1N1JB

Crystal structure of the nf-yb/nf-yc histone pair
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
78
structure length
78
Chain Sequence
b'LPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NF-YB
publication title The NF-YB/NF-YC structure gives insight into DNA binding and transcription regulation by CCAAT factor NF-Y
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 24
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2002-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1n1jB00
3KUYD 3AV1C 2PYOD 3W96C 3C1BD 1Q9CA 5CPJA 3MNNB 5B24A 4UUZB 5JA4B 3AFAB 3MGQB 4WU9C 3R45A 3A6NB 4ZUXB 5AV5B 1P3ID 4R8PD 4JJND 1BFMA 1P34C 3MGSC 5B32C 5GT3A 4Z66C 5GSUC 5CPJD 4G91B 5B24D 1S32C 1KX4A 3V9RB 3KWQC 5KDMB 5AV6C 1KX5A 1TAFA 1P3AC 1AOIA 3AZFC 4KGCD 5B2JA 5GT3D 3UTAB 3REIA 2F8NB 3KSYA 4YM6C 4KUDC 1P3FB 5B1LB 5B33B 4YS3C 3WTPC 1U35C 1KX5D 4H9SA 2AROC 3REJB 3NQJA 4H9PB 1AOID 5CPKA 3WAAB 5B2JD 4EO5B 4G92C 1KU5A 3REID 5AVCA 3X1UB 2IO5C 4KHAB 3AZMA 4Z5TC 1F66A 1P3BB 1M18A 3WKJB 5B40B 3REHA 3AZLB 5F99B 3MGRB 5CPKD 3AZGA 3KUYC 1P3KB 3WA9C 1BH9A 5AVCD 3MVDB 3AZHA 3C1BC 3NQUB 3X1SC 3AZMD 1HQ3B 3X1VB 1F66D 1KX3B 3LZ1A 1M18D 3AV1A 3TU4C 5AY8B 3REHD 1P3IC 4R8PC 4J8XC 4JJNC 3AZGD 2CV5B 5AVBB 4WU9A 4QLCA 2HUEC 2PYOB 3AZHD 2F8NG 3VH6A 5BO0B 1R4VA 4J8VA 1P3PA 3LZ1D 1JFIA 4WNNB 5E5AB 4KGCC 2NQBC 1S32A 4WU9D 4QLCD 3MGPA 1M1AC 5AV6A 5GXQD 5B1MA 2YFWB 5CPJB 4J8VD 5B24B 1N1JA 1P3AA 1P3PD 3AZFA 3LJAC 3W97B 5B2IB 4WU8A 5B2JC 1S32D 5GT3B 4YM6A 3O62A 3MGPD 4DRBA 3REIC 3AZJA 3WTPA 4YS3A 2NZDC 5AV8B 5AV6D 5B1MD 2AROA 1P3AD 3AZFD 1KX4B 1TZYB 3AZIB 1ZLAB 3AN2B 4WU8D 1KX5B 1TAFB 5CPKC 1P3LA 1EQZC 4YM6D 5AV9C 3O62D 3VH5A 3AZJD 1M19D 4WZSB 3WTPD 4YS3D 3B6GA 5B31D 2AROD 2HIOB 1M18C 3X1TC 3WA9A 1H3OA 4H9RB 1P3LD 3X1SA 3W98B 3AZGC 3B6GD 5AVCB 3AZHC 3TU4A 4J8WA 4XZQB 4M6BA 3AZEA 5BT1D 4J8XA 3AZMB 4AWLC 1F66B 3AV2A 3LZ1C 5GT0A 3WA9D 3REHB 3AZKB 4NFTA 3X1SD 3AZNC 5JRGC 4QLCC 3KXBA 1P3OA 3TU4D 4J8WD 4XUJB 5GXQC 3AZED 2YFVB 4J8XD 4J8VC 1P3PC 3AV2D 3WTPE 2FJ7A 2NQBA 4KGCA 5GT0D 3AV1B 3W96B 5C3IC 4J8UD 1M1AA 3KXBD 3MGPC 1P3OD 3LJAA 5B1MC 2FJ7D 2NQBD 1P34B 5B0ZA 3MGSB 5B32B 4HGAC 3B0DC 4Z66B 5FUGB 2NZDA 4WU8C 1M1AD 5GSUB 2BYMB 1S32B 3O62C 3AZJC 5BNXB 4NE5A 1M19C 3KWQB 3LJAD 1P3MA 5AV6B 5B31C 3W99C 1P3AB 2F8NK 4H9QA 3C1CA 3AZFB 5CP6C 5B0ZD 1EQZA 3LZ0C 5AV9A 2NZDD 1P3LC 5B0YC 2BYKA 4LD9A 4YM6B 1ID3A 3B6GC 4EO5C 4KUDB 1P3MD 4YS3B 3X1TA 1U35B 1HTAA 5CPIA 3REKA 2AROB 5BT1C 3C1CD 1EQZD 4X23A 5AV9D 5DNMA 1P3BC 4LD9D 2IO5B 3B6FA 1ID3D 4Z5TB 3RELB 3AYWA 4H9OA 3UTBD 3X1TD 4J8WC 5CPID 4CSRA 3REKD 3AZEC 4X23D 3AV2C 3AZNA 1HQ3C 5JRGA 5GT0C 5DNMD 5B32G 3KUYB 3WA9B 4J8UC 3C1BB 1F1EA 3X1SB 5GXQA 4ZBJC 3B6FD 5CHLB 3MNNA 3KXBC 3AYWD 1P3OC 4UUZA 3AFAA 3MGQA 3TU4B 1P3IB 5AV5A 4R8PB 4H9NB 4J8XB 4JJNB 3AZND 5JRGD 2FJ7C 2HUEB 5BNVA 1B67A 3MNND 3AFAD 3R45B 3MGQD 3V9RA 5AV5D 4KGCB 5B0ZC 2NQBB 3UTAA 1M19A 1M1AB 5B31A 4CAYA 3W99A 5CP6A 1P3MC 3LZ0A 2CWEA 5B1LA 3B0CT 3LJAB 5B33A 1P3FA 4WV4B 3UT9C 1AOIB 3C1CC 5B0YA 3REJA 4H9PA 5B2JB 3WAAA 3UTAD 3REIB 3AZIC 2NZDB 2F8ND 4LD9C 3W99D 1ID3C 5G49A 4KHAA 5CP6D 3LZ0D 3UTBC 1P3FD 5B1LD 1P3GC 5B33D 4E44A 5CPIC 3REKC 1P3BA 3WKJA 3NQJB 3AZLA 5B0YD 4X23C 4H9QB 3MGRA 3REJD 5CPKB 5DNNC 3WAAD 5DNMC 5AV9B 3MVDA 3X1UD 2BYKB 3B6FC 3VH5T 3AYWC 1HQ3A 3X1VA 1M18B 1BH8A 3X1TB 1KX3A 1P3BD 3WKJD 3LELC 4J8UA 5AY8A 5B40D 3AZLD 3MGRD 2LY8A 3AZGB 2CV5A 4Z2MH 1BH9B 3AZHB 3MVDD 3AZKC 3MNNC 4AWLB 1HQ3D 3X1VD 3AFAC 3LZ1B 3MGQC 1KX3D 5BS7C 5AY8D 4ZUXC 3A6NC 5AV5C 4WNNA 5E5AA 5JRGB 2CV5D 4WU9B 3B0CW 4QLCB 5AVBD 5GXQB 4J8VB 4G91C 1P3PB 2YFWA 1JFIB 3W97A 5C3IB 5B2IA 5E5AD 2L5AA 3UTAC 3MGPB 5BNVB 5B1MB 5AV8A 3UT9A 1N1JB 1P3FC 4HGAB 5B1LC 3B0DB 5B33C 1TZYA 3W97D 3AZIA 5B2ID 4WU8B 3VH5W 1ZLAA 3AN2A 3REJC 3WAAC 3O62B 3AZJB 1M19B 3WTPB 3UTBA 1P3GA 5B31B 4NE3A 4CAYB 5AV8D 3X1UC 3UT9D 3W99B 5CP6B 5DNNA 4G92B 2HIOA 3LZ0B 1KX4D 1TZYD 2RVQD 3AZID 3WKJC 5B40C 1ZLAD 3AZLC 5F99C 3MGRC 3AN2D 1P3LB 4H9RA 5B0YB 3W98A 3B6GB 1P3KC 1P3GD 3MVDC 1WWSA 3LELA 4XZQA 5G49B 3X1VC 5DNND 2HIOD 3RELC 1KX3C 1H3OB 5AY8C 3AZKA 3W98D 2CV5C 5AVBC 5JA4A 2PYOC 5BS7A 4J8WB 3LELD 3A6NA 4ZUXA 3AZEB 4E45A 4XUJA 4XZQD 3AV2B 2YFVA 5GT0B 1BH8B 1A7WA 4J8UB 3W96A 5E5AC 4NE6A 3AZKD 4ZBJB 3KXBB 1P3OB 3VH6T 5KDMA 3A6ND 4ZUXD 5B31G 4XUJD 5CPJC 2FJ7B 5B24C 1ULYA 1P34A 3MGSA 5B32A 3AV1D 3W97C 4Z66A 5B2IC 5FUGA 2F8NA 3W96D 5GSUA 2BYMA 5GT3C 5BNXA 3KWQA 5AV8C 2F8NH 2JSSA 5B0ZB 1P34D 1KX4C 3MGSD 5B32D 1TZYC 2RVQC 4Z66D 1ZLAC 3AN2C 1KX5C 3X1UA 5GSUD 1AOIC 1P3MB 4DRAA 4KUDA 3KWQD 1WWIA 1U35A 5B40A 3UT9B 5F99A 3C1CB 1EQZB 4Z2MG 2HIOC 1P3KA 4H9SC 4LD9B 3NQUA 3W98C 1ID3B 3B0BA 1B6WA 4Z5TA 3RELA 3UTBB 4KUDD 1P3GB 5AVCC 5CPIB 3REKB 1U35D 5F99D 4XZQC 4X23B 3AZMC 1F66C 5DNNB 3VH6W 5DNMB 5AVBA 1P3KD 3KUYA 2PYOA 3REHC 3C1BA 5BO0A 3B6FB 3AYWB 4H9OB 4Z5TD 3RELD 4CSRB 3LELB 4XUJC 3AZNB 1P3IA 4R8PA 4JJNA 4H9NA
