1N2EA

Crystal structure of a pantothenate synthetase from m. tuberculosis in complex with ampcpp and pantoate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
288
structure length
288
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pantothenate synthetase
publication title Crystal structures of a pantothenate synthetase from M. tuberculosis and its complexes with substrates and a reaction intermediate
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 92
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2002-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 1n2eA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1n2eA01
2PZAA 2IELA 2QUJA 3IVCA 1EE1A 4QRDA 4MW1A 2A86A 1O97C 1T6ZA 1T6YA 1WOYA 4MW0A 1GPMA 1J1ZA 1R6UA 2CFOA 1X6VA 3KT0A 1MC1A 1T9GR 2A88A 1GAXA 4KR9A 1ULHA 1O96B 3SZGA 4HJXA 1JILA 1T9GS 1WXGA 4CT0A 1J21A 1M8KA 4MUEA 1VLHA 2GOYA 5IHXA 1NSYA 2CYAA 2PXHA 1O97D 5H7XA 4WNYA 2PFSA 3DPIA 3SYTA 2BYTA 2Z08A 2IP1A 1YUMA 4HPWA 1M1ZA 3UOWA 1TYCA 4MW7A 4AS1A 2NSYA 1NURA 5LLTA 1TYAE 1B6TA 3KT6A 1KH1A 4MWCA 1PFYA 1IQRA 1R6XA 1JEEA 3N8HA 2E0IA 5F23A 3HFJA 1JMVA 2YY5A 4G6ZA 4KR7A 3AKZA 3ISJA 3HMQA 3IOBA 2CV2A 1OWOA 2A1UB 2X1LA 3TZLA 2ZUEA 1NI5A 1OWLA 1OWNA 4E1AA 1F7UA 5DK4A 5KHAA 3H97A 2YWBA 1JIKA 1J09A 3MLBA 1O94C 4KKVA 2DLCX 3GLVA 4I6JA 1EJ2A 1VL2A 4YP7A 4PBTA 3X1JA 1EFPA 3OTWA 1GTRA 4NZPA 2GKSA 2D13A 1NZJA 3ELBA 5DB4A 3P0IA 1I6LA 1HYBA 1QU3A 2CT8A 1OBHA 4ND7A 4DJAA 3CR8A 5FO0A 1JIJA 3C8ZA 1NUQA 1GTSA 1H1TA 4ARIA 5HUHA 1IHOA 4R2MA 3ND6A 1P7PA 1IRXA 3UMVA 1O94D 4YP6A 3FG9A 4F4HA 4JFAA 4CDNA 3CLSC 4YP5A 3FETA 4FZJA 5J59A 3AIIA 3P0JA 2CYCA 2DEUA 1KQOA 1N2EA 3H99A 3MMXA 3N2YA 4MUJA 1NUUA 3UK2A 1KR2A 3MLAA 4PBSA 3RK0A 4QBTA 1EFVB 5KWVA 1ZH0A 2E21A 3PNYA 4KPUA 3COZA 3CA8A 4MUGA 1VBMA 3ZXSA 1K92A 2E18A 1KKUA 1KP2A 3VGJA 3A04A 3LCJA 5FNZA 2PZ8A 3MXTA 1H3NA 4Q93A 4MWEA 3KFLA 3MUEA 4GRIA 3TZEA 1ZJWA 4MW9A 1KQNA 1R6TA 1ZH6A 3TS1A 1WZ2A 2A84A 3LOQA 4A91A 3KT8A 4KR6A 4EG6A 1I2DA 1ILEA 1U3DA 2A1TR 1H3EA 1V8FA 1JECA 2WSIA 2XRZA 2YXNA 4OJMX 2H29A 2A1TS 1M83A 2DPLA 2V0GA 4I6EA 3ND7A 3SEZA 3COVA 3K9WA 4ZCRA 5JBNA 2OQ2A 3SDBA 1G59A 1D2RA 3CVXA 1VBNA 4JXXA 1JHDA 1NUPA 4U7JA 1QTQA 1M8GA 4WSOA 1MAUA 1PFVA 4K03A 1JIIA 3D6VA 1YI8A 3IMCA 2DETA 5DEOA 3IDFA 3U1VA 1FFYA 2G36A 1NYLA 3ZJVA 2EJCA 3ZGZA 2V0CA 1A8HA 3A05A 4ND6A 2RD2A 4EG1A 3OP1A 4XFJA 2A4MA 3P52A 3AL0C 1OWMA 2DXIA 4ZT2A 4MVYA 1JZSA 2J07A 2QUHA 4ZT6A 2D5BA 3CVWA 3DV2A 1ZUNA 4HJRA 3FI0A 1EUYA 3UY4A 2AG6A 3ZJTA 3A4IA 5H16A 1QRTA 1WXHA 4OUDA 3X1MA 1V47A 4NX2A 3HZRA 5IJXA 1PFWA 4H3SA 3TNJA 3IH5A 2DERA 4MUFA 1F9AA 3ZJUA 1IFXA 3RHSA 2HZ7A 1K97A 1YULA 3FY4A 4ZT7A 1T6XA 4ZCTA 2BTEA 1X8XA 2I1LA 1K4MA 1WXFA 1UFVA 4XSVA 3G5AA 3COWA 1G8FA 4MW6A 1G8GA 2X0KA 3F3MA 3FHJA 1JGTA 3HV0A 1JZQA 3L92A 4MUKA 1WY5A 1PG2A 2AZXA 1TYDE 2JA2A 3TQIA 4K0RA 1XNGA 4MVWA 1WQ3A 3N9IA 4Q16A 4RPIA 1NUSA 3SEQA 4L2IA 3BL5A 5J58A 1TFUA 3CLTC 2PZBA 3LE8A 2O5RA 2QUIA 3RBAA 3AG5A 3ZXIA 3CVVA 2VTBA 1KAMA 2RE8A 3GUZA 1MJHA 1J20A 5LM3A 1O0BA 1OBCA 3SZ3A 2X3FA 5BNZA 4I6GA 1IQUA 3H9CA 1OD6A 5TEWA 3PXUA 3IUEA 2D54A 3ZUGA 1M8FA 2A1UA 3Q12A 4MUHA 3AFHA 1M8JA 1N3LA 3QE4A 3FH0A 4ZCPA 2J09A 3NBAA 4R2LA 3CLTD 3IMEA 1MBZA 2B7LA 3COYA 2DUMA 3K32A 3PRHA 1LW7A 2A7XA 4DDHA 1WJGA 1F4LA 4NATA 1N1DA 1KORA 1O6BA 4DNXA 1N2HA 2QJTA 2CV1A 2CV0A 4GU5A 5TS2A 1M8PA 2H2AA 4MVCA 3CLUC 3UC5A 4XFDA 3M5WA 4EFKA 2WQ7A 2J4DA 3VU8A 1GLNA 4MWBA 1XNJA 4EG3A 4CDMA 1N2BA 2QJFA 4EF6A 4MULA 1COZA 1GZUA 2WB2A 1Q11A 3INNA 1IH8A 1MB2A 1QQTA 4U63A 3FIUA 3IOCA 1NUTA 4J76A 1BS2A 1O5TA 3KT3A 4MVXA 2PIDA 5HG0A 5EKDA 3CLUD 1PFUA 4HK4A 3ILVA 4MAFA 4PY2A 4CQNA 4MW4A 1YIAA 4J75A 1H3FA 1KH2A 1RQGA 1U3CA 1MB9A 4G5FA 1PG0A 4NAUA 3H9BA 1KH3A 4EG4A 3G59A 2R5WA 3H05A 2VXOA 1Q15A 3GMIA 2J08A 1N2GA 5K0SA 2QTNA 3CVYA 1Q77A 1N2OA 2QUKA 1QNFA 3JXEA 1WXEA 4MUIA 1N78A 3QTBA 3NV7A 1J70A 1EFPB 1WQ4A 5LFAA 1N75A 4P2BA 3PNBA 3A2KA 4JYZA 3E27A 1G8HA 1QRUA 1YIDA 1QJCA 3AG6A 5HUJA 3IVXA 2NZ2A 4NDAA 5J5AA 4MW2A 1N77A 4L2IB 4YMIA 1TQ8A 3G6KA 1I6KA 4QREA 3FWKA 4JZYA 1K4KA 4MLPA 1O96A 2VTBB 3NBKA 2HMAA 3CLRC 3FDXA 1N2IA 1CT9A 2PG3A 1QRSA 1IVSA 3IOEA 3IVGA 2QJOA 1LI7A 1SURA 1XNHA 2DR2A 3VRHA 3L93A 1NP7A 2X1MA 4MUNA 4DDMA 4EG8A 4KPUB 4S1OA 1KQPA 4UZEA 5K0TA 3PNVA 1U7DA 1N2JA 3QTTA 3CLRD 2JANA 4EGAA 1U7XA 1MRZA 1WXIA 1GN8A 3Q10A 2AKEA 2CUZA 1MAWA 2YWCA 1I6MA 2XRYA 1MOPA 2HGZA 2Z09A 4R0NA 1KAQA 4AQ7A 3DLAA 3X1KA 3RFFA 3HL4A 1TEZA 1XJQA 1LI5A 1QU2A 2QTMA 4X0EA 3DO8A 3P0HA 5TEVA 1YUNA 2O8VA 2OV4A 4DE5A 3ZIUA 3N05A 5KCMA 2CSXA 2JAXA 3FOCA 4JXZA 1IQ0A 2CYBA 4ARCA 1O95C 4ZT3A 4PBRA 3IUBA 1Q19A 2Z3VA 4MW5A 4EG7A 4EG5A 4MQ6A 2C5SA 4NAHA 1EXDA 1TYBE 3Q4GA 1U0BB 3IMGA 1JEDA 2GM3A 4ZCSA 4ZCQA 1F7VA 5AHWA 5TGTA 4F3RA 4BWVA 3FNRA 1S4MA 4UZFA 2WQ6A 3ND5A 3CLSD 2IJGX 3RJZA 1KP3A 2J5BA 1O95D 1EUQA 2ZP1A 3IODA 1J1UA 4ZT5A 1EFVA 1WKBA 4TS1A 3SP1A 2E89A 2TS1A 1DNPA 4DDKA 4ZT4A 3RK1A 3CVUA 5FO1A 3HGMA 4RUKA 3D6UA 1OWPA 2ZUFA 2EL7A 4G5YA 5DASA 4DLPA 2QTRA 3TQOA 4YBRA 4OUDB 3S3TA 1Y42X 1O0CA 1VBKA 3I05A 4MWDA 4U8HA 1FYDA
