1N1JB

Crystal structure of the nf-yb/nf-yc histone pair
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
78
structure length
78
Chain Sequence
LPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NF-YB
publication title The NF-YB/NF-YC structure gives insight into DNA binding and transcription regulation by CCAAT factor NF-Y
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 24
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2002-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1n1jB00
3AV1A 2AROA 1P3GC 4EO5B 4J8WC 4G92B 3A6NB 2HIOD 4WNNA 3O62B 4J8VC 3AV2C 5AVCB 5B0YD 2HUEC 3UT9B 1P3AB 4J8UC 5CP6A 5GXQA 5B40D 3RELD 4H9RB 1P34A 3KWQA 1P3OB 1EQZD 1P3MC 5CPIB 2PYOB 1U35A 4X23C 3REIA 3AZEA 1P3PA 3X1UA 4WNNB 3REJC 5C3IB 3C1CD 2YFVA 2HIOC 3LELA 5B0YC 3MVDB 4LD9D 3WAAA 3AZKB 1KX4B 1S32A 5AV5B 3RELC 3NQUB 3X1VA 4YM6A 1ID3A 3B6FA 1M18D 2NZDD 3C1BC 1TZYB 2CWEA 3AZFD 3W98A 4QLCD 1HQ3A 5CPJA 5DNNA 4XUJD 1M19B 3UTBC 2NQBB 3AFAB 2CV5B 1P3AD 4J8XD 1N1JB 1AOIB 5B33A 5B32G 3C1CC 1JFIB 3LJAA 3WAAB 3MNNB 3AZHA 1S32B 1P3OD 3B6GD 4LD9C 3LZ1D 5B24A 3AV1D 5CPKB 2AROD 4YS3B 1M18C 2NZDC 3MGPB 5B31B 3AZFC 5GT3D 4QLCC 5B32A 5GXQD 5CP6D 5B2IB 2BYKA 1P34D 3WKJA 3KWQD 4J8XC 4J8UA 5B2JA 4AWLB 5JA4B 4CAYA 5B1LB 3B6GC 4H9OA 1U35D 3REID 3LZ1C 3AZED 1ULYA 1P3PD 3X1UD 3AV1C 2IO5C 4CSRA 4Z66B 2AROC 2FJ7A 4E45A 1P3GB 4J8WB 4J8VB 5DNMA 3LELD 5GT3C 3AV2B 3KXBA 2HUEB 5BO0A 3VH6A 3REJA 3W96A 3WAAD 5GXQC 5CP6C 5AV9C 3AZJA 1KU5A 2YFWA 1P34C 4G91C 3KWQC 3X1VD 4YM6D 1ID3D 3B6FD 3B0DC 3AZIC 1P3MB 1M1AB 3W98D 1U35C 4Z2MG 3REIC 4X23B 1HQ3D 5CPJD 5DNND 3MGRA 3AZEC 1P3PC 5F99A 3C1BA 3WA9A 1P3IA 5B33D 3REJB 3UTBA 3LJAD 4H9PB 2HIOB 5BNXA 3LELC 3AZHD 5B0YB 4KUDA 5B24D 3B0CT 3LZ0C 5B40B 3RELB 3X1TA 4YM6C 1ID3C 3B6FC 1EQZB 3WTPE 3NQJB 5CHLB 3REKC 3W98C 1TAFA 1HQ3C 5B32D 5DNNC 5AV8A 2L5AA 3WKJD 4Z2MH 3R45B 5B2JD 4J8UD 5B33C 3C1CB 3LJAC 5AV6A 3AZHC 3V9RA 3WTPA 4LD9B 5B24C 5B1MC 4NFTA 2FJ7D 4ZBJC 1M18B 4WU8C 1P3LA 2NZDB 5DNMD 3AZFB 3KXBD 3REJD 4QLCB 5B32C 5BNVB 3W96D 3VH5T 4XUJB 5GT3A 4H9NA 5AY8A 3AZJD 3WKJC 4J8XB 5B2JC 5AV9A 3B6GB 4JJNA 3LZ1B 3X1SC 3MGRD 3AZIA 4XZQD 4Z5TA 5F99D 3C1BD 3AV1B 5BS7A 2IO5B 3WA9D 2FJ7C 2AROB 1P3ID 4WZSB 3UTBD 5DNMC 5GT3B 1ZLAC 3KXBC 4KUDD 3W96C 5GXQB 5CP6B 5AV9B 3AZJC 4NE6A 2BYMA 3X1TD 4G91B 3KWQB 3KUYA 1P34B 3B0DB 3LZ0A 1U35B 3REIB 5GSUC 3MGRC 5AV8D 4XZQC 3AZEB 5F99C 1P3PB 3REKA 1B67A 3X1UB 3WA9C 4NE5A 1P3IC 1P3BA 2YFVB 5AV6D 3LELB 4KUDC 3WTPD 4WU9A 3MGSA 3X1TC 3X1VB 4YM6B 1ID3B 3B6FB 5B1MA 1P3LD 1WWIA 5FUGA 3REKB 3AZNC 3W98B 3AYWA 1HQ3B 4WU8A 5AV8C 5DNNB 5CPJB 4DRAA 1P3FA 5AY8D 5B33B 5AV6C 5AV9D 3LJAB 1H3OA 3AZHB 3WTPC 4JJND 5B24B 3AN2A 3AZID 5B1MB 4Z5TD 5FUGB 5E5AA 5AVBC 3W99C 3X1SA 4R8PC 3W97A 4ZBJB 4E44A 1P3LC 5B32B 1F66C 5AY8C 1ZLAA 3TU4A 2BYKB 3KUYD 3WKJB 4G92C 4J8UB 5B2JB 3O62C 3LZ0D 4CAYB 4H9OB 4JJNC 4Z5TC 3REKD 5KDMA 2F8NG 5BS7C 4CSRB 2FJ7B 1BH8A 5GSUA 4XZQA 1P3BD 2PYOC 5DNMB 4DRBA 1ZLAB 4WU9D 5BO0B 3KXBB 3W96B 3REHD 5G49A 3MGSD 3AZJB 2YFWB 3KUYC 5B1MD 1P3KA 2F8NA 3AZGA 3UTAD 3VH6W 5JRGA 3AYWD 4WU8D 5GSUB 4H9QA 3MGRB 4XZQB 3AZLA 4NE3A 1Q9CA 5GT0A 5F99B 3C1BB 3AZNA 1P3FD 3WA9B 1P3IB 1P3BC 3UTBB 3AZMA 1KX3A 5BNXB 4WU9C 4KUDB 4KGCA 3AN2D 3REHC 3MGSC 5E5AD 5B0ZA 3X1TB 3X1SD 3W97D 3MGQA 1KX5D 5AVBA 3UTAC 4R8PA 1TAFB 3W99A 3AYWC 4UUZA 5AV8B 4ZUXC 1P3FC 2JSSA 1ZLAD 3TU4D 1WWSA 1F66A 5AV6B 3VH6T 3KSYA 1B6WA 3A6NA 3V9RB 3WTPB 3O62A 3AN2C 5AVCA 5B2IC 3UT9A 1R4VA 5E5AC 4HGAC 5AVBB 3W97C 3W99B 5GSUD 4R8PB 4H9RA 1P3LB 1KX5C 2RVQD 5CPIA 2PYOA 4Z66C 1F66B 4H9NB 5AY8B 3TU4C 1P3KD 2F8ND 3AZGD 5JRGD 4JJNB 3AZIB 3MVDA 3AZLD 4Z5TB 5GT0D 3AZND 3AZKA 1KX4A 5AV5A 1M1AC 3NQUA 4WV4B 3AZMD 1KX3D 2RVQC 4KGCD 1TZYA 3B0BA 5B0ZD 1M19A 2BYMB 2LY8A 3KUYB 3AFAA 2NQBA 5B31G 2CV5A 3REHA 3LZ0B 3MGQD 1P3KC 1N1JA 1AOIA 3AZGC 5AVBD 1JFIA 3W99D 4R8PD 5JRGC 3MNNA 5B40C 3AZLC 5GT0C 3UTAA 1EQZC 4ZUXA 5CPKA 1P3BB 3AZMC 1F66D 1KX3C 4YS3A 3A6ND 3MGPA 5B31A 3O62D 5BT1D 4H9SC 4WU9B 4KGCC 5AVCD 3REHB 3UT9D 3MGSB 5B0ZC 5B2IA 3MGQC 3UTAB 5JA4A 3AYWB 5CPID 4WU8B 5B1LA 2PYOD 4ZUXB 1KX5A 1P3FB 1BH9A 4Z66A 1H3OB 4EO5C 1P3GA 3A6NC 4J8WA 4XUJC 5BT1C 4J8VA 3AN2B 5AVCC 3AV2A 1P3AC 3UT9C 3MVDD 5E5AB 4HGAB 3AZKD 1KX4D 3X1SB 3W97B 5AV5D 1P3OC 1KX5B 1BH9B 5CPIC 1P3MA 1M1AA 1TZYD 2F8NK 4X23A 3B0CW 3TU4B 1M19D 2NQBD 3AFAD 2CV5D 3VH5A 1AOID 5C3IC 1F1EA 4H9PA 2HIOA 3MNND 1S32D 5B0YA 3MVDC 5KDMB 3AZKC 1KX4C 1BH8B 5AV5C 5B40A 4ZUXD 3RELA 5CPKD 4YS3D 1EQZA 3MGPD 3NQJA 5B31D 1TZYC 3X1UC 5G49B 2F8NH 1M19C 2NQBC 3AFAC 4H9SA 2CV5C 5B2ID 3R45A 1P3KB 1AOIC 1A7WA 3AZGB 3C1CA 2F8NB 3WAAC 5JRGB 3MNNC 1S32C 1HTAA 5B1LD 4H9QB 4KHAA 3VH5W 3AZLB 3X1VC 4LD9A 5GT0B 3AZNB 5CPKC 4Z66D 3AZMB 1BFMA 1KX3B 4YS3C 1M18A 5CPJC 1P3GD 4J8WD 3MGPC 5B31C 2NZDA 4J8VD 4KGCB 3AZFA 3AV2D 4QLCA 5BNVA 4XUJA 5B0ZB 4M6BA 1P3AA 3MGQB 4J8XA 4KHAB 4AWLC 1P3MD 1M1AD 5B1LC 1P3OA 4UUZB 3B6GA 4X23D 3LZ1A
