1N2GA

Crystal structure of a pantothenate synthetase from m. tuberculosis in complex with ampcpp
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
289
structure length
289
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a pantothenate synthetase from M. tuberculosis and its complexes with substrates and a reaction intermediate
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords Pantothenate synthetase
total genus 94
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2002-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 1n2gA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1n2gA01
3TS1A 2IELA 3IODA 2CFOA 1KQPA 1M8GA 4YP6A 3FY4A 2VTBB 1MB9A 4PBSA 4GRIA 3QTTA 1U7DA 3RFFA 2YWCA 1XNJA 2IP1A 1M8FA 3LOQA 1O97D 3VU8A 3N2YA 4R0NA 3CLTD 3IUBA 2D13A 2QJTA 1KH2A 3CA8A 3D6VA 4S1OA 4EG7A 3UK2A 2BYTA 1JHDA 2QUKA 5DEOA 1I6KA 3TZEA 1WXFA 3SDBA 1GLNA 4MWDA 3PNYA 2DETA 4RUKA 2Z09A 1H3NA 3IVXA 1N75A 5IHXA 4FZJA 1YIDA 2A4MA 3RJZA 1PG0A 1R6TA 3NBKA 3X1KA 5H7XA 1WXHA 4MUGA 2OV4A 1N1DA 4KR9A 1GZUA 3CLRD 1Q19A 1EFPA 1QNFA 1NP7A 3MMXA 3GLVA 1J1ZA 1PG2A 4YP7A 5HUHA 4R2LA 1FYDA 3CVYA 2Z3VA 2H2AA 3PNVA 4EG6A 4EG5A 2DPLA 1JGTA 1F9AA 1JZSA 5J58A 3H99A 1PFWA 1QRSA 4HPWA 4DNXA 4ND7A 1JIKA 1MB2A 1WXEA 3UC5A 3AIIA 3MXTA 2A88A 3UY4A 1WY5A 3N9IA 1KKUA 4GU5A 1O96B 4MWEA 3QE4A 3A2KA 4CQNA 3Q12A 1N2IA 3IOCA 2WSIA 4YP5A 2CV0A 1NUUA 1MBZA 3TQIA 3ZXSA 4OUDB 1YUMA 3DV2A 4MVXA 3A05A 1O5TA 2PZBA 3FOCA 4OJMX 3SZ3A 4PBRA 4E1AA 2E21A 3HGMA 2QUJA 3HL4A 3HV0A 1M8JA 1EFPB 4R2MA 5KHAA 1EUYA 4ZT4A 3MLAA 1Y42X 3X1JA 1QRTA 3OTWA 4MQ6A 1NYLA 3CLUC 3ZXIA 2A1TR 1XNHA 4MW7A 4MLPA 1PFVA 3FIUA 1EFVB 2RE8A 1U7XA 1KP2A 3H9BA 1TYBE 1WJGA 2QUHA 1OWPA 3C8ZA 3SP1A 4G5FA 5TS2A 4U7JA 5LLTA 1D2RA 3BL5A 4JXZA 2JANA 4CT0A 4MW5A 1TYCA 3GUZA 2TS1A 4G6ZA 4L2IA 1WXGA 1EE1A 2PG3A 4U8HA 3RK1A 4MULA 1KR2A 4UZEA 2DEUA 1GTSA 2X3FA 4MUNA 3K9WA 4I6EA 1V47A 3A04A 2GM3A 1K92A 1OWOA 4MUJA 1Q11A 2CV1A 3FI0A 2YWBA 3COZA 1ZH0A 1NUPA 2OQ2A 1J20A 4EFKA 4XFDA 2YXNA 1N2BA 2VXOA 4MW1A 5EKDA 1EJ2A 4HK4A 1I2DA 1JMVA 4QREA 2QUIA 1QU3A 1F7UA 2AKEA 1NURA 3COYA 4NDAA 4RPIA 4MUIA 1KH1A 1K4MA 3VGJA 3ZIUA 4MWBA 2DXIA 3FDXA 1X6VA 2A86A 1QQTA 1CT9A 1N2EA 4A91A 3FH0A 5KWVA 4MVWA 4G5YA 3L92A 3PNBA 4MAFA 1DNPA 5TEWA 3SEQA 1WQ4A 3AFHA 1VBKA 4JYZA 4XSVA 5IJXA 1XNGA 1X8XA 1ILEA 2PZAA 5K0TA 3IUEA 1LI7A 1VL2A 4NZPA 4NAHA 1QRUA 3CLUD 3ZJUA 1JILA 1T6YA 3AG6A 2J08A 1TYAE 3HFJA 1WZ2A 1IRXA 1GN8A 3CR8A 5LFAA 3CVVA 3SZGA 3RK0A 2B7LA 4KKVA 2E89A 3JXEA 1I6MA 3DO8A 2IJGX 3CLSD 2BTEA 1KQNA 1N2JA 1S4MA 3SYTA 1T6XA 3D6UA 1JIIA 2DERA 4DE5A 2HMAA 2QTRA 4DJAA 4EF6A 1J1UA 4ZT3A 4MVCA 3SEZA 4DLPA 2CYBA 4XFJA 5DK4A 1M1ZA 3AL0C 1QJCA 3NV7A 2QJFA 1OBHA 1OWNA 4JZYA 3G59A 4L2IB 2EL7A 2AZXA 3IOEA 3HMQA 4ZCRA 1A8HA 1LI5A 4OUDA 4Q16A 1BS2A 3L93A 4MUKA 3H9CA 2V0GA 2CUZA 1KAQA 1N2HA 2PXHA 4ARIA 3ND6A 1O96A 3N05A 4MW9A 2QTMA 3ISJA 2ZP1A 3HZRA 2WQ6A 3COVA 1EFVA 1QTQA 1J09A 1M83A 1VBMA 2HGZA 3M5WA 1ULHA 1TFUA 1IHOA 2ZUFA 4ZT6A 4K0RA 1J21A 2HZ7A 1FFYA 3KT3A 4YMIA 1OBCA 1LW7A 3H97A 1JIJA 4EG4A 2GOYA 4MVYA 1PFUA 4K03A 3LE8A 4ZCTA 2PIDA 2WB2A 1R6XA 3PRHA 2DUMA 1PFYA 1TEZA 1O0BA 4AQ7A 4P2BA 2JA2A 1J70A 3E27A 3N8HA 1WQ3A 4PY2A 2CYAA 4KPUA 3ZUGA 1R6UA 1TQ8A 3MLBA 3FNRA 4ARCA 3P0JA 3KT6A 5FO0A 4X0EA 2VTBA 2XRYA 3P0IA 1H3EA 3CVXA 4QBTA 1G8HA 3FHJA 1F7VA 5J5AA 4AS1A 5FNZA 1OWMA 5JBNA 5HG0A 1MRZA 4DDHA 1IQUA 1K97A 2X1MA 1N2GA 2X0KA 4MW4A 4DDMA 3DPIA 1YULA 4JFAA 1WXIA 2H29A 1N3LA 1ZUNA 4MW0A 4KR6A 3Q4GA 4ZCQA 3TZLA 4ND6A 3CLSC 1U0BB 1H1TA 4WNYA 2C5SA 2YY5A 3ZJVA 1XJQA 1SURA 3FWKA 2PZ8A 3IVGA 2RD2A 3ZGZA 3RBAA 3F3MA 4BWVA 2J4DA 3INNA 3KT8A 1KP3A 2A7XA 5TGTA 2DLCX 1GTRA 2A1TS 2NZ2A 2CSXA 3ND5A 