chains in the Genus database with same CATH superfamily
3TRJA 2H0QA 1DVRA 2QTWB 2DFNA 5LZ7A 2RAVA 3OZDA 4Y0NA 4GP7A 4NDNE 3ICEA 4KYIB 1DMRA 2C2WA 2IYLD 2VDRB 4O02B 4PM4A 4MW0A 2QS9A 1FNSA 4N8SA 2X76A 1NG9A 1ZOIA 1DIBA 1T5BA 2X77A 4P33A 5EIAA 4OG2A 4Z86A 2XJ4A 1AUPA 3GDWA 2YV3A 1FRQA 5TV2A 3GRVA 2ZYUX 3V9AA 3WZ2A 3AOGA 5EQTA 4D4JA 4EGCB 2AMFA 1FVXA 2J3DA 2WUDA 3B1XA 1YQEA 1ULUA 3GJ7A 3LHKA 3QE2A 3R5SA 1AN9A 4OLFA 2GBCA 3BICA 4B76A 4Q05A 3EIWA 3R3ZA 1JP7A 1GM5A 4A0SA 1OYVA 4GLFA 2FEAA 2IHVA 3OE1A 3H5IA 1HRKA 4YCMA 3KB6A 2AN5A 3TLKA 4HNRA 2G3YA 1SVIA 4RESA 1VLQA 3JARA 1FTYA 3WOVA 4YDHB 4MW7A 5EZSA 1A88A 3DL7A 3IJ5A 5DYTA 3LI2A 4L16A 3B5IA 4ZC8A 4OHKA 2IHYA 5IK2D 1SQ0A 4LJ6A 2YJNA 2ZWVA 3T3DA 5FJIA 1NJ2A 3N8HA 2H18A 1ZCFA 3WGTA 4JJ8A 4PV7A 4B6PA 5CM2Z 3M5CA 4WJKB 4YAFA 1J39A 1OWOA 4ACBA 3GAFA 5EZYF 1XVVA 3Q3JB 1U9IC 2YZNA 3USZA 4HXEB 5L53A 3QX9A 3MS7A 1J5PA 4JOQA 2BFDA 2IYAA 1Q21A 3WRYC 3NHLA 1O94C 4KKVA 1H1LA 4AJOA 2AT1A 1U9CA 3TM4A 1WDWB 4MVJM 4URVR 1KC1A 1OPXA 2WU4A 5GONB 5A3RA 2WJIA 1VJCA 3SPXA 1SBYA 3RYCA 4HB3A 3DBOB 5HFAA 2HWKA 1HYBA 1QUEA 3I12A 4J7XA 1THZA 2VS1A 3IV6A 3V1UA 3GELA 4BYMA 4EG0A 3CFHL 3DM5A 1PGOA 2NOAA 4L28A 1Q2XA 4BWFB 3LLMA 1DAKA 1P18A 1ZP6A 1RYEA 5D01A 2RIPA 3R77A 4HRAA 1PR2A 1KE1A 3RU7A 2X2EA 3DLTA 5EWMB 4EVQA 5H4GA 4FMDF 3DMTC 5CVTA 2EF1A 2FVXA 4Y6RA 1ZWLA 3H19A 5FV4A 4Q1AA 3TFWA 2CLHB 2HCJB 4LWZA 5MN4A 5IARA 3D0OA 3BGVA 1EPUA 1MFZA 3BAFA 4R0MA 4MMXB 3CM0A 3E03A 4Q15A 2ZYRA 4YPOA 4C6RA 3MMXA 3MGBA 3EF3A 4MDHA 3X1DA 4ZK2A 2D6FA 2QN9A 2VHZA 1S01A 3KCQA 3PF9A 5C5CA 4BP3A 3RK0A 2XCQA 4JENA 1ADYA 1TUEA 3PNYA 1NPDA 1WBBA 1TUIA 4FR5A 4KQKA 3HM9A 4OAQA 3PT5A 1VPWA 1ZYUA 4BJ3A 1M72A 1U0GA 3I9LA 4TTTS 2C2BA 2OUKA 4O59O 2C2MA 3GQBB 4RJJA 5EY5B 1KFEB 3Q2IA 2IWRA 4U39A 2GD0A 2I62A 2PT7A 3C3AA 4US2R 4YRRA 4YJ3F 1PLJA 4ZHQA 3T7SA 2VWHA 1CY8A 2H8KA 1XD2B 1X87A 2LDXA 3BWVA 3KFLA 3LPCA 1GZDA 3RYTC 3PI7A 4J91A 1E1RD 1W8IA 2DUWA 2YJ6A 2OMEA 4UJ5A 5KKAA 1XXHB 1DRKA 3GVPA 1OZFA 1IZZA 1U99A 2FDXA 4GOJA 4IBOA 2FDCA 5LOVF 5BUCA 3UATA 5DTEA 1W5BA 2OB1A 1J99A 4CTMA 5HDQA 3HABA 3ZY5A 5FR2A 4WXMA 4HNUA 5JVDF 1NQXA 2CMKA 3BJRA 4S1NA 4DIKA 2FX5A 1ZISA 3NOVA 3PGMA 4WVLA 2Q3JA 5DP2A 3DBLB 2I7CA 1IEWA 1YRBA 1C0IA 1T4CA 1UMBA 1EB9A 2YFQA 3OIGA 2V3CC 3WNCA 2IYUA 4KPFC 5LDDC 1LPPA 1Y1PA 4UULA 3DBHA 1DJQA 4KTVE 4B6EA 4HMPA 1VBNA 3W8FA 2IU3A 1N4AA 3DJFA 2FPIA 5AHRA 4RNDB 1A9SA 3KELA 4DT1A 2DPHA 3MQFA 1Q12A 4DBLE 2BHNA 5JJ5A 3PXAA 2PLNA 2OLJA 4TYNA 4ITUA 3VU9B 4R3WA 2R66A 1O5IA 1DCKA 4H1WA 3QVGA 4HUQB 2OSVA 4IRXA 4AXXA 4PPNA 3A1NA 3K9LA 2BRUC 5ECGC 2RD2A 2XKKA 5G0VA 1M6VA 4DCNA 5UKDA 1G5FA 1RWMA 1XL0A 3DZJA 3FWHA 3IHTA 2IEYA 3MUFA 2QPLA 3IQHX 4GQBA 4MGEA 5KYXA 4LJKA 1GO2A 4XOIA 2XR1A 1PUIA 1ZU4A 5CLHA 1UM8A 1YHZA 1IAVA 3BHJA 4RWEA 3W2HA 4C4AA 1EP9A 2VTEA 3I8XA 4QTXA 2QJWA 4Y6SA 3ZWYA 4AMYA 2H6EA 5B2FA 5I3CA 2WAOA 4OVKA 1CF4A 5JXWA 2FCRA 5H16A 1T24A 2NZYA 3ZQJA 3EPKA 4Z7OB 1QRTA 1NYTA 2CNBA 1OFHA 3PX3A 2FZVA 3X1MA 1W36B 16PKA 1F0PA 1PJCA 3CIOA 1NF3A 1RI5A 3SG0A 4GZ5A 3F97A 2OXRA 4BB6A 1GTMA 2VBCA 4BP8A 3A7DA 5L7YA 1TCVA 4B17A 1C14A 4DRXB 5E3HA 4I08A 4KMRA 1R0ZA 1JHPA 5B4VA 1HBJA 2XE4A 5AIAA 3MEQA 2CUKA 2QIOA 1UBSB 5T6MA 5KEIA 3PGJA 4I4TB 3U37A 2EL9A 5BVHB 1S6YA 1I3CA 4MROA 4BCBA 1T1SA 1XVLA 1YAJA 1YQGA 4G9BA 3QFFA 4P22A 1ZMOA 3HUEA 4L3VA 3IESA 4GX5A 4G3XA 4G0MA 4BNFA 5I8PA 1QS0B 1GNQA 2WSYB 3A2LA 3RW9A 4U7DA 3OCWA 1T36A 3ZDBA 1UC5B 2AK3A 2HYDA 1XROA 1QFZA 3KZMA 4OMFG 2CEKA 5T3UA 4YUAA 4CW7A 2BKLA 5LP1A 3TX2A 1SXJB 2CDNA 3E7XA 3PPXA 3K73O 2FOIA 4IAOA 4UBOA 3BD6A 3EOAI 1KQGA 1LPAB 2WTBA 3GPIA 3MB5A 3OJ0A 4LAFA 4TKMA 4HAOA 2IF0A 2PVPA 1OBFO 4BFSA 1RAFA 3ON5A 4TKZA 4V3CA 1SULA 5LUBA 3DS8A 4QBKA 2O48X 3GUZA 4WCDA 5BOVA 3ITKA 2CK3A 3MBIA 1Y33E 4KCGA 1SRRA 4KRYA 5EHZA 4LXYA 4YHBA 3ISTA 5JDCA 2R7LA 1ADCA 3DHYA 2ZTSA 4UATA 1LC0A 4PQEA 3GCZA 4KYUA 1SUCA 2B7CA 3L0YA 2JKZA 2C4UA 2EQAA 1PS8A 2NAFA 4RL4A 3SIWA 5A1JA 3P4YA 1R5JA 2IITA 1C1YA 3EVDA 3GZJA 3QVKA 5LJLA 1K9VF 3AHDA 2J09A 1PJSA 4MPRA 2A8YA 4JY7A 1I9CA 3COYA 2QB5A 2D06A 1QTIA 3MCZA 3OH8A 4GLBA 4GBMA 5IT0A 4I1RA 3Q7EA 1O87A 1UC4B 2VRWA 1BROA 2V98A 3OO1A 4KVZA 4P08A 5FUBA 3ZD9A 4AF8A 3IL2A 4Q7EA 1T2FA 2BGUA 5DBGA 2PZJA 4QATA 5TX7A 3WGUA 1XRJA 1VYHA 3TEMA 2HQOA 1C50A 5HFJA 4FDTA 4AVYA 1UANA 1YMVA 4IVRA 3CX7A 1G3UA 3ZY6A 4CLHA 1Y4DE 5JAZA 2X40A 3F2IA 4ND5A 2OM2A 1AZTA 3LYAA 4G0YA 4IF6A 4YJ2F 3GCXA 3T1OA 3MS2A 2D00A 4CCYA 4MWBA 2WG2A 3DO5A 1Q0QA 3EEFA 4NNOA 5B37A 3ND9A 2GILA 4DPMA 1SCKA 2I8LA 3UK7A 4MRMA 4TS9A 2FEWB 4HXFB 5DSTA 4FFMA 2YH2A 3II6X 4NJEB 4C05A 3TZCA 1PU2A 4LZZA 4UC0A 3EIQA 1BS2A 1KARA 2AN9A 3KT3A 2E48A 1VMKA 3C5CA 4PO3X 3QJGA 4NYMQ 3D4OA 3SZRA 3WIVA 3I1FA 2IW3A 3KJIA 3K0FB 4G2TA 1W4BA 3EW7A 1NY5A 4HK4A 2I52A 1KGSA 4US0R 3I53A 1ZN8A 1YZQA 3FMOB 2K7FA 2DQKA 4FSXA 3LA8A 1LPBB 1K0FA 3DAGA 2J3LA 5CAEA 4N5MA 2EHJA 5A02A 3BE4A 3T1VA 1Z2NX 4L07A 1P8AA 1NHWA 3FWZA 3VOSA 2I0FA 1KVSA 4BFVA 3PNKA 2ODNA 4BO1A 4NFLA 1XNRB 1OH6A 3Q1LA 2OFWA 3M83A 4D8XA 1M2VA 1VPEA 4CT4B 4UVGA 4Y9UA 5KS2A 2WABA 4JBHA 1FRZA 4U2DA 3ENVA 5FPQA 