chains in the Genus database with same CATH superfamily
2J8PA 3AV1A 2AROA 1P3GC 4EO5B 4J8WC 4G92B 3A6NB 2HIOD 4WNNA 2ZY3A 3O62B 4J8VC 3AV2C 5AVCB 5B0YD 2HUEC 3UT9B 1P3AB 4J8UC 5CP6A 5GXQA 5B40D 3RELD 4H9RB 1P34A 3KWQA 1P3OB 1EQZD 1P3MC 5CPIB 2PYOB 1U35A 4X23C 3REIA 3AZEA 1P3PA 2Y2KA 3X1UA 4WNNB 3REJC 5C3IB 3C1CD 2YFVA 2HIOC 3LELA 5B0YC 3MVDB 4LD9D 3WAAA 3AZKB 1KX4B 1S32A 5AV5B 3RELC 3NQUB 3X1VA 4YM6A 1ID3A 3B6FA 1M18D 2NZDD 3C1BC 1TZYB 2CWEA 3AZFD 3W98A 4QLCD 2Y2JA 1HQ3A 5CPJA 5DNNA 4XUJD 1M19B 3UTBC 2NQBB 3AFAB 2CV5B 1P3AD 2BG1A 4J8XD 1N1JB 1AOIB 5B33A 2JE5A 5B32G 3C1CC 3LJAA 1JFIB 3WAAB 3MNNB 3AZHA 1S32B 1P3OD 3B6GD 4LD9C 3LZ1D 5B24A 3AV1D 5CPKB 3P5JB 2AROD 4YS3B 1M18C 2NZDC 2Y2PA 5B31B 3MGPB 3AZFC 5GT3D 2DQNC 4QLCC 5B32A 5GXQD 5CP6D 5B2IB 2BYKA 1P34D 3WKJA 3KWQD 4J8XC 4J8UA 5B2JA 4AWLB 5JA4B 4CAYA 5B1LB 3B6GC 4H9OA 1U35D 3REID 3LZ1C 3AZED 1ULYA 1P3PD 2UWXA 3X1UD 3AV1C 2IO5C 4CSRA 4Z66B 2AROC 2FJ7A 4E45A 1P3GB 4J8WB 4J8VB 5DNMA 3LELD 5GT3C 3AV2B 3KXBA 2HUEB 5BO0A 3VH6A 3REJA 3W96A 3WAAD 5GXQC 5CP6C 5AV9C 3AZJA 1KU5A 2YFWA 1P34C 4G91C 3KWQC 3X1VD 4YM6D 1ID3D 3B6FD 3B0DC 3H0MC 3AZIC 1P3MB 1M1AB 3W98D 1U35C 4Z2MG 3REIC 4X23B 1HQ3D 5CPJD 5DNND 3MGRA 3AZEC 1P3PC 5F99A 3C1BA 3IP4C 3WA9A 1Z2CB 1P3IA 5B33D 3REJB 3UTBA 3LJAD 4H9PB 2HIOB 5BNXA 3LELC 3AZHD 5B0YB 4KUDA 5B24D 3B0CT 3LZ0C 5B40B 3RELB 3X1TA 4YM6C 1ID3C 3B6FC 1EQZB 3H0LC 3NQJB 5CHLB 3WTPE 3REKC 3W98C 1TAFA 1HQ3C 5B32D 5DNNC 5AV8A 2L5AA 3WKJD 4Z2MH 3R45B 5B2JD 4J8UD 5B33C 3C1CB 3LJAC 5AV6A 3AZHC 3V9RA 3A1IA 3EG5B 5B24C 3WTPA 4LD9B 5B1MC 4NFTA 1W2EA 2FJ7D 4ZBJC 1M18B 4WU8C 1P3LA 2NZDB 5DNMD 3AZFB 3KXBD 3REJD 4QLCB 5B32C 5BNVB 2ZY5A 3W96D 3VH5T 4XUJB 5GT3A 4H9NA 5AY8A 3AZJD 3WKJC 4J8XB 5B2JC 5AV9A 3B6GB 4JJNA 3LZ1B 3X1SC 3MGRD 3AZIA 4XZQD 4Z5TA 5F99D 3C1BD 3AV1B 5BS7A 2IO5B 3WA9D 2FJ7C 2AROB 1P3ID 4WZSB 2Y2OA 3UTBD 5DNMC 5GT3B 1ZLAC 3KXBC 4KUDD 3W96C 5GXQB 5CP6B 5AV9B 3AZJC 4NE6A 2BYMA 3X1TD 4G91B 3KWQB 3KUYA 1P34B 3B0DB 3LZ0A 1U35B 3REIB 5GSUC 3MGRC 5AV8D 4XZQC 3AZEB 5F99C 1P3PB 3REKA 1B67A 3X1UB 3WA9C 4NE5A 1P3IC 1P3BA 2YFVB 5AV6D 3AL0C 3LELB 4KUDC 3WTPD 4WU9A 3EPJA 3MGSA 2Y2MA 3X1TC 3X1VB 4YM6B 1ID3B 3B6FB 5B1MA 1P3LD 1WWIA 5FUGA 3REKB 3AZNC 3W98B 3AYWA 1HQ3B 4WU8A 2Y2NA 5DNNB 5AV8C 4DRAA 5CPJB 1P3FA 5AY8D 5B33B 5AV6C 5AV9D 3LJAB 1H3OA 3AZHB 2Y2GA 3WTPC 4JJND 5B24B 3AN2A 3AZID 5B1MB 4Z5TD 5FUGB 5E5AA 5AVBC 3W99C 3X1SA 4R8PC 3W97A 4ZBJB 4E44A 1P3LC 2ZY4A 5B32B 1F66C 5AY8C 3EPKA 3FDDA 3TU4A 2BYKB 2XD1A 3KUYD 4G92C 1ZLAA 3WKJB 3EPHA 4J8UB 5B2JB 3O62C 3LZ0D 4CAYB 4H9OB 4JJNC 2Y2QA 2RIQA 4Z5TC 3REKD 2F2AC 5KDMA 2F8NG 5BS7C 4CSRB 2FJ7B 1BH8A 5GSUA 4XZQA 1P3BD 2PYOC 5DNMB 1PZRA 4DRBA 1ZLAB 4WU9D 5BO0B 3KXBB 3W96B 3REHD 5G49A 2JCHA 3MGSD 3AZJB 2YFWB 3KUYC 5B1MD 1P3KA 4DQYB 2F8NA 3AZGA 3UTAD 3VH6W 5JRGA 3AYWD 4WU8D 5GSUB 4H9QA 3MGRB 4XZQB 3AZLA 4NE3A 1Q9CA 5GT0A 5F99B 3C1BB 3AZNA 1P3FD 3WA9B 1P3IB 1P3BC 2XD5A 3UTBB 3AZMA 1KX3A 5BNXB 4WU9C 4KUDB 4KGCA 3AN2D 3REHC 3MGSC 5E5AD 5B0ZA 3X1TB 3X1SD 3W97D 3MGQA 1KX5D 5AVBA 3UTAC 4R8PA 1TAFB 3W99A 3AYWC 4ZUXC 4UUZA 5AV8B 1P3FC 2JSSA 1ZLAD 3TU4D 3KFUG 1WWSA 1F66A 5AV6B 3VH6T 1T3UA 3KSYA 1B6WA 3A6NA 2Y2LA 3WTPB 3V9RB 3O62A 3AN2C 5AVCA 5B2IC 3UT9A 1R4VA 5E5AC 4HGAC 5AVBB 3W97C 3W99B 5GSUD 4R8PB 4H9RA 1P3LB 1KX5C 2RVQD 5CPIA 3F6TA 2PYOA 4Z66C 1F66B 5AY8B 4H9NB 3TU4C 1P3KD 2F8ND 3AZGD 2DF4C 5JRGD 4JJNB 2G5IC 3AZIB 3MVDA 3AZLD 4Z5TB 5GT0D 3AZND 3AZKA 1KX4A 5AV5A 1M1AC 3NQUA 4WV4B 3AZMD 1KX3D 2RVQC 4KGCD 1TZYA 3B0BA 5B0ZD 1M19A 2BYMB 2LY8A 3KUYB 3AFAA 2NQBA 5B31G 2CV5A 3REHA 3LZ0B 3MGQD 1P3KC 1N1JA 1AOIA 3AZGC 5AVBD 2FFFB 3W99D 4R8PD 1JFIA 5JRGC 3MNNA 5B40C 3AZLC 5GT0C 3UTAA 1EQZC 4ZUXA 5CPKA 1P3BB 3AZMC 1F66D 1KX3C 4YS3A 2ZM5A 2ZY2A 3A6ND 3MGPA 5B31A 3O62D 5BT1D 4H9SC 4WU9B 4KGCC 5AVCD 3REHB 3UT9D 3MGSB 5B0ZC 5B2IA 3MGQC 3UTAB 5JA4A 3AYWB 5CPID 4WU8B 5B1LA 2PYOD 4ZUXB 1KX5A 1P3FB 1BH9A 2VQRA 4Z66A 1H3OB 2W8SA 