chains in the Genus database with same CATH superfamily
3KUYD 3AV1C 2PYOD 3W96C 3C1BD 1Q9CA 2Y2OA 5CPJA 3MNNB 5B24A 4UUZB 5JA4B 3AFAB 3MGQB 4WU9C 3R45A 3A6NB 4ZUXB 5AV5B 1P3ID 4R8PD 4JJND 1BFMA 1P34C 3MGSC 5B32C 5GT3A 4Z66C 1W2EA 5GSUC 5CPJD 4G91B 5B24D 1S32C 3AL0C 1KX4A 3V9RB 3KWQC 5KDMB 5AV6C 2FFFB 1KX5A 1TAFA 1P3AC 1AOIA 3AZFC 4KGCD 5B2JA 5GT3D 3UTAB 2JCHA 3REIA 2F8NB 3KSYA 3EG5B 4YM6C 4KUDC 1P3FB 5B1LB 5B33B 4YS3C 3WTPC 1U35C 1KX5D 4H9SA 2AROC 3REJB 3NQJA 4H9PB 1AOID 5CPKA 3WAAB 5B2JD 4EO5B 4G92C 1KU5A 3REID 5AVCA 3X1UB 2IO5C 4KHAB 3AZMA 4Z5TC 1F66A 1P3BB 1M18A 3WKJB 5B40B 3REHA 3AZLB 5F99B 3MGRB 5CPKD 3AZGA 3KUYC 1P3KB 3WA9C 1BH9A 5AVCD 3MVDB 3AZHA 3C1BC 3NQUB 3X1SC 3AZMD 1HQ3B 3X1VB 1F66D 1KX3B 3LZ1A 1M18D 3AV1A 3TU4C 5AY8B 3REHD 1P3IC 4R8PC 4J8XC 4JJNC 3AZGD 2CV5B 5AVBB 4WU9A 4QLCA 2HUEC 2PYOB 3AZHD 2F8NG 3VH6A 5BO0B 1R4VA 4J8VA 1P3PA 2Y2JA 3LZ1D 1JFIA 4WNNB 5E5AB 4KGCC 2NQBC 1S32A 3KFUG 4WU9D 4QLCD 3MGPA 1M1AC 5AV6A 5GXQD 5B1MA 2YFWB 5CPJB 4J8VD 5B24B 1N1JA 1P3AA 1P3PD 3AZFA 2XD1A 3LJAC 3W97B 5B2IB 4WU8A 5B2JC 1S32D 5GT3B 4YM6A 3O62A 3MGPD 4DRBA 3REIC 3AZJA 3WTPA 4YS3A 2NZDC 5AV8B 5AV6D 5B1MD 2AROA 1P3AD 3AZFD 1KX4B 1TZYB 3AZIB 1ZLAB 3AN2B 4WU8D 1KX5B 1TAFB 5CPKC 1P3LA 1EQZC 4YM6D 5AV9C 3O62D 3VH5A 3AZJD 1M19D 4WZSB 3WTPD 4YS3D 3B6GA 5B31D 2AROD 3FDDA 2HIOB 2Y2PA 1M18C 3A1KA 2DQNC 3X1TC 3WA9A 1H3OA 4H9RB 1P3LD 3X1SA 3W98B 3AZGC 3B6GD 5AVCB 3AZHC 2ZY3A 3TU4A 4J8WA 4XZQB 4M6BA 3AZEA 5BT1D 4J8XA 3AZMB 4AWLC 1F66B 3AV2A 3LZ1C 5GT0A 3WA9D 3REHB 3AZKB 4NFTA 3X1SD 3AZNC 5JRGC 4QLCC 3KXBA 1P3OA 1Z2CB 3TU4D 4J8WD 2Y2HA 4XUJB 5GXQC 3AZED 2YFVB 4J8XD 4J8VC 1P3PC 3AV2D 3WTPE 2FJ7A 2NQBA 4KGCA 5GT0D 3AV1B 3W96B 5C3IC 4J8UD 2JE5A 1M1AA 3KXBD 3MGPC 1P3OD 3LJAA 3EPKA 5B1MC 3P5JB 2FJ7D 2NQBD 1P34B 5B0ZA 3MGSB 5B32B 4HGAC 3B0DC 4Z66B 5FUGB 2NZDA 4WU8C 1M1AD 5GSUB 2BYMB 1S32B 3O62C 3AZJC 5BNXB 4NE5A 1M19C 3KWQB 3LJAD 1P3MA 5AV6B 5B31C 3W99C 1P3AB 2F8NK 4H9QA 3C1CA 3AZFB 5CP6C 5B0ZD 1EQZA 3LZ0C 5AV9A 2NZDD 2ZY4A 1P3LC 2G5HC 5B0YC 2BYKA 4LD9A 3H0LC 4YM6B 1ID3A 3B6GC 4EO5C 4KUDB 1P3MD 4YS3B 3X1TA 1U35B 1HTAA 2J8PA 4WJ3C 5CPIA 3REKA 2AROB 5BT1C 3EPHA 3C1CD 1EQZD 4X23A 5AV9D 5DNMA 1P3BC 4LD9D 2IO5B 3B6FA 1ID3D 4Z5TB 4DQYB 3RELB 2BG1A 4H9OA 3AYWA 3UTBD 3X1TD 4J8WC 5CPID 4CSRA 3REKD 3AZEC 4X23D 3AV2C 3AZNA 1HQ3C 5JRGA 5GT0C 5DNMD 5B32G 3KUYB 3WA9B 4J8UC 3C1BB 1F1EA 3X1SB 5GXQA 4ZBJC 3B6FD 5CHLB 3MNNA 3KXBC 3AYWD 1P3OC 4UUZA 3AFAA 2Y2IA 3MGQA 3TU4B 1P3IB 2UWXA 5AV5A 4R8PB 4H9NB 4J8XB 4JJNB 2ZY2A 5JRGD 3AZND 2FJ7C 2HUEB 5BNVA 1B67A 3MNND 3AFAD 3R45B 3MGQD 3V9RA 5AV5D 2Y2QA 5B0ZC 4KGCB 2NQBB 2XD5A 3UTAA 1M19A 1M1AB 5B31A 4CAYA 3W99A 5CP6A 1P3MC 3LZ0A 2CWEA 5B1LA 3B0CT 3LJAB 5B33A 1P3FA 4WV4B 3UT9C 1AOIB 3C1CC 5B0YA 3REJA 4H9PA 5B2JB 3WAAA 3UTAD 3REIB 3AZIC 2NZDB 2F8ND 4LD9C 3W99D 1ID3C 5G49A 4KHAA 5CP6D 3LZ0D 3UTBC 1P3FD 5B1LD 1P3GC 5B33D 4E44A 5CPIC 3REKC 1P3BA 3WKJA 3NQJB 3AZLA 5B0YD 4X23C 4H9QB 3MGRA 3REJD 5CPKB 5DNNC 3WAAD 5DNMC 5AV9B 3IP4C 3MVDA 3X1UD 2BYKB 3B6FC 3VH5T 3AYWC 1HQ3A 3X1VA 1M18B 1BH8A 3X1TB 1KX3A 1P3BD 3WKJD 3LELC 4J8UA 5AY8A 5B40D 2ZM5A 3MGRD 2LY8A 3AZLD 2DF4C 3AZGB 2CV5A 4Z2MH 1BH9B 3AZHB 3MVDD 1T3UA 3AZKC 3MNNC 4AWLB 1HQ3D 3X1VD 3AFAC 3LZ1B 3MGQC 1KX3D 5BS7C 5AY8D 4ZUXC 3A6NC 5AV5C 4WNNA 5E5AA 5JRGB 2CV5D 4WU9B 3B0CW 4QLCB 5AVBD 5GXQB 4J8VB 4G91C 1P3PB 2YFWA 2Y2KA 1JFIB 3W97A 5C3IB 5B2IA 5E5AD 2L5AA 3UTAC 3MGPB 5BNVB 5B1MB 5AV8A 3UT9A 1N1JB 1P3FC 4HGAB 5B1LC 3B0DB 5B33C 1TZYA 3W97D 3AZIA 3EPJA 5B2ID 4WU8B 3VH5W 1ZLAA 3AN2A 3REJC 3WAAC 3O62B 3AZJB 1M19B 3WTPB 3UTBA 1P3GA 5B31B 4NE3A 4CAYB 5AV8D 3X1UC 3UT9D 3W99B 5CP6B 5DNNA 4G92B 2HIOA 2VQRA 3LZ0B 1KX4D 1TZYD 2RVQD 3AZID 3WKJC 5B40C 1ZLAD 3AZLC 5F99C 3MGRC 3AN2D 1P3LB 4H9RA 5B0YB 3W98A 3B6GB 1P3KC 1P3GD 3MVDC 1WWSA 2F2AC 2RIQA 3LELA 3A1IA 4XZQA 2Y2NA 5G49B 3X1VC 5DNND 2HIOD 3RELC 1KX3C 1H3OB 5AY8C 3AZKA 3W98D 2CV5C 5AVBC 5JA4A 2PYOC 5BS7A 