3K20A 3UMCA 2YVKA 5F1YA 5LYJA 4BECA 5JADA 3O1HB 4HDMA 1WG8A 4GE3A 4JUIA 2P65A 2XRMA 3MPOA 1Q77A 4EQ6B 3CFIA 2VXCA 3H2IA 2JCVA 4FS3A 1Q14A 2LDBA 2QYSA 2H07A 5IF9A 5C0OE 3Q87B 3T4XA 2Q1UA 4QWMA 4Z4CA 3U4DA 4G86A 2E37A 3LVRE 4UMDA 4Q37A 1H66A 4RNCA 1KOLA 2CUTA 4C22A 1N75A 1UXKA 4LNUA 4YLGA 1Z5GA 4WZAE 3CPJB 3F5FA 1F20A 1VZ2A 5J1TB 1RXVA 3ZZTA 4PLFA 3CPSA 4C1NA 2GDZA 1J06A 1E2NA 2EQBA 3CX6A 3T9CA 3AG6A 4F72A 3WDKA 5JNLA 3OF5A 1LD3A 5LDGA 5LP6F 2VOJA 3JQBA 4PF1A 1FDRA 2GHQA 1IUPA 1MABB 2IVZA 2I6SA 1QVZA 2PX8A 3CN9A 2HK9A 1DQNA 2VTBB 1VSTA 4QFMA 1JBQA 2I2CA 3PZRA 1NPYA 1WO8A 1XZGA 3JQAD 3MXOA 1KEPA 4ND4A 1EYZA 5KSZA 3NWPA 1UPUA 1JKJA 2XGGA 2EKQA 4K9DA 1H0RA 1WW2A 4DLSA 1UEXC 3UTCA 5KJ1A 3LLVA 5DHFA 2IRWA 3IO3A 3JYPA 3DYIA 2Y0DA 4G89A 4EPTA 2X8WA 2G5ZA 1LBTA 2XTMA 3DE1X 3TDNA 4FK8A 4MLPA 5IC6A 5IJ9B 4M83A 2WTXA 4RYLA 1J49A 3OJEA 3E9MA 1LDYA 2GQ0A 2OHVA 1NW8A 5H3HA 3PNVA 4Y2QA 1N2JA 1JHOA 1AKWA 3PEEA 3W3AD 1VJTA 4Y2GA 4JWTA 4MGHA 1RRKA 2B3DA 2HSJA 2WU1A 3NAQA 1MAWA 4PSAA 4PHFA 5CB4B 4RACA 3OZTA 2WINI 3HY3A 4GWLA 4JA0A 4QU8A 3K1ZA 3DH0A 5T64A 4PZLA 1SU6A 4AUKA 5DZSA 4GKKB 4EK9A 4X1OA 3ZWCA 1YUBA 1N5JA 3PQ3A 4RD3A 5J63A 1FSGA 3KAKA 3N6VA 1RAGA 4B4OA 3C6QA 3C7TA 2BIFA 5A03A 4OQYA 2C58A 3CRZA 4PYOA 1VJ1A 4I46A 2Z83A 3BYZA 4J0EA 5BQOA 3L0BA 1VBFA 1IN7A 1XFDA 1Y3CE 2QZJA 2Q5LA 1VKNA 2GDJA 4TWZA 1VSVA 4XH9B 4DHEA 4GKVA 1YRYE 1W34A 4J90A 4X8LA 3NNSA 5GONA 4CL8A 5K03A 4N6GA 1DTEA 3I2IA 1TTTA 5DGHA 1S02A 1YBVA 2XWSA 3IUBA 5D3ZA 4E70A 3ASVA 2FWBA 4PLGA 2D5AA 3TLMA 5F3RA 5EJ2A 1SZJG 2P3OA 1OJLA 1VZ3A 3PWTA 4K9NA 4QULA 5JH7B 3EARA 1JSCA 4P4LA 2NIPA 3Q5DA 3KVVA 3Q9LA 1V41E 1RWQA 1G9SA 1I33A 4IIFA 1QAQA 5EWMA 4V1CI 4OGGA 1KDTA 4EPVA 5LQMA 1THGA 4F3RA 1V9SA 3M3PA 4IOMA 4Q34A 5I4KA 5AO9A 3IKLA 2WA2A 4YB8A 5CX4A 3F47A 3ONVA 1K1EA 2JFZA 3TLYA 5CCXA 1KK3A 3HA2A 4C3OB 2FQQA 4I55B 1H85A 1WB4A 4HX9A 1IB0A 1UQUA 3DMPA 3I42A 5B7NA 3DLBA 1YS6A 2PNJA 3VR5H 2GF0A 2GTHA 4BHRA 2JLAA 3D3JA 4AFNA 5C7OO 1UJ6A 4G1FA 4ADSG 1UMCB 4PPFA 4TS1A 3UB4A 2A54A 2DC1A 1P60A 2AVNA 2G1AA 1UBMS 4JJIA 4QDJA 4LTDA 5CK5A 2AHRA 4KYTA 4E5DA 5LKAA 4RZUA 2EL7A 4GPZA 4GX2A 4HLUC 3QVOA 2HHCA 5K6TA 3GQBA 1R0RE 1TUGA 4G5YA 1FDOA 1NR5A 5B4UA 4RK4A 5K3OA 1N1EA 4RXTA 4TV8B 1VPLA 3CBQA 4QL3A 1K9SA 3ROTA 2W4QA 4OMUA 3GJ8A 5SY9A 3ZDQA 2FKNA 4U8HA 2QZZA 5F77A 2RHJA 1VJRA 1U0RA 2PZAA 4L57A 1XXHA 2VUTA 4QXMA 3VM6A 4K9OA 2A86A 2JL1A 1GXSA 2EFJA 4YV1A 4WLVA 4ZMSA 1KWGA 2W6MA 3TIXB 1X6VA 4WVFA 5L4NA 4R8SA 2R7AA 3GT7A 3B7WA 3TPZA 3ZDXB 1Y6RA 3UJ6A 4U2FA 1SKYE 4CQMD 4F46A 5ADHA 1SCQA 2QWXA 1A8PA 2QN8A 5K0JA 2QA5A 3DDCA 4PWZA 1JXQA 3GFTA 4ZOCA 4CJXA 1I5RA 4TKUB 4XGRA 1B4DA 4HEJA 2P41A 1U11A 3B9PA 5AVJA 5IEJA 1RZRA 3GGCA 1R64A 1BVRA 1G5TA 4EW2A 4Y98A 2NUAB 2E5WA 1KPHA 1P5ZB 3SSMA 3T7KA 2PO5A 1O97D 4D42A 3ENQA 4YYZA 2PFSA 2L0XA 1ZM2A 2B94A 2XITA 3JQ9C 1X42A 2C8JA 2N3ZA 3ZVKA 1DQRA 1HV8A 1TW2A 4M9CA 5CHYA 1ECBA 1YBAA 4QNMA 4X20B 5DTQA 4B85A 3WQHA 3VU9A 4EX6A 3WK8A 5IKEA 2J6CA 1YK1A 3PXEA 4CV1A 4P4NA 4JXKA 4ZVLA 5EAIA 4HUQA 2GPJA 2HRZA 2I3BA 3AKCA 3VXKA 4G6ZA 4RHEA 2WWVD 4MP6A 2CFRA 4B3GA 2FR8A 2W98A 1C7EA 3WYNA 3GEGA 4CTJA 2WEKA 1QAMA 4GYJA 1H69A 3CVOA 4RXMA 3TZLA 2N1BA 3FMVA 3ZX4A 4X3OA 5DCWA 4GOMD 3EVBA 4IWNA 1G9TA 1OY1A 3A3OA 3BXHA 3H6GA 4RX1A 1FFAA 4N4AA 2PMFA 4IV0A 3QW4B 1BDHA 3MJTA 3WG9A 1OSNA 2I2WA 4OJKA 1DB3A 1EFPA 1HK7A 4XGNA 2HTEA 1B16A 2BF7A 4RZSA 4M9ZA 4TQ9A 1SXQA 2JPDA 1IJFA 1J23A 1HURA 2J45A 3F49S 2O4UX 2YNMC 3HV2A 5BN5B 2ZOSA 4XYBA 4DRXA 3E82A 4W1QA 2HU2A 1QHSA 2W70A 2IPNA 3I9NA 3D0RA 3RBVA 5JJKA 4GGMX 4YJHA 1KZHA 3CHYA 2C5BA 1EE9A 1QQ6A 5MF6A 4I4TA 1WMDA 2BEWB 4N5LA 4HDAA 3A6ZA 1IONA 3F90A 4NH4A 1PBTA 5KDDA 1J0DA 2P7HA 1UM9A 1GUBA 3AHEA 1F48A 4E11A 1QKJA 1LLQA 3LKDA 2ZK7A 1UFQA 2IZ5A 5D7BA 1JU4A 1UC9A 2OHHA 3FETA 3RF7A 4CTNA 4E5SA 1C9EA 4MQ5A 3FFWA 1SVNA 1XTJA 1J2JA 2ZB2A 1SXJA 3OHMA 3ZCPA 1SIBE 3CT6A 4FHDA 5F9MA 3UANA 1T8WA 3TSWA 3WDMA 3IJEB 2AE1A 3K3PA 1DKRA 1GFZA 1U1IA 2F67A 1NMSA 2FQWA 2DBZA 2HB6A 2SCUB 3WSTA 4O2AF 1MGPA 2HPVA 1DC4A 3CW8X 1NQUA 2I1WA 2BH9A 1EUDA 2EP5A 2XUIA 1RC0A 2GYYA 2WF7A 2JLSA 3DAOA 3BZWA 4LHXA 3UF0A 5KNBH 1O6ZA 1ISGA 1IOZA 2FB9A 3A04A 4RE5A 1II8A 2PSEA 4TMKA 3MXTA 4HB2A 1IWPB 4PZDA 1XAHA 4GBGA 1KTVA 4KXQA 4RWZA 3VAYA 5EWLB 4KGDA 4BLUA 4L74A 4DM7A 3J81A 4QUIA 1EFLA 3GLKA 1CUVA 1FUUA 4PYQA 2ZG6A 4B2LA 5IHPA 5JCPA 1V11B 1XYYA 1Z5OA 4DR5B 5JCOC 4LRXA 4UD6A 4ARZB 1I2DA 2UUOA 2I34A 3HUDA 3RASA 1H3EA 4NARA 3W06A 4C2BA 1JECA 4MYCA 4PIVA 2ORYA 1HDEA 3NHWA 1Q6ZA 3BCUA 4OJMX 2YL2A 4RF2A 2GZ1A 3SZUA 3OU7A 5AXAA 1AE1A 2IY9A 3N8IA 1W75A 4U6NA 3GFVA 4N7BA 2QF7A 3BXZA 3PD0A 2GF2A 3U31A 1PKXA 4FOSA 3DZIA 2NT3A 1JHDA 3VV3A 3E7WA 4RVUA 4RIFA 3G68A 1ZC4A 1E5XA 1ONNA 1T0IA 1ZAKA 2HRRA 3G5TA 3NBUA 2G09A 3A6GA 3R23A 3V2HA 2XQGA 1P91A 3NGLA 3VTZA 3CSDA 1P33A 3L04A 2Y1GA 3CBGA 2JLWA 4Q3DA 1QM5A 2G36A 3RJ9A 3U3RA 1QGYA 1VP3A 2BMWA 1U7OA 5BV7A 2NO4A 1RXSA 1H6DA 2QGNA 1XJ0A 3DMRA 3FWYA 1JNXX 5LVAA 3R8XA 3Q7SA 1Q0RA 3WJ1A 4A2PA 3C15C 1CF2O 2X9LA 3HPQA 4Z3OA 1E2HA 3ICOA 2VTDA 4A0GA 2WY2D 4FLFA 3UXEA 3K0FA 