4EO5C 1P3GA 3A6NC 4J8WA 4XUJC 5BT1C 4J8VA 3AN2B 5AVCC 3AV2A 1P3AC 3UT9C 3MVDD 5E5AB 4HGAB 3AZKD 1KX4D 3X1SB 3W97B 5AV5D 1P3OC 1KX5B 1BH9B 5CPIC 1P3MA 1M1AA 4WJ3C 1TZYD 2F8NK 4X23A 3B0CW 3TU4B 1M19D 2NQBD 3AFAD 2CV5D 2Y2IA 3VH5A 1AOID 5C3IC 1F1EA 4H9PA 2HIOA 3MNND 1S32D 3A1KA 5B0YA 3MVDC 5KDMB 3AZKC 1KX4C 1BH8B 5AV5C 5B40A 4ZUXD 3RELA 5CPKD 4YS3D 1EQZA 3MGPD 3NQJA 5B31D 1TZYC 3X1UC 5G49B 2F8NH 1M19C 2NQBC 3AFAC 4H9SA 2CV5C 5B2ID 3EPLA 4UPKA 3R45A 1P3KB 1AOIC 1A7WA 3AZGB 3C1CA 2F8NB 3WAAC 5JRGB 3MNNC 1S32C 1HTAA 5B1LD 4H9QB 4KHAA 2G5HC 3VH5W 3AZLB 3X1VC 4LD9A 5GT0B 3AZNB 3H0RC 5CPKC 4Z66D 3AZMB 1BFMA 1KX3B 4YS3C 1M18A 5CPJC 1P3GD 4J8WD 3MGPC 5B31C 2NZDA 4J8VD 4KGCB 3AZFA 3AV2D 4QLCA 5BNVA 4XUJA 5B0ZB 4M6BA 2Y2HA 1P3AA 3MGQB 4J8XA 4KHAB 4AWLC 1P3MD 1M1AD 5B1LC 1P3OA 4UUZB 3B6GA 4X23D 3LZ1A
chains in the Genus database with same CATH topology
2J8PA 3AV1A 2AROA 1P3GC 4EO5B 4J8WC 4G92B 3A6NB 2HIOD 4WNNA 2ZY3A 3O62B 4J8VC 3AV2C 5AVCB 5B0YD 2HUEC 3UT9B 1P3AB 4J8UC 5CP6A 5GXQA 5B40D 3RELD 4H9RB 1P34A 3KWQA 1P3OB 1EQZD 1P3MC 5CPIB 2PYOB 1U35A 4X23C 3REIA 3AZEA 1P3PA 2Y2KA 3X1UA 4WNNB 3REJC 5C3IB 3C1CD 2YFVA 2HIOC 3LELA 5B0YC 3MVDB 4LD9D 3WAAA 3AZKB 1KX4B 1S32A 5AV5B 3RELC 3NQUB 3X1VA 4YM6A 1ID3A 3B6FA 1M18D 2NZDD 3C1BC 1TZYB 2CWEA 3AZFD 3W98A 4QLCD 2Y2JA 1HQ3A 5CPJA 5DNNA 4XUJD 1M19B 3UTBC 2NQBB 3AFAB 2CV5B 1P3AD 2BG1A 4J8XD 1N1JB 1AOIB 5B33A 2JE5A 5B32G 3C1CC 3LJAA 1JFIB 3WAAB 3MNNB 3AZHA 1S32B 1P3OD 3B6GD 4LD9C 3LZ1D 5B24A 3AV1D 5CPKB 3P5JB 2AROD 4YS3B 1M18C 2NZDC 2Y2PA 5B31B 3MGPB 3AZFC 5GT3D 2DQNC 4QLCC 5B32A 5GXQD 5CP6D 5B2IB 2BYKA 1P34D 3WKJA 3KWQD 4J8XC 4J8UA 5B2JA 4AWLB 5JA4B 4CAYA 5B1LB 3B6GC 4H9OA 1U35D 3REID 3LZ1C 3AZED 1ULYA 1P3PD 2UWXA 3X1UD 3AV1C 2IO5C 4CSRA 4Z66B 2AROC 2FJ7A 4E45A 1P3GB 4J8WB 4J8VB 5DNMA 3LELD 5GT3C 3AV2B 3KXBA 2HUEB 5BO0A 3VH6A 3REJA 3W96A 3WAAD 5GXQC 5CP6C 5AV9C 3AZJA 1KU5A 2YFWA 1P34C 4G91C 3KWQC 3X1VD 4YM6D 1ID3D 3B6FD 3B0DC 3H0MC 3AZIC 1P3MB 1M1AB 3W98D 1U35C 4Z2MG 3REIC 4X23B 1HQ3D 5CPJD 5DNND 3MGRA 3AZEC 1P3PC 5F99A 3C1BA 3IP4C 3WA9A 1Z2CB 1P3IA 5B33D 3REJB 3UTBA 3LJAD 4H9PB 2HIOB 5BNXA 3LELC 3AZHD 5B0YB 4KUDA 5B24D 3B0CT 3LZ0C 5B40B 3RELB 3X1TA 4YM6C 1ID3C 3B6FC 1EQZB 3H0LC 3NQJB 5CHLB 3WTPE 3REKC 3W98C 1TAFA 1HQ3C 5B32D 5DNNC 5AV8A 2L5AA 3WKJD 4Z2MH 3R45B 5B2JD 4J8UD 5B33C 3C1CB 3LJAC 5AV6A 3AZHC 3V9RA 3A1IA 3EG5B 5B24C 3WTPA 4LD9B 5B1MC 4NFTA 1W2EA 2FJ7D 4ZBJC 1M18B 4WU8C 1P3LA 2NZDB 5DNMD 3AZFB 3KXBD 3REJD 4QLCB 5B32C 5BNVB 2ZY5A 3W96D 3VH5T 4XUJB 5GT3A 4H9NA 5AY8A 3AZJD 3WKJC 4J8XB 5B2JC 5AV9A 3B6GB 4JJNA 3LZ1B 3X1SC 3MGRD 3AZIA 4XZQD 4Z5TA 5F99D 3C1BD 3AV1B 5BS7A 2IO5B 3WA9D 2FJ7C 2AROB 1P3ID 4WZSB 2Y2OA 3UTBD 5DNMC 5GT3B 1ZLAC 3KXBC 4KUDD 3W96C 5GXQB 5CP6B 5AV9B 3AZJC 4NE6A 2BYMA 3X1TD 4G91B 3KWQB 3KUYA 1P34B 3B0DB 3LZ0A 1U35B 3REIB 5GSUC 3MGRC 5AV8D 4XZQC 3AZEB 5F99C 1P3PB 3REKA 1B67A 3X1UB 3WA9C 4NE5A 1P3IC 1P3BA 2YFVB 5AV6D 3AL0C 3LELB 4KUDC 3WTPD 4WU9A 3EPJA 3MGSA 2Y2MA 3X1TC 3X1VB 4YM6B 1ID3B 3B6FB 5B1MA 1P3LD 1WWIA 5FUGA 3REKB 3AZNC 3W98B 3AYWA 1HQ3B 4WU8A 2Y2NA 5DNNB 5AV8C 4DRAA 5CPJB 1P3FA 5AY8D 5B33B 5AV6C 5AV9D 3LJAB 1H3OA 3AZHB 2Y2GA 3WTPC 4JJND 5B24B 3AN2A 3AZID 5B1MB 4Z5TD 5FUGB 5E5AA 5AVBC 3W99C 3X1SA 4R8PC 3W97A 4ZBJB 4E44A 1P3LC 2ZY4A 5B32B 1F66C 5AY8C 3EPKA 3FDDA 3TU4A 2BYKB 2XD1A 3KUYD 4G92C 1ZLAA 3WKJB 3EPHA 4J8UB 5B2JB 3O62C 3LZ0D 4CAYB 4H9OB 4JJNC 2Y2QA 2RIQA 4Z5TC 3REKD 2F2AC 5KDMA 2F8NG 5BS7C 4CSRB 2FJ7B 1BH8A 5GSUA 4XZQA 1P3BD 2PYOC 5DNMB 1PZRA 4DRBA 1ZLAB 4WU9D 5BO0B 3KXBB 3W96B 3REHD 5G49A 2JCHA 3MGSD 3AZJB 2YFWB 3KUYC 5B1MD 1P3KA 4DQYB 2F8NA 3AZGA 3UTAD 3VH6W 5JRGA 3AYWD 4WU8D 5GSUB 4H9QA 3MGRB 4XZQB 3AZLA 4NE3A 1Q9CA 5GT0A 5F99B 3C1BB 3AZNA 1P3FD 3WA9B 1P3IB 1P3BC 2XD5A 3UTBB 3AZMA 1KX3A 5BNXB 4WU9C 4KUDB 4KGCA 3AN2D 3REHC 3MGSC 5E5AD 5B0ZA 3X1TB 3X1SD 3W97D 3MGQA 1KX5D 5AVBA 3UTAC 4R8PA 1TAFB 3W99A 3AYWC 4ZUXC 4UUZA 5AV8B 1P3FC 2JSSA 1ZLAD 3TU4D 3KFUG 1WWSA 1F66A 5AV6B 3VH6T 1T3UA 3KSYA 1B6WA 3A6NA 2Y2LA 3WTPB 3V9RB 3O62A 3AN2C 5AVCA 5B2IC 3UT9A 1R4VA 5E5AC 4HGAC 5AVBB 3W97C 3W99B 5GSUD 4R8PB 4H9RA 1P3LB 1KX5C 2RVQD 5CPIA 3F6TA 2PYOA 4Z66C 1F66B 5AY8B 4H9NB 3TU4C 1P3KD 2F8ND 3AZGD 2DF4C 5JRGD 4JJNB 2G5IC 3AZIB 3MVDA 3AZLD 4Z5TB 5GT0D 3AZND 3AZKA 1KX4A 5AV5A 1M1AC 3NQUA 4WV4B 3AZMD 1KX3D 2RVQC 4KGCD 1TZYA 3B0BA 5B0ZD 1M19A 2BYMB 2LY8A 3KUYB 3AFAA 2NQBA 5B31G 2CV5A 3REHA 3LZ0B 