26A 4W8GA 1GZ7A 2PGOA 1AC5A 3BICA 3KUUA 3NBKA 4WPGA 1V7ZA 1Z25A 1R2QA 5JBNA 4N12A 5IJ0A 1WD7A 3LUJA 3QWIA 1Q95A 4OSOA 2BFAA 1UFRA 4JYPA 1PK7A 1FUKA 5B1SA 3ZJUA 3A6HA 4OKIA 2OVFA 3MTJA 1NXXA 1JHXA 3PC2A 3WKBA 4KPYA 3CUWA 2NUPB 2P2ZA 2RGXA 5ALWA 2FK7A 5GP1A 2B4RO 4GLFA 1IN6A 2QL9A 1M8FA 2C5SA 3HCBA 3Q2IA 1KMMA 1J42A 5JAOA 1NVWQ 3BWMA 3X3HA 1VPWA 1AB5A 1VIVA 1CX9B 2OFWA 3Q11A 4MIYA 3VTAA 5IJ9A 1XXHE 2RARA 2QTGA 2NX2A 3AFNA 1DLJA 5IAKA 4R40A 4Q21A 3TZCA 1FBNA 3UT5A 4BO0A 4MDFA 4A9AA 5HRCA 5KUTA 5KYVA 2XUKA 4W82A 4D9MA 1ZGAA 3IAXA 4G8BA 4ND5A 2PMKA 4EB6B 4UXJA 3EZ2A 2ZULA 1TRKA 3CUVA 4PCVA 1GL9B 4QYMA 5EKSA 3C15C 2YVKA 1Q0TA 1NLYA 4A0HA 1WDMA 1FPQA 3T8YA 3F67A 3ORFA 1YFZA 3AKZA 1RKQA 3H5WA 1A69A 2QT9A 4NV0A 4AKEA 4BJ3A 3IV9A 4P58A 2ERYA 1JFFA 1M67A 3WLTA 5K8UA 1CUCA 4NH4A 5HNKA 4QOEA 1DIRA 1YJBA 3PS9A 2EERA 3AP2A 1N3YA 1AZWA 3O0TA 1CSEE 5HS6A 3OOWA 2W98A 5J23A 1YBHA 5MDHA 3N2KB 3LQYA 1TT5B 5TGTA 3LPCA 1XDGA 1B3RA 1CR6A 2B35A 4MPRA 1D5WA 1GNQA 4IDNA 2QRHA 5J5AA 3RYFA 3OQHA 2H54A 1G2OA 1R0XA 1QM5A 2NO5A 4JUIA 5ECGC 3IKVA 3UWKA 3D6JA 3IAS6 1DBSA 2ONKA 4QHYA 5E6RB 1QR6A 1H2RS 3PA8A 3OMLA 4N3BA 1X94A 3C14C 3IP9A 4FVTA 4M38A 3ZZMA 4IJWA 3TSOA 4AWAA 5EHQA 1QO0A 1RLOA 1Y3IA 4B7ZA 3FKSD 4LGCA 4F91B 5HM8A 4RTJA 5CM8B 1SU8A 3FXAA 1XZJA 2CUKA 1RRCA 4CMEA 5K3AA 1YHZA 5L7YA 1A27A 4W6ZA 2R47A 4H1UA 3BTOA 1G5RA 4MVJP 3CS3A 4G41A 1XJCA 4W6QA 1H85A 2M1XA 3H19A 3VPGA 4S24A 4HATA 1Q7CA 3N2LA 5E1MA 2CDBA 4DVJA 3N9IA 3TIGA 3H6KA 2D5BA 4GQIA 4LGMA 2PKQP 2YYZA 5G0UA 1ILWA 5M34A 2OD7A 3D6TB 3DBHB 4GU5A 3N6RA 1E18A 3U7EB 2HLDD 2GESA 2AEFA 5HTOA 1E9SA 3LD9A 1M2OA 1PR5A 4M8LA 4BS9A 4YRBA 1TKCA 2IUYA 4UHBA 4FMCB 2PDAA 4QRHA 3C3PA 4K6OA 4L78A 5AK3A 2RGDA 4A8PA 3KSDO 3U17A 2PKQO 3U3DA 2EQAA 1O0CA 4GW3A 