4J8WB 3LELD 3A6NA 4ZUXA 3EPLA 3AZEB 4E45A 4XUJA 4XZQD 3AV2B 2YFVA 5GT0B 1BH8B 1A7WA 3H0MC 4J8UB 3W96A 5E5AC 4NE6A 3AZKD 4ZBJB 3KXBB 1P3OB 3VH6T 5KDMA 3A6ND 4ZUXD 5B31G 4XUJD 5CPJC 2FJ7B 5B24C 1ULYA 1P34A 3MGSA 5B32A 3AV1D 3W97C 4Z66A 3H0RC 5B2IC 5FUGA 2F8NA 3W96D 5GSUA 2BYMA 5GT3C 1PZRA 5BNXA 3KWQA 5AV8C 2W8SA 2F8NH 2Y2MA 2JSSA 5B0ZB 1P34D 1KX4C 3MGSD 5B32D 1TZYC 2RVQC 4Z66D 1ZLAC 4UPKA 3AN2C 1KX5C 3X1UA 5GSUD 1AOIC 2ZY5A 1P3MB 4DRAA 4KUDA 3KWQD 1WWIA 1U35A 5B40A 3UT9B 5F99A 2Y2GA 3C1CB 4Z2MG 1EQZB 2HIOC 1P3KA 4H9SC 4LD9B 3F6TA 3NQUA 3W98C 1ID3B 3B0BA 1B6WA 4Z5TA 3RELA 3UTBB 4KUDD 1P3GB 5AVCC 5CPIB 3REKB 1U35D 5F99D 4XZQC 4X23B 3AZMC 1F66C 5DNNB 3VH6W 5DNMB 5AVBA 1P3KD 3KUYA 2PYOA 3REHC 3C1BA 5BO0A 3B6FB 2Y2LA 3AYWB 4H9OB 4Z5TD 3RELD 4CSRB 2G5IC 3LELB 4XUJC 3AZNB 1P3IA 4R8PA 4JJNA 4H9NA
chains in the Genus database with same CATH topology
3KUYD 3AV1C 2PYOD 3W96C 3C1BD 1Q9CA 2Y2OA 5CPJA 3MNNB 5B24A 4UUZB 5JA4B 3AFAB 3MGQB 4WU9C 3R45A 3A6NB 4ZUXB 5AV5B 1P3ID 4R8PD 4JJND 1BFMA 1P34C 3MGSC 5B32C 5GT3A 4Z66C 1W2EA 5GSUC 5CPJD 4G91B 5B24D 1S32C 3AL0C 1KX4A 3V9RB 3KWQC 5KDMB 5AV6C 2FFFB 1KX5A 1TAFA 1P3AC 1AOIA 3AZFC 4KGCD 5B2JA 5GT3D 3UTAB 2JCHA 3REIA 2F8NB 3KSYA 3EG5B 4YM6C 4KUDC 1P3FB 5B1LB 5B33B 4YS3C 3WTPC 1U35C 1KX5D 4H9SA 2AROC 3REJB 3NQJA 4H9PB 1AOID 5CPKA 3WAAB 5B2JD 4EO5B 4G92C 1KU5A 3REID 5AVCA 3X1UB 2IO5C 4KHAB 3AZMA 4Z5TC 1F66A 1P3BB 1M18A 3WKJB 5B40B 3REHA 3AZLB 5F99B 3MGRB 5CPKD 3AZGA 3KUYC 1P3KB 3WA9C 1BH9A 5AVCD 3MVDB 3AZHA 3C1BC 3NQUB 3X1SC 3AZMD 1HQ3B 3X1VB 1F66D 1KX3B 3LZ1A 1M18D 3AV1A 3TU4C 5AY8B 3REHD 1P3IC 4R8PC 4J8XC 4JJNC 3AZGD 2CV5B 5AVBB 4WU9A 4QLCA 2HUEC 2PYOB 3AZHD 2F8NG 3VH6A 5BO0B 1R4VA 4J8VA 1P3PA 2Y2JA 3LZ1D 1JFIA 4WNNB 5E5AB 4KGCC 2NQBC 1S32A 3KFUG 4WU9D 4QLCD 3MGPA 1M1AC 5AV6A 5GXQD 5B1MA 2YFWB 5CPJB 4J8VD 5B24B 1N1JA 1P3AA 1P3PD 3AZFA 2XD1A 3LJAC 3W97B 5B2IB 4WU8A 5B2JC 1S32D 5GT3B 4YM6A 3O62A 3MGPD 4DRBA 3REIC 3AZJA 3WTPA 4YS3A 2NZDC 5AV8B 5AV6D 5B1MD 2AROA 1P3AD 3AZFD 1KX4B 1TZYB 3AZIB 1ZLAB 3AN2B 4WU8D 1KX5B 1TAFB 5CPKC 1P3LA 1EQZC 4YM6D 5AV9C 3O62D 3VH5A 3AZJD 1M19D 4WZSB 3WTPD 4YS3D 3B6GA 5B31D 2AROD 3FDDA 2HIOB 2Y2PA 1M18C 3A1KA 2DQNC 3X1TC 3WA9A 1H3OA 4H9RB 1P3LD 3X1SA 3W98B 3AZGC 3B6GD 5AVCB 3AZHC 2ZY3A 3TU4A 4J8WA 4XZQB 4M6BA 3AZEA 5BT1D 4J8XA 3AZMB 4AWLC 1F66B 3AV2A 3LZ1C 5GT0A 3WA9D 3REHB 3AZKB 4NFTA 3X1SD 3AZNC 5JRGC 4QLCC 3KXBA 1P3OA 1Z2CB 3TU4D 4J8WD 2Y2HA 4XUJB 5GXQC 3AZED 2YFVB 4J8XD 4J8VC 1P3PC 3AV2D 3WTPE 2FJ7A 2NQBA 4KGCA 5GT0D 3AV1B 3W96B 5C3IC 4J8UD 2JE5A 1M1AA 3KXBD 3MGPC 1P3OD 3LJAA 3EPKA 5B1MC 3P5JB 2FJ7D 2NQBD 1P34B 5B0ZA 3MGSB 5B32B 4HGAC 3B0DC 4Z66B 5FUGB 2NZDA 4WU8C 1M1AD 5GSUB 2BYMB 1S32B 3O62C 3AZJC 5BNXB 4NE5A 1M19C 3KWQB 3LJAD 1P3MA 5AV6B 5B31C 3W99C 1P3AB 2F8NK 4H9QA 3C1CA 3AZFB 5CP6C 5B0ZD 1EQZA 3LZ0C 5AV9A 2NZDD 2ZY4A 1P3LC 2G5HC 5B0YC 2BYKA 4LD9A 3H0LC 4YM6B 1ID3A 3B6GC 4EO5C 4KUDB 1P3MD 4YS3B 3X1TA 1U35B 1HTAA 2J8PA 4WJ3C 5CPIA 3REKA 2AROB 5BT1C 3EPHA 3C1CD 1EQZD 4X23A 5AV9D 5DNMA 1P3BC 4LD9D 2IO5B 3B6FA 1ID3D 4Z5TB 4DQYB 3RELB 2BG1A 4H9OA 3AYWA 3UTBD 3X1TD 4J8WC 5CPID 4CSRA 3REKD 3AZEC 4X23D 3AV2C 3AZNA 1HQ3C 5JRGA 5GT0C 5DNMD 5B32G 3KUYB 3WA9B 4J8UC 3C1BB 1F1EA 3X1SB 5GXQA 4ZBJC 3B6FD 5CHLB 3MNNA 3KXBC 3AYWD 1P3OC 4UUZA 3AFAA 2Y2IA 3MGQA 3TU4B 1P3IB 2UWXA 5AV5A 4R8PB 4H9NB 4J8XB 4JJNB 2ZY2A 5JRGD 3AZND 2FJ7C 2HUEB 5BNVA 1B67A 3MNND 3AFAD 3R45B 3MGQD 3V9RA 5AV5D 2Y2QA 5B0ZC 4KGCB 2NQBB 2XD5A 3UTAA 1M19A 1M1AB 5B31A 4CAYA 3W99A 5CP6A 1P3MC 3LZ0A 2CWEA 5B1LA 3B0CT 3LJAB 5B33A 1P3FA 4WV4B 3UT9C 1AOIB 3C1CC 5B0YA 3REJA 4H9PA 5B2JB 3WAAA 3UTAD 3REIB 3AZIC 2NZDB 2F8ND 4LD9C 3W99D 1ID3C 5G49A 4KHAA 5CP6D 3LZ0D 3UTBC 1P3FD 5B1LD 1P3GC 5B33D 4E44A 5CPIC 3REKC 1P3BA 3WKJA 3NQJB 3AZLA 5B0YD 4X23C 4H9QB 3MGRA 3REJD 5CPKB 5DNNC 3WAAD 5DNMC 5AV9B 3IP4C 3MVDA 3X1UD 2BYKB 3B6FC 3VH5T 3AYWC 1HQ3A 3X1VA 1M18B 1BH8A 3X1TB 1KX3A 1P3BD 3WKJD 3LELC 4J8UA 5AY8A 5B40D 2ZM5A 3MGRD 2LY8A 3AZLD 2DF4C 3AZGB 2CV5A 4Z2MH 1BH9B 3AZHB 3MVDD 1T3UA 3AZKC 3MNNC 4AWLB 1HQ3D 3X1VD 3AFAC 3LZ1B 3MGQC 1KX3D 5BS7C 5AY8D 4ZUXC 3A6NC 5AV5C 4WNNA 5E5AA 5JRGB 2CV5D 4WU9B 3B0CW 4QLCB 5AVBD 5GXQB 4J8VB 4G91C 1P3PB 2YFWA 2Y2KA 1JFIB 3W97A 5C3IB 5B2IA 5E5AD 2L5AA 3UTAC 3MGPB 5BNVB 5B1MB 5AV8A 3UT9A 1N1JB 1P3FC 4HGAB 5B1LC 3B0DB 5B33C 1TZYA 3W97D 3AZIA 3EPJA 5B2ID 4WU8B 3VH5W 1ZLAA 3AN2A 3REJC 3WAAC 3O62B 3AZJB 1M19B 3WTPB 