3MGQD 1P3KC 1N1JA 1AOIA 3AZGC 5AVBD 2FFFB 3W99D 4R8PD 1JFIA 5JRGC 3MNNA 5B40C 3AZLC 5GT0C 3UTAA 1EQZC 4ZUXA 5CPKA 1P3BB 3AZMC 1F66D 1KX3C 4YS3A 2ZM5A 2ZY2A 3A6ND 3MGPA 5B31A 3O62D 5BT1D 4H9SC 4WU9B 4KGCC 5AVCD 3REHB 3UT9D 3MGSB 5B0ZC 5B2IA 3MGQC 3UTAB 5JA4A 3AYWB 5CPID 4WU8B 5B1LA 2PYOD 4ZUXB 1KX5A 1P3FB 1BH9A 2VQRA 4Z66A 1H3OB 2W8SA 4EO5C 1P3GA 3A6NC 4J8WA 4XUJC 5BT1C 4J8VA 3AN2B 5AVCC 3AV2A 1P3AC 3UT9C 3MVDD 5E5AB 4HGAB 3AZKD 1KX4D 3X1SB 3W97B 5AV5D 1P3OC 1KX5B 1BH9B 5CPIC 1P3MA 1M1AA 4WJ3C 1TZYD 2F8NK 4X23A 3B0CW 3TU4B 1M19D 2NQBD 3AFAD 2CV5D 2Y2IA 3VH5A 1AOID 5C3IC 1F1EA 4H9PA 2HIOA 3MNND 1S32D 3A1KA 5B0YA 3MVDC 5KDMB 3AZKC 1KX4C 1BH8B 5AV5C 5B40A 4ZUXD 3RELA 5CPKD 4YS3D 1EQZA 3MGPD 3NQJA 5B31D 1TZYC 3X1UC 5G49B 2F8NH 1M19C 2NQBC 3AFAC 4H9SA 2CV5C 5B2ID 3EPLA 4UPKA 3R45A 1P3KB 1AOIC 1A7WA 3AZGB 3C1CA 2F8NB 3WAAC 5JRGB 3MNNC 1S32C 1HTAA 5B1LD 4H9QB 4KHAA 2G5HC 3VH5W 3AZLB 3X1VC 4LD9A 5GT0B 3AZNB 3H0RC 5CPKC 4Z66D 3AZMB 1BFMA 1KX3B 4YS3C 1M18A 5CPJC 1P3GD 4J8WD 3MGPC 5B31C 2NZDA 4J8VD 4KGCB 3AZFA 3AV2D 4QLCA 5BNVA 4XUJA 5B0ZB 4M6BA 2Y2HA 1P3AA 3MGQB 4J8XA 4KHAB 4AWLC 1P3MD 1M1AD 5B1LC 1P3OA 4UUZB 3B6GA 4X23D 3LZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV1 A;  2ARO A;  1P3G C;  4EO5 B;  4J8W C;  4G92 B;  3A6N B;  2HIO D;  4WNN A;  3O62 B;  4J8V C;  3AV2 C;  5AVC B;  5B0Y D;  2HUE C;  3UT9 B;  1P3A B;  4J8U C;  5CP6 A;  5GXQ A;  5B40 D;  3REL D;  4H9R B;  1P34 A;  3KWQ A;  1P3O B;  1EQZ D;  1P3M C;  5CPI B;  2PYO B;  1U35 A;  4X23 C;  3REI A;  3AZE A;  1P3P A;  3X1U A;  4WNN B;  3REJ C;  5C3I B;  3C1C D;  2YFV A;  2HIO C;  3LEL A;  5B0Y C;  3MVD B;  4LD9 D;  3WAA A;  3AZK B;  1KX4 B;  1S32 A;  5AV5 B;  3REL C;  3NQU B;  3X1V A;  4YM6 A;  1ID3 A;  3B6F A;  1M18 D;  2NZD D;  3C1B C;  1TZY B;  2CWE A;  3AZF D;  3W98 A;  4QLC D;  1HQ3 A;  5CPJ A;  5DNN A;  4XUJ D;  1M19 B;  3UTB C;  2NQB B;  3AFA B;  2CV5 B;  1P3A D;  4J8X D;  1N1J B;  1AOI B;  5B33 A;  5B32 G;  3C1C C;  1JFI B;  3LJA A;  3WAA B;  3MNN B;  3AZH A;  1S32 B;  1P3O D;  3B6G D;  4LD9 C;  3LZ1 D;  5B24 A;  3AV1 D;  5CPK B;  2ARO D;  4YS3 B;  1M18 C;  2NZD C;  3MGP B;  5B31 B;  3AZF C;  5GT3 D;  4QLC C;  5B32 A;  5GXQ D;  5CP6 D;  5B2I B;  2BYK A;  1P34 D;  3WKJ A;  3KWQ D;  4J8X C;  4J8U A;  5B2J A;  4AWL B;  5JA4 B;  4CAY A;  5B1L B;  3B6G C;  4H9O A;  1U35 D;  3REI D;  3LZ1 C;  3AZE D;  1ULY A;  1P3P D;  3X1U D;  3AV1 C;  2IO5 C;  4CSR A;  4Z66 B;  2ARO C;  2FJ7 A;  4E45 A;  1P3G B;  4J8W B;  4J8V B;  5DNM A;  3LEL D;  5GT3 C;  3AV2 B;  3KXB A;  2HUE B;  5BO0 A;  3VH6 A;  3REJ A;  3W96 A;  3WAA D;  5GXQ C;  5CP6 C;  5AV9 C;  3AZJ A;  1KU5 A;  2YFW A;  1P34 C;  4G91 C;  3KWQ C;  3X1V D;  4YM6 D;  1ID3 D;  3B6F D;  3B0D C;  3AZI C;  1P3M B;  1M1A B;  3W98 D;  1U35 C;  4Z2M G;  3REI C;  4X23 B;  1HQ3 D;  5CPJ D;  5DNN D;  3MGR A;  3AZE C;  1P3P C;  5F99 A;  3C1B A;  3WA9 A;  1P3I A;  5B33 D;  3REJ B;  3UTB A;  3LJA D;  4H9P B;  2HIO B;  5BNX A;  3LEL C;  3AZH D;  5B0Y B;  4KUD A;  5B24 D;  3B0C T;  3LZ0 C;  5B40 B;  3REL B;  3X1T A;  4YM6 C;  1ID3 C;  3B6F C;  1EQZ B;  3WTP E;  3NQJ B;  5CHL B;  3REK C;  3W98 C;  1TAF A;  1HQ3 C;  5B32 D;  5DNN C;  5AV8 A;  2L5A A;  3WKJ D;  4Z2M H;  3R45 B;  5B2J D;  4J8U D;  5B33 C;  3C1C B;  3LJA C;  5AV6 A;  3AZH C;  3V9R A;  3WTP A;  4LD9 B;  5B24 C;  5B1M C;  4NFT A;  2FJ7 D;  4ZBJ C;  1M18 B;  4WU8 C;  1P3L A;  2NZD B;  5DNM D;  3AZF B;  3KXB D;  3REJ D;  4QLC B;  5B32 C;  5BNV B;  3W96 D;  3VH5 T;  4XUJ B;  5GT3 A;  4H9N A;  5AY8 A;  3AZJ D;  3WKJ C;  4J8X B;  5B2J C;  5AV9 A;  3B6G B;  4JJN A;  3LZ1 B;  3X1S C;  3MGR D;  3AZI A;  4XZQ D;  4Z5T A;  5F99 D;  3C1B D;  3AV1 B;  5BS7 A;  2IO5 B;  3WA9 D;  2FJ7 C;  2ARO B;  1P3I D;  4WZS B;  3UTB D;  5DNM C;  5GT3 B;  1ZLA C;  3KXB C;  4KUD D;  3W96 C;  5GXQ B;  5CP6 B;  5AV9 B;  3AZJ C;  4NE6 A;  2BYM A;  3X1T D;  4G91 B;  3KWQ B;  3KUY A;  1P34 B;  3B0D B;  3LZ0 A;  1U35 B;  3REI B;  5GSU C;  3MGR C;  5AV8 D;  4XZQ C;  3AZE B;  5F99 C;  1P3P B;  3REK A;  1B67 A;  3X1U B;  3WA9 C;  4NE5 A;  1P3I C;  1P3B A;  2YFV B;  5AV6 D;  3LEL B;  4KUD C;  3WTP D;  4WU9 A;  3MGS A;  3X1T C;  3X1V B;  4YM6 B;  1ID3 B;  3B6F B;  5B1M A;  1P3L D;  1WWI A;  5FUG A;  3REK B;  3AZN C;  3W98 B;  3AYW A;  1HQ3 B;  4WU8 A;  5AV8 C;  5DNN B;  5CPJ B;  4DRA A;  1P3F A;  5AY8 D;  5B33 B;  5AV6 C;  5AV9 D;  3LJA