3GMIA 1NI5A 1H3FA 3ND7A 3G5AA 1KQOA 3LCJA 2Z08A 3RHSA 4ZT2A 4KR7A 3IVCA 4MUHA 1WOYA 1NUQA 3KFLA 4HJXA 1MOPA 3TQOA 3IOBA 2PFSA 1IFXA 4MWCA 1O94D 2ZUEA 3PXUA 1OD6A 4I6JA 3IH5A 4ZT7A 1GAXA 1O6BA 1U3DA 5HUJA 1O95C 4U63A 2GKSA 1T6ZA 1N78A 1I6LA 3CLRC 3FETA 2O5RA 4TS1A 1N77A 2A1UB 1YUNA 2QTNA 3X1MA 1IQRA 1Q77A 2E18A 3DLAA 5DASA 5LM3A 2A84A 2D5BA 3S3TA 3ZJTA 2R5WA 4MW2A 3ELBA 5BNZA 4NATA 2X1LA 3I05A 4QRDA 5H16A 1VBNA 4F3RA 1NUSA 2DR2A 1NZJA 3IMCA 5K0SA 1KAMA 3IMGA 2QJOA 4EG8A 1JEDA 3G6KA 2WQ7A 2O8VA 2E0IA 3IMEA 4PBTA 1IH8A 1M8PA 3FG9A 3A4IA 5TEVA 3CVUA 1JZQA 4ZCSA 1YIAA 4J76A 1KH3A 5FO1A 2D54A 2A1UA 2EJCA 4UZFA 1MJHA 4I6GA 1JEEA 1IQ0A 1IVSA 3CLTC 4NAUA 2AG6A 2CT8A 3Q10A 2J09A 1B6TA 3CVWA 1O97C 3UOWA 1HYBA 1YI8A 2XRZA 1WKBA 2G36A 4ZCPA 2J5BA 1VLHA 4YBRA 3AKZA 3QTBA 1EXDA 2NSYA 1O0CA 4EGAA 3KT0A 4MUEA 4NX2A 5F23A 1G59A 3AG5A 1Q15A 4CDNA 1O94C 4WSOA 4H3SA 5J59A 1G8GA 1ZH6A 1GPMA 3NBAA 1K4KA 5KCMA 1O95D 3K32A 1U3CA 1ZJWA 5DB4A 3U1VA 4CDMA 4Q93A 1JECA 3UMVA 1F4LA 1NSYA 4EG1A 3COWA 3ILVA 1UFVA 4JXXA 2V0CA 1MAUA 1V8FA 4HJRA 3MUEA 4J75A 1COZA 1NUTA 2JAXA 1N2OA 4ZT5A 2J07A 1T9GR 1KORA 1TYDE 2I1LA 5AHWA 2CYCA 4MW6A 3VRHA 1MC1A 1G8FA 3P52A 4F4HA 1MAWA 4EG3A 4MUFA 2CV2A 1EUQA 3H05A 1RQGA 3OP1A 1QU2A 3P0HA 3TNJA 1OWLA 3IDFA 4DDKA 1P7PA 1T9GS 4KPUB 1M8KA
chains in the Genus database with same CATH superfamily
2IELA 2XSZA 3OZVA 4OIMA 4I5FA 1NW3A 3B8HA 2D8AA 3C7CB 4QRIA 2A5GA 4QSHA 4DEVA 1HFEL 3SQLA 1FYFA 2NYRA 3R6DA 2L0XA 4YJKA 3ZDYB 3ITEA 2GILA 4F8JA 3FF4A 1U7DA 1GJRA 1QTIA 4DDWA 5JZSA 4IXDA 1VPLA 1C9DB 4BEVA 5IWAB 4L4RA 3LPAA 3VU8A 1GEGA 2ID7A 3CLTD 4JJEA 4ZOLB 3S8EA 5BT8A 1EMDA 1ZK3A 2VATA 5FUXA 2CHUA 2AV6A 2E55A 1ZRNA 1MO2A 2I1VB 3CH5A 5DX8A 4IDPA 4ILEA 2E1RA 4JJ4A 4IFEA 5BSEA 1J33A 2I4NA 7GPBA 3IEMA 1JG6A 5KNCH 5FL7D 2R68A 1OAKA 1M1UA 2G06A 2VDNB 3HCDA 3LYAA 3V42A 3RC2A 3BBLA 1G7SA 3WWPA 4M89A 1PK8A 3VZBA 1UXOA 3JQ7A 2XSZD 3UTCA 3KB1A 4RY9A 1QNFA 4HYQA 4LXIA 1DKUA 1P45A 4LSGA 2BBSA 3O8CA 3OT4A 1TIKA 2O50A 4CF7A 4KK3A 3SHTA 3WISA 2I4TA 1Y3FE 3HEAA 4Q9IA 3W05A 2FMUA 2IXTA 5DHUA 3ZDEA 4G4GA 4WK4B 2ZSFA 2V6JA 5A71A 2I4RA 3DZIA 1TK2A 5IT9A 1RZVA 2B69A 5MN4A 3NDPA 3TXXA 2D1FA 5A05A 5LZ7A 4IDQA 3H04A 4NS1A 1TTTA 3OQMA 1MB2A 1T0BA 3NOQA 4JLOA 3QKSA 3PJGA 3H8WA 2A88A 3SXUA 5FT9A 4LVCA 3LGSA 1RXCA 1ENZA 2RARA 2CCGA 4EDFA 2EGGA 4RTQA 3QPWA 3FDIA 3A2KA 1L5MA 3L04A 8GPBA 4J0JA 2IZ5A 3OA0A 1ILWA 3CSSA 1FQKA 3G2KA 3SC6A 2IY9A 3DB2A 2ZYIA 4UE3S 1XXHE 2J3MA 3RVOA 4HHEA 1CDZA 1L7EA 3KYCB 3OG9A 2J6HA 3DSRA 4LJYA 4OK3A 5KTTA 2I91A 4EO4A 1QV7A 4J1QA 1PSDA 3A05A 2XB6A 4A23A 5IN5A 1FTGA 1W4ZA 4FC7A 4OJMX 2NYVA 2Y0PA 1M0WA 3MGGA 3N70A 4X41A 3GEDA 3IO5A 3SMVA 2BEVA 1HYGA 1H9BA 1SRRA 2P2GA 2R6HA 1OF1A 4NCJA 3SDZA 3UC9A 4CM8A 5F5NA 2HPAA 2QMUA 3F3KA 3CWQA 2BEUA 2ZI9A 1OYYA 2J9YB 3X1JA 2D5AA 2I4MA 3B1WA 1TA0A 3HFSA 1HT3A 5SZJA 5THXA 5AO9A 1I6WA 3AV0B 1ZISA 3MTBA 2ZWAA 5I3CA 3DXZA 4RZ2A 3CF0A 1WZNA 3C6BA 1D4ZA 2IIBA 1E98A 2H54A 1VHJA 2ZBFA 5BSRA 3FW1A 3PJDA 1GTMA 1KZ1A 2AVDA 3CONA 5IDVA 3UXMA 4ZDIA 2JLWA 3OJEA 4C0QC 4YBZA 1PI3A 3DTTA 3IS3A 2BF7A 1H65A 2W4QA 1R74A 1QB7A 1SULA 3LUPA 4FDMA 5G40A 5TF0A 3RRXA 4EY8A 3NYWA 4Q1DA 4B6OA 4C0SA 3PL1A 3VVCA 4E11A 2Q3BA 2K87A 2FG7C 3UJ3X 3C3EA 4YV0A 4L50A 1E4YA 4GEKA 3ONWA 1WRBA 1XMVA 4S2EA 2WD9A 3KEQA 2F3PA 1G4AE 1WXGA 2ZJ4A 4JELA 5EVJA 3CR7A 5DK6A 1WP4A 3RUEA 5KTPA 2LDBA 1PVVA 4EI9A 4JYCA 1VLQA 2J59A 1ZNZA 1O89A 5SZHB 3TQQA 3UPUA 2ACWA 3FZNA 1BX3A 3EGWA 2YMPA 4B1FA 2X1HA 3WBKA 4D4MA 3DLIA 1XLVA 2EF1A 1ISGA 3MOSA 4MYRA 4MI3A 3VNBA 1GG2A 4UM9D 1T25A 3GFTA 4KV7A 4X1KA 3A9TA 1C3LA 1QYRA 1UBRS 1WTCA 2OHGA 2BFBA 3DWFA 2Y27A 3E70C 3ECAA 2GRUA 3NFYA 4G8JA 2ZYDA 2BFPA 4M1SA 5LBIA 