1QVZA 3ESAA 1YB7A 1HL3A 1C41A 3BJRA 3G2KA 4OK5A 4C0WA 2WM3A 3FWHA 2XVMA 2HK8A 4MW9A 4CR8A 3U7RA 3CZAA 3U16A 1D2NA 3EWAA 4R68A 2PQ2A 3UWPA 3D8RA 2HI0A 3L82B 4EB0A 5JAHA 3C7CB 4JI0B 5SY9A 1M1ZA 1ZJYA 2Q3EA 4BBJA 4U1RA 4R5MA 2ZCJA 1E6WA 3NP9A 2AHOA 1ZM9A 2G0TA 5C81A 4O6VA 3V4PB 1SCDA 5CFMA 2GXUA 1UFVA 2RCNA 2RHCA 1GPH1 3G89A 2BBWA 4RK4A 2AFIE 4R16A 5A62A 1BRMA 2P65A 4Z3DA 1IYZA 2HXYA 4XD7D 5A4FS 4DDUA 3PUWA 5KQLA 4HL6A 1T9AA 3P4XA 1UFOA 4PC6A 4N41A 1LPNA 4PU0A 1ZRNA 2YJGA 3HXQA 3GDWA 3NXKA 1IAVA 4FW9A 1AA6A 2G40A 1R4ZA 4P92A 1Y6QA 1QG6A 4P4SA 2QX9A 4RXMA 4P4LA 4V0KA 4BNIA 2WIDA 2DY0A 3K92A 2EZUA 1QFZA 1UPUA 4J1TA 2UVQA 2C2BA 5DF1A 2IS1A 5CDHA 4J4TA 1VCNA 3GJRA 4EJSB 5C1BA 2A30A 4OX9Y 2VF4X 4G67A 2ZTVA 4XQCA 3JPWA 1JQAA 3JX9A 1AO3A 3TLEA 3OOSA 1QNLA 3FBTA 3SIXA 1QUFA 2YCLA 4MW5A 3VXKA 2C4NA 1S8OA 5KOYA 4RDHA 1ORVA 5CLIA 3L0SA 4L9SA 1XLTA 4X20A 2CSXA 1QKKA 3ZE2B 3L7JA 3E0QA 4IL5A 1DG3A 1Y4SA 3JASA 5IFKA 2A5GA 2F1JA 3AW8A 3ANLA 2YJNA 3I92A 4GYJA 1GTSA 2UUAB 4OP1A 1FUUA 2DE0X 2C5FA 1V26A 3G9XA 4LXQA 2FVXA 5CNIA 3S7ZA 2REQA 4N7MA 4QU8A 4PPNA 2J6BA 2O0MA 4GR4A 3GCZA 1N5KA 5FEMA 2A6PA 2YYYA 2Y27A 2A8YA 3PLRA 1OVMA 1RI4A 4FS3A 4J2HA 4R81A 2E89A 2C07A 1T26A 1T1EA 4F6CA 2RBGA 4PRLA 1KFEB 2BV3A 4OATA 4Q3LA 4QBTA 2CXQA 4TUYB 5K7SA 1NI4A 2PSSA 1P45A 4HDKA 3VPSA 3UGJA 2FZ5A 2PM8A 4MOWA 1WUJS 1KHHA 3BWDD 4M8IA 2NYVA 4O4LB 5CT5A 3KJIA 1Y7PA 2OVBA 4DBLC 4LVUA 3VYRB 2BGKA 3KKQA 2WHYA 3ZNNA 4AZVA 2GO1A 2ABWA 4PR0A 2HO5A 2XMZA 5BV1A 2AZTA 2YXNA 2ZJ3A 2C7RA 2HCBA 1RBYA 4ZVLA 3ACCA 1E4EA 1YS6A 2ZETA 2Q4RA 4J2OA 3VVCA 4CIVA 1TO6A 1SXQA 1KOGA 3K9CA 3B1ZA 3C3YA 1WXDA 3C8HA 2VSNA 4Z0NA 5LLSA 3OZVA 3BQ9A 3Q1KA 1A3CA 4B8ZA 1OZAA 1WZUA 3OTOB 2GNAA 3T35A 4QLAA 1OH7A 5AI6A 4B47A 1PK9A 1IK4A 4RMIA 4QNNA 