B;  1H3O A;  3AZH B;  3WTP C;  4JJN D;  5B24 B;  3AN2 A;  3AZI D;  5B1M B;  4Z5T D;  5FUG B;  5E5A A;  5AVB C;  3W99 C;  3X1S A;  4R8P C;  3W97 A;  4ZBJ B;  4E44 A;  1P3L C;  5B32 B;  1F66 C;  5AY8 C;  1ZLA A;  3TU4 A;  2BYK B;  3KUY D;  3WKJ B;  4G92 C;  4J8U B;  5B2J B;  3O62 C;  3LZ0 D;  4CAY B;  4H9O B;  4JJN C;  4Z5T C;  3REK D;  5KDM A;  2F8N G;  5BS7 C;  4CSR B;  2FJ7 B;  1BH8 A;  5GSU A;  4XZQ A;  1P3B D;  2PYO C;  5DNM B;  4DRB A;  1ZLA B;  4WU9 D;  5BO0 B;  3KXB B;  3W96 B;  3REH D;  5G49 A;  3MGS D;  3AZJ B;  2YFW B;  3KUY C;  5B1M D;  1P3K A;  2F8N A;  3AZG A;  3UTA D;  3VH6 W;  5JRG A;  3AYW D;  4WU8 D;  5GSU B;  4H9Q A;  3MGR B;  4XZQ B;  3AZL A;  4NE3 A;  1Q9C A;  5GT0 A;  5F99 B;  3C1B B;  3AZN A;  1P3F D;  3WA9 B;  1P3I B;  1P3B C;  3UTB B;  3AZM A;  1KX3 A;  5BNX B;  4WU9 C;  4KUD B;  4KGC A;  3AN2 D;  3REH C;  3MGS C;  5E5A D;  5B0Z A;  3X1T B;  3X1S D;  3W97 D;  3MGQ A;  1KX5 D;  5AVB A;  3UTA C;  4R8P A;  1TAF B;  3W99 A;  3AYW C;  4UUZ A;  5AV8 B;  4ZUX C;  1P3F C;  2JSS A;  1ZLA D;  3TU4 D;  1WWS A;  1F66 A;  5AV6 B;  3VH6 T;  3KSY A;  1B6W A;  3A6N A;  3V9R B;  3WTP B;  3O62 A;  3AN2 C;  5AVC A;  5B2I C;  3UT9 A;  1R4V A;  5E5A C;  4HGA C;  5AVB B;  3W97 C;  3W99 B;  5GSU D;  4R8P B;  4H9R A;  1P3L B;  1KX5 C;  2RVQ D;  5CPI A;  2PYO A;  4Z66 C;  1F66 B;  4H9N B;  5AY8 B;  3TU4 C;  1P3K D;  2F8N D;  3AZG D;  5JRG D;  4JJN B;  3AZI B;  3MVD A;  3AZL D;  4Z5T B;  5GT0 D;  3AZN D;  3AZK A;  1KX4 A;  5AV5 A;  1M1A C;  3NQU A;  4WV4 B;  3AZM D;  1KX3 D;  2RVQ C;  4KGC D;  1TZY A;  3B0B A;  5B0Z D;  1M19 A;  2BYM B;  2LY8 A;  3KUY B;  3AFA A;  2NQB A;  5B31 G;  2CV5 A;  3REH A;  3LZ0 B;  3MGQ D;  1P3K C;  1N1J A;  1AOI A;  3AZG C;  5AVB D;  1JFI A;  3W99 D;  4R8P D;  5JRG C;  3MNN A;  5B40 C;  3AZL C;  5GT0 C;  3UTA A;  1EQZ C;  4ZUX A;  5CPK A;  1P3B B;  3AZM C;  1F66 D;  1KX3 C;  4YS3 A;  3A6N D;  3MGP A;  5B31 A;  3O62 D;  5BT1 D;  4H9S C;  4WU9 B;  4KGC C;  5AVC D;  3REH B;  3UT9 D;  3MGS B;  5B0Z C;  5B2I A;  3MGQ C;  3UTA B;  5JA4 A;  3AYW B;  5CPI D;  4WU8 B;  5B1L A;  2PYO D;  4ZUX B;  1KX5 A;  1P3F B;  1BH9 A;  4Z66 A;  1H3O B;  4EO5 C;  1P3G A;  3A6N C;  4J8W A;  4XUJ C;  5BT1 C;  4J8V A;  3AN2 B;  5AVC C;  3AV2 A;  1P3A C;  3UT9 C;  3MVD D;  5E5A B;  4HGA B;  3AZK D;  1KX4 D;  3X1S B;  3W97 B;  5AV5 D;  1P3O C;  1KX5 B;  1BH9 B;  5CPI C;  1P3M A;  1M1A A;  1TZY D;  2F8N K;  4X23 A;  3B0C W;  3TU4 B;  1M19 D;  2NQB D;  3AFA D;  2CV5 D;  3VH5 A;  1AOI D;  5C3I C;  1F1E A;  4H9P A;  2HIO A;  3MNN D;  1S32 D;  5B0Y A;  3MVD C;  5KDM B;  3AZK C;  1KX4 C;  1BH8 B;  5AV5 C;  5B40 A;  4ZUX D;  3REL A;  5CPK D;  4YS3 D;  1EQZ A;  3MGP D;  3NQJ A;  5B31 D;  1TZY C;  3X1U C;  5G49 B;  2F8N H;  1M19 C;  2NQB C;  3AFA C;  4H9S A;  2CV5 C;  5B2I D;  3R45 A;  1P3K B;  1AOI C;  1A7W A;  3AZG B;  3C1C A;  2F8N B;  3WAA C;  5JRG B;  3MNN C;  1S32 C;  1HTA A;  5B1L D;  4H9Q B;  4KHA A;  3VH5 W;  3AZL B;  3X1V C;  4LD9 A;  5GT0 B;  3AZN B;  5CPK C;  4Z66 D;  3AZM B;  1BFM A;  1KX3 B;  4YS3 C;  1M18 A;  5CPJ C;  1P3G D;  4J8W D;  3MGP C;  5B31 C;  2NZD A;  4J8V D;  4KGC B;  3AZF A;  3AV2 D;  4QLC A;  5BNV A;  4XUJ A;  5B0Z B;  4M6B A;  1P3A A;  3MGQ B;  4J8X A;  4KHA B;  4AWL C;  1P3M D;  1M1A D;  5B1L C;  1P3O A;  4UUZ B;  3B6G A;  4X23 D;  3LZ1 A; 
#chains in the Genus database with same CATH topology
 2J8P A;  3AV1 A;  2ARO A;  1P3G C;  4EO5 B;  4J8W C;  4G92 B;  3A6N B;  2HIO D;  4WNN A;  2ZY3 A;  3O62 B;  4J8V C;  3AV2 C;  5AVC B;  5B0Y D;  2HUE C;  3UT9 B;  1P3A B;  4J8U C;  5CP6 A;  5GXQ A;  5B40 D;  3REL D;  4H9R B;  1P34 A;  3KWQ A;  1P3O B;  1EQZ D;  1P3M C;  5CPI B;  2PYO B;  1U35 A;  4X23 C;  3REI A;  3AZE A;  1P3P A;  2Y2K A;  3X1U A;  4WNN B;  3REJ C;  5C3I B;  3C1C D;  2YFV A;  2HIO C;  3LEL A;  5B0Y C;  3MVD B;  4LD9 D;  3WAA A;  3AZK B;  1KX4 B;  1S32 A;  5AV5 B;  3REL C;  3NQU B;  3X1V A;  4YM6 A;  1ID3 A;  3B6F A;  1M18 D;  2NZD D;  3C1B C;  1TZY B;  2CWE A;  3AZF D;  3W98 A;  4QLC D;  2Y2J A;  1HQ3 A;  5CPJ A;  5DNN A;  4XUJ D;  1M19 B;  3UTB C;  2NQB B;  3AFA B;  2CV5 B;  1P3A D;  2BG1 A;  4J8X D;  1N1J B;  1AOI B;  5B33 A;  2JE5 A;  5B32 G;  3C1C C;  3LJA A;  1JFI B;  3WAA B;  3MNN B;  3AZH A;  1S32 B;  1P3O D;  3B6G D;  4LD9 C;  3LZ1 D;  5B24 A;  3AV1 D;  5CPK B;  3P5J B;  2ARO D;  4YS3 B;  1M18 C;  2NZD C;  2Y2P