3TQTA 1PO7A 3F98A 3W8FA 3B70A 1Z28A 1UJBA 4HGNA 2YXPX 4L0MA 3RYFA 4U5QA 1JFFA 5EKDA 1JA0A 1QR2A 1G8AA 1YNSA 5EIXA 3TVYA 1IOLA 2EFGA 3IMFA 2RAUA 4O2BF 3TIGA 1PYDA 3GQVA 2NX2A 1YOVA 2NLOA 1O8CA 1GV1A 2CHQA 1Q22A 1ODJA 2YZKA 3ABOB 16PKA 4GOKA 1QQBA 3A31A 3AJEA 5FX2A 2P79A 3I9JA 1TC1A 3QVMA 2BFFA 3DNMA 2V98A 3N74A 3G9TA 4LCBA 5LQSA 3T54A 3PICA 1E99A 2AB0A 5IJ0A 1XNQB 3HB7A 5K05A 1TLLA 3L1KA 4Y2YA 1XCLA 4D92A 4J7XA 2J5XA 2D0OB 2D59A 4LXUA 4DMFA 5K3OA 3PITA 3U44A 1DO0A 2GD2A 2XT6A 1TM5E 1ILEA 4HNAA 3VR4D 3WKDA 2QZSA 3P9IA 3RUFA 4LBWA 3N86A 1PX2A 1U7WA 4NCIA 2NO6A 3HMKA 4DTCA 1KO5A 2AUNA 3AVPA 4N49A 4NZPA 4CHTA 1U28C 3WLKX 2OMEA 3UMSA 1GO2A 2KI5A 4R7TA 3T1VA 4BWYA 3TWOA 4EY4A 5HF5A 3PPWA 1T5DX 2JDID 4MKZA 3KWMA 5KJEA 3GT4A 4E5SA 4ISCA 1Z25A 3K0HA 3ICWA 3MNFA 1QONA 4UPEA 1YB1A 2VHYA 5I9LA 5K3EA 3OUTA 4M22A 3K0SA 2PH3A 3DDCA 2WEKA 3KD3A 3LQ2A 2CY0A 4W1SA 2XTJA 2VHWA 3X44A 2MHCA 5IC5A 1SBNE 2O2DA 1LF5A 1KI9A 4H1VA 2B34A 3SF0A 5KDDA 3F74A 1DE0A 2XA2A 2QNIA 3JWIA 3R9IA 4K46A 2R00A 4OFZA 4EJSC 4C5CA 1SXJA 3UEOA 3JWHA 5CW1A 1P9LA 2DZDA 5G0WA 4YAKA 2X0RA 3Q5GA 3QMMA 2QJFA 4KIJA 3HM2A 1T8RA 5BQOA 2ZDQA 1FNSA 4QU0A 2W2QA 3QVXA 3VZDA 1SCUA 3VR2D 2PKRA 4BNWA 4GDFA 4DUGD 1YA4A 4OUDA 4IVRA 3WLLA 2P3QA 1YMVA 3L93A 5HJEA 3X2FA 1QMGA 5LZ9A 4KG7A 5LPNA 2BLNA 3EXHC 3VA7A 3TW6A 4R1OA 3N0WA 2HYDA 1EK5A 1VC2A 4M1QA 3MK31 1K9VF 4MLCA 2BBWA 3UB4A 3T1QA 821PA 3IIKA 3DR5A 1ZD8A 4R8VA 1O4VA 2J7KA 1NFFA 1NMYA 1KJ9A 1ADGA 2INGX 2QMEA 2M6LA 4GR4A 1NVTA 5BQFA 5ETJA 2XUOA 1PV2A 2OVBA 3RGGA 1AOXA 3V33A 4LFBB 1Z45A 2QG4A 1FFYA 3KT3A 3NGLA 2G67A 4QQ8A 1UMCA 2A7QA 3HDVA 2HLDD 3CQ9A 4IDBA 4TQ9A 4U00A 2Q4OA 5FWDA 4R71A 2EW2A 4LKOA 4O1MA 5IBQA 5EJEA 1Y1RA 2L18A 3OM0A 1K5PA 1G42A 2K6GA 5IJ9A 1XKTA 3C8MA 3L01A 2VP9A 3ZI7A 4IHJB 2FETA 2PD4A 4GD3Q 2RGUA 4NH4A 3NVKI 4CTMA 1C0IA 3U3JA 1L7DA 1M1NB 1I7NA 2VPPA 4FLFA 4UUOA 3ITKA 1HPLA 5CK4A 2HHJA 2PUJA 3PXBA 2O7RA 1QIDA 4YT5A 1CKEA 3HNPA 5KS2A 2J9ZB 4HXYA 4JX8A 3CUEF 1WDLA 4J0QA 1WVGA 4IDCA 2NZUG 3MRTA 5ALIA 5TT1A 2ZBRA 4FYYA 2XBLA 1Y5RA 4GI7A 1WAMA 2B5OA 4GYWA 4QELA 1MOQA 1AX9A 4XPIA 3STXA 1TL7C 4WGFA 3TTUA 5JR3A 4DHEA 1WXDA 4JP8A 5J5AA 3EH2A 4GOJA 5K45A 2M32A 5BN4B 4KVZA 4TZ6A 4DDHA 3JQ9C 4RQAA 3VR5D 2GBFA 2JK1A 5EFOA 2GFIA 3AFIA 3LW7A 3O84A 4QO8A 1DAKA 3ZGVA 3CB2A 5JXGA 4YCNA 4AMGA 3FPGA 4EYSA 5BUSA 2ZSJA 4IDGA 1FMLA 3GGGA 4LTMA 4UARA 3WO0A 1ZXBA 3NWOA 4PZAA 2YJ4A 3Q6NA 3K15A 2C9DA 5LMCA 1GPNA 1UDCA 4OL9A 2GRJA 3EVGA 5IULC 4K7JA 1RAFA 1CEYA 1QGDA 4QHYA 3HY4A 2IE0A 5HGXA 2BI4A 2Q4DA 3BXGA 5B1HA 1EEHA 2RK6A 4GOXA 2Q2OA 4Z54A 3NCHA 4HAZA 1ZSVA 2J85A 4K9QA 4MS4B 5KU1A 2B0JA 2ZRFA 4KACA 3KRTA 1KMMA 1JWAB 1JH8A 1ACLA 4HLUC 3R3VA 4HTFB 5IAKA 1U0GA 3F4LA 3K0KA 4OF4A 4ZGGA 4XWKA 1SWVA 3D6NB 5GV8A 2BN4A 1CZUA 1M6VB 1VCHA 2FE4A 1KQ3A 3FA2A 1CXZA 4MVJM 5A0TA 3GLRA 3NMUF 3OQNA 1P9OA 1X15A 3F5FA 1MX1A 1G41A 3LUKA 3PHJA 5I7AA 1Z39A 1L9XA 5JJIA 3LNTA 2BSQA 1LX6A 3ZLTA 2W11A 3TQOA 2C9MA 1FNNA 4RVCA 4OAPA 1ZI8A 2Q2WA 4LFAB 2LE0A 1PR0A 1Z2DA 4RJIA 2C31A 4UKDA 4HVLA 1JSRA 5EJAA 3GEMA 3R3SA 3LFUA 3R3XA 2FY8A 3A06A 3ONVA 3UMCA 4EW1A 2ZK7A 4FOTA 1QIJA 4KI7A 1B00A 5FUWA 3TIVA 1UEIA 2F17A 4WXPA 3T38A 1DEOA 2GBIA 1JJAA 1WUIS 2C94A 4OLHA 2IDMA 4A8JA 3O7WA 4H7FA 2MIIA 4JOBA 1FMCA 1H8EA 2O5VA 1OLSB 4YP9A 4WBXC 1GT6A 1UMKA 2J30A 4DLBA 1JHAA 2C5BA 3FUWA 2DE0X 2J0VA 3IAFA 3ROFA 3ECSA 2OGTA 4MEBA 2QAGB 2ZEJA 4WCFA 2I8LA 3LYUA 4TWAA 4UEQA 4LSMA 2R48A 3WYFA 3ZLJA 2CDBA 1PT6A 1AF7A 4S1NA 4NATA 5B3KA 4QM6A 1T15A 2R47A 3RC7A 3BB1A 4YHBA 3RYHA 3ZLBA 4COOA 3FPCA 2E4VA 2VYFA 5AM1A 1P5HA 3WQSB 4ZCMA 4V0MA 5K0LA 1TAHA 4LZAA 5JFOA 4FXOA 5KNDA 3OTQA 1X1TA 2F64A 2WA1A 1IG3A 1W9MA 1JW9B 2OTCA 3OIFA 3E4CA 5LQCA 1IK4A 