3UTBA 1P3GA 5B31B 4NE3A 4CAYB 5AV8D 3X1UC 3UT9D 3W99B 5CP6B 5DNNA 4G92B 2HIOA 2VQRA 3LZ0B 1KX4D 1TZYD 2RVQD 3AZID 3WKJC 5B40C 1ZLAD 3AZLC 5F99C 3MGRC 3AN2D 1P3LB 4H9RA 5B0YB 3W98A 3B6GB 1P3KC 1P3GD 3MVDC 1WWSA 2F2AC 2RIQA 3LELA 3A1IA 4XZQA 2Y2NA 5G49B 3X1VC 5DNND 2HIOD 3RELC 1KX3C 1H3OB 5AY8C 3AZKA 3W98D 2CV5C 5AVBC 5JA4A 2PYOC 5BS7A 4J8WB 3LELD 3A6NA 4ZUXA 3EPLA 3AZEB 4E45A 4XUJA 4XZQD 3AV2B 2YFVA 5GT0B 1BH8B 1A7WA 3H0MC 4J8UB 3W96A 5E5AC 4NE6A 3AZKD 4ZBJB 3KXBB 1P3OB 3VH6T 5KDMA 3A6ND 4ZUXD 5B31G 4XUJD 5CPJC 2FJ7B 5B24C 1ULYA 1P34A 3MGSA 5B32A 3AV1D 3W97C 4Z66A 3H0RC 5B2IC 5FUGA 2F8NA 3W96D 5GSUA 2BYMA 5GT3C 1PZRA 5BNXA 3KWQA 5AV8C 2W8SA 2F8NH 2Y2MA 2JSSA 5B0ZB 1P34D 1KX4C 3MGSD 5B32D 1TZYC 2RVQC 4Z66D 1ZLAC 4UPKA 3AN2C 1KX5C 3X1UA 5GSUD 1AOIC 2ZY5A 1P3MB 4DRAA 4KUDA 3KWQD 1WWIA 1U35A 5B40A 3UT9B 5F99A 2Y2GA 3C1CB 4Z2MG 1EQZB 2HIOC 1P3KA 4H9SC 4LD9B 3F6TA 3NQUA 3W98C 1ID3B 3B0BA 1B6WA 4Z5TA 3RELA 3UTBB 4KUDD 1P3GB 5AVCC 5CPIB 3REKB 1U35D 5F99D 4XZQC 4X23B 3AZMC 1F66C 5DNNB 3VH6W 5DNMB 5AVBA 1P3KD 3KUYA 2PYOA 3REHC 3C1BA 5BO0A 3B6FB 2Y2LA 3AYWB 4H9OB 4Z5TD 3RELD 4CSRB 2G5IC 3LELB 4XUJC 3AZNB 1P3IA 4R8PA 4JJNA 4H9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KUY D;  3AV1 C;  2PYO D;  3W96 C;  3C1B D;  1Q9C A;  5CPJ A;  3MNN B;  5B24 A;  4UUZ B;  5JA4 B;  3AFA B;  3MGQ B;  4WU9 C;  3R45 A;  3A6N B;  4ZUX B;  5AV5 B;  1P3I D;  4R8P D;  4JJN D;  1BFM A;  1P34 C;  3MGS C;  5B32 C;  5GT3 A;  4Z66 C;  5GSU C;  5CPJ D;  4G91 B;  5B24 D;  1S32 C;  1KX4 A;  3V9R B;  3KWQ C;  5KDM B;  5AV6 C;  1KX5 A;  1TAF A;  1P3A C;  1AOI A;  3AZF C;  4KGC D;  5B2J A;  5GT3 D;  3UTA B;  3REI A;  2F8N B;  3KSY A;  4YM6 C;  4KUD C;  1P3F B;  5B1L B;  5B33 B;  4YS3 C;  3WTP C;  1U35 C;  1KX5 D;  4H9S A;  2ARO C;  3REJ B;  3NQJ A;  4H9P B;  1AOI D;  5CPK A;  3WAA B;  5B2J D;  4EO5 B;  4G92 C;  1KU5 A;  3REI D;  5AVC A;  3X1U B;  2IO5 C;  4KHA B;  3AZM A;  4Z5T C;  1F66 A;  1P3B B;  1M18 A;  3WKJ B;  5B40 B;  3REH A;  3AZL B;  5F99 B;  3MGR B;  5CPK D;  3AZG A;  3KUY C;  1P3K B;  3WA9 C;  1BH9 A;  5AVC D;  3MVD B;  3AZH A;  3C1B C;  3NQU B;  3X1S C;  3AZM D;  1HQ3 B;  3X1V B;  1F66 D;  1KX3 B;  3LZ1 A;  1M18 D;  3AV1 A;  3TU4 C;  5AY8 B;  3REH D;  1P3I C;  4R8P C;  4J8X C;  4JJN C;  3AZG D;  2CV5 B;  5AVB B;  4WU9 A;  4QLC A;  2HUE C;  2PYO B;  3AZH D;  2F8N G;  3VH6 A;  5BO0 B;  1R4V A;  4J8V A;  1P3P A;  3LZ1 D;  1JFI A;  4WNN B;  5E5A B;  4KGC C;  2NQB C;  1S32 A;  4WU9 D;  4QLC D;  3MGP A;  1M1A C;  5AV6 A;  5GXQ D;  5B1M A;  2YFW B;  5CPJ B;  4J8V D;  5B24 B;  1N1J A;  1P3A A;  1P3P D;  3AZF A;  3LJA C;  3W97 B;  5B2I B;  4WU8 A;  5B2J C;  1S32 D;  5GT3 B;  4YM6 A;  3O62 A;  3MGP D;  4DRB A;  3REI C;  3AZJ A;  3WTP A;  4YS3 A;  2NZD C;  5AV8 B;  5AV6 D;  5B1M D;  2ARO A;  1P3A D;  3AZF D;  1KX4 B;  1TZY B;  3AZI B;  1ZLA B;  3AN2 B;  4WU8 D;  1KX5 B;  1TAF B;  5CPK C;  1P3L A;  1EQZ C;  4YM6 D;  5AV9 C;  3O62 D;  3VH5 A;  3AZJ D;  1M19 D;  4WZS B;  3WTP D;  4YS3 D;  3B6G A;  5B31 D;  2ARO D;  2HIO B;  1M18 C;  3X1T C;  3WA9 A;  1H3O A;  4H9R B;  1P3L D;  3X1S A;  3W98 B;  3AZG C;  3B6G D;  5AVC B;  3AZH C;  3TU4 A;  4J8W A;  4XZQ B;  4M6B A;  3AZE A;  5BT1 D;  4J8X A;  3AZM B;  4AWL C;  1F66 B;  3AV2 A;  3LZ1 C;  5GT0 A;  3WA9 D;  3REH B;  3AZK B;  4NFT A;  3X1S D;  3AZN C;  5JRG C;  4QLC C;  3KXB A;  1P3O A;  3TU4 D;  4J8W D;  4XUJ B;  5GXQ C;  3AZE D;  2YFV B;  4J8X D;  4J8V C;  1P3P C;  3AV2 D;  3WTP E;  2FJ7 A;  2NQB A;  4KGC A;  5GT0 D;  3AV1 B;  3W96 B;  5C3I C;  4J8U D;  1M1A A;  3KXB D;  3MGP C;  1P3O D;  3LJA A;  5B1M C;  2FJ7 D;  2NQB D;  1P34 B;  5B0Z A;  3MGS B;  5B32 B;  4HGA C;  3B0D C;  4Z66 B;  5FUG B;  2NZD A;  4WU8 C;  1M1A D;  5GSU B;  2BYM B;  1S32 B;  3O62 C;  3AZJ C;  5BNX B;  4NE5 A;  1M19 C;  3KWQ B;  3LJA D;  1P3M A;  5AV6 B;  5B31 C;  3W99 C;  1P3A B;  2F8N K;  4H9Q A;  3C1C A;  3AZF B;  5CP6 C;  5B0Z D;  1EQZ A;  3LZ0 C;  5AV9 A;  2NZD D;  1P3L C;  5B0Y C;  2BYK A;  4LD9 A;  4YM6 B;  1ID3 A;  3B6G C;  4EO5 C;  4KUD B;  1P3M D;  4YS3 B;  3X1T A;  1U35 B;  1HTA A;  5CPI A;  3REK A;  2ARO B;  5BT1 C;  3C1C D;  1EQZ D;  4X23 A;  5AV9 D;  5DNM A;  1P3B C;  4LD9 D;  2IO5 B;  3B6F A;  1ID3 D;  4Z5T B;  3REL B;  3AYW A;  4H9O A;  3UTB D;  3X1T D;  4J8W C;  5CPI D;  4CSR A;  3REK D;  3AZE C;  4X23 D;  3AV2 C;  3AZN A;  1HQ3 C;  5JRG A;  5GT0 