A;  5B31 B;  3MGP B;  3AZF C;  5GT3 D;  2DQN C;  4QLC C;  5B32 A;  5GXQ D;  5CP6 D;  5B2I B;  2BYK A;  1P34 D;  3WKJ A;  3KWQ D;  4J8X C;  4J8U A;  5B2J A;  4AWL B;  5JA4 B;  4CAY A;  5B1L B;  3B6G C;  4H9O A;  1U35 D;  3REI D;  3LZ1 C;  3AZE D;  1ULY A;  1P3P D;  2UWX A;  3X1U D;  3AV1 C;  2IO5 C;  4CSR A;  4Z66 B;  2ARO C;  2FJ7 A;  4E45 A;  1P3G B;  4J8W B;  4J8V B;  5DNM A;  3LEL D;  5GT3 C;  3AV2 B;  3KXB A;  2HUE B;  5BO0 A;  3VH6 A;  3REJ A;  3W96 A;  3WAA D;  5GXQ C;  5CP6 C;  5AV9 C;  3AZJ A;  1KU5 A;  2YFW A;  1P34 C;  4G91 C;  3KWQ C;  3X1V D;  4YM6 D;  1ID3 D;  3B6F D;  3B0D C;  3H0M C;  3AZI C;  1P3M B;  1M1A B;  3W98 D;  1U35 C;  4Z2M G;  3REI C;  4X23 B;  1HQ3 D;  5CPJ D;  5DNN D;  3MGR A;  3AZE C;  1P3P C;  5F99 A;  3C1B A;  3IP4 C;  3WA9 A;  1Z2C B;  1P3I A;  5B33 D;  3REJ B;  3UTB A;  3LJA D;  4H9P B;  2HIO B;  5BNX A;  3LEL C;  3AZH D;  5B0Y B;  4KUD A;  5B24 D;  3B0C T;  3LZ0 C;  5B40 B;  3REL B;  3X1T A;  4YM6 C;  1ID3 C;  3B6F C;  1EQZ B;  3H0L C;  3NQJ B;  5CHL B;  3WTP E;  3REK C;  3W98 C;  1TAF A;  1HQ3 C;  5B32 D;  5DNN C;  5AV8 A;  2L5A A;  3WKJ D;  4Z2M H;  3R45 B;  5B2J D;  4J8U D;  5B33 C;  3C1C B;  3LJA C;  5AV6 A;  3AZH C;  3V9R A;  3A1I A;  3EG5 B;  5B24 C;  3WTP A;  4LD9 B;  5B1M C;  4NFT A;  1W2E A;  2FJ7 D;  4ZBJ C;  1M18 B;  4WU8 C;  1P3L A;  2NZD B;  5DNM D;  3AZF B;  3KXB D;  3REJ D;  4QLC B;  5B32 C;  5BNV B;  2ZY5 A;  3W96 D;  3VH5 T;  4XUJ B;  5GT3 A;  4H9N A;  5AY8 A;  3AZJ D;  3WKJ C;  4J8X B;  5B2J C;  5AV9 A;  3B6G B;  4JJN A;  3LZ1 B;  3X1S C;  3MGR D;  3AZI A;  4XZQ D;  4Z5T A;  5F99 D;  3C1B D;  3AV1 B;  5BS7 A;  2IO5 B;  3WA9 D;  2FJ7 C;  2ARO B;  1P3I D;  4WZS B;  2Y2O A;  3UTB D;  5DNM C;  5GT3 B;  1ZLA C;  3KXB C;  4KUD D;  3W96 C;  5GXQ B;  5CP6 B;  5AV9 B;  3AZJ C;  4NE6 A;  2BYM A;  3X1T D;  4G91 B;  3KWQ B;  3KUY A;  1P34 B;  3B0D B;  3LZ0 A;  1U35 B;  3REI B;  5GSU C;  3MGR C;  5AV8 D;  4XZQ C;  3AZE B;  5F99 C;  1P3P B;  3REK A;  1B67 A;  3X1U B;  3WA9 C;  4NE5 A;  1P3I C;  1P3B A;  2YFV B;  5AV6 D;  3AL0 C;  3LEL B;  4KUD C;  3WTP D;  4WU9 A;  3EPJ A;  3MGS A;  2Y2M A;  3X1T C;  3X1V B;  4YM6 B;  1ID3 B;  3B6F B;  5B1M A;  1P3L D;  1WWI A;  5FUG A;  3REK B;  3AZN C;  3W98 B;  3AYW A;  1HQ3 B;  4WU8 A;  2Y2N A;  5DNN B;  5AV8 C;  4DRA A;  5CPJ B;  1P3F A;  5AY8 D;  5B33 B;  5AV6 C;  5AV9 D;  3LJA B;  1H3O A;  3AZH B;  2Y2G A;  3WTP C;  4JJN D;  5B24 B;  3AN2 A;  3AZI D;  5B1M B;  4Z5T D;  5FUG B;  5E5A A;  5AVB C;  3W99 C;  3X1S A;  4R8P C;  3W97 A;  4ZBJ B;  4E44 A;  1P3L C;  2ZY4 A;  5B32 B;  1F66 C;  5AY8 C;  3EPK A;  3FDD A;  3TU4 A;  2BYK B;  2XD1 A;  3KUY D;  4G92 C;  1ZLA A;  3WKJ B;  3EPH A;  4J8U B;  5B2J B;  3O62 C;  3LZ0 D;  4CAY B;  4H9O B;  4JJN C;  2Y2Q A;  2RIQ A;  4Z5T C;  3REK D;  2F2A C;  5KDM A;  2F8N G;  5BS7 C;  4CSR B;  2FJ7 B;  1BH8 A;  5GSU A;  4XZQ A;  1P3B D;  2PYO C;  5DNM B;  1PZR A;  4DRB A;  1ZLA B;  4WU9 D;  5BO0 B;  3KXB B;  3W96 B;  3REH D;  5G49 A;  2JCH A;  3MGS D;  3AZJ B;  2YFW B;  3KUY C;  5B1M D;  1P3K A;  4DQY B;  2F8N A;  3AZG A;  3UTA D;  3VH6 W;  5JRG A;  3AYW D;  4WU8 D;  5GSU B;  4H9Q A;  3MGR B;  4XZQ B;  3AZL A;  4NE3 A;  1Q9C A;  5GT0 A;  5F99 B;  3C1B B;  3AZN A;  1P3F D;  3WA9 B;  1P3I B;  1P3B C;  2XD5 A;  3UTB B;  3AZM A;  1KX3 A;  5BNX B;  4WU9 C;  4KUD B;  4KGC A;  3AN2 D;  3REH C;  3MGS C;  5E5A D;  5B0Z A;  3X1T B;  3X1S D;  3W97 D;  3MGQ A;  1KX5 D;  5AVB A;  3UTA C;  4R8P A;  1TAF B;  3W99 A;  3AYW C;  4ZUX C;  4UUZ A;  5AV8 B;  1P3F C;  2JSS A;  1ZLA D;  3TU4 D;  3KFU G;  1WWS A;  1F66 A;  5AV6 B;  3VH6 T;  1T3U A;  3KSY A;  1B6W A;  3A6N A;  2Y2L A;  3WTP B;  3V9R B;  3O62 A;  3AN2 C;  5AVC A;  5B2I C;  3UT9 A;  1R4V A;  5E5A C;  4HGA C;  5AVB B;  3W97 C;  3W99 B;  5GSU D;  4R8P B;  4H9R A;  1P3L B;  1KX5 C;  2RVQ D;  5CPI A;  3F6T A;  2PYO A;  4Z66 C;  1F66 B;  5AY8 B;  4H9N B;  3TU4 C;  1P3K D;  2F8N D;  3AZG D;  2DF4 C;  5JRG D;  4JJN B;  2G5I C;  3AZI B;  3MVD A;  3AZL D;  4Z5T B;  5GT0 D;  3AZN D;  3AZK A;  1KX4 A;  5AV5 A;  1M1A C;  3NQU A;  4WV4 B;  3AZM D;  1KX3 D;  2RVQ C;  4KGC D;  1TZY A;  3B0B A;  5B0Z D;  1M19 A;  2BYM B;  2LY8 A;  3KUY B;  3AFA A;  2NQB A;  5B31 G;  2CV5 A;  3REH A;  3LZ0 B;  3MGQ D;  1P3K C;  1N1J A;  1AOI A;  3AZG C;  5AVB D;  2FFF B;  3W99 D;  4R8P D;  1JFI A;  5JRG C;  3MNN A;  5B40 C;  