5IF9A 3OLQA 4ZANA 2I54A 4URZR 1LTKA 1GNVA 3HV2A 4FIZA 3L7DA 1NXOA 1IH8A 4TSRA 1CJVC 3MILA 3W1WA 5IZ4A 2QR2A 3B6JA 5JD6A 4ZQHA 1R4AA 3E6AA 4JZKA 1XK7A 2EDCA 4FFDA 2MSKA 3SFZA 3NJRA 1K6JA 2XQKA 1YQUA 4AJEA 5KHLB 3S2ZA 1XBTA 3HP4A 3M1AA 4JEHA 2IECA 3GJ4A 4X1IB 5AFSA 3L0BA 1JXQA 5DTJA 3ZJ5A 2WTNA 1TUIA 3AI3A 5FA8A 1XROA 3HUUA 3L40A 3I23A 4QUDA 2Z9CA 3N6VA 3D7RA 4HX5A 4XCXA 2J8ZA 2Z4TA 2M6SA 4QM7A 4BMXA 3AWIA 4R9UC 4TYQA 1XF9A 5EE5B 5LYJB 1M2NA 3NWPA 5AK5A 1EFDN 4AIRA 1NRJB 2CLCX 2Y4OA 3K53A 1GRRA 4CM4A 4DABA 3FVTA 2WYOA 1CWUA 2Q99A 3HCWA 5CPFA 5K4HA 4PYOA 2G0TA 1SUWA 1T3LA 3HB5X 1R18A 2EU8A 2WWRA 4QGHA 5CMLA 4C6RA 1SC3A 2XQVA 3QTBA 1L7VC 2DWUA 3B1FA 1P6UA 2OCGA 1Z5ZA 3L49A 3MB5A 1SBCA 4M9QA 4QARA 4QFMA 3QYAA 5JD3A 4E6PA 2DR0A 5CVDA 4ZYTA 3SE0A 2P9BA 2RH8A 1AE1A 3CEJA 3NT4A 4MR7A 4P6VF 3PUZA 3HA5A 4IJMA 2Y76A 4ER3A 3WKEA 1M5RA 4C87A 3OO0A 4R2KA 4OH7A 4OU4A 3TE6A 1Q16A 3D6HA 5H83A 2IH4A 2W98A 2Y1XA 2JC3A 3ZWAA 1SPBS 1KJZA 4W9NC 2AN5A 3ETHA 4FILA 4YJHB 3U81A 1KBZA 4YMLA 2C4KA 4TTVA 1A4UA 1NF2A 1Z5NA 1W46A 3H86A 1MPTA 1J0DA 2RK4A 4PNZA 4RQTA 1EVZA 2RDMA 1A9YA 2JCGA 3KEOA 3GOHA 1H42A 3TD2A 2OKCA 1TKCA 2YWJA 1T1RA 1O5OA 2V7BA 1L5YA 4DBLC 3BE4A 5MHTA 1U6KA 4UCQA 2P91A 4OOFA 3PQFA 4YAOA 3H5WA 1KRXA 2CXTA 4TMWA 1E2LA 4Y30A 3QXGA 1U6IA 4L85A 3HB4X 1M54A 3MGBA 4ZVQA 4B7UA 2VDMB 3JWGA 3WLEA 4C22A 3P0HA 5CIQA 1QU2A 2IYEA 2E5FA 4QYWA 4R2HA 4WDRA 4V2UA 1D5CA 2H6EA 2RBEA 3OUUA 4BP1A 4TTRA 4XDGA 2CFOA 4A1OA 3K6JA 4OAQA 1B8NA 4Y2UA 1G5RA 3N58A 1Z22A 2FQXA 2O52A 3L8FA 3K6KA 4RXTA 5K3FB 1KFBB 5BSFA 2C1ZA 2W6IA 3BCRA 3AKEA 3QY0A 4DG5A 3I1FA 1ST2A 1Y1TA 2XMRA 2C7VA 3W3AA 5DLEA 3EW7A 4FNOA 1XZGA 3QIAA 4Z7JA 2JLVA 3EG5A 1UBMS 3GNLA 1H69A 5AK6A 1JXMA 3R41A 4UTOA 3RCBA 1JHDA 2HU8A 3CX6A 3TZEA 3WGYA 1YB5A 2GCEA 4EQZA 1Y5NA 1JQDA 4YPOA 2FLVA 4OAOA 4RKFA 2D5IA 4FZ3A 1XL1A 2QXUA 4PRYA 4V0RA 4FZJA 1P4RA 2X6QA 4G5OA 4XWAA 3NBKA 1VYTA 4K9MA 3TLYA 1G5TA 4WK2B 4GECA 3RRNA 2PK3A 3FTNA 4O4IB 3M3DA 1GZUA 3ZQ6A 1Z5UA 1T24A 4DSUA 1FPQA 1PW7A 1MQ9A 2RJNA 5GVRA 3W5UA 3W6ZA 3K70D 1L3CA 2IHZA 3A9SA 3BGOS 4MNTA 2PS9A 2Y99A 3VOAA 3AVVA 2BRUA 2JGKA 4JY7A 1M0EA 4HRVA 2V3WA 4A26A 1D6MA 2VPTA 1CQXA 1P5JA 2EATA 3BK1A 1XUOA 1YR1A 4UEWA 2CVPA 2QRKA 2FHSA 2QOEA 2Q1YA 3LKDA 3PNVA 4UFOA 4KNVA 2ODPA 3H6GA 1NVVR 3NOOA 5LP6C 3VDNB 2B20A 1ETUA 3DB1A 1UMDB 3AUSA 3QX8A 4RIGA 2BP7A 3QQPA 1VL8A 1Q95A 1N1GA 2GGSA 1ODTC 4E2XA 1CIVA 4I4CA 1NXTA 1SQ0A 2DKFA 3CRVA 3HEBA 4EHBA 3A6EA 1EPUA 4JYBA 2VTKA 4OB6A 3VO8A 1PYGA 4KPYA 3NKVA 2ADOA 3C5HA 1A7JA 4RQUA 2J46A 3MCAA 1LBHA 1NJ1A 2X0JA 3TQIA 5CT6A 4UOZA 4KCGA 2XUZA 1ND5A 4R1QA 3HI6A 4A6EA 3GJ0A 4IZ6A 3C6KA 5ERXA 1RQRA 1NW6A 4C21A 1P2FA 4RTOA 1ODSA 2BGTA 1ZIXA 3DBOB 4HNGA 1D1PA 1P8AA 1XMIA 2ZOSA 3OF2A 4LJ7A 4RF3A 2H59A 2UUPA 1B8OA 3IUQA 1KEEB 3JQRA 4ZT4A 1NBIA 4ZEWA 1E7WA 4LOHA 3HWX1 4M87A 4O4JB 3ANLA 4PU0A 3CZ9A 3LZDA 1OTXA 4QUEA 1QRTA 1A77A 2IDZA 4AP5A 1B1AA 1ZUD1 2GEVA 4EVRA 1W5AA 3B9RA 5FD8A 4DM4A 1NZFA 1AN0A 3RS2A 1BOOA 1KK2A 4JL5A 3H1PA 5IJ0B 1U7PA 1H2WA 1ID1A 1MV8A 3EAQA 2AXQA 2QAGC 4G8DA 4D0LB 4DCJA 3PFFA 3T0IA 4CCYA 2R7AA 1QYXA 2X40A 3G2LA 2QG9A 2W2TA 1ARZA 5FWYB 3N2ZB 4I5DA 1JBKA 3DMGA 3E23A 4CETA 2W42A 1T6BY 4N5NA 2RI0A 4DLVA 3CFIA 4NBVA 3BIFA 1NVEA 2IY8A 2DTEA 2JFUA 1DBPA 4NFHA 3R0ZA 4RACA 2QV7A 5ERYA 2PHZA 1VGQA 1B3RA 2ZQYA 5AW6A 2WUGA 4RH3A 4F4DA 1VP9A 3RSZA 1JRLA 3AUAA 4MVJI 1H1LA 3IBCA 4Q01A 1ZLXA 3QV2A 2AQKA 3VO9A 4TTSA 4YMHA 5I48A 4FN4A 2I6TA 5KVQA 2C04A 2JGNA 4ND5A 1JIXA 1V95A 2LIPA 4UUQA 4CM6A 3MMZA 1DWOA 1QBGA 3G1WA 2J32A 1UMBA 1A9OA 1YS1X 1OASA 4YQZA 4FP9A 2YWBA 4XCVA 2NM0A 4BJ3A 2VJCA 2G1KA 4V0ME 3ZHYA 2APJA 1K2VN 3EDOA 2Q2QA 1SD5A 3K9FC 4TN1A 2CKDA 1JL3A 4FCCA 1K75A 