4EVSA 4F4IA 1Y37A 3DZGA 2PWAA 3DV2A 4IIJF 1QP8A 1RIIA 4HJRA 4BPBA 3FI0A 3OX4A 3JQFA 4X44A 5IZ4A 4QQFA 1ZC3A 1MIHA 3VI3B 3QXCA 2NTVA 3GMTA 1Q83A 1ZMRA 4AKEA 4EYEA 3NBYC 2Y0EA 4JFRA 4NBKA 1L4FA 2GMWA 1OCEA 4CF6A 4P34A 3LUDA 3DE6X 1QONA 3KUKA 1PL0A 2P1DA 3QVTA 4KXMA 3UHOA 1R5OA 3IMKA 5IYZF 3OWOA 1ENPA 1F2UB 3P2OA 3VMMA 5CBPB 4QJIA 1PNOA 1LGYA 4RKRA 1Q1ZA 2EFYA 3ZHRA 2OG2A 1MH9A 1RQNA 2LKCA 1IXKA 1GSHA 3NYQA 3H18A 1PFQA 3EVTA 4EQ6A 1ZS9A 1BSVA 1PN3A 2GN2A 3OIDA 5EJ9A 5LXTA 3WIDA 3GMDA 4DB2A 2OHFA 1FFBA 4FKMA 4U2CA 3ZH2A 3UWSA 5CG1A 1G8GA 1PGNA 3D02A 5GOZA 2QMHA 3S7ZA 4EFDA 3AFIA 3BOSA 3M8KA 3OI7A 2AR7A 1FS6A 4NK5A 1E61A 4X3PA 2PLAA 3G85A 2JK1A 3KAJA 3WMXA 3HVUA 4PNHA 1MV8A 3MYRA 5TMPA 3KVOA 4P4TA 4CMIA 4JQYA 1QGZA 1HFKA 1B3BA 4D5GA 4A4DA 1Z39A 4YONB 4TQGA 1XIVA 3CV3A 3CLTC 4ZVQA 4H2DA 4B6JA 4XGIA 1PX0A 3RBAA 4LI0A 1MABA 2DHRA 5DO9A 2AWNA 4IIBA 2VTBA 4ZO4A 3GXBA 4KUGA 4YFVA 5DV9A 3S2ZA 1Y5NA 2WFMA 3FLMA 1TNDA 1JB9A 5BPHA 5JXHA 3OBBA 1YACA 3KOMA 4I5GA 5KWJA 4JU9A 2VDWB 3H9CA 4I6GA 4MMYB 1OD6A 4QOGA 3U3DA 3VO2A 8MHTA 421PA 1B2LA 3DTYA 2ODAA 1H23A 2A1UA 4O0MA 1JFFB 4TLDA 4A3SA 3U0VA 5KAPA 1XZAA 2AMLA 1CZUA 2VI5A 4XIGS 4YCCA 5IJ9A 5LQJA 1W7AA 4FC6A 3R7SA 3AGPA 4MUXA 1WW3A 3FH0A 1OQAA 3E70C 5BWCA 1WDKA 3DEHA 4UCQA 1ISSA 2JRLA 4LPSA 1I2AA 3RC7A 4QDZA 4KIWA 1PNRA 2PL9A 3COSA 4R1NA 3PD7A 3OIVA 4XI9A 3JVVA 2FMTA 4BLWA 2H2DA 3DDNA 2IHZA 1JHQA 4BEVA 4KN6A 3CFYA 2FSFA 4WXRA 4MDFA 1F3LA 3JX9A 4U7FA 1UL1X 1P77A 1U4SA 4ZZ3A 3RJMA 1Y48E 1EFRA 3OQMA 1L5NA 1RJEA 2IX9A 3G7NA 2CV0A 1I7DA 2P5TB 2GBLA 1YRQA 2YRFA 2P90A 1T8PA 2ECKA 3E9ZA 3C97A 3I0MA 3DTNA 2YKGA 1TC1A 2A3NA 4X8HA 4HFRA 1M1YB 2PS1A 3GR6A 5D1HA 1ARZA 2QAGC 2JI7A 4MYSA 4I4IA 4NHOA 5C18A 1FTSA 3ZHBA 1M34B 2UUPA 3G88A 3HBMA 3S7TA 1Z4LA 3ITEA 1W52X 2X0NA 2ZTHA 5ICSA 3O94A 3K5HA 4KR3A 1LY1A 3EVFA 3V6MA 1E1LA 3QYJA 2V55B 2Q7OE 1SQSA 4M55A 3HI4A 3KUCA 2QVLA 3NYWA 2PUWA 1U0HC 5HG0A 4JQSA 1KZYC 3UT5B 1E6MA 2GLUA 3VJLA 5JH7A 2LD4A 4CQMA 4JX9A 2W6OA 2HHAA 3GAMA 2YHAA 3NGMA 1YOVA 2K87A 2C2XA 4IDBA 3P2MA 4NKRA 3U4GA 5F9HA 1F4PA 3EXAA 1BN7A 1GNSA 2GPSA 1SCBA 3BXXA 3ZV4A 13PKA 2VATA 4LNAA 3ELDA 2GPNA 4BCDA 1GN9A 2FN7A 5ED4A 2GZAA 4I55A 3HVKA 4RKFA 5T57A 3TYXA 4NU0A 4AQYB 5DT9A 1E3DA 3ADBA 2R11A 3A58B 2G28A 2QLFA 3DZHA 5JJCA 3PKJA 4IUYA 3AUFA 1KPGA 4RJKA 1GVHA 3AY7A 1RYHA 1UMCA 2ONKA 3L7AA 1YHNA 2C5FA 3GLGE 2PQ2A 1TVEA 3ROEA 1EKXA 5FBWB 2JCGA 5K0SA 1JAHA 2NP7A 2O7VA 2VAXA 1USUA 2QUKA 2R6JA 2W93A 4P3YA 5D5PA 4AM8A 4EUSA 1A5SB 1RAIA 5HE8A 1M6YA 2CXQA 2ZJAA 2P1ZA 3K5PA 4RY9A 2P2ZA 3SS9X 2YICA 5HBGA 1BGVA 3P9NA 3QTBA 2KW5A 1ETHA 1U3GA 2GAJA 5BO5A 4CKCB 2DECA 2YMQA 1VMEA 1A50B 1P3JA 2C4MA 4M8SA 2EVWX 4NOLA 2BHRA 4RSMA 1JQBA 3JW8A 1LLCA 3QXSA 5L45A 2RKWA 5C53B 3ZK8A 3NDIA 3ZCUA 1UKCA 2PTHA 4E4TA 5F1PA 2B1RA 3ROZA 2VNJA 4N8DA 3OTHA 1E20A 4D9HA 2AD1A 1IXYA 3EZ7A 4FR0A 5L95A 3GLQA 1ZUD1 3V8EA 3AL3A 3BSYA 3ADCA 2ABWA 2UXCB 4N7RA 4KQFA 5LBUA 5BURA 3OM1A 1RYBA 3IXLA 3PHLA 1HE2A 1A9RA 4TKUA 1U6JA 2YOGA 1CT9A 2P9TA 3D7RA 3PNLA 3OQNA 1ZKMA 2OD2A 1CTQA 5COBA 5ESWA 1U0OC 2VNKA 1JU9A 2W4MA 2H2IA 1J2TA 3LBNA 2ZSDA 3TW8A 2NUAA 4JEIA 3CX8A 3VRHA 4LCEA 2VPYA 2FUNB 1GGVA 3KQMA 3L93A 3OPXA 1PQWA 2ZKIA 4PLYA 3MUNA 2BZGA 4RH0A 1W1IA 1T5OA 4DQXA 4J4TA 3FRIA 1EDEA 4HNVA 4EG8A 5C1OA 2QYOA 3PXCX 2QRLA 5KTOA 3B7PA 3I2KA 4X20A 2BMAA 3IAXA 4P31A 3EH2A 2RCYA 2H0AA 3B13B 3HR8A 2JANA 3F6SA 1NM5C 2MSCB 1N0UA 1ZJ6A 2EW8A 1T9DA 3KPWA 4HTAA 4C78A 3U6KA 1UT6A 3D8BA 4M1YA 4NYJR 4CLDA 1VRWA 2HBYA 2XRYA 3D0QA 1MOPA 1CDDA 5T67A 1SOAA 4BVAA 2PSSA 4EY4A 2HK6A 2RHGB 1APBA 1GNLA 4B4WA 3A3NA 1LPOA 1X92A 1Z36A 4IJ5A 3X1KA 2VH1A 3BRWD 4YC7A 1KAEA 3JWGA 3DOIA 2IIBA 3GBVA 5EC8A 5B1EA 1ESNA 5FBVB 4LFBB 2Y99A 3ZIUA 4TL9A 3UOAB 5EP3A 1V7QA 1TD1A 2MR6A 2B92A 3TBKA 4AK9A 1I9GA 1UDRA 1CUDA 2AI1A 3KEOA 1PWHA 4ZT3A 3AW8A 3TB4A 2VDQB 4O2RA 1NC1A 2VHUA 3PQ2A 5BNTA 2RFLA 3WO0A 5IAKA 4NAHA 2WTNA 5ESRA 4CF3A 3N76A 1BFUA 2I1QA 3LKVA 1HXHA 1UK6A 4NCIA 5DLYA 1TAGA 1NF9A 2GM3A 5JZBA 1XTKA 3UK0A 3OKPA 5HUQA 3E35A 1KO8A 4UXIA 2J9GA 4M2LA 3DL4A 1ULTA 1WETA 3EIXA 5BV2P 1SU8A 4YVFA 1WXWA 4X3CA 4LVOA 4Z9FA 5KQRA 1UBOS 3LRTA 3L7LA 1E2DA 1T25A 1W87A 3THXA 2XGOA 4IM7A 5JYDA 4RHTA 3M49A 4YRNA 3GPBA 3SHWA 3TRHA 2XZOA 4QC2A 2GVNA 1K8QA 3PEFA 4PGAA 4BKUA 5BV0A 3GRKA 2W2QA 2QRVA 1QO0A 4BQFA 2SCUA 1CLEA 1UODA 1Y4ZA 4JT2A 3MCTA 4U2GA 3V2IA 5CFPA 3HGMA 1O08A 2C3MA 2QR3A 1BW9B 4IGFA 3DAHA 1ZNWA 1Y7HA 1OWPA 1Z0JA 4JLBA 5L9AA 4XSHA 1R18A 2HY7A 3OKAA 3V7NA 4Q18A 4R2KA 3PUHA 5TS3A 2CNLA 5JNVA 1KY5A 5BUQA 5J43A 2AH5A 3H3FA 5C31A 3P0RA 3S3TA 4DVJA 2BISA 4CTOA 5F64A 1PSWA 1DDGA 3A0RB 1PE0A 2BZ0A 2WB4A 3AFOA 3DQPA 1FYDA 1I0IA 1JRLA 3M7IA 1VCOA 3OC6A 4Y2VA 5FF9A 3RTDA 3VO1A 3GJXC 4DAEA 2KPOA 1D8AA 1JAXA 4YJDA 1V11A 4F4UA 2R6HA 4DZZA 2UZ0A 1MC8A 5C81A 3R75A 1SOWA 2R87A 3HYCA 5JNSA 1WOYA 2PS9A 3UK1A 5AI5A 2G5PA 2WM9B 3P45A 3QNWA 5KUTA 3QEAZ 4U9HS 3SZGA 4FOOA 1ORWA 4QBHA 1JILA 3LDGA 1URPA 4IXMA 4JVSB 4R2HA 2XUDA 4TSRA 4DCJA 2GHTA 2DH5A 1T9KA 4ZMBA 1BXZA 1OFUA 2ECOA 2REQB 2RC6A 4W6QA 1JR3D 2BMFA 4BC1A 4F3KA 1U2DC 2EERA 