1N1QA

Crystal structure of a dps protein from bacillus brevis
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
149
structure length
149
Chain Sequence
MKTSIQQLVAVLLNRQVANWVVLYVKLHNFHWNVNGPNFFTLHEKFEELYTEASGHIDTLAERVLSIGGSPIATLAASLEEASIKEATGGESAAEMVSSVVNDFVDLVGELKVARDVADEADDEATADMLDAIEAGLEKHVWMLEAFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DPS Protein
publication title The Multi-layered Structure of Dps with a Novel Di-nuclear Ferroxidase Center
pubmed doi rcsb
molecule tags Unknown function
total genus 65
structure length 149
sequence length 149
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 1n1qA00
3BKNA 2GS4A 1LB3A 1O9RA 5FFCA 4RC5B 4ZKHA 4MJYA 5J93A 2CN6A 2WLAA 3BVIA 3KWOA 2ZG7X 5JKMA 1F30A 5FFBA 5K53A 4KVRA 4XKSA 3F35A 3PWQA 2ZG9X 4LQHA 4LPJA 2BKCA 4ZL5A 2GYDA 5FFAA 1YUXA 3NP2X 1IERA 3ISFA 4RC6A 3HIUA 1DATA 4M33A 3PVRA 1RYTA 4CVPA 3IQ1A 2V15A 3E1QA 3T9JA 3PVTB 1R03A 3BVKA 3FVBA 2CHIA 2OC5A 2W0OA 4ZMCA 1MFRA 5J9VA 3PZAA 3E6RA 4IWKA 1IESA 2QQYA 4R42A 5K52A 4ITTA 3PWQC 2V2NA 4REUA 5D8XA 3R2HA 4MUDA 3O7SA 1YUZA 1TK6A 2V2OA 5I4JA 4M32A 1OTKA 4MKUA 4RC6B 3SE1A 5GU3X 4ML5A 1DVBA 4M35A 3R2KA 3PVRB 3RAVA 4LPNA 4DYXA 5ERJA 4CYAA 4XKTA 1SOFA 1UVHA 1S2ZA 4DASA 2CHPA 4AM5A 1NF4A 4TOEA 1Z6OM 1VELA 2CIHA 4CY9A 1L8IA 3OGHA 3QHCA 4CYBA 3NP0X 2IB0A 3AJPA 2VZBA 2D5KA 1JKVA 4RC8A 4ETRA 3AF8X 1BFRA 2V2IA 1LKMA 3H7GA 4A25A 4TODA 1NNQA 2ZA8A 5JACA 4LQVA 3PWFA 1AEWA 2VXIA 3BVLA 1VLGA 3EGMA 2YW7A 2HR5A 1QYBA 4CMYV 3GVYA 1KRQA 5AXSA 2FHAA 3AF9X 4IWJA 1ZUJA 4TO9A 2FJCA 3ERZA 2FZFA 3O7RA 5GOUA 3E6SA 4DYUA 3F34A 4ZKWA 3GHQA 1RCIA 3F32A 4CVTA 2CLBA 5CMQA 4Z5SA 3E1LA 4ZKXA 2C2JA 3E1NA 3U90A 4ISMA 5GU2X 1JREA 4RC7A 3UOIA 1UMNA 1H96A 3AK9A 3KX9A 5C6FA 2PYBA 3VNXA 2XJMA 2JD70 4PGKA 5FFEA 1NFVA 4LYXA 4ZJKA 4QUWA 4PGIA 3R2MA 4EVBA 4DZ0A 5GU1X 4TOHA 4EVEA 2XJOA 3ES3A 2F7NA 3QVDA 3BVFA 3UNOA 4M34A 3QHBA 5GU0X 1BCFA 5LBHA 2C2UA 1JIGA 4MN9A 2GYQA 4RC7B 3QZ3A 4LYUA 1Z4AA 2CLUA 2FL0A 1F33A 3OJ5A 3PVYA 5FEJA 3R2SA 3EZ0A 2ZA7A 1NF6A 4KVQA 5GN8A 4DI0A 3KA4A 1FHAA 3PW1A 2ZURX 2YJJA 4ZL6A 3ISEA 1TKPA 5LG8A 3RD0A 3F36A 3KA6A 3WNWA 3HL1A 4LQJA 3IS7A 3Q4OA 5HQOA 1J30A 3FSEA 2Z5PA 1SQ3A 3SIDA 3E1MA 4ISPA 4CVSA 2JD80 3AF7X 3BVEA 2JD60 2Y3QA 3PVYB 2XKQA 3KA3A 4LPMA 5D8SA 2C41A 3Q4QA 4TOAA 1VJXA 5GN8B 2FG8A 4TOCA 2ZG8X 3PW1B 1ZS3A 3SHXA 1JYBA 1RCDA 3QD8A 3AJQA 3KA8A 1JI4A 2ITBA 2XGWA 4CVRA 3WVVA 3TA8A 5D8RA 2IU2A 2CN7A 3F39A 4YKHA 1O9IA 1Z6OA 2CF7A 3IS8A 3R2RA 3UOFA 3E1OA 4OYNA 2QF9A 3WVUA 3A9QA 1LKOA 3GE4A 4XKUA 5CZUA 4U3GA 3NOZX 2OH3A 5HJHA 5D8QA 2IY4A 2YJKA 5JKLG 2VXXA 2G4HA 2XJNA 2V2LA 2BW1A 2V2PA 5ERKA 1LKPA 2UX1A 4IXKA 4EVCA 2YW6A 3E2CA 4TOFA 3MPSA 1HRSA 1XZ3A 2CEIA 2V2RA 1BG7A 3QB9A 5IX6A 1S30A 4CMYA 2WTLA 5LG2A 1TJOA 3WVWA 2FKZA 2BJYA 5D8OA 2BK6A 4Z3BA 3F37A 3SH6A 4EVDA 4TW3A 5JKLA 2HTNA 2FG4A 5LS9A 1N1QA 4ZTTA 1QGHA 3KXUA 3PW8A 4ITWA 