1U8XX 3MUNA 4G89A 3WDSA 1M0SA 5E3IA 3TQCA 1C80A 1SUSA 3SIPA 4EA7A 3HCPA 1ISSA 2M9MA 3D3JA 1VLMA 4S04A 4WINA 2GLXA 1M7GA 2P9ZA 4MIEA 1DVRA 4TV9F 2L42A 1Q2UA 3AW8A 4MWBA 4M2LA 5ALPA 3WVNA 3QWHA 2P40A 1X6VA 4ZICA 1DO2A 2G76A 4M38A 3NIFB 3U31A 3T5DA 1NQOA 1PLKA 1VMKA 1PTJA 4EZIA 1UPAA 1X74A 2CXRA 4QT0A 5EN4A 1U0RA 1HNZB 2XX3A 3H18A 1BYUA 3JQ9A 4EB8A 4RDIA 5ECWA 1II8B 3NRCA 3C16C 1ZIDA 4RABA 5BYJA 4C0AC 4K8RB 3RC3A 1X8XA 1JG7A 1IN7A 1Y3CE 2J9FB 1QFSA 2YFYA 1F20A 1LRJA 3ADKA 4M8NE 2I4OA 2FSHA 3I73A 2POQX 2XUPA 1QGZA 3U7RA 4Z4HA 3PKIA 1IOWA 1BO6A 2R3SA 3ZJUA 1ZKMA 5B3AA 4PGGA 1E1MA 1PVOA 2WFLA 4R6XA 4NNPA 5LDHA 3B60A 4J90A 5KYUB 3B3FA 4C9BA 3NBMA 4IM7A 4LPKA 4P5DA 3ZV3A 4AN1A 3EE6A 4OH1A 1TIBA 1Z08A 1PWZA 2ZRDA 1EK6A 1QO0A 3DO8A 1IVYA 1I10A 3PWKA 4UNRA 5IWCA 4PYKA 1TIPA 1FUEA 3GH3A 5I51A 1EXWA 2H18A 4K9RA 4EX6A 3ABRB 2XCSB 3M9LA 4CIXA 4X7RA 5FI1B 5D1NA 2YJNA 3DYVA 3RTCA 4XH9B 4YDRA 1LLFA 3FI9A 4RS4A 1W5BA 4UHCA 5FI0B 1W7AA 2O3QA 5HFJA 1WMFA 4J0GA 4UEOA 4DSNA 3JYQA 3N5CA 4EGSA 1SVUA 5L4SA 1J39A 4US0R 3VZPA 1WIWA 4DM7A 4DG9A 4DNOA 3OSUA 3ZWCA 3UA3A 1Y9JA 4LHSA 4LPSA 4KUHA 4L2IB 1J8FA 2W9XA 4FMCB 4O8CA 5GTDA 1XNRB 2CJPA 4QTTB 3JZIA 4UUNA 1BQEA 3TB6A 1TLTA 2XHZA 4UOEA 3EGEA 1SQ6A 2GPAA 4EHFA 3RFCA 1G20A 5EFZA 2QX8A 3CE6A 1YCFA 3HKEA 1S6YA 5KSOA 4G4JA 4P4LA 3DMTC 2WE7A 4PQGA 2YY7A 1H4QA 1O3YA 3F96A 4GYYA 4M60A 3VO1A 2HGZA 2QN6A 4J16C 2QPOA 1WV1A 2JI4A 4C7MA 1B6GA 3LK7A 3SBOA 4CCSA 5DTQA 5C1IA 5H80A 3ZIDA 5IBCA 2P3OA 4FC6A 4TZ0A 4HH3C 1LW7A 2AUMA 4FDUA 3EULA 3SC4A 1JZTA 4EW6A 1PZHA 4TQUS 4JP5A 4XRRA 4CQJA 3P26A 5BV1A 2HR1A 4LXQA 2PXAA 1VCMA 1R6XA 2B4QA 2WG2A 1OY1A 4N5LA 3AHEA 1BZYA 1PR4A 4QHSA 2F4NA 3OCXA 5EWJA 4E15A 4IVNA 1P7CA 2GNAA 2RIPA 4GL4A 3HZHA 3PC8A 4G56A 2HF9A 3T3IA 5A6VA 5K0JA 4RF2A 1M0TA 3EZ6A 1RPTA 4G4SP 1TQ8A 3FHLA 4C0KA 3IP5A 4Z0PA 2D2EA 3KHTA 3MTDA 2IYSA 4M0DA 4U2FA 2PVCA 4EKIA 1PWYE 2R4QA 3ZZMA 4FI3C 3HCEA 2ZRPA 4X3PA 4Z1MD 5G53C 1V16A 1D0VA 4GZ5A 2X6RA 2A67A 3DZFA 3ABIA 3Q8XB 5ARCA 2ONYA 4RPKA 3R7WA 1XAGA 4QPDA 1UBKS 4DIFA 1RADA 1T9AA 5ALTA 1OWMA 1FUKA 1NBWB 3ZY2A 5HG0A 3MWLA 3KE9A 4QVKA 4KXYA 5CBPB 3KC2A 1E7SA 5H9WA 4XGKA 1K97A 3HYRA 4EYEA 4IZHA 4BO0A 3LDFA 2NVBA 1LNSA 3RGWS 1WXIA 2AZTA 4ND1A 2RGAA 4MPPA 1EM6A 1C1YA 2ZQZA 4D4LA 2BMWA 4MA0A 3FIJA 3PXDA 2XGSA 3PDJA 4WCFC 3FMFA 1EE2A 4HC4A 4DSOA 3F8SA 3AIKA 5DYYA 5H3LA 2QLMA 4FGWA 3ZCUA 3UT5A 7AT1A 1AKYA 3S1LA 3SZMA 1U2RA 4ZCLA 1USUA 2G08A 2PBLA 3OOHA 2OHOA 5IJAA 2HO5A 1I4WA 1Y4AE 1G3IA 3PGLA 4F5WA 5JYCA 3CRMA 5ALQA 4G86A 2YQ5A 5HNKA 2X2OA 3H11B 1Y3AA 2CL6X 3FUTA 4HZUB 3RVDA 1D07A 3J7AC 4MCHA 4F5EA 3L0IB 2RGEA 4QDTA 2OZPA 1BMQA 4Z6KA 1T1JA 2G9NA 3UJBA 4AZ3A 4H17A 1CCWA 3UPTA 5G4LA 2PANA 4RTLA 2G6TA 1I8TA 5A5VA 1ZL0A 1LH0A 3EQ2A 3BZBA 3KALA 4XUCA 1J5XA 4GGOA 1NDHA 2ID8A 3QFHA 5EUCA 3V6LA 4GXTA 2YRXA 2ZJZA 1UZMA 3PXUA 4D7AA 1L7MA 4H2DA 2WJIA 4ZYWA 3A10A 3BSWA 3Q6MA 5HUJA 3SM9A 1NI3A 1P39A 4IJ6A 2BTQB 2RJOA 1GPDG 2DFLA 1ZIPA 4GM1A 3THRA 1ZVJA 1IJKA 3AU8A 3B1JA 3EDCA 3U9LA 4AKEA 4CKBA 2JAUA 3PE3A 4N6OA 5AIAA 1MXHA 1GZ3A 1PIWA 1MZPA 5BURA 5DYGA 3UNXA 2WVHA 3E3MA 3DMRA 1RP7A 4LXTA 4R0MA 5EC8A 1BIFA 2GZMA 4RO0A 2DBQA 4YCDA 2ZGVA 3H9QA 3DZ8A 4DLYA 1UKEA 3ZNOA 4OI2A 3FCAA 1IBLB 4HWOA 3WJ7A 1Y9DA 4RGQA 4RA9B 3ZJTA 4KE8A 1EDOA 3ELBA 4ZOLF 1RRCA 3EWIA 3P1JA 1YZUA 3HU2A 1ZD5A 1W96A 3PEUA 1JKMA 3KTAB 3AEKA 5DBOA 4B4OA 4B73A 4D9FA 1HT1E 3IVRA 1RACA 5DTMA 3FCXA 5BNFA 1UXJA 2PQ6A 3EQZA 4CMKA 5F1PA 3OHSX 4CTOA 5IXJA 1RLUA 1EFLA 2R2GA 3MCZA 1HR0B 2EHDA 1UJ6A 3OFKA 2MJLA 3G6KA 1U3VA 3THXA 2AD1A 3AEZA 2RHTA 4QFCA 2DGDA 5DHQA 4LZPA 5TQ0B 1AMOA 4JCOA 2KJQA 2HF8A 2P9EA 3IMEA 5HOEA 4KXUA 1U8UA 1NKTA 2IVZA 4FSHA 4YV2A 2OAEA 3CPEA 1MNQA 1F3OA 