C;  5DNM D;  5B32 G;  3KUY B;  3WA9 B;  4J8U C;  3C1B B;  1F1E A;  3X1S B;  5GXQ A;  4ZBJ C;  3B6F D;  5CHL B;  3MNN A;  3KXB C;  3AYW D;  1P3O C;  4UUZ A;  3AFA A;  3MGQ A;  3TU4 B;  1P3I B;  5AV5 A;  4R8P B;  4H9N B;  4J8X B;  4JJN B;  3AZN D;  5JRG D;  2FJ7 C;  2HUE B;  5BNV A;  1B67 A;  3MNN D;  3AFA D;  3R45 B;  3MGQ D;  3V9R A;  5AV5 D;  4KGC B;  5B0Z C;  2NQB B;  3UTA A;  1M19 A;  1M1A B;  5B31 A;  4CAY A;  3W99 A;  5CP6 A;  1P3M C;  3LZ0 A;  2CWE A;  5B1L A;  3B0C T;  3LJA B;  5B33 A;  1P3F A;  4WV4 B;  3UT9 C;  1AOI B;  3C1C C;  5B0Y A;  3REJ A;  4H9P A;  5B2J B;  3WAA A;  3UTA D;  3REI B;  3AZI C;  2NZD B;  2F8N D;  4LD9 C;  3W99 D;  1ID3 C;  5G49 A;  4KHA A;  5CP6 D;  3LZ0 D;  3UTB C;  1P3F D;  5B1L D;  1P3G C;  5B33 D;  4E44 A;  5CPI C;  3REK C;  1P3B A;  3WKJ A;  3NQJ B;  3AZL A;  5B0Y D;  4X23 C;  4H9Q B;  3MGR A;  3REJ D;  5CPK B;  5DNN C;  3WAA D;  5DNM C;  5AV9 B;  3MVD A;  3X1U D;  2BYK B;  3B6F C;  3VH5 T;  3AYW C;  1HQ3 A;  3X1V A;  1M18 B;  1BH8 A;  3X1T B;  1KX3 A;  1P3B D;  3WKJ D;  3LEL C;  4J8U A;  5AY8 A;  5B40 D;  3AZL D;  3MGR D;  2LY8 A;  3AZG B;  2CV5 A;  4Z2M H;  1BH9 B;  3AZH B;  3MVD D;  3AZK C;  3MNN C;  4AWL B;  1HQ3 D;  3X1V D;  3AFA C;  3LZ1 B;  3MGQ C;  1KX3 D;  5BS7 C;  5AY8 D;  4ZUX C;  3A6N C;  5AV5 C;  4WNN A;  5E5A A;  5JRG B;  2CV5 D;  4WU9 B;  3B0C W;  4QLC B;  5AVB D;  5GXQ B;  4J8V B;  4G91 C;  1P3P B;  2YFW A;  1JFI B;  3W97 A;  5C3I B;  5B2I A;  5E5A D;  2L5A A;  3UTA C;  3MGP B;  5BNV B;  5B1M B;  5AV8 A;  3UT9 A;  1N1J B;  1P3F C;  4HGA B;  5B1L C;  3B0D B;  5B33 C;  1TZY A;  3W97 D;  3AZI A;  5B2I D;  4WU8 B;  3VH5 W;  1ZLA A;  3AN2 A;  3REJ C;  3WAA C;  3O62 B;  3AZJ B;  1M19 B;  3WTP B;  3UTB A;  1P3G A;  5B31 B;  4NE3 A;  4CAY B;  5AV8 D;  3X1U C;  3UT9 D;  3W99 B;  5CP6 B;  5DNN A;  4G92 B;  2HIO A;  3LZ0 B;  1KX4 D;  1TZY D;  2RVQ D;  3AZI D;  3WKJ C;  5B40 C;  1ZLA D;  3AZL C;  5F99 C;  3MGR C;  3AN2 D;  1P3L B;  4H9R A;  5B0Y B;  3W98 A;  3B6G B;  1P3K C;  1P3G D;  3MVD C;  1WWS A;  3LEL A;  4XZQ A;  5G49 B;  3X1V C;  5DNN D;  2HIO D;  3REL C;  1KX3 C;  1H3O B;  5AY8 C;  3AZK A;  3W98 D;  2CV5 C;  5AVB C;  5JA4 A;  2PYO C;  5BS7 A;  4J8W B;  3LEL D;  3A6N A;  4ZUX A;  3AZE B;  4E45 A;  4XUJ A;  4XZQ D;  3AV2 B;  2YFV A;  5GT0 B;  1BH8 B;  1A7W A;  4J8U B;  3W96 A;  5E5A C;  4NE6 A;  3AZK D;  4ZBJ B;  3KXB B;  1P3O B;  3VH6 T;  5KDM A;  3A6N D;  4ZUX D;  5B31 G;  4XUJ D;  5CPJ C;  2FJ7 B;  5B24 C;  1ULY A;  1P34 A;  3MGS A;  5B32 A;  3AV1 D;  3W97 C;  4Z66 A;  5B2I C;  5FUG A;  2F8N A;  3W96 D;  5GSU A;  2BYM A;  5GT3 C;  5BNX A;  3KWQ A;  5AV8 C;  2F8N H;  2JSS A;  5B0Z B;  1P34 D;  1KX4 C;  3MGS D;  5B32 D;  1TZY C;  2RVQ C;  4Z66 D;  1ZLA C;  3AN2 C;  1KX5 C;  3X1U A;  5GSU D;  1AOI C;  1P3M B;  4DRA A;  4KUD A;  3KWQ D;  1WWI A;  1U35 A;  5B40 A;  3UT9 B;  5F99 A;  3C1C B;  1EQZ B;  4Z2M G;  2HIO C;  1P3K A;  4H9S C;  4LD9 B;  3NQU A;  3W98 C;  1ID3 B;  3B0B A;  1B6W A;  4Z5T A;  3REL A;  3UTB B;  4KUD D;  1P3G B;  5AVC C;  5CPI B;  3REK B;  1U35 D;  5F99 D;  4XZQ C;  4X23 B;  3AZM C;  1F66 C;  5DNN B;  3VH6 W;  5DNM B;  5AVB A;  1P3K D;  3KUY A;  2PYO A;  3REH C;  3C1B A;  5BO0 A;  3B6F B;  3AYW B;  4H9O B;  4Z5T D;  3REL D;  4CSR B;  3LEL B;  4XUJ C;  3AZN B;  1P3I A;  4R8P A;  4JJN A;  4H9N A; 
#chains in the Genus database with same CATH topology
 3KUY D;  3AV1 C;  2PYO D;  3W96 C;  3C1B D;  1Q9C A;  2Y2O A;  5CPJ A;  3MNN B;  5B24 A;  4UUZ B;  5JA4 B;  3AFA B;  3MGQ B;  4WU9 C;  3R45 A;  3A6N B;  4ZUX B;  5AV5 B;  1P3I D;  4R8P D;  4JJN D;  1BFM A;  1P34 C;  3MGS C;  5B32 C;  5GT3 A;  4Z66 C;  1W2E A;  5GSU C;  5CPJ D;  4G91 B;  5B24 D;  1S32 C;  3AL0 C;  1KX4 A;  3V9R B;  3KWQ C;  5KDM B;  5AV6 C;  2FFF B;  1KX5 A;  1TAF A;  1P3A C;  1AOI A;  3AZF C;  4KGC D;  5B2J A;  5GT3 D;  3UTA B;  2JCH A;  3REI A;  2F8N B;  3KSY A;  3EG5 B;  4YM6 C;  4KUD C;  1P3F B;  5B1L B;  5B33 B;  4YS3 C;  3WTP C;  1U35 C;  1KX5 D;  4H9S A;  2ARO C;  3REJ B;  3NQJ A;  4H9P B;  1AOI D;  5CPK A;  3WAA B;  5B2J D;  4EO5 B;  4G92 C;  1KU5 A;  3REI D;  5AVC A;  3X1U B;  2IO5 C;  4KHA B;  3AZM A;  4Z5T C;  1F66 A;  1P3B B;  1M18 A;  3WKJ B;  5B40 B;  3REH A;  3AZL B;  5F99 B;  3MGR B;  5CPK D;  3AZG A;  3KUY C;  1P3K B;  3WA9 C;  1BH9 A;  5AVC D;  3MVD B;  3AZH A;  3C1B C;  3NQU B;  3X1S C;  3AZM D;  