2QSZA 3IJPA 1V96A 4ZOAA 4XJSA 4AP5A 4YAGA 2WJWA 2NU7A 1UJ6A 2Q6VA 4N39A 3D64A 5DT9A 1K5GA 2W2LD 3KTAB 4W7IA 5J59A 2R1TB 1Y98A 1KI9A 1Q7GA 1SBTA 4LV8B 3S29A 1ZH0A 4DKXA 1BE1A 3LY7A 3ZVNA 4AULA 4INOA 4ZU1X 2XVAA 4MLCA 3KQPA 2OCAA 2CLFB 1SPXA 3AZQA 3H5VA 3ZHOA 4IXMA 2IIQA 3DZIA 3DZJA 4NIMA 5C7YA 2ZSUA 3ILYA 2DFPA 4HTFB 1OOEA 3OZCA 4AB1A 4IXDA 4NICA 5CBPA 4HQLA 1Z38A 3B2QA 2WV9A 3RC7A 1BD4A 4DREA 3LBIA 1CULC 1OXXK 1UDCA 2ODEA 8ADHA 3TRIA 1M2HA 1SIWA 1DRJA 3A2LA 5EQJB 1FS5A 3N2EA 1E3IA 4FSXA 4LRWA 2H5JA 1HPLA 5A6SA 4UMVA 5DNWA 5CFZA 5AVQA 1R0WA 2W83A 2JIRA 3CH7A 3RVLA 2DETA 1BAPA 3D4OA 3FGNA 3GLHB 3K30A 4PO3X 3R75A 3ZDYB 1U7HA 4BFYA 3H6GA 2RB4A 3V1UA 4C7BA 5LU8A 1GAJA 2XA9A 2XZDA 2GWHA 1C1DA 3AOEC 4GBGA 4KVAA 2IC5A 4JBGA 1JHAA 4DUZB 5JYBA 3UZUA 4MIEA 1XLVA 2CHGA 1SVNA 3EVDA 1BZYA 1OWOA 3DZDA 3WY9A 3MT0A 3MTDA 1WCYA 2MMGA 2ZXFA 2EYUA 3JVEA 5FPYA 5LP1A 2DF8A 3HJTA 4Y6RA 2DC1A 1NASA 1UDWA 3AR8A 4OYHA 5DTQA 4YDSA 4YEDA 1YOBA 2VXCA 3PBKA 4IEIA 2QHXA 2R2AA 3FDIA 2UXBB 4EHIA 1Y33E 4YRGA 3TZLA 4BEVA 4V02A 3D43A 1W35A 2ORVA 3VZQA 5EJ2A 5FUVA 2PWZA 4WAUA 2VP0A 1SBQA 4B3SB 2EIXA 3EZ6A 3X1WA 3WBJA 4U7DA 1CVRA 1PG5A 3TW4A 5JATA 3OVMA 2TMGA 3I9OA 1Z2CA 3ND9A 5EXEA 3EXEA 2Y77A 3MINB 1SRRA 2JEOA 4Y2HA 3NT2A 1T0PA 3ST7A 4DT1A 4KR6A 1MN6A 4TYMA 3RRMA 4Q1CA 3PYMA 4MGYR 3SXJA 3OG9A 3S27A 3W3ZB 1GXSB 3R3YA 3DR5A 4QBFA 2HMUA 2Q3LA 3NBQA 2BFPA 4GG1A 2AG5A 5BNTA 3RKUA 3W78A 3VH2A 4H4DA 5DX8A 1T0IA 3M6LA 1XDUA 3A3NA 4IQ0A 4L9WA 4X7MA 2JVIA 5E38A 4G8JA 4RS3A 3UJ3X 1D0IA 2OKCA 2Z0MA 2PJZA 1C4KA 3BREA 3U3RA 2PD4A 1TVCA 3LP6A 2ZJ1A 1COZA 2WIKA 2IEIA 1JNXX 4OJYA 5BV8A 4EQ6A 3LKZA 5TE9A 1MOZA 1P1KA 5GGXA 3SF0A 4W5WA 3KR1A 2DPGA 3V3TA 3HKDA 2ZAIA 2ZVPX 3RIYA 1G19A 3O0DA 2PSFA 1ENZA 2XE6A 4EZBA 2H4JA 4P7JA 