4DDWA 1UJ5A 2KBEA 4X91A 1I3OA 4BTEA 1G20E 2BWJA 1LRJA 1WTAA 4MCHA 2WJAA 2DCMA 4OA8A 1MJGM 1ONSA 3GA7A 1ZONA 3IP9A 3KTAB 3NIGB 5EMJA 1WKVA 1GYPA 1B15A 3FSGA 1M1ZA 4OQFA 4RMGA 1DDOA 3REOA 3EZLA 3KSRA 4LF5B 2LIPA 3HB0A 1EBFA 1AV6A 3O9VA 3LDAA 1GA4A 3NHUA 4NQRA 4YCLA 3OBIA 4BATA 5CXQA 1Y8QB 2CZCA 5LUAA 2OHXA 1DC6A 4F2WA 2WF5A 2WM3A 2BDTA 2OEPA 3A1SA 3VKGA 4OGKA 1SEVA 3QUCA 4KITB 1JJIA 1DWOA 2DLNA 2WQZA 4GSYA 3WTCA 2IDKA 3ZVNA 2ACKA 2QQ5A 1FFHA 3L1HA 3RI3A 5EHQA 4E21A 4Z1OA 5FT9A 2P3LA 4MP3A 4HWPA 1GG5A 2JGLA 3G0HA 3AEQA 1Y34E 1NI5A 3LK7A 4HR7A 3R5TA 4EDFA 1P4RA 1M1XB 2NO7A 5EIEA 2RETA 1RM3A 2NWQA 2ZUSA 1TF2A 2J87A 3EDCA 3GLVA 3PHJA 5EE5B 2Q5OA 5TNXA 3VHQA 4AECA 4CMHA 2D5LA 4UNNA 2QPAA 5FIUA 3PNMA 1RWVA 4RQAA 1QOZA 2IK8A 4AN1A 5JD6A 1FNCA 1ZHOA 3AM3A 4UVDA 1DV1A 3H2GA 5DB4A 3RIGA 4UUMA 4FGWA 4CN9A 2DFTA 1W59A 1ZXBA 5CBPA 4MS4A 1XCLA 3LVFO 5SYAA 1BGWA 2EDAA 5FO0A 1A5BB 1QORA 3VPGA 3WGOA 4ROSA 5FUXA 1RBZA 1C7JA 2OO3A 2DR0A 3HJTA 4JT4A 4TVKA 1AS3A 2R4QA 3CE9A 3FD8A 5HUHA 2ZZNA 3X1WA 2FWNA 4L6CA 5CLIA 2JAUA 1AKNA 4XWAA 2ZUCA 3UTDA 2Q3FA 3AVWA 3AEZA 1U3UA 1BCSB 4RKEA 5FORA 4W9RA 4MV9A 4TMTA 4OHWA 1S8AA 1ZJJA 1H6AA 1CY1A 2ZDGA 3B70A 3L1UA 4IS2A 4DUYB 2GB4A 1TJ3A 1C4OA 1VJ0A 2RGAA 3L4EA 3R0VA 4YRPA 821PA 4CETA 5TRTA 3F7OA 4KHZA 5LSAA 5DW0A 2PU5A 4HFJA 1OE0A 3ZCQA 4LVNA 5B7PA 4WXPA 2VAWA 1A4UA 1TK3A 3F1LA 1ZIPA 1K5DA 2UV8A 2GAAA 2OBLA 3QOWA 5EXTA 3WZLA 3K71B 1J8MF 1CUZA 4KFUA 3UAWA 5JAIA 2XYPA 3E0XA 4YT4A 1HNZB 1SIWA 1SPBS 5K2MA 2VDWA 3UKOA 3WLNA 4DTCA 3KKPA 2CSUA 3WMGA 2XLBA 4AG6A 1JFFA 4FSHA 4TTIA 3RUCA 1VHTA 3ZUPA 4OGWA 3MWDB 1M5RA 1IMOA 3W5UA 3ZZMA 3QKWA 2AOUA 3CR7A 3HU2A 3ADDA 2GXQA 3ONEA 2UYHA 1JKIA 4URXR 1M2KA 1KL7A 5I8ZA 1ZFNA 3W2IA 3KQKA 4OX9Y 1FS5A 2R8ZA 4WBXC 3LXRA 1Z3CA 2R6ZA 1WUHS 2DQYA 3M4ZA 4L0DA 2RHLA 2CZQA 3Q3IA 1ADGA 1M83A 3BH6A 4M1QA 3VTKA 2O2HA 4MLCA 2EWWA 1M73E 1PJQA 2QG6A 1RAAA 3KXPA 4U3JB 5EG5A 4A5SA 1P4JA 1BX0A 1GNVA 1FYEA 1E9EA 2XCLA 3ANYB 3AHJA 1D7AA 4HVLA 1M2OB 4ZI7B 1WXXA 3N75A 3OURA 2WR8A 2OLKA 1SPXA 2VP0A 4E51A 2HWYA 1SD5A 3ZCRA 5HK9A 5HNKA 2F1KA 2XUPA 4NZYA 1M1YA 4P54A 5KOYA 4ZANA 3IQGX 2COUA 3QV2A 4WCFC 1K75A 4J2OA 1RS0A 3N2EA 1L5RA 1WLYA 1XTQA 2B2CA 1M34A 2RI1A 3LC7O 4N40A 1OXUA 2VSOA 4MNTA 1EXNA 1WP4A 2XMBA 1T3GA 5JD4A 3ZDAA 1GILA 1GPWB 3DOHA 3QOYA 2BHLA 1EFKA 1MKYA 1HYHA 1OYOA 1RVV1 2OCPA 2RHHA 3L1JA 4HRVA 4C0SA 5CG2A 2ZYSA 4HNHA 2OV1A 3AL0C 1ZOSA 3UT5A 3TQSA 1NR1A 4I1VA 3R9KA 2GCNA 2ZBVA 1BMFD 1EEHA 3FJ1A 4PW0A 1JZSA 3M0EA 4N54A 4XXHA 3QHAA 3GDHA 1QKIA 2H4YA 2XQVA 1PFGA 3ZJ5A 2QJRA 1CYEA 3AF0A 3HFSA 4F0JA 1GL3A 3UY4A 1FSPA 4FFWA 1KA9H 2I29A 4JBLA 4X7PA 1GZ6A 1SUIA 2FG6C 3D1VA 4LOAA 4QGFA 4TQUS 3WQSB 1VCIA 4FQ7A 1OILA 1MJNA 5LB2A 4HDCA 1SG6A 2B6HA 2WLTA 4JI6B 3OZFA 5HOEA 3FJOA 2X23A 4BXOA 3MC1A 3I9FA 5M2QA 1U1GA 4URYR 4ATNA 1YH3A 2Y2UA 4R51A 4XTRA 2BFFB 3A6LA 1XZIA 2YS6A 1SCDA 2DR3A 3FYCA 2GN8A 2EYQA 3VPFA 1IEVA 2QLNA 3JQQA 1GPJA 3TNLA 2BKEA 4REOA 4C7BA 3WV4A 5B30A 4LJ9A 5KJ6A 3B60A 4CKCA 3T34A 3TRKA 4AUEA 4C01A 1R8YA 4KIFA 5FOTA 3PQ5A 5EPEA 3RSQA 2G6BA 1M1NA 2CNWA 3ES9A 3OM0A 1F6WA 1NUHA 1QLHA 4N3NA 4BV8A 4YXFA 1T3SA 3S44A 1NATA 1XTRA 1XQWA 2LGJA 1B8UA 2BMEA 4KXXA 1XLTC 3WWZA 2ICAA 3D81A 3LE8A 3D2AA 4AICA 3DE4X 2QPTA 2XI4A 4OIMA 1Q22A 3R7LA 1J42A 2H59A 3L1KA 3FIJA 1ZOOA 1JQ5A 2QX4A 2VKTA 2V9ZA 3E1GA 1OBCA 4KV7A 3P19A 4B4DA 3F4BA 2V5VA 1NBHA 4XIFA 2C7RA 3W2TA 4FZRA 4D2IA 3IBTA 5TEWA 3OOWA 1PBNA 1TO1E 2B78A 3F4KA 3CB4A 4IVNA 3WK7A 4CQLB 2WD8A 3IHWA 5HF6A 1RJGA 3SR0A 1R4AA 1KC3A 5TQJA 5BR8B 4NMLA 3A31A 1I24A 1LEHA 4ERXA 1EK0A 3OIUA 4PTYA 1GKYA 1NW6A 4K87A 2PZKA 3TIIA 3WZMA 3BK7A 2RGGA 1KDZA 4Q7LA 3PUVA 1HR0B 3EUWA 1IY9A 4E5PA 3QPCA 2QXYA 3U7HB 2NZ8A 5IWAB 3R0QA 2Y4OA 4QFDA 5FULA 1QZ3A 2QD3A 4QPDA 1E4YA 3Q8WA 4PYJA 3NVKI 4YASA 4CEIA 1MIOA 3FBTA 2JCXA 1WPGA 1ZU5A 5BQPA 1C9JA 2RHRA 3DFKA 2AC4A 2HBRA 3FI9A 3MIIA 5ESXA 5EXXA 4B7AA 5BOSB 1DCFA 5DT2A 1SOUA 3LMKA 3OLZA 2GPWA 4FYPA 2J0EA 5I7WA 1LDEA 2AJLI 3SC6A 4HWTA 3WGYA 1KMIY 1ORDA 2TYSB 3JD4A 4YT2A 4RK7A 2QTFA 2CNDA 3AC0A 3GCWA 2WJ6A 3VPAA 3GUCA 2Y68A 1NTOA 3KJFA 4HVAA 1EVKA 4F5ZA 4Z0TA 4UE2A 3N28A 5BVGB 3TMKA 4IHQA 2N1MA 3T7RA 3NBFA 5IDXA 1VL0A 1WS6A 3D0KA 3JR3A 2YS7A 4Z4IA 1MJ5A 1RHRA 1GLNA 2CFCA 2P3QA 2ZJ3A 2R8OA 2FMFA 1A3CA 3H4VA 4MR8B 4YPVA 1XI2A 1G8JA 2HK7A 2YWDA 2VPWA 2V03A 3M82A 5I7OA 3SVTA 4C7KA 2LCIA 5DBEX 4CGZA 4EB8A 1IH8A 5C4MA 3T3NA 4E2YA 3HVRA 1KBOA 3GJZA 5F98A 4UBMA 5ADWA 4OBEA 1XEWY 3BGOS 5JRDS 2ZULA 3W78A 3ZLUA 1E63A 4AMGA 4D74A 3AHCA 4MI6A 3RSHA 2R65A 3H9UA 4IWYA 4MKGA 4MKRA 4ARUA 2B0JA 4CIYA 3VJMA 1QLWA 4AJJA 3ODGA 2XNCA 2ZRGA 3ILVA 3LW8A 3PTLA 4KQEA 1ZMTA 1KIAA 4CHGA 1XVUA 4D4LA 3TB6A 1SKUA 4KIJA 1M67A 2B98A 3FOZA 1L9XA 3F73A 4GO1A 1NJFA 2D5CA 2PSHA 3KM0A 1DWQA 3V4FA 1JQEA 4NQZA 4PE5B 3THWB 4I1OA 1UQTA 3QU2A 2EC5A 1ORTA 3O6VA 3TLJA 1S5PA 4AZVA 1HETA 3K70C 2A3RA 4L3WA 3ZC3A 4RADA 4MJ7A 4B48A 2ZRCA 1RT9A 1OFGA 4J6FA 1E3IA 1ODLA 3A32A 4O2BB 5IAGA 4JBGA 1IB6A 3NP9A 4HWSA 3V8MA 2HX1A 4GX1A 3MFQA 2A0WA 1XK7A 3E4DA 3RRXA 4MHTA 3M1IA 5D6OA 4DVGA 4JVMA 1K8YB 