1HQ3 B;  3X1V B;  1F66 D;  1KX3 B;  3LZ1 A;  1M18 D;  3AV1 A;  3TU4 C;  5AY8 B;  3REH D;  1P3I C;  4R8P C;  4J8X C;  4JJN C;  3AZG D;  2CV5 B;  5AVB B;  4WU9 A;  4QLC A;  2HUE C;  2PYO B;  3AZH D;  2F8N G;  3VH6 A;  5BO0 B;  1R4V A;  4J8V A;  1P3P A;  2Y2J A;  3LZ1 D;  1JFI A;  4WNN B;  5E5A B;  4KGC C;  2NQB C;  1S32 A;  3KFU G;  4WU9 D;  4QLC D;  3MGP A;  1M1A C;  5AV6 A;  5GXQ D;  5B1M A;  2YFW B;  5CPJ B;  4J8V D;  5B24 B;  1N1J A;  1P3A A;  1P3P D;  3AZF A;  2XD1 A;  3LJA C;  3W97 B;  5B2I B;  4WU8 A;  5B2J C;  1S32 D;  5GT3 B;  4YM6 A;  3O62 A;  3MGP D;  4DRB A;  3REI C;  3AZJ A;  3WTP A;  4YS3 A;  2NZD C;  5AV8 B;  5AV6 D;  5B1M D;  2ARO A;  1P3A D;  3AZF D;  1KX4 B;  1TZY B;  3AZI B;  1ZLA B;  3AN2 B;  4WU8 D;  1KX5 B;  1TAF B;  5CPK C;  1P3L A;  1EQZ C;  4YM6 D;  5AV9 C;  3O62 D;  3VH5 A;  3AZJ D;  1M19 D;  4WZS B;  3WTP D;  4YS3 D;  3B6G A;  5B31 D;  2ARO D;  3FDD A;  2HIO B;  2Y2P A;  1M18 C;  3A1K A;  2DQN C;  3X1T C;  3WA9 A;  1H3O A;  4H9R B;  1P3L D;  3X1S A;  3W98 B;  3AZG C;  3B6G D;  5AVC B;  3AZH C;  2ZY3 A;  3TU4 A;  4J8W A;  4XZQ B;  4M6B A;  3AZE A;  5BT1 D;  4J8X A;  3AZM B;  4AWL C;  1F66 B;  3AV2 A;  3LZ1 C;  5GT0 A;  3WA9 D;  3REH B;  3AZK B;  4NFT A;  3X1S D;  3AZN C;  5JRG C;  4QLC C;  3KXB A;  1P3O A;  1Z2C B;  3TU4 D;  4J8W D;  2Y2H A;  4XUJ B;  5GXQ C;  3AZE D;  2YFV B;  4J8X D;  4J8V C;  1P3P C;  3AV2 D;  3WTP E;  2FJ7 A;  2NQB A;  4KGC A;  5GT0 D;  3AV1 B;  3W96 B;  5C3I C;  4J8U D;  2JE5 A;  1M1A A;  3KXB D;  3MGP C;  1P3O D;  3LJA A;  3EPK A;  5B1M C;  3P5J B;  2FJ7 D;  2NQB D;  1P34 B;  5B0Z A;  3MGS B;  5B32 B;  4HGA C;  3B0D C;  4Z66 B;  5FUG B;  2NZD A;  4WU8 C;  1M1A D;  5GSU B;  2BYM B;  1S32 B;  3O62 C;  3AZJ C;  5BNX B;  4NE5 A;  1M19 C;  3KWQ B;  3LJA D;  1P3M A;  5AV6 B;  5B31 C;  3W99 C;  1P3A B;  2F8N K;  4H9Q A;  3C1C A;  3AZF B;  5CP6 C;  5B0Z D;  1EQZ A;  3LZ0 C;  5AV9 A;  2NZD D;  2ZY4 A;  1P3L C;  2G5H C;  5B0Y C;  2BYK A;  4LD9 A;  3H0L C;  4YM6 B;  1ID3 A;  3B6G C;  4EO5 C;  4KUD B;  1P3M D;  4YS3 B;  3X1T A;  1U35 B;  1HTA A;  2J8P A;  4WJ3 C;  5CPI A;  3REK A;  2ARO B;  5BT1 C;  3EPH A;  3C1C D;  1EQZ D;  4X23 A;  5AV9 D;  5DNM A;  1P3B C;  4LD9 D;  2IO5 B;  3B6F A;  1ID3 D;  4Z5T B;  4DQY B;  3REL B;  2BG1 A;  4H9O A;  3AYW A;  3UTB D;  3X1T D;  4J8W C;  5CPI D;  4CSR A;  3REK D;  3AZE C;  4X23 D;  3AV2 C;  3AZN A;  1HQ3 C;  5JRG A;  5GT0 C;  5DNM D;  5B32 G;  3KUY B;  3WA9 B;  4J8U C;  3C1B B;  1F1E A;  3X1S B;  5GXQ A;  4ZBJ C;  3B6F D;  5CHL B;  3MNN A;  3KXB C;  3AYW D;  1P3O C;  4UUZ A;  3AFA A;  2Y2I A;  3MGQ A;  3TU4 B;  1P3I B;  2UWX A;  5AV5 A;  4R8P B;  4H9N B;  4J8X B;  4JJN B;  2ZY2 A;  5JRG D;  3AZN D;  2FJ7 C;  2HUE B;  5BNV A;  1B67 A;  3MNN D;  3AFA D;  3R45 B;  3MGQ D;  3V9R A;  5AV5 D;  2Y2Q A;  5B0Z C;  4KGC B;  2NQB B;  2XD5 A;  3UTA A;  1M19 A;  1M1A B;  5B31 A;  4CAY A;  3W99 A;  5CP6 A;  1P3M C;  3LZ0 A;  2CWE A;  5B1L A;  3B0C T;  3LJA B;  5B33 A;  1P3F A;  4WV4 B;  3UT9 C;  1AOI B;  3C1C C;  5B0Y A;  3REJ A;  4H9P A;  5B2J B;  3WAA A;  3UTA D;  3REI B;  3AZI C;  2NZD B;  2F8N D;  4LD9 C;  3W99 D;  1ID3 C;  5G49 A;  4KHA A;  5CP6 D;  3LZ0 D;  3UTB C;  1P3F D;  5B1L D;  1P3G C;  5B33 D;  4E44 A;  5CPI C;  3REK C;  1P3B A;  3WKJ A;  3NQJ B;  3AZL A;  5B0Y D;  4X23 C;  4H9Q B;  3MGR A;  3REJ D;  5CPK B;  5DNN C;  3WAA D;  5DNM C;  5AV9 B;  3IP4 C;  3MVD A;  3X1U D;  2BYK B;  3B6F C;  3VH5 T;  3AYW C;  1HQ3 A;  3X1V A;  1M18 B;  1BH8 A;  3X1T B;  1KX3 A;  1P3B D;  3WKJ D;  3LEL C;  4J8U A;  5AY8 A;  5B40 D;  2ZM5 A;  3MGR D;  2LY8 A;  3AZL D;  2DF4 C;  3AZG B;  2CV5 A;  4Z2M H;  1BH9 B;  3AZH B;  3MVD D;  1T3U A;  3AZK C;  3MNN C;  4AWL B;  1HQ3 D;  3X1V D;  3AFA C;  3LZ1 B;  3MGQ C;  1KX3 D;  5BS7 C;  5AY8 D;  4ZUX C;  3A6N C;  5AV5 C;  4WNN A;  5E5A A;  5JRG B;  2CV5 D;  4WU9 B;  3B0C W;  4QLC B;  5AVB D;  5GXQ B;  4J8V B;  4G91 C;  1P3P B;  2YFW A;  2Y2K A;  1JFI B;  3W97 A;  5C3I B;  5B2I A;  5E5A D;  2L5A A;  3UTA C;  3MGP B;  5BNV B;  5B1M B;  5AV8 A;  3UT9 A;  1N1J B;  1P3F C;  4HGA B;  5B1L C;  3B0D B;  5B33 C;  1TZY A;  3W97 D;  3AZI A;  3EPJ A;  5B2I D;  4WU8 B;  3VH5 W;  1ZLA A;  3AN2 A;  3REJ C;  3WAA C;  3O62 B;  3AZJ B;  1M19 B;  3WTP B;  3UTB A;  1P3G A;  5B31 B;  4NE3 A;  4CAY B;  5AV8 D;  3X1U C;  3UT9 D;  3W99 B;  5CP6 B;  5DNN A;  4G92 B;  2HIO A;  