1OLXB 1M8PA 1GXSB 5AHKA 2GCPA 5JVDB 2FSUA 1GYPA 4MEJA 4WL0A 3RYIB 3WRXA 1FZTA 3K73O 4HH1A 4Q1VA 1Y6GA 1YKGA 1LDMA 4RL6A 1FJ2A 1I36A 5P21A 1Y9ZA 3H1EA 1FYXA 3CN7A 1X39A 4K6HA 4MYCA 1SZDA 3C98A 2VXBA 1ZRSA 4PPYA 5IYZA 2X0FA 5EXTA 4M1KA 1BMFA 3EISA 3CLTC 2X22A 3F46A 4GW3A 4ZZ0A 5C7YA 4E3WA 3TUJC 1CF2O 2W6OA 2BI8A 1O08A 3RTBA 2IHNA 1DWUA 1AKVA 4LJKA 1CJSA 2YWHA 2Z1MA 8ADHA 2YNMC 3W9SA 4QTXA 1XMSA 3N0RA 1DCTA 3FX2A 5DWQA 4CM8B 3HADA 3PEEA 4IDEA 1UXKA 2W2LA 4MJXA 2IYNA 1A2OA 1KYVA 1YZLA 4M76B 5KWEA 1Z7YA 1IN6A 1O0CA 1DBRA 1NW4A 2DWOA 3CEMA 3MT9A 3UCEA 4MUEA 2VCHA 4MP3A 4F21A 3L8GA 2BUBA 4WPGA 2CZCA 2WOJA 5AJUA 2QLLA 1XXLA 3RKSA 3S68A 2AR7A 2W2MA 2VO1A 4QQNA 3ZW7A 3QLVA 1Q2XA 1YMUA 3CNLA 3D8UA 3WGUA 5K7SA 3ZTYA 4UAUA 3GLFA 2JHPA 4R2XA 4ADSG 4OQEA 1U2GC 1V25A 4QU5A 4WW0A 2E3JA 5KTYA 4F0JA 2O19A 1JA9A 3D0QA 3I9KA 2BZ1A 2JK0A 3FLBA 1ODLA 2O2IA 5ICMA 4QXOA 4LFCB 4KZKA 5BV7A 2AMVA 2PXCA 2GASA 4OSEA 2H5IA 4YT2A 2VH1A 4JQSA 4ZV9A 1W87A 5DFAA 4N18A 3TSWA 1JHPA 4CMHA 1O7JA 4Q3DA 3U4QA 1RPZA 2W6QA 3ZU2A 5IBPA 4AFNA 1G5QA 1CB7A 2E2WA 2R1VB 3HN7A 3PFCA 1NKVA 1WXQA 2CYCA 2HRBA 2JGRA 3OIGA 4YALA 5B5SA 2PUFA 4ALNA 5F7XA 1NBMD 2C2YA 4Q5IA 3OH8A 4LYHA 4QSMA 1H1LB 1S1CA 4YA6A 1T9GS 2OHXA 2A0YA 3QXJA 2G3DA 4HX2A 1BKSB 4XIIA 3H2JA 3ZYCA 1A9PA 3U7HB 1FX0B 2VOEA 3E1SA 5F78A 5F7ZA 2AX4A 1SKAA 1U6JA 3CS3A 2I6XA 3GJ5A 3HS3A 4K9DA 3GJTA 4G8CA 4MS3B 2BKLA 1ZN7A 2HF7A 4Z4CA 4A3SA 1G9XA 1NF3A 5IM5A 1UAAA 3HP1A 3ORYA 3RUIA 3USCS 1FLVA 3GJSA 3EZYA 4JL6A 1B7GO 2ZIAA 2OKGA 2ZJ6A 4W5JA 4Z3KA 5KNDH 3FOFC 3OQOA 1WOMA 4MWDA 3V34A 2XAAA 2XXAB 4CM3A 3LC1O 3WHIA 3RVJA 1D1QA 4Q7QA 3M3HA 1P61B 3QITA 4ZOQI 1L4EA 1YR8A 1XA0A 1MT0A 1TQHA 1RIFA 4NTZA 2NO0A 4ZZ1A 3PNOA 4G0NA 2QUZA 1HE1C 3LUGA 4I55B 5K3SA 1HORA 4PYNA 3DZGA 2EKBA 4IGKA 3ILXA 4QRHA 4PYMA 4RGBA 2BH9A 1NPTO 4MP8A 4CTJA 2NVUB 5AVVA 2GH1A 4Q39A 4A6PA 3DFMA 2Q4RA 1EKXA 3A3PA 1GPAA 3UQYS 1XQ6A 3ZZUA 1IVNA 3AUKA 1M2OB 1JIVA 4KO1S 4ICIA 3FJ1A 1FX0A 1GADO 1X1BA 2O23A 2VR1A 4LHVA 5AI6A 5TJ9A 4IDNA 3HR7A 2BR5A 2YJ3A 4B6QA 4BQFA 3H16A 2A53A 1H66A 1VL0A 4UAGA 1WXEA 4ZI7B 4TXHA 3H4TA 1A9XB 5DTEA 4PLWA 4RVHA 3O3CA 2NU8A 4A82A 1JHYA 1U0SY 3N9IA 4L8YA 2XD9A 3TCXB 2I2DA 4OGWA 3VQTA 4CQNA 1DEHA 1FSFA 1NJ5A 1YQDA 4IWXA 3OMXA 4Q4AB 4D2IA 3O2JA 4QOIA 2UXDB 4PC6A 1U0TA 2QXTA 1NI4A 4PVDA 1JDNA 4PXYA 5LKAA 1DJOA 3U5TA 1KJWA 3BREA 3PQDA 4NG4A 4I99A 4OHOA 1UT6A 4CV3A 4F60A 4OHYA 1G60A 3LA8A 3SQDA 1NONA 1IWBB 3PEFA 3EMVA 2WFAA 4EDHA 2CFRA 2IXAA 3HVIA 4B6SA 2JLCA 4V1CA 1A50B 1K4YA 1LRKA 1Z15A 1NG1A 1RS0A 1ZFNA 2QUJA 3NTQA 1D04A 1L5QA 4RMJA 4B2PA 1Q83A 2QM8A 3BFXA 3P19A 3WBBA 2IEAA 4KZPA 3CPSA 3KYIB 4NE7A 4DZTA 1V39A 4EI7A 2GBCA 3BJZA 4G0PA 3MINB 3L3BA 2BGMA 1BSVA 1LGYA 1ISPA 1S9HA 3EIEA 3IAM6 3CWCA 3LP6A 4HBGA 3SBDA 1IU9A 5H59A 3GRFA 4O0LA 1YVUA 3U1TA 5A9TA 3SHVA 4A10A 1IB6A 1UZAA 4ENRA 1JLLA 2ISSD 2GAAA 1IZ7A 1UP4A 4LWZA 1I94B 3JD4A 1T3HA 2FN8A 1P4SA 4FEGA 1GL6A 3I5MA 2ZYVX 1G3UA 1SM4A 3GT0A 4L1KA 2XT0A 1DTSA 3LV8A 1E5DA 5E4TA 5AVSA 4YXWD 2ZXFA 4J2HA 1XMQB 3LKVA 4LGVA 4D3SA 1H85A 1LVGA 2NVWA 4LWPA 5JPCA 5BMOA 1YT5A 1Z2OX 4P4SB 3FKQA 4OO3A 3QP9A 3HXPA 3MEQA 4G84A 1G5PA 1I32A 2OO3A 4URYR 5F52A 5U4XA 3AL2A 4IUCS 4LJLA 1BQ3A 2W90A 4ZPJA 3AIOA 1WCIB 4BBJA 2WICA 2Q6TA 4O3FA 2FZ5A 3ZGNA 1NVKA 4W5QA 2GX6A 1UBGA 1SXJB 1C2TA 4DNQA 2E5LB 3PSAA 2REOA 4GSLA 4O59O 3O3MB 4J07A 4TLAA 4X1YB 2JIRA 2O57A 3D5QA 1C5KA 4MRSA 5TMPA 2D7DA 3BIWA 3NFRA 1R4MA 1GVNB 4Q82A 3C1AA 4KQ1A 5E6SB 4D4HA 3SD7A 1IHPA 3AM3A 4JLMA 3ICPA 2L17A 3EPPA 3OEHD 4TMFA 13PKA 4KE7A 1W44A 1GZ5A 2PY6A 3STTA 2Y68A 1NUPA 5L7TA 5I9MA 3RC9A 2FDRA 3HLYA 3OPXA 4GBED 4HEA6 4DEYA 1YR6A 2DFPA 2GHRA 3NG1A 4EFKA 3RS4A 3SIRA 1QG0A 1YDMA 2H06A 