2C0CA 1G3QA 3CF0A 1BAPA 3EHEA 1EK1A 1YZGA 1H22A 1X8JA 4YALA 3KWMA 1QFYA 3EYAA 5H81A 3A2KA 1ZGCA 5KBYA 4ZTBA 1ZM3A 1BMTA 2OORC 3A1UA 3MIZA 4DUGD 2XOEA 1YQXA 4PQYA 3GLIE 3KQQA 2YHBA 1RYMA 4DHWA 1NMEA 4Q47A 3NATA 1UXJA 4X85A 4YCSA 3G6KA 3KPYA 1VG0B 1TKRA 3HSSA 1L7VC 1QQ7A 2CL7X 3D6TB 2CDBA 4HAYA 3CGWA 2FLVA 2QG9A 1XDGA 2A14A 4LEIA 1YR9A 2XEDA 3FM9A 3F78A 3WE7A 4CN8A 3IVGA 1D5CA 3B6JA 4YMVA 3DZCA 3BFVA 5JTTA 3MN1A 1P75A 2QL9A 2GW4A 1KI1A 4NCBA 3R9XA 4RDCA 1XXHE 1E2PA 2O54A 3QRWA 3IP5A 1C9KA 1POWA 3KTAA 4H35A 4UNQA 1KSFX 3BZBA 3MHTA 5A7GA 5KPDA 3CINA 4Q1DA 1V9LA 3S1SA 1FP4B 4YIKA 4Y18A 1LDGA 1L7RA 1Z25A 4IQ4A 5J2TB 3CMCO 5ENVA 2BFOA 4IHAA 3DZFA 4TLMB 3R3UA 4K9RA 4IX1A 4AS3A 3HZZA 5KYNA 1MNAA 4BMVA 1LW6E 4A27A 3EJWA 2BBTA 4JLMA 4BJHB 3JQCA 3QVJA 2NU9A 4OP1A 5IX8A 4IJUA 4ZIRB 3EZ2A 4R6WA 2F43B 3H1AA 3GF4A 1OFTA 5EUBA 4DLKA 3VSAA 1EQUA 3OOEA 1T1EA 3OKCA 1AKQA 4RLHA 1E1CA 3DO8A 5K51A 4X1IA 4PHHA 5CB4F 2JFWA 4G07A 5JMTA 2I7VA 1B0ZA 2XNKA 5G1OA 4G5SA 1U3TA 2EG5A 3DVQX 2WU8A 1Q74A 3IR5A 4R6XA 3IC5A 4M9QA 2CB9A 3TTXA 3HJCA 4IHKA 4CM5A 4HDOB 4EG7A 5HW0A 2C5SA 4TZKA 3OSZA 2PYZA 1KAGA 1NBME 2EFDB 5IAEA 1PD0A 2VRNA 2H52A 5DGXA 4EB3A 3KO8A 2FQXA 1JEDA 1TEXA 2DRIA 3S2UA 3QELB 3SK0A 5ALPA 2JEYA 2P5SA 2Q99A 4HGOA 5CT8A 4FHGA 3LNTA 3FFAA 4QUHA 2OBYA 5JNUA 1RQ2A 2BSQA 2QENA 4HI0E 1BCSA 5AWFC 4IO1A 1FFXB 1I10A 3B3QA 4R3UC 4RE6A 5C34B 5JSFA 1GPNA 4LTNA 4MWGA 3H11B 4Y2SA 3HA7A 2DB3A 1K06A 1MR3F 2G2SA 1H1DA 2CMDA 2HIHA 4NBVA 3ACCA 3R20A 5JPDA 3G2QA 5CIWA 4BNHA 1YB6A 2I6GA 1P2BA 2ZIXB 1XKTA 2OQRA 4J4HA 3RAPR 4E5YA 1OXMA 1WU8A 3KUXA 2BTQB 4NCHA 1RHQA 2F64A 2FWMX 5LCXA 4ABYA 4EEXA 5BWBA 3V6LA 3D6UA 4KFCA 4ISBA 3ORHA 4J1TC 1JEYA 1GCIA 2WYIA 3L8HA 5ERYA 5SICE 3KUDA 3C3DA 3K0AB 3MWEA 3OT5A 1LVHA 1CPYA 3NHZA 5G3ZA 2IV3A 3KKLA 1L6RA 1G66A 2IUSA 3LLUA 4BQRA 4N41A 2C0PA 3E22A 1XZQA 1BMFA 4B8ZA 3QLTA 1T3ZA 3PNQA 5CFLA 1SXJE 1ACMA 1YL5A 2HNAA 2J9ZB 4TLCA 4UUOA 3UWMA 4B3BA 4YUXA 2HWUA 2HLDA 3MWDA 1GAQA 5KYVA 5HJ7A 3BRCA 3BA6A 2BV3A 1T35A 2Y93A 4U1RA 4RYDA 1XB2A 3ZBUA 2IYOA 1G8SA 3C6BA 2Q8PA 1QIIA 2WPNA 4QFCA 4QLOA 3TPCA 5LZ9A 2WHPB 4EARA 1GPMA 4QOSA 2HLPA 3PR1A 1NMXA 1U98A 3DQZA 4HAZA 1GGKA 2PLWA 4TV8F 4UM7A 3J81k 4NCAA 3L43A 5T8KC 1AF7A 5GV7A 3ZWWA 4CR7A 5MN6A 3D5EA 3U13A 4HQKA 4HJXA 4P82A 2PV7A 2ZR7A 1P5FA 1EVQA 3E5MA 2DWUA 3D3WB 4U3JA 5CLJA 3NDPA 3UJHA 3RS8A 4URUR 1L4EA 4ENPA 4YECA 2RGXA 5G0UA 3LDHA 2VPZA 4V0QA 4F2PA 2VT7A 2GCGA 4BAGA 3L6EA 4BMSA 4A1OA 3IP1A 2BYTA 1DRVA 3U4CA 1YUMA 3QPAA 1YFLA 2Z98A 3HEMA 1OTXA 2GETA 2Z6UA 4NJMB 3UM9A 3I62A 2PGDA 6ABPA 1XDWA 2PH3A 3ESXA 2PD3A 4EYGA 1KH1A 1HEYA 4MVJH 4D44A 1PFYA 1FBTA 4UBJA 2E0IA 3U6BA 3U80A 3DE5X 4ZAVA 4N3BA 4QLAA 5JMPA 3FBGA 2O3TA 4KR7A 2NPFA 4KE6A 1CR6A 1E5VA 2XCOA 1VHLA 3KTDA 4FSDA 1P5HA 4RFSB 5DLQC 2QM8A 3SC3A 4BO3A 4Y7CA 3AJ9A 4KOEC 2CE2X 4B3JA 2FFAA 3L6BA 3K5WA 1SC9A 5GY7A 1ECCA 3JQGA 3U7RA 1A96A 5KKNB 3ENWA 3ICPA 5DK4A 1L7AA 2QD5A 1OKKD 1HT1E 1KAOA 1LK0A 3DOCA 3E3NA 3MLBA 2CY0A 4V03A 5D2CA 3AUSA 2DLCX 1Y9DA 1U5CA 1CJCA 1ZH8A 1M0TA 2J59A 1WRBA 4Y6OA 2QTCA 4YFYA 5CA1B 3AEKA 2C8KA 1HPLA 1JR4A 4ZGGA 1RHMA 3NVAA 1K3UB 4QU0A 4E07A 3ED5A 1MTZA 1U8AA 2P4EA 3DNFA 1Y8ZA 4ZEVA 5TB5A 2EW2A 1NUQA 4X1KA 1GTSA 2ZIGA 4RTOA 4W5TA 1U3FA 3DULA 5HF5A 1B8PA 1ECLA 1SK8A 1YV9A 2DT5A 1XZBA 2ZE5A 3B20A 4COKA 2H2GA 1XQ6A 3E0QA 3HVJA 3T3PB 4UHDA 1C7QA 1Z4PX 2A5GA 3E9DA 3IQXA 5DNEA 3QBVA 2FG5A 2O1WA 1EG7A 2ZCUA 1XWFA 1ZIDA 2XJ9A 3EQ2A 4IMIB 4J7AA 4YJKA 3TUIC 2G1JA 2O2IA 5H70A 4ZYWA 4KGXA 5H9WA 1LBQA 3OM9A 3M3DA 1C9YA 4CMEC 1Z2DA 3KJHA 1ES9A 1UDAA 4KXUA 3UK2A 3BAZA 4Y3UA 1VP9A 5KWVA 1PQPA 3IT1A 1VQ1A 4UE6A 3YASA 1IPEA 3VYVA 3M4JA 1T8UA 4Q3AA 3NX4A 1YR8A 1SB9A 2OV2A 2HLNA 3GX1A 4QEDA 4ESHA 4IJQA 4YGXB 1XV5A 1H3NA 2VG8A 3D31A 5KC9A 2GH1A 4PXSA 1Z56C 3AUXA 1T2EA 1NQVA 2NXJA 4ISCA 3HJHA 3ED1A 4KO3S 4Y2XA 3MUEA 2YHSA 3ANMA 4UVIA 1CDEA 1JEJA 3UA4A 3DCIA 5TPWA 1OVMA 2JD0A 1ZH6A 2MMGA 2YY6A 1PS9A 5AQEA 3F6YA 3UUWA 3VKUA 1Z06A 4WNIA 3KT8A 3SZOA 1QMPA 2RCNA 3EVCA 4L72A 2C3OA 2A1TR 2K5UA 2FHSA 2GK4A 4XPIB 5ELLA 3NHYA 4IJMA 2HREA 3LHDA 4TWRA 1YFZA 2H9YA 2V0GA 1JFVA 3OZIA 4QYIB 3M2TA 1IOWA 4XM1A 3ZVLA 2FR0A 5FNVB 2RGEA 3K94A 1WZUA 7REQB 2H06A 3OPYI 2IW1A 5JBNA 3NGXA 4CI9A 3UPUA 5DYGA 5K3FB 4UTOA 2OWDA 3ZLTA 4DV1B 4BUZA 5BVGA 1BWQA 2VJQA 1H2XA 3IRUA 3C3MA 5ALRA 5KYTA 3FMGA 2VA8A 5K4AA 2DETA 3GZNB 2P78A 4O8ZA 3DKKA 1G42A 1HGXA 4Y6PA 2OL4A 4KQXA 1SUAA 2H57A 4QNRA 1ESCA 2EJCA 1UP4A 2WD9A 3G2JA 1UINA 1WSBA 1C3VA 1YI1A 2ZWAA 3BSSA 1X77A 2H11A 3KR0A 4ND6A 1SAYA 4DANA 1NIJA 4EW1A 3RVLA 4LC1A 2I2XB 4LE0A 4KE8A 2OSBA 3JQRA 1D2EA 3WLIA 3P0FA 1G7SA 5FWDA 3VZBA 3PFNA 1UXIA 1GPAA 3K8YA 4ZK6A 5G4KA 3AKYA 3CVWA 4KDCA 3AF2A 2MSDB 3RVRA 3SM9A 3GLFB 3LTNC 3HBNA 3G0GA 1N2ZA 4GBED 4HN9A 5JZ9A 3EEYA 3DBIA 2DM6A 4RF5A 3THWA 1KK0A 3OZ7A 3T9FA 4BZQA 5KDOA 3UJ8A 2JAWA 3WMFA 2B5VA 3MT0A 4LZOA 5FWNA 3R9IA 1FVHA 1VFPA 4PAQA 3RC3A 4ENTA 2F1JA 2FZ4A 2J9FB 4EM6A 5IKPA 4ZT7A 1H2YA 3WDLA 4JKOA 3KQOA 3W7BA 5IT4A 5CM9C 3REQB 4KI7A 4D4HA 3IIKA 1KVUA 2PUVA 3PSHA 1QDLB 3DDZX 1T8TA 3PDWA 2D1QA 