1XZ1A 4XGSA 4PG0A 3AJOA 2V2MA 3BT5A 1JI5A 4ERUA 1GWGA 2WLUA 4KVSA 4MY7A 2RBDA 3FI6A 4Y08A 4PG1A 4E6KA 1DPSA 1JTSA 5D8PA 4ZLWA 1YV1A 3RBCA 3PW8C 4II4A 3AK8A 1RCCA 3Q4NA 2Z90A 4DYZA 1RCEA 5J8SA 3R2OA 5J8WA 2Z6MA 4DE6A 2ZA6A 2C2FA 3F38A 3KA9A 5D8YA 5CMRA 2Z5QA 2V2JA 1MOJA 2Z5RA 1RCGA 3F33A 1EUMA 3E1JA 1TKOA 4RC5A 4AM4A 1L8HA 3R2LA 1S3QA 2V2SA 1JKUA 3Q4RA 5E2DA 5FFDA 3RE7A 2C6RA 4TOGA 1VEQA 1VEIA 4II4B 1JGCA 2X170 3E1PA 4TOBA 3A68A 5JKMG 2FFXJ 5E1UA 1B71A 4P18A 5HJFA 4DYYA 4AM2A 4LQNA 3EZUA 3RGDA 3PVTA
chains in the Genus database with same CATH superfamily
3BKNA 2GS4A 1LB3A 1O9RA 5FFCA 4RC5B 4ZKHA 2OKCA 4MJYA 5J93A 2CN6A 2WLAA 3BVIA 3KWOA 2ZG7X 5JKMA 1F30A 5FFBA 5K53A 4KVRA 5JDOB 4XKSA 3C1YA 3F35A 3PWQA 2ZG9X 4LQHA 4LPJA 2BKCA 4ZL5A 2GYDA 5FFAA 1YUXA 3NP2X 1IERA 3ISFA 4RC6A 3HIUA 1DATA 4M33A 2AR0A 3PVRA 1RYTA 4CVPA 3IQ1A 2V15A 3E1QA 3T9JA 3PVTB 1R03A 3BVKA 3FVBA 3V3KB 2CHIA 2OC5A 2W0OA 4ZMCA 4X0JA 1MFRA 5J9VA 3PZAA 3E6RA 4IWKA 1IESA 2QQYA 4R42A 5K52A 4ITTA 3PWQC 2V2NA 4REUA 4KXRB 5D8XA 3R2HA 4MUDA 3O7SA 1YUZA 1TK6A 2V2OA 3DBYA 5I4JA 4M32A 1OTKA 4MKUA 4RC6B 3SE1A 5GU3X 4ML5A 1DVBA 4M35A 3R2KA 3PVRB 3RAVA 4LPNA 4DYXA 5ERJA 4CYAA 4XKTA 1SOFA 1UVHA 1S2ZA 4DASA 2CHPA 4AM5A 4YXJA 1NF4A 4TOEA 1Z6OM 1VELA 2CIHA 4CY9A 1L8IA 3OGHA 3QHCA 4CYBA 5HU6D 3NP0X 2IB0A 3AJPA 3C21A 2VZBA 2D5KA 1JKVA 4RC8A 4ETRA 3AF8X 3VV9A 1BFRA 2V2IA 1LKMA 3H7GA 4A25A 4TODA 1NNQA 2ZA8A 5JACA 4LQVA 3PWFA 1AEWA 2VXIA 2N02A 3BVLA 1VLGA 3EGMA 2YW7A 2HR5A 1QYBA 4CMYV 3GVYA 1KRQA 5AXSA 2FHAA 3AF9X 4IWJA 1ZUJA 4TO9A 2G38B 2FJCA 3ERZA 2FZFA 3O7RA 5GOUA 3E6SA 4DYUA 3F34A 4ZKWA 3GHQA 1RCIA 3F32A 4CVTA 2CLBA 5CMQA 4Z5SA 3E1LA 4ZKXA 2C2JA 3E1NA 3U90A 3KHKA 2MGYA 4ISMA 5GU2X 1JREA 3FRRA 4MXPA 4RC7A 3UOIA 1UMNA 1H96A 3JZ9A 3AK9A 3KX9A 5C6FA 3C23A 2PYBA 3VNXA 2XJMA 2JD70 4PGKA 5FFEA 1NFVA 4LYXA 4ZJKA 4QUWA 4PGIA 3R2MA 4EVBA 3D19A 4DZ0A 5GU1X 4TOHA 4EVEA 2XJOA 2WWXB 3ES3A 2F7NA 3QVDA 3BVFA 3UNOA 4M34A 3QHBA 5GU0X 1BCFA 5LBHA 2V8TA 2C2UA 1JIGA 4MN9A 4YVZA 2GYQA 4RC7B 3QZ3A 4LYUA 1Z4AA 2CLUA 2FL0A 1F33A 3OJ5A 3PVYA 5FEJA 3UFBA 3R2SA 3EZ0A 2ZA7A 1NF6A 4KVQA 5GN8A 4DI0A 3KA4A 1FHAA 3PW1A 2ZURX 2YJJA 4ZL6A 3M6JA 3ISEA 1TKPA 3GGYA 5LG8A 3RD0A 3F36A 3KA6A 3WNWA 3HL1A 4LQJA 3IS7A 3Q4OA 5HQOA 1J30A 3FSEA 2Z5PA 1SQ3A 3SIDA 3E1MA 4ISPA 4CVSA 2JD80 3AF7X 3BVEA 2JD60 2Y3QA 3PVYB 2XKQA 3KA3A 4LPMA 5D8SA 2C41A 3Q4QA 4TOAA 1VJXA 5GN8B 2FG8A 4TOCA 2ZG8X 3PW1B 1ZS3A 3SHXA 1JYBA 1RCDA 3QD8A 4W4KB 3AJQA 3KA8A 1JI4A 2ITBA 2XGWA 4CVRA 3WVVA 3TA8A 5D8RA 2IU2A 2CN7A 3F39A 4YKHA 1O9IA 1Z6OA 2CF7A 3IS8A 3R2RA 3UOFA 3E1OA 4OYNA 2QF9A 3WVUA 3A9QA 1LKOA 3GE4A 3GGZA 4XKUA 5CZUA 4U3GA 3NOZX 2OH3A 5HJHA 5D8QA 3L0MA 2IY4A 2YJKA 5JKLG 2VXXA 4E40A 2G4HA 2XJNA 2V2LA 2BW1A 2V2PA 3VVAA 5ERKA 1LKPA 3JZAB 2UX1A 4IXKA 4EVCA 2YW6A 3E2CA 4TOFA 3MPSA 1HRSA 1XZ3A 2CEIA 3C1ZA 2V2RA 1BG7A 3QB9A 5IX6A 1S30A 4CMYA 2WTLA 