3E4DA 1K68A 1P4GA 2OCIA 2Q5IA 1IOWA 2VK8A 3G0CA 1XWIA 2W4IA 3AYZB 3L07A 4ODIA 4UARA 4W1RA 4TL8A 4R05A 4KWEA 3KQKA 4B3HA 4ZOLF 1H4TA 2VHEA 2WYWA 4TMFA 3BTUA 1XNHA 2Q2QA 1ZGCA 5FLKA 1DRVA 3B9RA 2HGZA 2B0JA 2I4LA 3MQ2A 3SC3A 2IY7A 4JNKA 5EP3A 4M60A 4XWTA 1N25A 4CKEA 1XCLA 4EENA 5E2IA 4C6RA 3O94A 3G17A 4UAVA 3WDSA 4MA5A 1E1NA 4G4IA 4TTTS 4DABA 1GO2A 1NQOA 2PTGA 2ZBVA 3U4QA 3ZKWB 1YVDA 4HC4A 1FPMA 4P0TA 3FVWA 4C30A 1I0ZA 1R5OA 1M6EX 3GCDA 3H6HA 1UC9A 2CVFA 3JYNA 3FFWA 4Q1AA 3VM6A 1KU6A 1CP3A 1HDIA 2QG9A 1AGYA 3NOVA 5HCNA 1YHNA 1FL9A 1AURA 1CS0B 2W0SA 3AESB 3QELB 2VBGA 4PQRA 2C8KA 3ROZA 3A6KA 1T5OA 3H2JA 1HYEA 1FXWF 1RAIA 3OCCA 4LJSA 1XSEA 1OKKA 4DB2A 4Y2SA 3WB1A 1XEWX 1UM9A 1J56A 2PKRA 1ZXLA 2NXJA 1G21E 3MTGA 4TKZA 2C7QA 4LYHA 5LQKA 2EWWA 1KI8A 2G09A 3ESQA 3NTOA 1Z6GA 2GPJA 1JJIA 2V9ZA 3O8DA 3LHKA 3SIPA 3EEOA 4PWZA 1XTVA 4F7WA 1HDZA 2X0NA 4ZV9A 1W1UA 5FX2A 2G9QA 5ARBA 2AC4A 2HPVA 2HHLA 3C3AA 1TU3A 4MUMA 2ENUA 5CJJA 2FW8A 3ELWA 4EGFA 5A4AA 3MC1A 1XXLA 4HBGA 1RQGA 2NXWA 2FLKA 1DBIA 3SHVA 3TLYA 3FLBA 1IM5A 2XCOA 1WMBA 2ILTA 3E22A 5I47A 2VTBB 5KTKA 1RBZA 1F2DA 1PJBA 5CH8A 1P2FA 2BHNA 3HCCA 4G4SO 3FAZA 1U1IA 5JC8A 2PWAA 2XLCA 3H3JA 2WF9A 1B76A 4I6GA 2ZTLA 1RC1A 2P11A 2JH9A 4PLTA 4JXXA 1E5LA 3OPQA 1DNPA 3D7NA 4MCHA 5CX4A 3U7FB 1WU8A 4QOJA 3OPMA 4UBJA 4EW3A 3KOXA 1QR2A 1R5BA 3GGCA 3WJ1A 2BRUC 3AJ9A 2FWIA 3EXIA 3QKRA 2WFAA 3PNQA 2ZYUX 2NQTA 3R3HA 4Q15A 3KXPA 1QOPB 3PSHA 1QZTA 1ZCAA 3CLHA 5CMLA 2O4UX 2Q5FA 1A9ZA 1T1SA 1Z3IX 4ASUA 1L5QA 3WAKA 5CEFA 3BF8A 2FSIA 2OMKA 1GR1A 2C03A 1H0SA 2D3WA 4G81A 4JXKA 3RB8A 3OM0A 1ISSA 3I2GA 3BGWA 4RMNA 4I3HA 4PY2A 4DMUB 5CU7A 2QGNA 3DYBA 1P7WA 1WY5A 2WP8J 1QIEA 2WOJA 3WNCA 3CSDA 5DBEX 3FCEA 2ZRLA 5DCLA 4NYMQ 4Q3BA 4YJ3B 3IIMA 3L6OO 1PSZA 1ZISA 3QSYA 