2VQR A;  3LZ0 B;  1KX4 D;  1TZY D;  2RVQ D;  3AZI D;  3WKJ C;  5B40 C;  1ZLA D;  3AZL C;  5F99 C;  3MGR C;  3AN2 D;  1P3L B;  4H9R A;  5B0Y B;  3W98 A;  3B6G B;  1P3K C;  1P3G D;  3MVD C;  1WWS A;  2F2A C;  2RIQ A;  3LEL A;  3A1I A;  4XZQ A;  2Y2N A;  5G49 B;  3X1V C;  5DNN D;  2HIO D;  3REL C;  1KX3 C;  1H3O B;  5AY8 C;  3AZK A;  3W98 D;  2CV5 C;  5AVB C;  5JA4 A;  2PYO C;  5BS7 A;  4J8W B;  3LEL D;  3A6N A;  4ZUX A;  3EPL A;  3AZE B;  4E45 A;  4XUJ A;  4XZQ D;  3AV2 B;  2YFV A;  5GT0 B;  1BH8 B;  1A7W A;  3H0M C;  4J8U B;  3W96 A;  5E5A C;  4NE6 A;  3AZK D;  4ZBJ B;  3KXB B;  1P3O B;  3VH6 T;  5KDM A;  3A6N D;  4ZUX D;  5B31 G;  4XUJ D;  5CPJ C;  2FJ7 B;  5B24 C;  1ULY A;  1P34 A;  3MGS A;  5B32 A;  3AV1 D;  3W97 C;  4Z66 A;  3H0R C;  5B2I C;  5FUG A;  2F8N A;  3W96 D;  5GSU A;  2BYM A;  5GT3 C;  1PZR A;  5BNX A;  3KWQ A;  5AV8 C;  2W8S A;  2F8N H;  2Y2M A;  2JSS A;  5B0Z B;  1P34 D;  1KX4 C;  3MGS D;  5B32 D;  1TZY C;  2RVQ C;  4Z66 D;  1ZLA C;  4UPK A;  3AN2 C;  1KX5 C;  3X1U A;  5GSU D;  1AOI C;  2ZY5 A;  1P3M B;  4DRA A;  4KUD A;  3KWQ D;  1WWI A;  1U35 A;  5B40 A;  3UT9 B;  5F99 A;  2Y2G A;  3C1C B;  4Z2M G;  1EQZ B;  2HIO C;  1P3K A;  4H9S C;  4LD9 B;  3F6T A;  3NQU A;  3W98 C;  1ID3 B;  3B0B A;  1B6W A;  4Z5T A;  3REL A;  3UTB B;  4KUD D;  1P3G B;  5AVC C;  5CPI B;  3REK B;  1U35 D;  5F99 D;  4XZQ C;  4X23 B;  3AZM C;  1F66 C;  5DNN B;  3VH6 W;  5DNM B;  5AVB A;  1P3K D;  3KUY A;  2PYO A;  3REH C;  3C1B A;  5BO0 A;  3B6F B;  2Y2L A;  3AYW B;  4H9O B;  4Z5T D;  3REL D;  4CSR B;  2G5I C;  3LEL B;  4XUJ C;  3AZN B;  1P3I A;  4R8P A;  4JJN A;  4H9N A; 
#chains in the Genus database with same CATH homology
 3KUY D;  3AV1 C;  2PYO D;  3W96 C;  3C1B D;  1Q9C A;  2Y2O A;  5CPJ A;  3MNN B;  5B24 A;  4UUZ B;  5JA4 B;  3AFA B;  3MGQ B;  4WU9 C;  3R45 A;  3A6N B;  4ZUX B;  5AV5 B;  1P3I D;  4R8P D;  4JJN D;  1BFM A;  1P34 C;  3MGS C;  5B32 C;  5GT3 A;  4Z66 C;  1W2E A;  5GSU C;  5CPJ D;  4G91 B;  5B24 D;  1S32 C;  3AL0 C;  1KX4 A;  3V9R B;  3KWQ C;  5KDM B;  5AV6 C;  2FFF B;  1KX5 A;  1TAF A;  1P3A C;  1AOI A;  3AZF C;  4KGC D;  5B2J A;  5GT3 D;  3UTA B;  2JCH A;  3REI A;  2F8N B;  3KSY A;  3EG5 B;  4YM6 C;  4KUD C;  1P3F B;  5B1L B;  5B33 B;  4YS3 C;  3WTP C;  1U35 C;  1KX5 D;  4H9S A;  2ARO C;  3REJ B;  3NQJ A;  4H9P B;  1AOI D;  5CPK A;  3WAA B;  5B2J D;  4EO5 B;  4G92 C;  1KU5 A;  3REI D;  5AVC A;  3X1U B;  2IO5 C;  4KHA B;  3AZM A;  4Z5T C;  1F66 A;  1P3B B;  1M18 A;  3WKJ B;  5B40 B;  3REH A;  3AZL B;  5F99 B;  3MGR B;  5CPK D;  3AZG A;  3KUY C;  1P3K B;  3WA9 C;  1BH9 A;  5AVC D;  3MVD B;  3AZH A;  3C1B C;  3NQU B;  3X1S C;  3AZM D;  1HQ3 B;  3X1V B;  1F66 D;  1KX3 B;  3LZ1 A;  1M18 D;  3AV1 A;  3TU4 C;  5AY8 B;  3REH D;  1P3I C;  4R8P C;  4J8X C;  4JJN C;  3AZG D;  2CV5 B;  5AVB B;  4WU9 A;  4QLC A;  2HUE C;  2PYO B;  3AZH D;  2F8N G;  3VH6 A;  5BO0 B;  1R4V A;  4J8V A;  1P3P A;  2Y2J A;  3LZ1 D;  1JFI A;  4WNN B;  5E5A B;  4KGC C;  2NQB C;  1S32 A;  3KFU G;  4WU9 D;  4QLC D;  3MGP A;  1M1A C;  5AV6 A;  5GXQ D;  5B1M A;  2YFW B;  5CPJ B;  4J8V D;  5B24 B;  1N1J A;  1P3A A;  1P3P D;  3AZF A;  2XD1 A;  3LJA C;  3W97 B;  5B2I B;  4WU8 A;  5B2J C;  1S32 D;  5GT3 B;  4YM6 A;  3O62 A;  3MGP D;  4DRB A;  3REI C;  3AZJ A;  3WTP A;  4YS3 A;  2NZD C;  5AV8 B;  5AV6 D;  5B1M D;  2ARO A;  1P3A D;  3AZF D;  1KX4 B;  1TZY B;  3AZI B;  1ZLA B;  3AN2 B;  4WU8 D;  1KX5 B;  1TAF B;  5CPK C;  1P3L A;  1EQZ C;  4YM6 D;  5AV9 C;  3O62 D;  3VH5 A;  3AZJ D;  1M19 D;  4WZS B;  3WTP D;  4YS3 D;  3B6G A;  5B31 D;  2ARO D;  3FDD A;  2HIO B;  2Y2P A;  1M18 C;  3A1K A;  2DQN C;  3X1T C;  3WA9 A;  1H3O A;  4H9R B;  1P3L D;  3X1S A;  3W98 B;  3AZG C;  3B6G D;  5AVC B;  3AZH C;  2ZY3 A;  3TU4 A;  4J8W A;  4XZQ B;  4M6B A;  3AZE A;  5BT1 D;  4J8X A;  3AZM B;  4AWL C;  1F66 B;  3AV2 A;  3LZ1 C;  5GT0 A;  3WA9 D;  3REH B;  3AZK B;  4NFT A;  3X1S D;  3AZN C;  5JRG C;  4QLC C;  3KXB A;  1P3O A;  1Z2C B;  3TU4 D;  4J8W D;  2Y2H A;  4XUJ B;  5GXQ C;  3AZE D;  2YFV B;  4J8X D;  4J8V C;  1P3P C;  3AV2 D;  3WTP E;  2FJ7 A;  2NQB A;  4KGC A;  5GT0 D;  3AV1 B;  3W96 B;  5C3I C;  4J8U D;  2JE5 A;  1M1A A;  3KXB D;  3MGP C;  1P3O D;  3LJA A;  3EPK A;  5B1M C;  3P5J B;  2FJ7 D;  2NQB D;  1P34 B;  5B0Z A;  3MGS B;  5B32 B;  4HGA C;  3B0D C;  4Z66 B;  5FUG B;  2NZD A;  4WU8 C;  1M1A