2AFIA 1AHNA 1R0WA 4MSUA 1JSLA 3QXXA 8ABPA 4WZZA 1XRSB 2R1VB 3DB1A 3IQFA 1VIAA 3UAVA 1NNEA 1C0PA 4NV3A 2DYKA 4PG5A 1IN8A 2PRYA 5FLKA 2W6IA 4IIGA 3PWZA 3ZDFA 4FM9A 2YJ3A 1WPRA 1XQ9A 4L78A 2ATVA 4ZALA 3SAJA 4XOUA 3H4MA 2VT6A 1V5EA 5F2KA 4ENQA 2JIZD 3O31A 2YMPA 2E87A 4X5OA 1B1CA 3WXMA 3GYBA 3B5EA 1UPCA 2YWFA 2W6CX 3DL0A 1R8SA 1QQ5A 4K7JA 2XVAA 2FOLA 4FC7A 2P35A 3A70A 4AN0A 3NAZA 1RI4A 3TRFA 1QP4A 1BOOA 1P7CA 1SBNE 3IDSA 1QGAA 1Y6QA 3NTOA 4B5LA 2QVXX 1MJHA 2QP9X 4LN1A 3DF9A 2VZEA 2J31A 2NU7B 3N2ZB 1U9JA 3LUKA 3RSOA 4L5CA 4FWTA 3MJDA 2D0PB 2REBA 2EKPA 2M6RA 4YAGA 5HJEA 4ARSA 3GHYA 2JC3A 3OUUA 2HFJA 3ZUGA 2HO4A 1JQKA 4M6WB 4QUBA 3EXHC 3G02A 3DDOA 4LXGA 1PW5A 3AFHA 3E53A 5CDSA 3UMMA 2BGLA 1WCIA 1PDOA 1HNNA 2XMSA 4A7PA 1ZVVA 2YASA 1FP4A 4E12A 2F3SA 3IMEA 2PANA 1JXOA 5J2TA 4YWHA 2HI0A 2NZUG 2IBTA 3N2GA 2P2CA 4GGPA 4RMIA 2PKXA 3OSUA 4JCOA 3V4SA 2YIMA 4BN5A 2HQSA 4JITA 5B3JA 2Q1SA 2WK1A 3H7AA 3KHUA 2H17A 4BNXA 2GHRA 4FIDA 4AJIA 5TPZA 2FP4B 4RABA 2R8BA 4ZIRA 4DLAA 2IKSA 4P2GA 5GJCA 5BV1A 1EDZA 1UBGA 3PXGA 2F43A 1R3UA 3D3EA 4IDEA 1JAYA 4ESEA 1ZXLA 5JALA 2P3SA 1RDFA 2HSEA 1P74A 3QUQA 5GTDA 2O9JA 3A0UA 2I9KA 1BFDA 5D5HA 4JJAA 2GXSA 4RIEA 2QI9F 5DDIP 4RHXA 3V00A 1OX4B 2D4HA 3EMBA 1C3JA 4P84A 1JDVA 4BFZA 1U28A 2Q4OA 4OQLA 1I3NA 2L18A 3H2HA 1W76A 3WIBA 4XW2A 1MA0A 3HS3A 1SUWA 1NUTA 3NHMA 4WUVA 1AURA 4ZOLA 3LC2O 1VHJA 2AYYA 3H6KA 4YCDA 4ZAWA 2V45A 1EG2A 2W6JD 3TDKA 4DJDC 4X97A 3QELA 4JX8A 1SQ6A 3RYHA 3V8BA 3PZBA 1T2CA 2QXTA 3ZGOA 3ZWPA 2H1FA 1LH0A 3FUTA 1J6UA 1T5IA 3L07A 1YIAA 1SWVA 4OHRA 4C4YA 2PPLA 1FFXA 1F8XA 1R3DA 4I99A 1N5KA 3AF5A 2J3QA 3SQWA 1L0BA 5CLFA 1UXOA 4FI3C 1BX3A 1D2AA 1P73A 2H1IA 2QE7A 3JV7A 5HIIA 4LW8A 2OE2A 1Q15A 1RRCA 3UHAA 1W9MA 3VTAA 2FLKA 3M1AA 3KHSA 2FW8A 5CJ2A 3RSCA 3QLUC 1LSSA 3LQQA 1JQLB 2BAGA 3OICA 3PQ7A 2I9PA 2J08A 3EMKA 4HQLA 1LZKA 2BTQA 1EGAA 2GRUA 5LA6B 5EXSA 1PUXA 3LT2A 3UGKA 2ZTVA 1V71A 2NU6B 2E6KA 2FUCA 3OJFA 5KSYA 4ZN6A 5P8WA 2FU5C 2HMTA 1CUIA 2HRBA 2EEZA 2Q41A 3K0AA 4HVCA 3OZRA 1SBZA 2OZPA 4Y2HA 1PEYA 2ZT6A 4J2TA 1A0OA 4PC2A 1T8YA 1ZD3A 2WIJA 4PEVA 4Q12A 3WWCA 3ZXXA 2CF5A 2CB0A 3VR6D 2F59A 4Z4EA 4ALKA 4XWKA 4MI1A 2ZBEA 3RRYA 2GD2A 2PVSA 3B1FA 4BZWA 2I6FA 2GTPA 5IZCC 1AA6A 5E38A 5FFNA 4P0PB 4R01A 1KYYA 5G53C 3STHA 1OKKA 2NT4A 1ZXXA 3CKYA 3JWPA 3IVXA 1R4ZA 5LYYA 2WHPA 3ER8A 3RO7A 4DNFA 1XN1A 3W4JA 4WI1A 5HK8A 5A0FA 3T3GA 4X1YB 5AKYA 4YO7A 5ENZA 5LIPA 2XCSB 4OM8A 3R74A 4HPJB 5HVNA 3CLRC 3NT5A 1CUSA 2IBMA 5H83A 3RIXA 2RGBA 3D3WA 3A9UA 4HBZA 1Y1SA 4MV5A 5ERXA 4DIUA 1MTOA 3OM8A 3FDJA 4JT9A 1BWSA 4FMCB 1WUTA 1JH8A 3VDMA 1P0PA 1RPNA 4GICA 3WICA 4P83A 1CEXA 3CWCA 1D8TA 3UH1A 4JR1A 4LJAA 1NN0A 4PONA 4B46A 1CUEA 4JI1B 2AFHA 2YUIA 5EA2A 3CZ5A 1OJ7A 1B6SA 1Y7LA 1RBYA 3IEPA 1A8QA 4D7AA 3KB2A 3JQ7A 1QH0A 4F8EA 5GP1A 4DXAA 4NJMA 1J07A 1DT5A 3MCUA 2GSWA 4MQEB 2ZSUA 3EUAA 1I94B 1DAIA 3NOOA 2XB2A 1AXRA 3KYBA 3DD1A 3FDZB 2GKOA 4P35A 2GAIA 4XB2A 1RC8A 1Y98A 5B36A 4UM8B 2ANBA 2RKOA 2RHMA 4O1MA 4F45A 3EZNA 3LO8A 4HATA 5JAHA 3MPUA 2NVUB 1MFPA 5CNMA 1TEZA 1P9LA 4E14A 3H3XA 1AO0A 2YR0A 1Q20A 3TVDA 1WVMA 3I6YA 4DA6A 1LVGA 3BXPA 3DKPA 5LNK1 2EIXA 1ZSVA 2HPZA 3QXGA 1RPTA 3AJRA 3PHHA 3BHIA 4C7OB 4Q48A 1L5HA 3QZUA 2BEUB 1NBIA 2GO1A 3PDUA 3G2LA 2CSXA 1P39A 3NG1A 4ODIA 4AG3A 2Z3VA 1J9GA 3WYFA 5K0GA 1JVBA 1GAEO 3I28A 2WJ3A 1Z6AA 2ZSJA 4KC0A 4DR7B 1MRSA 4PCAA 5DLDA 2BFEB 1IVNA 1X8KA 4GI7A 3K0SA 4NMHA 3ZDYB 1BDJA 1RXEA 3LVBA 4IW3B 4M8IA 4ZCSA 1OMOA 1HO3A 1Z08A 1VA4A 3MWGA 1TKCA 4DXDA 1M74A 5IANA 4F4FA 4GXQA 2VJDA 3EPRA 4MKFA 4UZFA 1ISMA 2FPOA 3R4VA 4ARAA 4N3AA 1G16A 4BZPA 3RJZA 4LWQA 3SFZA 2JI9A 2V6MA 1I13A 1BHQ1 2NO9A 4ER5A 2Z9DA 3HR7A 3HHPA 4JNKA 4X6LA 1P2VA 3A6FA 3I9JA 2PZFA 2F3RA 2VVTA 3L8FA 3QMVA 4IKEA 3ROFA 4F7WA 4WBNB 1CXZA 2ZFUA 5J4KA 4KJXA 4GOND 4A9AA 2TMYA 4P3NA 2QMQA 3HXKA 5BRNA 1DNPA 4DDKA 2B34A 2HA3A 4CV3A 1N33B 3DTVD 3KKKA 1MF7A 3SC4A 2GEBA 2C5AA 1X0XA 3H17A 3I73A 4ON9A 3WISA 1RXCA 5DI3B 2CVHA 2EBHX 3U4MA 1FSFA 3F4LA 1GL9B 4KAFA 4P86A 5SV2A 1JDTA 2XMPA 1UC8A 5NULA 2NYRA 1JQDA 2O2SA 5H1YA 4M87A 4YBRA 2QT9A 4GBJA 4O4IB 3L8GA 3ECAA 1LV7A 5G40A 5GIOE 5HHTA 3ZE8A 3PP8A 4NIMA 4XGKA 4A6EA 3LUGA 2WFZA 1BD3A 2OXCA 4MB2A 3W5DA 3P2KA 3EZXA 2JZOA 3RFCA 4DGSA 1FA9A 1B8NA 3O4IA 5A5DA 4AJ2A 4N0PA 1XMPA 3AEXA 4XQEA 2C82A 1XC7A 3G0BA 1PVVA 1J1ZA 1SC6A 3G2HA 2ISSD 4FJ1A 1DXHA 5CCBA 3NIFB 4EDHA 4XPIA 4LY0A 1PGJA 1L4NA 2Q2OA 5A4DA 3TNDA 2CHGA 2XXBA 3EPPA 3WHKA 1JDUA 2W5UA 4MYRA 4MVJI 4QYIA 4BE4A 5JS7A 1WXGA 5FNVA 2OBMA 4ALLA 3ZE1B 7REQA 3V1LA 3JQ8B 2YDXA 1I30A 4LYGA 4G23A 1JIUA 3CZRA 5K3FA 4D25A 1FJXA 4JEUA 2OPBA 3GFQA 3I09A 5KTKA 2UKDA 4IZ6A 4PHCA 4GMKA 5HXAA 2QN1A 4Z7JA 5I4BA 3HDJA 4PR0A 5DHPA 4UHCA 2CXXA 1MDFA 2HBZA 1SCUA 3GZNA 3JD2A 3PGXA 1WMSA 3VVBA 3WFIA 3ZIDA 2PUGA 3R9WA 4CMKA 4K28A 1Z15A 4R8KA 4ZZ1A 3OHPA 1T1IA 3FSJX 3WAGA 1N5OX 3KT6A 4ZYYA 4A2QA 3LQFA 2XA2A 3PS9A 1IQRA 1O3YA 3WGZA 1JB1A 3TQFA 4X63A 5K6AC 2JIZA 3ICWA 1TK9A 2H4WA 3MGCA 5BMVB 1K8XB 1XO1A 5BR7A 3J7TA 3C48A 3NJ8A 1Z6GA 5FB3A 4XWWA 4JR0A 4PO1A 3WRYA 3HJAA 1IBRA 5HKOA 1AZLA 1MHTA 2VR1A 1KJJA 2A9FA 