1R5NA 1GGJA 4Q5IA 5JMTA 5D84A 5LOVA 1Z4QA 3LO5A 2OV8A 3VKUA 1PSWA 3LT4A 4NPCA 4WA7A 3DHNA 1U3WA 1RZRD 1JQLB 4OM7A 2PMWB 4TWAA 3I9LA 4R3WA 2Y99A 3K1AA 3DP7A 4MVXA 5HQJA 4HADA 4CL3A 3HI4A 4GRAA 2YYAA 1DBPA 1W5AA 3AEYA 3EK2A 4HQFA 3ECSA 1PZGA 4Q1FA 4UBKA 3ZNOA 3UCEA 4H7DA 2POCA 3R7LA 1OLXB 5AJUA 3CNEA 3VTFA 1XJ5A 3H42B 5HCIA 5SYMA 1IXZA 1ZJ5A 1YE3A 9GPBA 1V5GA 1U0SY 3EIOA 2V98A 2VRCA 3GQBA 3HR8A 3RR2A 3TDMA 2YHIB 4HH1A 3OF5A 2FWAA 1X1DA 2DT8A 2VPYA 3GA5A 4KWIA 2AXPA 1D2AA 1W7AA 5DYYA 2W22A 3ZWDA 3H2YA 5C8YF 2WTBA 4PLFA 4TYPA 3O83A 1M34A 1QDLB 2BHRA 1I4WA 2REOA 3QG1A 4DNOA 3MYRA 4QBHA 4DB4A 5DSXA 1J0BA 2REQB 3QEOA 5BSVA 1G5FA 2I3ZA 2AZ4A 3T9CA 2HLDA 4L74A 5I4CA 5I7OA 2EBFX 4D6XA 5K3FB 2F48A 5KOJB 4KBYA 1BXGB 2HN9A 2JIZA 3CWZA 3CCFA 1DINA 3DTTA 3FHLA 3KTFA 2OAEA 2H7CA 4DIFA 1EEXB 1E3QA 2R6JA 2W0MA 3M1LA 2ZI7A 3V1LA 4Y1GA 4DJTA 4DV5B 1OXUA 4MCJA 3TEFA 4EBBA 3NDRA 4GYWA 4OHFA 4QC2A 5FWXA 4B32A 4YP7A 4U7JA 4CCSA 2BMWA 2ZZKA 4MQFA 1E3TA 4MW7A 2VAVA 5CDSA 5T3UA 2VAMA 3PPYA 1W49A 2X2FA 1SVIA 3HY4A 1IPEA 2IZOA 2NVOA 1ML4A 4X1KB 3A1UA 3QTTA 2PR2A 2FSHA 1H6BA 2R5WA 4QU5A 5C5CA 4B3FX 3RRZA 3PXAA 2J31A 3F96A 4OHBA 1C3EA 4YI3A 2OQVA 4FYXA 1FW8A 4OXQA 5M04A 2B98A 3QKTA 4MB0A 4B3GA 1P39A 1JG1A 2CHFA 1H1LA 3CCBA 4YRIA 2UZIR 2E4AA 4AKSA 3K9LA 3WTBA 2GUWA 2GPAA 4BX0A 2JFUA 3E53A 2IXGA 1RE1A 2BFCB 2J3QA 1G1MA 1K7SN 2P9TA 1FFSA 4DIKA 3NW9A 1KVTA 1Q0RA 3W5CA 5FBHA 4E22A 4P7GA 3UJ8A 3L7IA 5CLFA 3MFQA 1QV6A 4LK2A 4JELA 1CB7A 1JYFA 3EVNA 5BSFA 5HK9A 1VI6A 1VHQA 4QECA 1HEUA 2WYIA 3GVHA 4MPTA 4DZTA 3KLOA 3HYCA 3GDHA 3JZMA 4LNHA 2QXTA 4RHUA 3R8CA 1LPPA 3H2SA 4C0KA 2C7GA 3AQ4A 3EFBA 4ZO8A 4HPWA 1FNBA 5EHGA 3DPSA 2ZUEA 4QRDA 5LKRA 2HCRA 3WICA 3SEQA 2GZMA 1TA9A 2I7VA 4CM9D 3THWB 3NONA 2B37A 2HJVA 3M5WA 