3LKDA 5LG2A 1TJOA 3WVWA 2FKZA 2BJYA 5D8OA 2BK6A 3W54A 3F37A 4Z3BA 3SH6A 4EVDA 4TW3A 5JKLA 2HTNA 2FG4A 5LS9A 1N1QA 4ZTTA 1QGHA 2V8UA 3KXUA 3PW8A 4ITWA 1XZ1A 4XGSA 4PG0A 3AJOA 2V2MA 3BT5A 1JI5A 2CWLA 2Y44A 4ERUA 1GWGA 2WLUA 4KVSA 3KDQA 4MY7A 2RBDA 3FI6A 4Y08A 4PG1A 4E6KA 1DPSA 1JTSA 5D8PA 4ZLWA 1YV1A 3RBCA 3PW8C 4II4A 3AK8A 3N6OA 1RCCA 3Q4NA 2Z90A 4DYZA 1RCEA 5J8SA 3R2OA 5J8WA 2Z6MA 4DE6A 2ZA6A 2C2FA 3F38A 3KA9A 5D8YA 5CMRA 2Z5QA 2V2JA 1MOJA 2Z5RA 1RCGA 3F33A 1EUMA 3E1JA 1TKOA 4RC5A 4AM4A 1L8HA 3R2LA 1S3QA 2V2SA 1JKUA 3Q4RA 5E2DA 5FFDA 4YXMA 3RE7A 2C6RA 4TOGA 1VEQA 3FRSA 1VEIA 4II4B 5JDOA 1JGCA 2X170 3E1PA 4TOBA 3A68A 5JKMG 2FFXJ 5E1UA 4W4LB 1B71A 4P18A 5HJFA 4DYYA 4AM2A 4LQNA 3EZUA 3RGDA 3PVTA 4WJG4
chains in the Genus database with same CATH topology
3BKNA 2GS4A 1LB3A 1O9RA 5FFCA 4RC5B 4ZKHA 2OKCA 4MJYA 5J93A 2CN6A 2WLAA 3BVIA 3KWOA 2ZG7X 5JKMA 1F30A 5FFBA 5K53A 4KVRA 5JDOB 4XKSA 3C1YA 3F35A 3PWQA 2ZG9X 4LQHA 4LPJA 2BKCA 4ZL5A 2GYDA 5FFAA 1YUXA 3NP2X 1IERA 3ISFA 4RC6A 3HIUA 1DATA 4M33A 2AR0A 3PVRA 1RYTA 4CVPA 3IQ1A 2V15A 3E1QA 3T9JA 3PVTB 1R03A 3BVKA 3FVBA 3V3KB 2CHIA 2OC5A 2W0OA 4ZMCA 4X0JA 1MFRA 5J9VA 3PZAA 3E6RA 4IWKA 1IESA 2QQYA 4R42A 5K52A 4ITTA 3PWQC 2V2NA 4REUA 4KXRB 5D8XA 3R2HA 4MUDA 3O7SA 1YUZA 1TK6A 2V2OA 3DBYA 5I4JA 4M32A 1OTKA 4MKUA 4RC6B 3SE1A 5GU3X 4ML5A 1DVBA 4M35A 3R2KA 3PVRB 3RAVA 4LPNA 4DYXA 5ERJA 4CYAA 4XKTA 1SOFA 1UVHA 1S2ZA 4DASA 2CHPA 4AM5A 4YXJA 1NF4A 4TOEA 1Z6OM 1VELA 2CIHA 4CY9A 1L8IA 3OGHA 3QHCA 4CYBA 5HU6D 3NP0X 2IB0A 3AJPA 3C21A 2VZBA 2D5KA 1JKVA 4RC8A 4ETRA 3AF8X 3VV9A 1BFRA 2V2IA 1LKMA 3H7GA 4A25A 4TODA 1NNQA 2ZA8A 5JACA 4LQVA 3PWFA 1AEWA 2VXIA 2N02A 3BVLA 1VLGA 3EGMA 2YW7A 2HR5A 1QYBA 4CMYV 3GVYA 1KRQA 5AXSA 2FHAA 3AF9X 4IWJA 1ZUJA 4TO9A 2G38B 2FJCA 3ERZA 2FZFA 3O7RA 5GOUA 3E6SA 4DYUA 3F34A 4ZKWA 3GHQA 1RCIA 3F32A 4CVTA 2CLBA 5CMQA 4Z5SA 3E1LA 4ZKXA 2C2JA 3E1NA 3U90A 3KHKA 2MGYA 4ISMA 5GU2X 1JREA 3FRRA 4MXPA 4RC7A 3UOIA 1UMNA 1H96A 3JZ9A 3AK9A 3KX9A 5C6FA 3C23A 2PYBA 3VNXA 2XJMA 2JD70 4PGKA 5FFEA 1NFVA 4LYXA 4ZJKA 4QUWA 4PGIA 3R2MA 4EVBA 3D19A 4DZ0A 5GU1X 4TOHA 4EVEA 2XJOA 2WWXB 3ES3A 2F7NA 3QVDA 3BVFA 3UNOA 4M34A 3QHBA 5GU0X 1BCFA 5LBHA 2V8TA 2C2UA 1JIGA 4MN9A 4YVZA 2GYQA 4RC7B 3QZ3A 4LYUA 1Z4AA 2CLUA 2FL0A 1F33A 3OJ5A 3PVYA 5FEJA 3UFBA 3R2SA 3EZ0A 2ZA7A 1NF6A 4KVQA 5GN8A 4DI0A 3KA4A 1FHAA 3PW1A 2ZURX 2YJJA 4ZL6A 3M6JA 3ISEA 1TKPA 3GGYA 5LG8A 3RD0A 3F36A 3KA6A 3WNWA 3HL1A 4LQJA 3IS7A 3Q4OA 5HQOA 1J30A 3FSEA 2Z5PA 1SQ3A 3SIDA 3E1MA 4ISPA 4CVSA 2JD80 3AF7X 3BVEA 2JD60 2Y3QA 3PVYB 2XKQA 3KA3A 4LPMA 5D8SA 2C41A 3Q4QA 4TOAA 1VJXA 5GN8B 2FG8A 4TOCA 2ZG8X 3PW1B 1ZS3A 3SHXA 1JYBA 1RCDA 3QD8A 4W4KB 3AJQA 3KA8A 1JI4A 2ITBA 2XGWA 4CVRA 3WVVA 3TA8A 5D8RA 2IU2A 2CN7A 3F39A 4YKHA 1O9IA 1Z6OA 2CF7A 3IS8A 3R2RA 3UOFA 3E1OA 4OYNA 2QF9A 3WVUA 3A9QA 1LKOA 3GE4A 3GGZA 4XKUA 5CZUA 4U3GA 3NOZX 2OH3A 5HJHA 