2QZSA 4L5BA 4RH3A 2W6NA 1OWNA 4TTAA 1M1YE 4BS9A 2NSHA 4D8UA 2IP4A 4NU8X 5E4YA 1Z4MA 1XTUA 1QP7A 3EA5A 5I47A 4BPRA 4WZBB 3KKMA 1Y1RA 1B23P 1AQ6A 4L9SA 3D6NB 1PK8A 1PWZA 4R83A 2IYPA 1P2SA 4K88A 3W34A 3IT0A 2C9MA 4P5DA 3W3AH 2VBFA 2VRBA 4B82A 4JQZA 1NN1A 2BN4A 3GFPA 2J9FA 2GNPA 1GU0A 4PG4A 5CTJA 1O4VA 5ER9A 3TQQA 4CMBA 3REQA 2JRCA 1NL3A 1RYZA 1QB7A 4GH5A 5EPUA 4JI3B 1FRNA 4G5QA 5F5XA 5HM6A 1F17A 1V8PA 1D4FA 1HL3A 4LXXA 3BQ9A 1YQUA 2G5CA 3KAQA 2WMYA 3TJRA 3MF4A 5HM8A 1G2QA 3ZVMA 1DUIA 2R1VA 4F4HA 4BKPA 1VLLA 1DU4A 1JA1A 2P68A 2VT2A 5KNLA 4I36A 4QYWA 2Y9MB 4QBGB 5F4BA 2PUFA 2XF8A 1QIJA 1QIDA 4MARA 4G5OA 1M5TA 2UZ3A 2Z95A 2W48A 1QXSA 2Q5IA 2DHDA 4YMWA 2HRCA 1NVFA 2AUTA 3IBYA 1KR2A 1RQXA 4GI1A 4S12A 2PUDA 1ZEMA 3TMAA 1ZH0A 1ENZA 4KPUA 5HJ2A 1N4DA 4MH0R 2JIQA 2UAGA 3N2KA 4GLLA 4DIEA 2J9RA 1G21A 1AS2A 4ZQCB 4B6SA 2HHLA 2PSJA 2E18A 2ZU0C 3BMXA 3ESZA 4RIGA 5AK3A 3GEHA 3GRFA 4NBTA 1GZ4A 2XAAA 3VGJA 2ZYTX 5BPFA 3GA5A 1NXTA 5J4LA 3C16C 1V35A 2NU7A 2VQ6A 3VR0A 4V2IA 4ENVA 4BZXA 1L8XA 2ZJ0A 3DUWA 5EZ6B 1GEEA 4F3NA 5BW8A 2LKDA 3GRZA 3PEWA 1YF3A 2H9IA 2O0HA 5JCJD 5FEMA 1D1QA 4P7BA 3L0DA 4M6WA 5DNYB 3G7SA 2XAUA 3FCOA 2QP4A 1PZFA 1XCGB 1EK2A 2VJKA 2XODA 3GA0A 4GR4A 4MPTA 3CNLA 3O8DA 1KI2A 3REGA 4KKXB 4B4VA 4ZVTA 5ITZB 1HTBA 3VHXB 1F60A 1Q95A 5K3SA 1R9NA 3L0SA 4BBZA 3N87A 4NZMA 3WBFA 2QN2A 1Z83A 1JHVA 1XHLA 5LMZA 4OMDA 4LDJA 1ESMA 1P7YA 2HQRA 4JSRA 4CKZA 2ZAGA 2GUWA 2Q3MA 2FMHA 3TNFA 4ZD6A 2RGDA 2FP4A 3GQVA 2VXBA 1Y9AA 3E2MA 4MVJF 1DG1G 4E22A 5JFOA 4DV3B 3S0JA 4ME6A 1SEPA 1V48A 2ZS7A 4QUJA 3C43A 1N6HA 3HZHA 4HH1A 2KBFA 1H65A 2V6IA 4R98A 2OAP1 5HKLA 1I4WA 1ZJYA 2XMRA 4CLXA 3GEMA 1MEJA 2VRCA 3BERA 3PC4A 4OD0A 5E7QA 4K03A 5B3AA 5JS2A 1YONA 1VMAA 1BCRA 2ZROA 3H8SA 4U7PB 4C87A 3S5JA 2P30A 1YCGA 3AB7A 3PFBA 4L8WB 4REMA 4WECA 3C3EA 4WNCA 1OX4A 3BVPA 1ZA2A 2FZLA 2BRUA 4AO6A 4EL5A 4X95A 4ZYUA 2UU9B 2YCLA 3ZWKA 1ST3A 1L7BA 1MENA 1XXLA 2V0CA 2C4WA 4EUFA 4JS0A 3K6RA 4CUZA 4YAOA 4BZZA 4EY6A 6GPBA 3ER9A 3QX7A 4KBFA 1EJBA 2WU3A 3O73A 2A4MA 3OP1A 3KXIA 1TU0A 5T4HA 2WKPA 1L5QA 4M0KA 5IW8A 2P5UA 1J00A 2DBRA 3HNOA 3QEOA 5DM0A 3VAZA 3ZZUA 1CRZA 4TV9B 2A1IA 2CCKA 4LXQA 4WH0A 3RQSA 1FQOA 4MGZR 2CJXA 1RE1A 3PLNA 4OQEA 4B1FA 4UE3S 4ZQGA 4CIWA 4FX5A 1VB3A 1U1FA 1NBOA 3P96A 3LPAA 1BE0A 3CE6A 4JV5B 2HDHA 2WUEA 4CYMA 3H2SA 2WE8A 4Y2TA 1OV6A 1J7KA 1SZPA 4M54A 2DU8A 3JYOA 5BYJA 5TARA 1Z7WA 2IDZA 5TGDA 3AZPA 5KYUB 1CEEA 1CUAA 1YR7A 2VK4A 4OM7A 1R4MB 1X39A 2I8CA 5A2GA 5G41A 3TAXA 2B7BA 1GRQA 2Q4RA 4PC6A 1JZTA 4Y9TA 5GV8A 3TOSA 1JJVA 1JN0A 5LA6A 3ZIAD 3WYAA 4BNDB 4UTPA 2NU6A 4X62B 5H68A 2GNOA 1VE6A 5EIBC 3RRJA 2GCPA 3ZZNA 2QAJA 3H65A 4MW6A 3B78A 3WMWA 1YIOA 2CJFA 2O3SA 4PN3A 1TKAA 4YK7A 4CFSA 3L92A 2AZXA 2OO5C 2P0YA 4F8JA 1EGHA 3JD1A 3EGXB 1ECJA 4KDFA 3VC3A 3WLOA 5CDFA 3DMDA 5TQ2A 1DRWA 2PJDA 2JVIA 3C7DB 1PJAA 4PZEA 4CE6A 4LX0A 5BV8A 3N9IA 2CHVA 3ABIA 2BEJA 4PLVA 2YCBA 1L5MA 3C6MA 3P9KA 3O4JA 3WDSA 3EGDA 1U0EA 3ZK9A 1QDEA 2XD4A 1C2TA 5J58A 3K72B 1QPGA 3IPYA 4WACA 1R50A 4HP8A 3AG5A 2GHIA 3CVVA 4KWHA 4GAEA 4F9FA 1KEUA 3EOBI 4LK3A 3A8TA 2WLSA 4JLUA 3ZWQA 3SVLA 3D7MA 2Y6VA 3ZCXA 3DV0B 5LM3A 1PR5A 3RUEA 3SQNA 3U7JA 3F71A 2WHXA 3SZ3A 3U3XA 5HILA 1TCAA 1IQUA 2BKAA 1EFDN 3OX1A 3B1ZA 3QFRA 2XDQB 1ZI9A 2D54A 3HBLA 3NWBA 4DMLA 1VYUA 2GZRA 2UZ1A 5K20A 1UWVA 3I0NA 3KC2A 3NMUF 3MA0A 4PO8A 4CPDA 1QIKA 3I2GA 2VP6A 4V0OA 3QK7A 3RS5A 1M8JA 3UEOA 4AU1A 1SUPA 4RZXA 5A7HA 3GVXA 3V46A 5CFNA 3WNZA 2IQIA 1AGRA 3WYDA 5HWSA 1RADA 4MQEA 4B73A 4BVGA 4JT8A 4UUQA 5ALNA 3PRHA 4PTLA 4YO8A 3KQUA 1VG1A 1CIVA 1M2FA 2BE9A 4BFTA 2QMZA 3UJCA 4FMPA 1H0KA 3L8YA 1Q7BA 4LBVA 1ORRA 4QXQA 3SGLA 3N8GA 5DN9A 1KORA 1E4VA 2BEVB 2OQIA 4DTIA 2AG8A 4P36A 4E0BA 4H16A 5AW4A 2EKZA 1KVQA 3LF1A 4GR9A 5FOVA 3SX0A 2NVUA 2VQ3A 3VR3A 4DCPA 5JNTA 3MGGA 1PYDA 1QFMA 1X1CA 2P0EA 1TAUA 3M5WA 2DE0X 3CCFA 1P9WA 4EFKA 3OX3A 5EXPA 5THXA 3FTNA 3WBBA 3HKDA 5AW8A 3NTRA 1YQDA 3GAAA 2WVGA 1N6IA 2F9MA 5ALIA 4IDNA 4FFDA 4WZBE 4QFBA 5F12A 1A4XA 1XCOA 3L7YA 5E1MA 3SLGA 1P2GA 1COZA 1MORA 2WJVA 3TQHA 3U9LA 1IVYA 3EW9A 1GTJ1 3ZCSA 1L5SA 5B58C 1ZCAA 3AKDA 1I32A 3UT0A 3DV9A 3T7TA 2O8EA 5AVVA 1HSZA 4ICIA 2PIDA 2BFEA 1IN4A 2ZSFA 3BN3A 2VTKA 2YDYA 3H8JA 3M6MD 1AGXA 1ZHHA 3LXUX 3U3KA 4ZDIA 4YRBA 3QBTA 5AVRA 2J0QA 2Z56A 4J0GA 4CKYA 1ORHA 1JEOA 4MAFA 4KO4S 3JALB 3F0TA 1XZEA 3MBOA 1RAHA 4MKIA 1Y6GA 1AZWA 5EIXA 2XX3A 2AFVA 4PZYA 3S2GA 2PL5A 1OAKA 1R6DA 3CJTA 5CDTA 1T9HA 2JAQA 3PICA 2PD6A 1NVDA 3EVNA 1NU6A 4QLBA 2I2AA 2ZBGA 3O9MA 1L7PA 4XM2A 3ZCTA 2QTHA 4UAGA 4WBNA 4AXBA 4F85A 2C04A 1NHGA 2ZJ2A 4PFSA 1C1XA 1J1IA 2CLCX 1J8QA 1TM7E 4ZO8A 2X42A 3FHOA 2PU7A 3OFND 1Z47A 2CDRA 2YXEA 5EE3A 1GTG1 5DI3A 4H31A 2X3YA 3L0ZA 3P2IA 4N01A 3HSKA 4PRZA 2Y0CA 1WW8A 2PFKA 1NASA 4RHCA 3NDBB 3GT0A 4QQ8A 2J3IA 2PX0A 3K31A 4IICA 4OSOA 1T4MA 4ZYLA 5LQAA 4XB1A 1USGA 1EVJA 2PO7A 2ZJBA 3JD3A 1FMLA 1OXKB 1Y3BE 2QRGA 3KJEA 4O2BF 1ZDMA 4II3A 4X7BA 5B6PA 2FN8A 4TSKA 2PZGA 1NLYA 3ZPXA 4WL0A 3QLVC 5CVUA 5K3EA 3M5DA 2GTIA 3KBBA 3WB2A 2DY0A 2JFQA 4CM9D 1UBNA 2HF9A 4NDAA 4H1HA 4MW2A 2X8LA 1JSRA 3ENNA 4JZKA 3RRNA