D;  5GSU B;  2BYM B;  1S32 B;  3O62 C;  3AZJ C;  5BNX B;  4NE5 A;  1M19 C;  3KWQ B;  3LJA D;  1P3M A;  5AV6 B;  5B31 C;  3W99 C;  1P3A B;  2F8N K;  4H9Q A;  3C1C A;  3AZF B;  5CP6 C;  5B0Z D;  1EQZ A;  3LZ0 C;  5AV9 A;  2NZD D;  2ZY4 A;  1P3L C;  2G5H C;  5B0Y C;  2BYK A;  4LD9 A;  3H0L C;  4YM6 B;  1ID3 A;  3B6G C;  4EO5 C;  4KUD B;  1P3M D;  4YS3 B;  3X1T A;  1U35 B;  1HTA A;  2J8P A;  4WJ3 C;  5CPI A;  3REK A;  2ARO B;  5BT1 C;  3EPH A;  3C1C D;  1EQZ D;  4X23 A;  5AV9 D;  5DNM A;  1P3B C;  4LD9 D;  2IO5 B;  3B6F A;  1ID3 D;  4Z5T B;  4DQY B;  3REL B;  2BG1 A;  4H9O A;  3AYW A;  3UTB D;  3X1T D;  4J8W C;  5CPI D;  4CSR A;  3REK D;  3AZE C;  4X23 D;  3AV2 C;  3AZN A;  1HQ3 C;  5JRG A;  5GT0 C;  5DNM D;  5B32 G;  3KUY B;  3WA9 B;  4J8U C;  3C1B B;  1F1E A;  3X1S B;  5GXQ A;  4ZBJ C;  3B6F D;  5CHL B;  3MNN A;  3KXB C;  3AYW D;  1P3O C;  4UUZ A;  3AFA A;  2Y2I A;  3MGQ A;  3TU4 B;  1P3I B;  2UWX A;  5AV5 A;  4R8P B;  4H9N B;  4J8X B;  4JJN B;  2ZY2 A;  5JRG D;  3AZN D;  2FJ7 C;  2HUE B;  5BNV A;  1B67 A;  3MNN D;  3AFA D;  3R45 B;  3MGQ D;  3V9R A;  5AV5 D;  2Y2Q A;  5B0Z C;  4KGC B;  2NQB B;  2XD5 A;  3UTA A;  1M19 A;  1M1A B;  5B31 A;  4CAY A;  3W99 A;  5CP6 A;  1P3M C;  3LZ0 A;  2CWE A;  5B1L A;  3B0C T;  3LJA B;  5B33 A;  1P3F A;  4WV4 B;  3UT9 C;  1AOI B;  3C1C C;  5B0Y A;  3REJ A;  4H9P A;  5B2J B;  3WAA A;  3UTA D;  3REI B;  3AZI C;  2NZD B;  2F8N D;  4LD9 C;  3W99 D;  1ID3 C;  5G49 A;  4KHA A;  5CP6 D;  3LZ0 D;  3UTB C;  1P3F D;  5B1L D;  1P3G C;  5B33 D;  4E44 A;  5CPI C;  3REK C;  1P3B A;  3WKJ A;  3NQJ B;  3AZL A;  5B0Y D;  4X23 C;  4H9Q B;  3MGR A;  3REJ D;  5CPK B;  5DNN C;  3WAA D;  5DNM C;  5AV9 B;  3IP4 C;  3MVD A;  3X1U D;  2BYK B;  3B6F C;  3VH5 T;  3AYW C;  1HQ3 A;  3X1V A;  1M18 B;  1BH8 A;  3X1T B;  1KX3 A;  1P3B D;  3WKJ D;  3LEL C;  4J8U A;  5AY8 A;  5B40 D;  2ZM5 A;  3MGR D;  2LY8 A;  3AZL D;  2DF4 C;  3AZG B;  2CV5 A;  4Z2M H;  1BH9 B;  3AZH B;  3MVD D;  1T3U A;  3AZK C;  3MNN C;  4AWL B;  1HQ3 D;  3X1V D;  3AFA C;  3LZ1 B;  3MGQ C;  1KX3 D;  5BS7 C;  5AY8 D;  4ZUX C;  3A6N C;  5AV5 C;  4WNN A;  5E5A A;  5JRG B;  2CV5 D;  4WU9 B;  3B0C W;  4QLC B;  5AVB D;  5GXQ B;  4J8V B;  4G91 C;  1P3P B;  2YFW A;  2Y2K A;  1JFI B;  3W97 A;  5C3I B;  5B2I A;  5E5A D;  2L5A A;  3UTA C;  3MGP B;  5BNV B;  5B1M B;  5AV8 A;  3UT9 A;  1N1J B;  1P3F C;  4HGA B;  5B1L C;  3B0D B;  5B33 C;  1TZY A;  3W97 D;  3AZI A;  3EPJ A;  5B2I D;  4WU8 B;  3VH5 W;  1ZLA A;  3AN2 A;  3REJ C;  3WAA C;  3O62 B;  3AZJ B;  1M19 B;  3WTP B;  3UTB A;  1P3G A;  5B31 B;  4NE3 A;  4CAY B;  5AV8 D;  3X1U C;  3UT9 D;  3W99 B;  5CP6 B;  5DNN A;  4G92 B;  2HIO A;  2VQR A;  3LZ0 B;  1KX4 D;  1TZY D;  2RVQ D;  3AZI D;  3WKJ C;  5B40 C;  1ZLA D;  3AZL C;  5F99 C;  3MGR C;  3AN2 D;  1P3L B;  4H9R A;  5B0Y B;  3W98 A;  3B6G B;  1P3K C;  1P3G D;  3MVD C;  1WWS A;  2F2A C;  2RIQ A;  3LEL A;  3A1I A;  4XZQ A;  2Y2N A;  5G49 B;  3X1V C;  5DNN D;  2HIO D;  3REL C;  1KX3 C;  1H3O B;  5AY8 C;  3AZK A;  3W98 D;  2CV5 C;  5AVB C;  5JA4 A;  2PYO C;  5BS7 A;  4J8W B;  3LEL D;  3A6N A;  4ZUX A;  3EPL A;  3AZE B;  4E45 A;  4XUJ A;  4XZQ D;  3AV2 B;  2YFV A;  5GT0 B;  1BH8 B;  1A7W A;  3H0M C;  4J8U B;  3W96 A;  5E5A C;  4NE6 A;  3AZK D;  4ZBJ B;  3KXB B;  1P3O B;  3VH6 T;  5KDM A;  3A6N D;  4ZUX D;  5B31 G;  4XUJ D;  5CPJ C;  2FJ7 B;  5B24 C;  1ULY A;  1P34 A;  3MGS A;  5B32 A;  3AV1 D;  3W97 C;  4Z66 A;  3H0R C;  5B2I C;  5FUG A;  2F8N A;  3W96 D;  5GSU A;  2BYM A;  5GT3 C;  1PZR A;  5BNX A;  3KWQ A;  5AV8 C;  2W8S A;  2F8N H;  2Y2M A;  2JSS A;  5B0Z B;  1P34 D;  1KX4 C;  3MGS D;  5B32 D;  1TZY C;  2RVQ C;  4Z66 D;  1ZLA C;  4UPK A;  3AN2 C;  1KX5 C;  3X1U A;  5GSU D;  1AOI C;  2ZY5 A;  1P3M B;  4DRA A;  4KUD A;  3KWQ D;  1WWI A;  1U35 A;  5B40 A;  3UT9 B;  5F99 A;  2Y2G A;  3C1C B;  4Z2M G;  1EQZ B;  2HIO C;  1P3K A;  4H9S C;  4LD9 B;  3F6T A;  3NQU A;  3W98 C;  1ID3 B;  3B0B A;  1B6W A;  4Z5T A;  3REL A;  3UTB B;  4KUD D;  1P3G B;  5AVC C;  5CPI B;  3REK B;  1U35 D;  5F99 D;  4XZQ C;  4X23 B;  3AZM C;  1F66 C;  5DNN B;  3VH6 W;  5DNM B;  5AVB A;  1P3K D;  3KUY A;  2PYO A;  3REH C;  3C1B A;  5BO0 A;  3B6F B;  2Y2L A;  3AYW B;  4H9O B;  4Z5T D;  3REL D;  4CSR B;  2G5I C;  3LEL B;  4XUJ C;  3AZN B;  1P3I A;  4R8P A;  4JJN A;  4H9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...