5D8QA 3L0MA 2IY4A 2YJKA 5JKLG 2VXXA 4E40A 2G4HA 2XJNA 2V2LA 2BW1A 2V2PA 3VVAA 5ERKA 1LKPA 3JZAB 2UX1A 4IXKA 4EVCA 2YW6A 3E2CA 4TOFA 3MPSA 1HRSA 1XZ3A 2CEIA 3C1ZA 2V2RA 1BG7A 3QB9A 5IX6A 1S30A 4CMYA 2WTLA 3LKDA 5LG2A 1TJOA 3WVWA 2FKZA 2BJYA 5D8OA 2BK6A 3W54A 3F37A 4Z3BA 3SH6A 4EVDA 4TW3A 5JKLA 2HTNA 2FG4A 5LS9A 1N1QA 4ZTTA 1QGHA 2V8UA 3KXUA 3PW8A 4ITWA 1XZ1A 4XGSA 4PG0A 3AJOA 2V2MA 3BT5A 1JI5A 2CWLA 2Y44A 4ERUA 1GWGA 2WLUA 4KVSA 3KDQA 4MY7A 2RBDA 3FI6A 4Y08A 4PG1A 4E6KA 1DPSA 1JTSA 5D8PA 4ZLWA 1YV1A 3RBCA 3PW8C 4II4A 3AK8A 3N6OA 1RCCA 3Q4NA 2Z90A 4DYZA 1RCEA 5J8SA 3R2OA 5J8WA 2Z6MA 4DE6A 2ZA6A 2C2FA 3F38A 3KA9A 5D8YA 5CMRA 2Z5QA 2V2JA 1MOJA 2Z5RA 1RCGA 3F33A 1EUMA 3E1JA 1TKOA 4RC5A 4AM4A 1L8HA 3R2LA 1S3QA 2V2SA 1JKUA 3Q4RA 5E2DA 5FFDA 4YXMA 3RE7A 2C6RA 4TOGA 1VEQA 3FRSA 1VEIA 4II4B 5JDOA 1JGCA 2X170 3E1PA 4TOBA 3A68A 5JKMG 2FFXJ 5E1UA 4W4LB 1B71A 4P18A 5HJFA 4DYYA 4AM2A 4LQNA 3EZUA 3RGDA 3PVTA 4WJG4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BKN A;  2GS4 A;  1LB3 A;  1O9R A;  5FFC A;  4RC5 B;  4ZKH A;  4MJY A;  5J93 A;  2CN6 A;  2WLA A;  3BVI A;  3KWO A;  2ZG7 X;  5JKM A;  1F30 A;  5FFB A;  5K53 A;  4KVR A;  4XKS A;  3F35 A;  3PWQ A;  2ZG9 X;  4LQH A;  4LPJ A;  2BKC A;  4ZL5 A;  2GYD A;  5FFA A;  1YUX A;  3NP2 X;  1IER A;  3ISF A;  4RC6 A;  3HIU A;  1DAT A;  4M33 A;  3PVR A;  1RYT A;  4CVP A;  3IQ1 A;  2V15 A;  3E1Q A;  3T9J A;  3PVT B;  1R03 A;  3BVK A;  3FVB A;  2CHI A;  2OC5 A;  2W0O A;  4ZMC A;  1MFR A;  5J9V A;  3PZA A;  3E6R A;  4IWK A;  1IES A;  2QQY A;  4R42 A;  5K52 A;  4ITT A;  3PWQ C;  2V2N A;  4REU A;  5D8X A;  3R2H A;  4MUD A;  3O7S A;  1YUZ A;  1TK6 A;  2V2O A;  5I4J A;  4M32 A;  1OTK A;  4MKU A;  4RC6 B;  3SE1 A;  5GU3 X;  4ML5 A;  1DVB A;  4M35 A;  3R2K A;  3PVR B;  3RAV A;  4LPN A;  4DYX A;  5ERJ A;  4CYA A;  4XKT A;  1SOF A;  1UVH A;  1S2Z A;  4DAS A;  2CHP A;  4AM5 A;  1NF4 A;  4TOE A;  1Z6O M;  1VEL A;  2CIH A;  4CY9 A;  1L8I A;  3OGH A;  3QHC A;  4CYB A;  3NP0 X;  2IB0 A;  3AJP A;  2VZB A;  2D5K A;  1JKV A;  4RC8 A;  4ETR A;  3AF8 X;  1BFR A;  2V2I A;  1LKM A;  3H7G A;  4A25 A;  4TOD A;  1NNQ A;  2ZA8 A;  5JAC A;  4LQV A;  3PWF A;  1AEW A;  2VXI A;  3BVL A;  1VLG A;  3EGM A;  2YW7 A;  2HR5 A;  1QYB A;  4CMY V;  3GVY A;  1KRQ A;  5AXS A;  2FHA A;  3AF9 X;  4IWJ A;  1ZUJ A;  4TO9 A;  2FJC A;  3ERZ A;  2FZF A;  3O7R A;  5GOU A;  3E6S A;  4DYU A;  3F34 A;  4ZKW A;  3GHQ A;  1RCI A;  3F32 A;  4CVT A;  2CLB A;  5CMQ A;  4Z5S A;  3E1L A;  4ZKX A;  2C2J A;  3E1N A;  3U90 A;  4ISM A;  5GU2 X;  1JRE A;  4RC7 A;  3UOI A;  1UMN A;  1H96 A;  3AK9 A;  3KX9 A;  5C6F A;  2PYB A;  3VNX A;  2XJM A;  2JD7 0;  4PGK A;  5FFE A;  1NFV A;  4LYX A;  4ZJK A;  4QUW A;  4PGI A;  3R2M A;  4EVB A;  4DZ0 A;  5GU1 X;  4TOH A;  4EVE A;  2XJO A;  3ES3 A;  2F7N A;  3QVD A;  3BVF A;  3UNO A;  4M34 A;  3QHB A;  5GU0 X;  1BCF