2H1LA 4MLPA 2XVYA 2X8JB 1RJDA 4JJ4A 5E7MA 1NP7A 2X0EA 1NXVA 1NJGA 1R88A 4HFJA 2HDNB 1NXOA 4O1MA 3RC2A 1AG9A 1SC4A 4AAYA 4B3TB 2QSYA 4AWBA 3CTVA 1KEPA 3G9UA 5ALYA 2NTJA 4XE5A 2DFTA 3O1IC 4GX2A 2I80A 4IQ4A 3MJFA 3CIOA 1L1QA 4V0ME 2G8NA 4KMSA 1KTVA 1UT8A 1H3FA 5FI1B 3FPKA 3QKSB 3TL3A 5HIIA 5IJ9B 3RM3A 3UA4A 2CZQA 2D1TA 1Z4OA 3KTDA 3EF1A 5F4BA 4RACA 4QO7A 1FRFS 4HGYA 4AQ7A 3MSCA 3SHFA 1PHRA 2CBZA 1RSZA 3ZXUB 4LVOA 1QO9A 4FJ0A 1HK7A 1V0JA 3CFYA 1N6OA 2FPIA 1II0A 3PHJA 3PFKA 3VOTA 2C8LA 2J0EA 7GPBA 2A3NA 1M8PA 4Q1BA 1PZNA 4GHWA 4BWYA 1ZONA 2HF8A 5CFPA 1OAAA 3RVDA 3VU9A 2PN1A 1Z0AA 3AHGA 1Y37A 2ANCA 3FPCA 3N70A 3DF7A 3OJOA 1Q14A 2QR2A 1R7RA 4YP0A 5JCOC 2YQZA 1Y5IA 4MV6A 5J1TB 5TS2A 5EUMA 2WMYA 3F3YA 5FOQA 1CWUA 4N03A 1XKTA 1R27A 1BW9A 5ALPA 3KUXA 4WK4B 5COQA 2PGJA 4B9AA 1P9WA 3IALA 4ARBA 2PAFA 2LXNA 3F7OA 1YQXA 4UTZA 2CLDX 1JA9A 4I7EA 2AKEA 3PUHA 3EGEA 4Q4HA 5BN4B 2IU0A 3H05A 1EE9A 1QV9A 4Q7MB 3HPRA 3CUSA 3GUHA 4W1QA 5BVHB 4WECA 5AKEA 2AXEA 4KFCA 2DOKA 1KORA 1YDHA 4F9TA 2O8EB 4TTIA 1E1DA 5L4NA 2P1RA 1WU7A 4RABA 3UJPA 1FDIA 4MMXB 4UUBA 1KEEA 3PTAA 5K4AA 3TAXA 1SXJC 1VJTA 3CRW1 1KYYA 4BY9E 1E2QA 1JXAA 2IU4A 3CONA 3W5UA 4Q1DA 2MYNA 4UTRA 3PJEA 3EDMA 1RXWA 3H65A 1Q11A 1O3YA 3FSRA 1TCCA 3RLIA 4BO4A 5DBHX 1NDQA 2ERXA 3HXTA 2Y9PB 3ROGA 1T4GA 1Z28A 1LDMA 3CO0S 5DO9A 4XSVA 2IPXA 4LDZA 5KOIA 2V1XA 2RI0A 4HWOA 2C9CA 4G0ZA 4KK3A 5TDHA 3MRXA 4O4JA 5EJAA 2ZTHA 1KY3A 1JKJA 2DU8A 1D7AA 2R8OA 4YP9A 1QFMA 1PD0A 1P7ZA 1SKAA 3NUQA 4KXVA 1NIJA 4UUQA 4QREA 5GV8A 1A7KA 4JD5A 3M4YA 4CM8B 4LMRA 3Q7QA 1IOZA 5SZKB 2H11A 4R1UA 4WJLA 2DPMA 4MICA 1DAOA 1N2CB 4OB8A 3LVBA 2G80A 4LE2A 2ZUCA 3QXGA 4F7DA 2FFHA 3WI7A 3CLTD 2DHQA 2EP8A 1AKTA 3ZXYA 2H8GA 3O82A 5K51A 2Q2VA 3C5HA 3P4UA 4GS5A 2QAIA 4XRGA 2VDNB 2KMLA 