2VK2A 3DVSX 3OZUA 3I2FA 1E2IA 3KM0A 3CTMA 3TZHA 1CDEA 5BW8A 2Z3ZA 1WABA 4G5HA 3NJ4A 2F6RA 1I0IA 4C2UA 4FSXA 3WB2A 2JGAA 3L07A 1FFCA 3WMEA 2ZUTA 2AKEA 3W3AD 4AJIA 4TXMA 4LKRA 4MKIA 3VGJA 1QCZA 1OCEA 1RBMA 4NENB 4HS9A 2BGIA 3FYSA 1KEUA 4YRJA 2OO7A 1B23P 3BDAA 1ATIA 3WOVA 3JQ8B 3KKLA 1HQCA 2X7JA 2F3QA 3EUFA 3AB7A 4I9HA 1VB3A 3TRJA 2QPAA 2DPYA 2J3LA 5GM1A 1M2HA 3DLPX 3FTPA 5K3CA 4EJSB 1DNPA 1F0KA 2YHSA 5DN9A 5FV7A 3X0DA 4DA6A 1WQ4A 1F8FA 1VBKA 2P5SA 4XSVA 5LZ4A 3K71B 1WLSA 1JLRA 1CP2A 1C9KA 3K70C 3RADC 4DS3A 2VLIA 5JCOA 4DTIA 5AICA 1OXKB 1WX1A 4PX5A 3F4KA 4WFJA 1VHDA 3VH2A 2HTFA 3BJMA 4RETA 1UBHS 2OAGA 3DZDA 5IAEA 4FWBA 4QNRA 4L78A 4MDHA 3L1JA 3TRIA 4EY5A 4Q1BA 5FPKA 1Z5WA 2AOTA 4LRXA 4MQUA 3VFDA 5ALJA 1PR2A 2DQSA 3G5TA 3T9AA 5LFAA 1GNPA 4PS0A 1L1QA 3H11A 3WNBA 1E64A 2ZM5A 1OIWA 2BOVA 3U1BA 3N07A 1PN3A 4GWKA 1BE0A 1I6MA 2IJGX 4C03A 3Q87B 5HXAA 5EEGA 3P4XA 3HU1A 2JG3A 3RTDA 3OQVA 4BZPA 3UIEA 2B2XA 1RLOA 4TTIA 3L7AA 2ZJOA 2QSYA 3AP3A 3NBUA 4CRWB 5KO2A 1NBHA 2XOKD 5E4YA 1XZ8A 5ED4A 3FKJA 4FCVA 4ITRC 4RAQA 1J2RA 1NW9B 4EL5A 5MGBA 4RY2A 3BRCA 2R87A 2FSSA 1GPYA 4YECA 4FYVA 1YAJA 4EF4A 1P2UA 2B8WA 2NU9B 1SUIA 1OXMA 2OZVA 3L8MA 4ZT3A 1QZTA 1TJ5A 3FM9A 3SEZA 1J1UA 3JZDA 1PFGA 3AL0C 1M2WA 1TM2A 3D5TA 5DXAA 4A8JB 2YJTD 4D4GA 4YCAA 4D9HA 1FK8A 2LGJA 3W1VA 3WYAA 4RTKA 4TKUB 3U6KA 2Y8EA 3GLGB 3W8DA 1W30A 4FUTA 2HU5A 4TMXA 4AMVA 1VJ5A 3AERB 3D4PA 3G2OA 2ODAA 3HVUA 3NNDA 3OEED 4K81B 4M0PA 4RSGA 2N47A 1Z7GA 2BFAA 3O9VA 4G5SA 4G1BA 1FP4A 1VE1A 4XYMA 1HNNA 1U0EA 5AKIA 3WMXA 2X0IA 2Q5IA 3GG9A 1Y3BE 3CZQA 3FSGD 2HK6A 3OQJA 1GR1A 3QYFA 5ANRB 1L5LA 2WAOA 5FL7A 4LRWA 2WQ6A 2XMPA 1LVHA 3KZVA 4D9GA 3K05A 1QTQA 1J09A 2DUJA 1JDBB 1NN1A 4LTNA 1NHWA 5E95A 3DS8A 4RVFA 4AXBA 4DJEC 1S3GA 4GXNA 3WL5A 4RTPA 1NQWA 1TVMA 1T9DA 4BQSA 3K1TA 1EFAA 4BFVA 4CF3A 4HI0E 4WFIA 1W73A 2HMWA 2I4IA 3T7CA 1CVIA 2FOIA 1GZHB 2I3BA 2UV8A 4E33A 4KAAA 3EVZA 3NM4A 3H97A 4X8HA 4YUYA 3U61B 2Q1TA 4B45A 3RBZA 1GDDA 4EUHA 3ZBQA 4GE0A 2RHOA 4QXAA 2WB2A 3L7NA 1OU0A 4IV8A 3PRHA 4C6TB 4MPJA 1N5IA 3BZUA 5J2UA 5B1SA 3CWZA 3E27A 3ZY3A 5JSFA 1X87A 1KK3A 2QT9A 2QEQA 3IPRA 4I36A 4K6MA 4PY2A 4YAEA 5H5JA 1E2QA 2VYND 1RWNA 2I67A 4XWGA 1RLJA 2OCKA 3QM1A 4J49A 4EP1A 4F04A 4MA4A 1I1HA 1YVPA 2PKEA 3BWMA 5FPHA 3UXEA 3FGPA 1E6WA 3DWGA 1EFHA 5FNVA 2C96A 5BSWA 4KEAA 4KRYA 4YRIA 4G07A 1A9XA 3IHWA 1XZAA 4B8WA 3AP2A 3KR1A 5AI9A 4I1UA 1UBEA 1F14A 5ICCA 2UXBB 3QBVA 4TWRA 4WNIA 2QORA 4JITA 1ZD9A 5KNLA 2ID9A 1C1XA 1QV6A 3PNKA 1NNSA 3S44A 3SSMA 2F1IA 2X1MA 3UHFA 1OIVA 1PJQA 5AOVA 1U1IA 1JPNA 3MPUA 5D6OA 3SZUA 1FC0A 3UH0A 1X86B 1XZHA 4HLNA 1PRYA 4DL9A 3JASB 3RSGA 3GLIE 4L9SA 1YZNA 3OURA 3ZK7A 9ATCA 2G63A 3VDRA 1H1TA 2PMWB 3AFOA 5EINA 3T12A 4ZARA 3UJ8A 4HNVA 4YASA 8MHTA 1J8QA 4YUVA 4BV9A 2FX2A 3ZJVA 4U4AA 1X7YB 2HIMA 1V1RA 4UW9A 5DNVA 4IL5A 1P4JA 1IY0A 3IVGA 2Q3MA 2RCNA 1I9GA 3QLVC 4LNAA 1OC4A 5JSQA 2BD0A 1KYWA 4HQNA 4A7PA 4GZMA 1M2FA 1QF6A 4CJXA 4J6FA 2VP5A 4TRNA 1E3WB 2G4CA 3UG6A 1L3BA 1VYUA 3O8OA 1COWD 3G7NA 3G5AA 1QC5A 3VPAA 1SU6A 2O0HA 4GMKA 1UJMA 2GA8A 4JJIA 4C7XA 3RREA 2FMIA 5J5VA 3VH3A 4FGJA 2GN4A 5DLDA 2ZUCA 5I9IA 4UBIA 4HJXA 4PHCA 3OCYA 2AS0A 3N76A 1LJUA 4RA6A 4KR0A 5D85A 5CNKA 4MB6A 4BO6A 1E0SA 1GOTA 3QE3A 2HSZA 2G4LA 1AKRA 3CUVA 3ON5A 4LC1A 3TZBA 3U7IA 1LBTA 1Y8ZA 1OXBB 5DX1A 3EFOB 2OO5A 4JU8A 1N78A 3VHRA 5C81A 1EVYA 1I6LA 2AFIA 2NZXA 3N7UA 3X1YA 4E7OA 1R16A 4U7PB 1YUNA 1G1AA 4IP0A 3R7DA 3X2EA 4WFQA 4FHFA 1LZKA 4ARZA 3AVWA 3BG5A 4K26A 4N03A 1TYEB 5HMMA 2BZ0A 3GLKA 3QZUA 2R00C 2ZYGA 4IS2A 5F4BA 4KN5A 4MMYB 5LD2C 2VL7A 3FWZA 1IM5A 3LM8A 3I45A 3B6EA 2PRKA 4D3YA 2LNDA 2X76A 2OXRA 4YFYA 3WMGA 1S2IA 4I1VA 3ZE9A 10MHA 1N7GA 2NNLD 3Q2IA 2GXUA 3UJDA 1MOZA 