A;  5LBH A;  2C2U A;  1JIG A;  4MN9 A;  2GYQ A;  4RC7 B;  3QZ3 A;  4LYU A;  1Z4A A;  2CLU A;  2FL0 A;  1F33 A;  3OJ5 A;  3PVY A;  5FEJ A;  3R2S A;  3EZ0 A;  2ZA7 A;  1NF6 A;  4KVQ A;  5GN8 A;  4DI0 A;  3KA4 A;  1FHA A;  3PW1 A;  2ZUR X;  2YJJ A;  4ZL6 A;  3ISE A;  1TKP A;  5LG8 A;  3RD0 A;  3F36 A;  3KA6 A;  3WNW A;  3HL1 A;  4LQJ A;  3IS7 A;  3Q4O A;  5HQO A;  1J30 A;  3FSE A;  2Z5P A;  1SQ3 A;  3SID A;  3E1M A;  4ISP A;  4CVS A;  2JD8 0;  3AF7 X;  3BVE A;  2JD6 0;  2Y3Q A;  3PVY B;  2XKQ A;  3KA3 A;  4LPM A;  5D8S A;  2C41 A;  3Q4Q A;  4TOA A;  1VJX A;  5GN8 B;  2FG8 A;  4TOC A;  2ZG8 X;  3PW1 B;  1ZS3 A;  3SHX A;  1JYB A;  1RCD A;  3QD8 A;  3AJQ A;  3KA8 A;  1JI4 A;  2ITB A;  2XGW A;  4CVR A;  3WVV A;  3TA8 A;  5D8R A;  2IU2 A;  2CN7 A;  3F39 A;  4YKH A;  1O9I A;  1Z6O A;  2CF7 A;  3IS8 A;  3R2R A;  3UOF A;  3E1O A;  4OYN A;  2QF9 A;  3WVU A;  3A9Q A;  1LKO A;  3GE4 A;  4XKU A;  5CZU A;  4U3G A;  3NOZ X;  2OH3 A;  5HJH A;  5D8Q A;  2IY4 A;  2YJK A;  5JKL G;  2VXX A;  2G4H A;  2XJN A;  2V2L A;  2BW1 A;  2V2P A;  5ERK A;  1LKP A;  2UX1 A;  4IXK A;  4EVC A;  2YW6 A;  3E2C A;  4TOF A;  3MPS A;  1HRS A;  1XZ3 A;  2CEI A;  2V2R A;  1BG7 A;  3QB9 A;  5IX6 A;  1S30 A;  4CMY A;  2WTL A;  5LG2 A;  1TJO A;  3WVW A;  2FKZ A;  2BJY A;  5D8O A;  2BK6 A;  4Z3B A;  3F37 A;  3SH6 A;  4EVD A;  4TW3 A;  5JKL A;  2HTN A;  2FG4 A;  5LS9 A;  1N1Q A;  4ZTT A;  1QGH A;  3KXU A;  3PW8 A;  4ITW A;  1XZ1 A;  4XGS A;  4PG0 A;  3AJO A;  2V2M A;  3BT5 A;  1JI5 A;  4ERU A;  1GWG A;  2WLU A;  4KVS A;  4MY7 A;  2RBD A;  3FI6 A;  4Y08 A;  4PG1 A;  4E6K A;  1DPS A;  1JTS A;  5D8P A;  4ZLW A;  1YV1 A;  3RBC A;  3PW8 C;  4II4 A;  3AK8 A;  1RCC A;  3Q4N A;  2Z90 A;  4DYZ A;  1RCE A;  5J8S A;  3R2O A;  5J8W A;  2Z6M A;  4DE6 A;  2ZA6 A;  2C2F A;  3F38 A;  3KA9 A;  5D8Y A;  5CMR A;  2Z5Q A;  2V2J A;  1MOJ A;  2Z5R A;  1RCG A;  3F33 A;  1EUM A;  3E1J A;  1TKO A;  4RC5 A;  4AM4 A;  1L8H A;  3R2L A;  1S3Q A;  2V2S A;  1JKU A;  3Q4R A;  5E2D A;  5FFD A;  3RE7 A;  2C6R A;  4TOG A;  1VEQ A;  1VEI A;  4II4 B;  1JGC A;  2X17 0;  3E1P A;  4TOB A;  3A68 A;  5JKM G;  2FFX J;  5E1U A;  1B71 A;  4P18 A;  5HJF A;  4DYY A;  4AM2 A;  4LQN A;  3EZU A;  3RGD A;  3PVT A; 
#chains in the Genus database with same CATH topology
 3BKN A;  2GS4 A;  1LB3 A;  1O9R A;  5FFC A;  4RC5 B;  4ZKH A;  2OKC A;  4MJY A;  5J93 A;  2CN6 A;  2WLA A;  3BVI A;  3KWO A;  2ZG7 X;  5JKM A;  1F30 A;  5FFB A;  5K53 A;  4KVR A;  5JDO B;  4XKS A;  3C1Y A;  3F35 A;  3PWQ A;  2ZG9 X;  4LQH A;  4LPJ A;  2BKC A;  4ZL5 A;  2GYD A;  5FFA A;  1YUX A;  3NP2 X;  1IER A;  3ISF A;  4RC6 A;  3HIU A;  1DAT A;  4M33 A;  2AR0 A;  3PVR A;  1RYT A;  4CVP A;  3IQ1 A;  2V15 A;  3E1Q A;  3T9J A;  3PVT B;  1R03 A;  3BVK A;  3FVB A;  3V3K B;  2CHI A;  2OC5 A;  2W0O A;  4ZMC A;  4X0J A;  1MFR A;  5J9V A;  3PZA A;  3E6R