3AZL C;  5GT0 C;  3UTA A;  1EQZ C;  4ZUX A;  5CPK A;  1P3B B;  3AZM C;  1F66 D;  1KX3 C;  4YS3 A;  2ZM5 A;  2ZY2 A;  3A6N D;  3MGP A;  5B31 A;  3O62 D;  5BT1 D;  4H9S C;  4WU9 B;  4KGC C;  5AVC D;  3REH B;  3UT9 D;  3MGS B;  5B0Z C;  5B2I A;  3MGQ C;  3UTA B;  5JA4 A;  3AYW B;  5CPI D;  4WU8 B;  5B1L A;  2PYO D;  4ZUX B;  1KX5 A;  1P3F B;  1BH9 A;  2VQR A;  4Z66 A;  1H3O B;  2W8S A;  4EO5 C;  1P3G A;  3A6N C;  4J8W A;  4XUJ C;  5BT1 C;  4J8V A;  3AN2 B;  5AVC C;  3AV2 A;  1P3A C;  3UT9 C;  3MVD D;  5E5A B;  4HGA B;  3AZK D;  1KX4 D;  3X1S B;  3W97 B;  5AV5 D;  1P3O C;  1KX5 B;  1BH9 B;  5CPI C;  1P3M A;  1M1A A;  4WJ3 C;  1TZY D;  2F8N K;  4X23 A;  3B0C W;  3TU4 B;  1M19 D;  2NQB D;  3AFA D;  2CV5 D;  2Y2I A;  3VH5 A;  1AOI D;  5C3I C;  1F1E A;  4H9P A;  2HIO A;  3MNN D;  1S32 D;  3A1K A;  5B0Y A;  3MVD C;  5KDM B;  3AZK C;  1KX4 C;  1BH8 B;  5AV5 C;  5B40 A;  4ZUX D;  3REL A;  5CPK D;  4YS3 D;  1EQZ A;  3MGP D;  3NQJ A;  5B31 D;  1TZY C;  3X1U C;  5G49 B;  2F8N H;  1M19 C;  2NQB C;  3AFA C;  4H9S A;  2CV5 C;  5B2I D;  3EPL A;  4UPK A;  3R45 A;  1P3K B;  1AOI C;  1A7W A;  3AZG B;  3C1C A;  2F8N B;  3WAA C;  5JRG B;  3MNN C;  1S32 C;  1HTA A;  5B1L D;  4H9Q B;  4KHA A;  2G5H C;  3VH5 W;  3AZL B;  3X1V C;  4LD9 A;  5GT0 B;  3AZN B;  3H0R C;  5CPK C;  4Z66 D;  3AZM B;  1BFM A;  1KX3 B;  4YS3 C;  1M18 A;  5CPJ C;  1P3G D;  4J8W D;  3MGP C;  5B31 C;  2NZD A;  4J8V D;  4KGC B;  3AZF A;  3AV2 D;  4QLC A;  5BNV A;  4XUJ A;  5B0Z B;  4M6B A;  2Y2H A;  1P3A A;  3MGQ B;  4J8X A;  4KHA B;  4AWL C;  1P3M D;  1M1A D;  5B1L C;  1P3O A;  4UUZ B;  3B6G A;  4X23 D;  3LZ1 A; 
#chains in the Genus database with same CATH homology
 2J8P A;  3AV1 A;  2ARO A;  1P3G C;  4EO5 B;  4J8W C;  4G92 B;  3A6N B;  2HIO D;  4WNN A;  2ZY3 A;  3O62 B;  4J8V C;  3AV2 C;  5AVC B;  5B0Y D;  2HUE C;  3UT9 B;  1P3A B;  4J8U C;  5CP6 A;  5GXQ A;  5B40 D;  3REL D;  4H9R B;  1P34 A;  3KWQ A;  1P3O B;  1EQZ D;  1P3M C;  5CPI B;  2PYO B;  1U35 A;  4X23 C;  3REI A;  3AZE A;  1P3P A;  2Y2K A;  3X1U A;  4WNN B;  3REJ C;  5C3I B;  3C1C D;  2YFV A;  2HIO C;  3LEL A;  5B0Y C;  3MVD B;  4LD9 D;  3WAA A;  3AZK B;  1KX4 B;  1S32 A;  5AV5 B;  3REL C;  3NQU B;  3X1V A;  4YM6 A;  1ID3 A;  3B6F A;  1M18 D;  2NZD D;  3C1B C;  1TZY B;  2CWE A;  3AZF D;  3W98 A;  4QLC D;  2Y2J A;  1HQ3 A;  5CPJ A;  5DNN A;  4XUJ D;  1M19 B;  3UTB C;  2NQB B;  3AFA B;  2CV5 B;  1P3A D;  2BG1 A;  4J8X D;  1N1J B;  1AOI B;  5B33 A;  2JE5 A;  5B32 G;  3C1C C;  3LJA A;  1JFI B;  3WAA B;  3MNN B;  3AZH A;  1S32 B;  1P3O D;  3B6G D;  4LD9 C;  3LZ1 D;  5B24 A;  3AV1 D;  5CPK B;  3P5J B;  2ARO D;  4YS3 B;  1M18 C;  2NZD C;  2Y2P A;  5B31 B;  3MGP B;  3AZF C;  5GT3 D;  2DQN C;  4QLC C;  5B32 A;  5GXQ D;  5CP6 D;  5B2I B;  2BYK A;  1P34 D;  3WKJ A;  3KWQ D;  4J8X C;  4J8U A;  5B2J A;  4AWL B;  5JA4 B;  4CAY A;  5B1L B;  3B6G C;  4H9O A;  1U35 D;  3REI D;  3LZ1 C;  3AZE D;  1ULY A;  1P3P D;  2UWX A;  3X1U D;  3AV1 C;  2IO5 C;  4CSR A;  4Z66 B;  2ARO C;  2FJ7 A;  4E45 A;  1P3G B;  4J8W B;  4J8V B;  5DNM A;  3LEL D;  5GT3 C;  3AV2 B;  3KXB A;  2HUE B;  5BO0 A;  3VH6 A;  3REJ A;  3W96 A;  3WAA D;  5GXQ C;  5CP6 C;  5AV9 C;  3AZJ A;  1KU5 A;  2YFW A;  1P34 C;  4G91 C;  3KWQ C;  3X1V D;  4YM6 D;  1ID3 D;  3B6F D;  3B0D C;  3H0M C;  3AZI C;  1P3M B;  1M1A B;  3W98 D;  1U35 C;  4Z2M G;  3REI C;  4X23 B;  1HQ3 D;  5CPJ D;  5DNN D;  3MGR A;  3AZE C;  1P3P C;  5F99 A;  3C1B A;  3IP4 C;  3WA9 A;  1Z2C B;  1P3I A;  5B33 D;  3REJ B;  3UTB A;  3LJA D;  4H9P B;  2HIO B;  5BNX A;  3LEL C;  3AZH D;  5B0Y B;  4KUD A;  5B24 D;  3B0C T;  3LZ0 C;  5B40 B;  3REL B;  3X1T A;  4YM6 C;  1ID3 C;  3B6F C;  1EQZ B;  3H0L C;  3NQJ B;  5CHL B;  3WTP E;  3REK C;  3W98 C;  1TAF A;  1HQ3 C;  5B32 D;  5DNN C;  5AV8 A;  2L5A A;  3WKJ D;  4Z2M H;  3R45 B;  5B2J D;  4J8U D;  5B33 C;  3C1C B;  3LJA C;  5AV6 A;  3AZH C;  3V9R A;  3A1I A;  3EG5 B;  5B24 C;  3WTP A;  4LD9 B;  5B1M C;  4NFT A;  1W2E A;  2FJ7 D;  4ZBJ C;  1M18 B;  4WU8 C;  1P3L A;  2NZD B;  5DNM D;  3AZF B;  3KXB D;  3REJ D;  4QLC B;  5B32 C;  5BNV B;  2ZY5 A;  3W96 D;  3VH5 T;  4XUJ B;  5GT3 A;  4H9N A;  5AY8 A;  3AZJ D;  3WKJ C;  4J8X B;  5B2J C;  5AV9 A;  3B6G B;  4JJN A;  3LZ1 B;  3X1S C;  3MGR D;  3AZI A;  4XZQ D;  4Z5T A;  5F99 D;  3C1B D;  3AV1 B;  5BS7 A;  2IO5 B;  3WA9 D;  2FJ7 C;  2ARO B;  1P3I