2VH1A 4PLPA 3JWIA 3TZBA 1GZUA 4CLDA 4JBXA 1XPUA 5KINB 1L4EA 1PVVA 3KOUA 1PTKA 4JKIA 4K28A 1TVKA 3EIEA 4RH1A 4XI9A 3AEQB 2HIHA 4M3NA 4V3CA 1KERA 2ALJA 3TE7A 1SCUA 3TVTA 3CZCA 4ALJA 2HIMA 2F55A 1HLGA 4OHKA 1OH6A 3RC3A 1YQ9A 2C83A 3M83A 3DMPA 4QTXA 1YUMA 3HFJA 2BISA 3SKXA 3C3EA 3PUYA 4JU9A 3QU5A 4A6EA 1YC2A 3ENWA 3GJ5A 2Y1CA 4UEWA 2XHEA 1G6KA 4ZK2A 1X1TA 4DSTA 2H2AA 3OEEA 2PG3A 3GZ4A 4ENPA 4CKEB 3FROA 4H4EA 4BXOB 1GUDA 2BFBB 2WE8A 3JQDA 3FVRA 4XQGA 3BE8A 4PQEA 4BASA 5GJBA 4MMYB 3BD8A 3T3PB 4CXMA 4NEHB 3N8DA 3AF0A 5CTAA 1XB2A 3HYRA 1PFQA 3EGVA 1F1JA 5BXYA 4H6XA 2F8MA 5H59A 4F3RA 4IMRA 1QGUA 2QRVB 2ZBRA 2EC5A 2AMFA 4R6WA 1EX7A 1U2GA 1Z7EA 5BMOA 4WNCA 3E15A 1OH8A 3EMDA 4ZVTA 2BSAA 1SOUA 4RHFA 4B87A 3L0OA 2IYSA 1RQ2A 1TM2A 4CDRA 2AHRA 5BMVA 3PPIA 4Y2XA 1JHMA 1QH1A 4IOMA 3H2HA 4Y9DA 1V41E 4UPDA 1U8CB 2QTRA 3MBOA 4KDFA 4CHTA 4UUAA 2MSLA 3T9BA 1Y89A 2Y66A 4IDGA 1VTKA 2R84A 1K7CA 1UJ5A 4PLWA 3L18A 5FO1A 1KJ9A 3IUNA 3KQYA 1FNDA 5IFLA 5LQCA 4MUXA 1GQRA 2F00A 2MU1A 2HEIA 3OPVA 4G4JA 3P2EA 2P8JA 3F9IA 5J47A 3FUWA 1YBAA 2BLLA 5JFGA 3KP1A 1U1FA 4A23A 2GPYA 2PA0A 2Y1DA 4B3CA 1MB3A 1ZY2A 1E98A 1FOEB 1GA6A 1M1XB 1R50A 1M6VB 2IHBA 4HGZA 3AJRA 1KNQA 2JCXA 3SQDA 3PJFA 2P78A 3DFIA 3W0LB 1G59A 2R6R1 3U44B 5JAPA 3WLLA 5HPYB 2WTUA 3FYDA 1W87A 1NRXA 1HNNA 1WMAA 3B36A 3L8HA 4RZSA 2B9VA 2VTVA 3RC9A 2ST1A 2H17A 1RQNA 2YHIA 3H5IA 4ISCA 3X2FA 4XJVA 1JXQA 3MUNA 4WFKA 4Y1RB 2IYOA 2L19A 3IURA 5FOVA 5MGBA 5C0OE 2GJKA 4DPKA 1AV6A 1OR8A 2CDCA 4OUDA 2Q6OA 1XEXB 4PZPA 1IULA 4R8KA 2PLRA 5JZOA 4KR0A 3G8BA 1YQGA 5HUQA 5JECA 3WIUA 3D8NA 5DCWA 2Y6VA 2X9LA 4Q1VA 3T7SA 5ARDA 1CDOA 1HL7A 4U7GA 1CUZA 1C4WA 2RGNC 2QN3A 3TX6A 5A5FA 4I9FA 3QLEA 3NPAA 2V0GA 5EIBC 3WWEA 1D8TA 2HQOA 1QUEA 2ZG6A 2GJ4A 3D9QX 1FRNA 3O4JA 4UJ3A