A;  4IWK A;  1IES A;  2QQY A;  4R42 A;  5K52 A;  4ITT A;  3PWQ C;  2V2N A;  4REU A;  4KXR B;  5D8X A;  3R2H A;  4MUD A;  3O7S A;  1YUZ A;  1TK6 A;  2V2O A;  3DBY A;  5I4J A;  4M32 A;  1OTK A;  4MKU A;  4RC6 B;  3SE1 A;  5GU3 X;  4ML5 A;  1DVB A;  4M35 A;  3R2K A;  3PVR B;  3RAV A;  4LPN A;  4DYX A;  5ERJ A;  4CYA A;  4XKT A;  1SOF A;  1UVH A;  1S2Z A;  4DAS A;  2CHP A;  4AM5 A;  4YXJ A;  1NF4 A;  4TOE A;  1Z6O M;  1VEL A;  2CIH A;  4CY9 A;  1L8I A;  3OGH A;  3QHC A;  4CYB A;  5HU6 D;  3NP0 X;  2IB0 A;  3AJP A;  3C21 A;  2VZB A;  2D5K A;  1JKV A;  4RC8 A;  4ETR A;  3AF8 X;  3VV9 A;  1BFR A;  2V2I A;  1LKM A;  3H7G A;  4A25 A;  4TOD A;  1NNQ A;  2ZA8 A;  5JAC A;  4LQV A;  3PWF A;  1AEW A;  2VXI A;  2N02 A;  3BVL A;  1VLG A;  3EGM A;  2YW7 A;  2HR5 A;  1QYB A;  4CMY V;  3GVY A;  1KRQ A;  5AXS A;  2FHA A;  3AF9 X;  4IWJ A;  1ZUJ A;  4TO9 A;  2G38 B;  2FJC A;  3ERZ A;  2FZF A;  3O7R A;  5GOU A;  3E6S A;  4DYU A;  3F34 A;  4ZKW A;  3GHQ A;  1RCI A;  3F32 A;  4CVT A;  2CLB A;  5CMQ A;  4Z5S A;  3E1L A;  4ZKX A;  2C2J A;  3E1N A;  3U90 A;  3KHK A;  2MGY A;  4ISM A;  5GU2 X;  1JRE A;  3FRR A;  4MXP A;  4RC7 A;  3UOI A;  1UMN A;  1H96 A;  3JZ9 A;  3AK9 A;  3KX9 A;  5C6F A;  3C23 A;  2PYB A;  3VNX A;  2XJM A;  2JD7 0;  4PGK A;  5FFE A;  1NFV A;  4LYX A;  4ZJK A;  4QUW A;  4PGI A;  3R2M A;  4EVB A;  3D19 A;  4DZ0 A;  5GU1 X;  4TOH A;  4EVE A;  2XJO A;  2WWX B;  3ES3 A;  2F7N A;  3QVD A;  3BVF A;  3UNO A;  4M34 A;  3QHB A;  5GU0 X;  1BCF A;  5LBH A;  2V8T A;  2C2U A;  1JIG A;  4MN9 A;  4YVZ A;  2GYQ A;  4RC7 B;  3QZ3 A;  4LYU A;  1Z4A A;  2CLU A;  2FL0 A;  1F33 A;  3OJ5 A;  3PVY A;  5FEJ A;  3UFB A;  3R2S A;  3EZ0 A;  2ZA7 A;  1NF6 A;  4KVQ A;  5GN8 A;  4DI0 A;  3KA4 A;  1FHA A;  3PW1 A;  2ZUR X;  2YJJ A;  4ZL6 A;  3M6J A;  3ISE A;  1TKP A;  3GGY A;  5LG8 A;  3RD0 A;  3F36 A;  3KA6 A;  3WNW A;  3HL1 A;  4LQJ A;  3IS7 A;  3Q4O A;  5HQO A;  1J30 A;  3FSE A;  2Z5P A;  1SQ3 A;  3SID A;  3E1M A;  4ISP A;  4CVS A;  2JD8 0;  3AF7 X;  3BVE A;  2JD6 0;  2Y3Q A;  3PVY B;  2XKQ A;  3KA3 A;  4LPM A;  5D8S A;  2C41 A;  3Q4Q A;  4TOA A;  1VJX A;  5GN8 B;  2FG8 A;  4TOC A;  2ZG8 X;  3PW1 B;  1ZS3 A;  3SHX A;  1JYB A;  1RCD A;  3QD8 A;  4W4K B;  3AJQ A;  3KA8 A;  1JI4 A;  2ITB A;  2XGW A;  4CVR A;  3WVV A;  3TA8 A;  5D8R A;  2IU2 A;  2CN7 A;  3F39 A;  4YKH A;  1O9I A;  1Z6O A;  2CF7 A;  3IS8 A;  3R2R A;  3UOF A;  3E1O A;  4OYN A;  2QF9 A;  3WVU A;  3A9Q A;  1LKO A;  3GE4 A;  3GGZ A;  4XKU A;  5CZU A;  4U3G A;  3NOZ X;  2OH3 A;  5HJH A;  5D8Q A;  3L0M A;  2IY4 A;  2YJK A;  5JKL G;  2VXX A;  4E40 A;  2G4H A;  2XJN A;  2V2L A;  2BW1 A;  2V2P A;  3VVA A;  5ERK A;  1LKP A;  3JZA B;  2UX1 A;  4IXK A;  4EVC A;  2YW6 A;  3E2C A;  4TOF A;  3MPS A;  1HRS A;  1XZ3 A;  2CEI A;  3C1Z A;  2V2R A;  1BG7 A;  3QB9 A;  5IX6 A;  1S30 A;  4CMY A;  2WTL A;  3LKD A;  