D;  4WZS B;  2Y2O A;  3UTB D;  5DNM C;  5GT3 B;  1ZLA C;  3KXB C;  4KUD D;  3W96 C;  5GXQ B;  5CP6 B;  5AV9 B;  3AZJ C;  4NE6 A;  2BYM A;  3X1T D;  4G91 B;  3KWQ B;  3KUY A;  1P34 B;  3B0D B;  3LZ0 A;  1U35 B;  3REI B;  5GSU C;  3MGR C;  5AV8 D;  4XZQ C;  3AZE B;  5F99 C;  1P3P B;  3REK A;  1B67 A;  3X1U B;  3WA9 C;  4NE5 A;  1P3I C;  1P3B A;  2YFV B;  5AV6 D;  3AL0 C;  3LEL B;  4KUD C;  3WTP D;  4WU9 A;  3EPJ A;  3MGS A;  2Y2M A;  3X1T C;  3X1V B;  4YM6 B;  1ID3 B;  3B6F B;  5B1M A;  1P3L D;  1WWI A;  5FUG A;  3REK B;  3AZN C;  3W98 B;  3AYW A;  1HQ3 B;  4WU8 A;  2Y2N A;  5DNN B;  5AV8 C;  4DRA A;  5CPJ B;  1P3F A;  5AY8 D;  5B33 B;  5AV6 C;  5AV9 D;  3LJA B;  1H3O A;  3AZH B;  2Y2G A;  3WTP C;  4JJN D;  5B24 B;  3AN2 A;  3AZI D;  5B1M B;  4Z5T D;  5FUG B;  5E5A A;  5AVB C;  3W99 C;  3X1S A;  4R8P C;  3W97 A;  4ZBJ B;  4E44 A;  1P3L C;  2ZY4 A;  5B32 B;  1F66 C;  5AY8 C;  3EPK A;  3FDD A;  3TU4 A;  2BYK B;  2XD1 A;  3KUY D;  4G92 C;  1ZLA A;  3WKJ B;  3EPH A;  4J8U B;  5B2J B;  3O62 C;  3LZ0 D;  4CAY B;  4H9O B;  4JJN C;  2Y2Q A;  2RIQ A;  4Z5T C;  3REK D;  2F2A C;  5KDM A;  2F8N G;  5BS7 C;  4CSR B;  2FJ7 B;  1BH8 A;  5GSU A;  4XZQ A;  1P3B D;  2PYO C;  5DNM B;  1PZR A;  4DRB A;  1ZLA B;  4WU9 D;  5BO0 B;  3KXB B;  3W96 B;  3REH D;  5G49 A;  2JCH A;  3MGS D;  3AZJ B;  2YFW B;  3KUY C;  5B1M D;  1P3K A;  4DQY B;  2F8N A;  3AZG A;  3UTA D;  3VH6 W;  5JRG A;  3AYW D;  4WU8 D;  5GSU B;  4H9Q A;  3MGR B;  4XZQ B;  3AZL A;  4NE3 A;  1Q9C A;  5GT0 A;  5F99 B;  3C1B B;  3AZN A;  1P3F D;  3WA9 B;  1P3I B;  1P3B C;  2XD5 A;  3UTB B;  3AZM A;  1KX3 A;  5BNX B;  4WU9 C;  4KUD B;  4KGC A;  3AN2 D;  3REH C;  3MGS C;  5E5A D;  5B0Z A;  3X1T B;  3X1S D;  3W97 D;  3MGQ A;  1KX5 D;  5AVB A;  3UTA C;  4R8P A;  1TAF B;  3W99 A;  3AYW C;  4ZUX C;  4UUZ A;  5AV8 B;  1P3F C;  2JSS A;  1ZLA D;  3TU4 D;  3KFU G;  1WWS A;  1F66 A;  5AV6 B;  3VH6 T;  1T3U A;  3KSY A;  1B6W A;  3A6N A;  2Y2L A;  3WTP B;  3V9R B;  3O62 A;  3AN2 C;  5AVC A;  5B2I C;  3UT9 A;  1R4V A;  5E5A C;  4HGA C;  5AVB B;  3W97 C;  3W99 B;  5GSU D;  4R8P B;  4H9R A;  1P3L B;  1KX5 C;  2RVQ D;  5CPI A;  3F6T A;  2PYO A;  4Z66 C;  1F66 B;  5AY8 B;  4H9N B;  3TU4 C;  1P3K D;  2F8N D;  3AZG D;  2DF4 C;  5JRG D;  4JJN B;  2G5I C;  3AZI B;  3MVD A;  3AZL D;  4Z5T B;  5GT0 D;  3AZN D;  3AZK A;  1KX4 A;  5AV5 A;  1M1A C;  3NQU A;  4WV4 B;  3AZM D;  1KX3 D;  2RVQ C;  4KGC D;  1TZY A;  3B0B A;  5B0Z D;  1M19 A;  2BYM B;  2LY8 A;  3KUY B;  3AFA A;  2NQB A;  5B31 G;  2CV5 A;  3REH A;  3LZ0 B;  3MGQ D;  1P3K C;  1N1J A;  1AOI A;  3AZG C;  5AVB D;  2FFF B;  3W99 D;  4R8P D;  1JFI A;  5JRG C;  3MNN A;  5B40 C;  3AZL C;  5GT0 C;  3UTA A;  1EQZ C;  4ZUX A;  5CPK A;  1P3B B;  3AZM C;  1F66 D;  1KX3 C;  4YS3 A;  2ZM5 A;  2ZY2 A;  3A6N D;  3MGP A;  5B31 A;  3O62 D;  5BT1 D;  4H9S C;  4WU9 B;  4KGC C;  5AVC D;  3REH B;  3UT9 D;  3MGS B;  5B0Z C;  5B2I A;  3MGQ C;  3UTA B;  5JA4 A;  3AYW B;  5CPI D;  4WU8 B;  5B1L A;  2PYO D;  4ZUX B;  1KX5 A;  1P3F B;  1BH9 A;  2VQR A;  4Z66 A;  1H3O B;  2W8S A;  4EO5 C;  1P3G A;  3A6N C;  4J8W A;  4XUJ C;  5BT1 C;  4J8V A;  3AN2 B;  5AVC C;  3AV2 A;  1P3A C;  3UT9 C;  3MVD D;  5E5A B;  4HGA B;  3AZK D;  1KX4 D;  3X1S B;  3W97 B;  5AV5 D;  1P3O C;  1KX5 B;  1BH9 B;  5CPI C;  1P3M A;  1M1A A;  4WJ3 C;  1TZY D;  2F8N K;  4X23 A;  3B0C W;  3TU4 B;  1M19 D;  2NQB D;  3AFA D;  2CV5 D;  2Y2I A;  3VH5 A;  1AOI D;  5C3I C;  1F1E A;  4H9P A;  2HIO A;  3MNN D;  1S32 D;  3A1K A;  5B0Y A;  3MVD C;  5KDM B;  3AZK C;  1KX4 C;  1BH8 B;  5AV5 C;  5B40 A;  4ZUX D;  3REL A;  5CPK D;  4YS3 D;  1EQZ A;  3MGP D;  3NQJ A;  5B31 D;  1TZY C;  3X1U C;  5G49 B;  2F8N H;  1M19 C;  2NQB C;  3AFA C;  4H9S A;  2CV5 C;  5B2I D;  3EPL A;  4UPK A;  3R45 A;  1P3K B;  1AOI C;  1A7W A;  3AZG B;  3C1C A;  2F8N B;  3WAA C;  5JRG B;  3MNN C;  1S32 C;  1HTA A;  5B1L D;  4H9Q B;  4KHA A;  2G5H C;  3VH5 W;  3AZL B;  3X1V C;  4LD9 A;  5GT0 B;  3AZN B;  3H0R C;  5CPK C;  4Z66 D;  3AZM B;  1BFM A;  1KX3 B;  4YS3 C;  1M18 A;  5CPJ C;  1P3G D;  4J8W D;  3MGP C;  5B31 C;  2NZD A;  4J8V D;  4KGC B;  3AZF A;  3AV2 D;  4QLC A;  5BNV A;  4XUJ A;  5B0Z B;  4M6B A;  2Y2H A;  1P3A A;  3MGQ B;  4J8X A;  4KHA B;  4AWL C;  1P3M D;  1M1A D;  5B1L C;  1P3O A;  4UUZ B;  3B6G A;  4X23 D;  3LZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...