5LG2 A;  1TJO A;  3WVW A;  2FKZ A;  2BJY A;  5D8O A;  2BK6 A;  3W54 A;  3F37 A;  4Z3B A;  3SH6 A;  4EVD A;  4TW3 A;  5JKL A;  2HTN A;  2FG4 A;  5LS9 A;  1N1Q A;  4ZTT A;  1QGH A;  2V8U A;  3KXU A;  3PW8 A;  4ITW A;  1XZ1 A;  4XGS A;  4PG0 A;  3AJO A;  2V2M A;  3BT5 A;  1JI5 A;  2CWL A;  2Y44 A;  4ERU A;  1GWG A;  2WLU A;  4KVS A;  3KDQ A;  4MY7 A;  2RBD A;  3FI6 A;  4Y08 A;  4PG1 A;  4E6K A;  1DPS A;  1JTS A;  5D8P A;  4ZLW A;  1YV1 A;  3RBC A;  3PW8 C;  4II4 A;  3AK8 A;  3N6O A;  1RCC A;  3Q4N A;  2Z90 A;  4DYZ A;  1RCE A;  5J8S A;  3R2O A;  5J8W A;  2Z6M A;  4DE6 A;  2ZA6 A;  2C2F A;  3F38 A;  3KA9 A;  5D8Y A;  5CMR A;  2Z5Q A;  2V2J A;  1MOJ A;  2Z5R A;  1RCG A;  3F33 A;  1EUM A;  3E1J A;  1TKO A;  4RC5 A;  4AM4 A;  1L8H A;  3R2L A;  1S3Q A;  2V2S A;  1JKU A;  3Q4R A;  5E2D A;  5FFD A;  4YXM A;  3RE7 A;  2C6R A;  4TOG A;  1VEQ A;  3FRS A;  1VEI A;  4II4 B;  5JDO A;  1JGC A;  2X17 0;  3E1P A;  4TOB A;  3A68 A;  5JKM G;  2FFX J;  5E1U A;  4W4L B;  1B71 A;  4P18 A;  5HJF A;  4DYY A;  4AM2 A;  4LQN A;  3EZU A;  3RGD A;  3PVT A;  4WJG 4; 
#chains in the Genus database with same CATH homology
 3BKN A;  2GS4 A;  1LB3 A;  1O9R A;  5FFC A;  4RC5 B;  4ZKH A;  2OKC A;  4MJY A;  5J93 A;  2CN6 A;  2WLA A;  3BVI A;  3KWO A;  2ZG7 X;  5JKM A;  1F30 A;  5FFB A;  5K53 A;  4KVR A;  5JDO B;  4XKS A;  3C1Y A;  3F35 A;  3PWQ A;  2ZG9 X;  4LQH A;  4LPJ A;  2BKC A;  4ZL5 A;  2GYD A;  5FFA A;  1YUX A;  3NP2 X;  1IER A;  3ISF A;  4RC6 A;  3HIU A;  1DAT A;  4M33 A;  2AR0 A;  3PVR A;  1RYT A;  4CVP A;  3IQ1 A;  2V15 A;  3E1Q A;  3T9J A;  3PVT B;  1R03 A;  3BVK A;  3FVB A;  3V3K B;  2CHI A;  2OC5 A;  2W0O A;  4ZMC A;  4X0J A;  1MFR A;  5J9V A;  3PZA A;  3E6R A;  4IWK A;  1IES A;  2QQY A;  4R42 A;  5K52 A;  4ITT A;  3PWQ C;  2V2N A;  4REU A;  4KXR B;  5D8X A;  3R2H A;  4MUD A;  3O7S A;  1YUZ A;  1TK6 A;  2V2O A;  3DBY A;  5I4J A;  4M32 A;  1OTK A;  4MKU A;  4RC6 B;  3SE1 A;  5GU3 X;  4ML5 A;  1DVB A;  4M35 A;  3R2K A;  3PVR B;  3RAV A;  4LPN A;  4DYX A;  5ERJ A;  4CYA A;  4XKT A;  1SOF A;  1UVH A;  1S2Z A;  4DAS A;  2CHP A;  4AM5 A;  4YXJ A;  1NF4 A;  4TOE A;  1Z6O M;  1VEL A;  2CIH A;  4CY9 A;  1L8I A;  3OGH A;  3QHC A;  4CYB A;  5HU6 D;  3NP0 X;  2IB0 A;  3AJP A;  3C21 A;  2VZB A;  2D5K A;  1JKV A;  4RC8 A;  4ETR A;  3AF8 X;  3VV9 A;  1BFR A;  2V2I A;  1LKM A;  3H7G A;  4A25 A;  4TOD A;  1NNQ A;  2ZA8 A;  5JAC A;  4LQV A;  3PWF A;  1AEW A;  2VXI A;  2N02 A;  3BVL A;  1VLG A;  3EGM A;  2YW7 A;  2HR5 A;  1QYB A;  4CMY V;  3GVY A;  1KRQ A;  5AXS A;  2FHA A;  3AF9 X;  4IWJ A;  1ZUJ A;  4TO9 A;  2G38 B;  2FJC A;  3ERZ A;  2FZF A;  3O7R A;  5GOU A;  3E6S A;  4DYU A;  3F34 A;  4ZKW A;  3GHQ A;  1RCI A;  3F32 A;  4CVT A;  2CLB A;  5CMQ A;  4Z5S A;  3E1L A;  4ZKX A;  2C2J A;  3E1N A;  3U90 A;  3KHK A;  2MGY A;  4ISM A;  5GU2 X;  1JRE A;  3FRR A;  4MXP A;  4RC7 A;  3UOI A;  1UMN A;  1H96 A;  3JZ9 A;  3AK9 A;  3KX9 A;  5C6F A;  3C23 A;  2PYB A;  3VNX A;  2XJM A;  2JD7 0;  4PGK A;  5FFE A;  1NFV A;  4LYX A;  4ZJK A;  4QUW A;  4PGI A;  3R2M A;  4EVB A;  3D19 A;  4DZ0 A;  5GU1 X;  4TOH A;  4EVE A;  2XJO A;  2WWX B;  3ES3 A;  2F7N A;  3QVD A;  3BVF A;  3UNO A;  4M34 A;  3QHB A;  5GU0 X;  1BCF A;  5LBH A;  2V8T A;  2C2U A;  1JIG A;  4MN9 A;  4YVZ A;  2GYQ A;  4RC7 B;  3QZ3 A;  4LYU A;  1Z4A A;  2CLU A;  2FL0 A;  1F33 A;  3OJ5 A;  3PVY A;  5FEJ A;  3UFB A;  3R2S A;  3EZ0 A;  2ZA7 A;  1NF6 A;  4KVQ A;  5GN8 A;  4DI0 A;  3KA4 A;  1FHA A;  3PW1 A;  2ZUR X;  2YJJ A;  4ZL6 A;  3M6J A;  3ISE A;  1TKP A;  3GGY A;  5LG8 A;  3RD0 A;  3F36 A;  3KA6 A;  3WNW A;  3HL1 A;  4LQJ A;  3IS7 A;  3Q4O A;  5HQO A;  1J30 A;  3FSE A;  2Z5P A;  1SQ3 A;  3SID A;  3E1M A;  4ISP A;  4CVS A;  2JD8 0;  3AF7 X;  3BVE A;  2JD6 0;  2Y3Q A;  3PVY B;  2XKQ A;  3KA3 A;  4LPM A;  5D8S A;  2C41 A;  3Q4Q A;  4TOA A;  1VJX A;  5GN8 B;  2FG8 A;  4TOC A;  2ZG8 X;  3PW1 B;  1ZS3 A;  3SHX A;  1JYB A;  1RCD A;  3QD8 A;  4W4K B;  3AJQ A;  3KA8 A;  1JI4 A;  2ITB A;  2XGW A;  4CVR A;  3WVV A;  3TA8 A;  5D8R A;  2IU2 A;  2CN7 A;  3F39 A;  4YKH A;  1O9I A;  1Z6O A;  2CF7 A;  3IS8 A;  3R2R A;  3UOF A;  3E1O A;  4OYN A;  2QF9 A;  3WVU A;  3A9Q A;  1LKO A;  3GE4 A;  3GGZ A;  4XKU A;  5CZU A;  4U3G A;  3NOZ X;  2OH3 A;  5HJH A;  5D8Q A;  3L0M A;  2IY4 A;  2YJK A;  5JKL G;  2VXX A;  4E40 A;  2G4H A;  2XJN A;  2V2L A;  2BW1 A;  2V2P A;  3VVA A;  5ERK A;  1LKP A;  3JZA B;  2UX1 A;  4IXK A;  4EVC A;  2YW6 A;  3E2C A;  4TOF A;  3MPS A;  1HRS A;  1XZ3 A;  2CEI A;  3C1Z A;  2V2R A;  1BG7 A;  3QB9 A;  5IX6 A;  1S30 A;  4CMY A;  2WTL A;  3LKD A;  5LG2 A;  1TJO A;  3WVW A;  2FKZ A;  2BJY A;  5D8O A;  2BK6 A;  3W54 A;  3F37 A;  4Z3B A;  3SH6 A;  4EVD A;  4TW3 A;  5JKL A;  2HTN A;  2FG4 A;  5LS9 A;  1N1Q A;  4ZTT A;  1QGH A;  2V8U A;  3KXU A;  3PW8 A;  4ITW A;  1XZ1 A;  4XGS A;  4PG0 A;  3AJO A;  2V2M A;  3BT5 A;  1JI5 A;  2CWL A;  2Y44 A;  4ERU A;  1GWG A;  2WLU A;  4KVS A;  3KDQ A;  4MY7 A;  2RBD A;  3FI6 A;  4Y08 A;  4PG1 A;  4E6K A;  1DPS A;  1JTS A;  5D8P A;  4ZLW A;  1YV1 A;  3RBC A;  3PW8 C;  4II4 A;  3AK8 A;  3N6O A;  1RCC A;  3Q4N A;  2Z90 A;  4DYZ A;  1RCE A;  5J8S A;  3R2O A;  5J8W A;  2Z6M A;  4DE6 A;  2ZA6 A;  2C2F A;  3F38 A;  3KA9 A;  5D8Y A;  5CMR A;  2Z5Q A;  2V2J A;  1MOJ A;  2Z5R A;  1RCG A;  3F33 A;  1EUM A;  3E1J A;  1TKO A;  4RC5 A;  4AM4 A;  1L8H A;  3R2L A;  1S3Q A;  2V2S A;  1JKU A;  3Q4R A;  5E2D A;  5FFD A;  4YXM A;  3RE7 A;  2C6R A;  4TOG A;  1VEQ A;  3FRS A;  1VEI A;  4II4 B;  5JDO A;  1JGC A;  2X17 0;  3E1P A;  4TOB A;  3A68 A;  5JKM G;  2FFX J;  5E1U A;  4W4L B;  1B71 A;  4P18 A;  5HJF A;  4DYY A;  4AM2 A;  4LQN A;  3EZU A;  3RGD A;  3PVT A;  4WJG 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...