2XJ4A 4YRFA 2ZM6B 1NJSA 2ZANA 2O8FA 5TB5A 3WFZA 2DWQA 3BOSA 1RCFA 4EFLA 3KZ1E 2IP4A 4GP7A 4LDNA 2ASVA 5BN5B 1NUSA 1JDBC 3A37A 3UF0A 4GSKA 4B79A 4DWWA 4M8KA 3FZEA 1EE9A 3H4MA 2ZSUA 3FHTA 2PPVA 2GB4A 5BP7A 1T5OA 5FPSA 5DNCA 3I04A 4M8SA 5LOVB 1BVUA 5SY9A 1QQ6A 2RGNC 3W77A 3HDQA 4LDJA 2JBAA 1X2EA 4TLDA 4CDGA 3A4IA 3KSUA 1I2AA 1WQ1R 2P9QA 4AUMA 5T4HA 3LIIA 3NVDA 1YIAA 3ILSA 3EWSA 2JRCA 2A1UA 1UZLA 2XGGA 3A0RB 3R7BA 1B3BA 2NTYC 1SXJE 1NHGA 3ZLVA 1VE9A 1TTPB 4N7JA 2Z6VA 4Z5XA 1YFLA 4EVSA 2GZHA 1NTRA 3GJ3A 3OQPA 3NALA 1EESA 3ZWXA 3O4HA 4BY9E 4XLLA 3LX4A 5BVHA 3FNIA 3NHWA 1N8KA 1SIOA 1C4OA 2DR3A 2YQ4A 4G2TA 4MRNA 1BGWA 2XKAA 4ROSA 4P7JA 5ILOA 1CIPA 4UJ3A 2G36A 3LT1A 3AKZA 3RUAA 1QIHA 4BX9A 3KUDA 2YFKA 1XTQA 1SPXA 1A4IA 1T2AA 3IHLA 5ES4B 5F9FA 4I1SA 2ZSIA 5IW8A 4YMTA 2AG0A 5D3QA 7ADHA 2YN2A 1BE1A 1KZYC 1N1EA 2IEIA 4MHOA 4OQPA 5E1DA 3H2HA 4Z9XA 2IOFK 3GD7A 4LDZA 1O57A 1UJCA 3I37X 1NX9A 1H2RS 4NABA 3SS9X 1L4FA 1USIA 3LP5A 3HYSA 2GETA 2O2EA 3A6KA 3TTTA 2G4VA 1CZHA 4UEJA 1IEVA 4DJTA 4NJEB 4CDMA 4Q93A 4C29A 1AMNA 2VP0A 1UQUA 4EYGA 4QJIA 3TSCA 1AS0A 4O4LA 2AEMA 2O9JA 4OP1A 2FF5A 2OXFA 3MWDB 2WSYB 3UUGA 4XWOA 2DBRA 4X90A 2QD5A 3C1TA 4UNSA 4DW8A 4L02A 4GC5A 4LHZA 4LXGA 4NSNA 2KLBA 3BULA 3W8NA 3KAJA 4TTPA 3GP3A 3D2BA 4P4UA 1Y6RA 3ODGA 5SZIA 4PYRA 3MTIA 5SYAA 2Z56A 3CB4A 4LDRA 3H4IA 2N1BA 4MYDA 1E63A 3JQBC 3DF9A 1T36A 4NICA 4XWYA 4QOSA 5TGDA 2AF3C 1MAWA 5CM8B 1DX9A 3PFBA 2JW5A 3I4LA 3F6BX 3H75A 5AVYA 2ZSHA 2IPMA 4KPUB 1X7HA 3B53X 3HGQA 5GJVC 4BLVA 4CLXA 4DMMA 1DXOA 5CFZA 2BHNA 1TAUA 3IODA 3R5JA 4NARA 4AWXA 5ILQA 1L7BA 2GPTA 3HLKA 4OFXA 3C87A 2Y9MB 4OSOA 3ZBUA 3KJEA 2PT6A 4WNAB 4E4RA 3PC6A 2H1CA 4JMPA 2JJ2A 4BPRA 2WY2D 4DMUB 4Y9RA 1Z7BA 2IDKA 4IOMA 4PC2A 1F0NA 2WIJA 4L27A 4EG7A 5JZ9A 1R1DA 1UCFA 5FBHA 5K2MA 5DEOA 4ZHQA 1JU3A 2H0QA 1ZOIA 1U4NA 2HMSA 3GUHA 2JDIA 2XEXA 1MPXA 3L6UA 3LT0A 4HNSA 3NDIA 1AKNA 1MX5A 1DELA 4S0XA 1JB9A 3NM5A 3P2OA 1KVRA 1OMOA 3E3LA 4BN5A 3Q72A 2A52A 2X0NA 2ZDGA 3OFND 4XLTA 5DHFA 4PQRA 4URXR 4PIMA 3MS4A 4C1BA 3UWOA 1Z63A 2N0SA 3BS4A 5H7XA 2CNLA 1DBIA 1QGUB 3I52A 2XT9A 2NUAB 5IUJC 4W5HA 5HE8A 4J3NA 3WIDA 1U8FO 5CXSA 2G80A 4UNQA 1BN6A 4BLUA 1CJCA 3HWWA 2VN8A 4NEHB 4HDSA 2JGFA 2JRLA 1Y1LA 4DC1A 3PGXA 4D3DA 1O54A 2VPYA 3L84A 4A0GA 4ARZB 1FZQA 1BRMA 4MPTA 5EERA 5BW0B 3TLJA 2ZUUA 4Q05A 2J3QA 4I1YA 3BC1A 4TV9B 2H2AA 3KQQA 4RF4A 4DGQA 3KQLA 4WXMA 2O2SA 3VM6A 1W1UA 1LI4A 4AB1A 3AW9A 2EERA 3M70A 4HNQA 1IUNA 1RXSA 4HPWA 4L74A 1JQLB 1N5OX 3BERA 2UYQA 3IGFA 3AIIA 4E0BA 3ITNA 2ODBA 2WJZB 1YU9A 1ULSA 3LKBA 1SB8A 3P9CA 1J49A 4ZA2A 5CDFA 1HF3A 3GF4A 4Q1CA 4XFKA 4XDYA 5J1SB 6YASA 3K09A 3QWIA 1W0KD 3QEMA 5J2UB 4YY3B 3FAKA 3LBFA 5LMNB 1JJVA 1HG1A 2Q7DA 1E1YA 4LZNA 4CDRA 3AGPA 5JNVA 1PS9A 4GLBA 4LRUA 3DW3X 4UATA 1RTKA 3BVPA 3G0HA 1TLFA 2EFJA 5AR1A 2BZSA 1L9KA 3OZSA 4LMAA 1BXRB 3EX7C 1QYIA 1GQYA 2FEAA 2WINI 3VR5A 1J5EB 1U4OA 4CQMD 4ZDWA 3I0NA 1F0PA 2VCYA 4O2AB 3FOCA 1G38A 3RF6A 1QIEA 4RHXA 5ENZA 3TFOA 3B1VA 3NZEA 1T91A 2VH5R 4UPVA 3V8VA 1S2LA 5MFZA 2PUEA 4OXXA 5FR1A 3TFWA 2XKJE 1FYWA 2A9JA 4IXMA 1U02A 2PVPA 3MWDA 4GBGA 1K7SN 2VQ3A 3A4TA 1E2PA 3MGKA 1Z5OA 1W5TA 2PTGA 4UXIA 5CT5A 5K4GA 2VDKB 1PZFA 1RBZA 2PSSA 4WOJA 1R12A 4UD6A 4DRYA 3QVKA 2Y2VA 2V58A 5J3JA 4OKSA 2AYZA 3E1GA 4RJTA 4B3CA 5BQXA 5EQDA 2GJSA 3P9PA 2GHIA 1A4XA 1YMQA 2Q0QA 2Q8PA 4ME6A 4X91A 4OHMA 3L06A 5H4HA 1U7XA 4WZBB 3WIVA 1A72A 4DLKA 5CBPA 2R5FA 4RPJA 4LV8B 3QLUA 4AG5A 1OWPA 3B5IA 3K94A 4WVLA 3I6IA 1CY1A 2HZBA 1WY7A 3JWJA 1YB4A 5AM5A 5EMKA 3OLCX 4JI6B 1DQYA 3BJEA 3FSJX 3JTMA 3K2EA 4AS2A 5HM6A 4GGMX 4OXKA 5AQ1A 4GR5A 3E2MA 3D8SA 3NGMA 3OESA 2O0JA 2YX1A 2ZE6A 4GFDA 3GP5A 2Q8NA 4P53A 3DNPA 5J9FA 3FZYA 1RHUA 3SJUA 4D9JA 3QEBZ 1H0SA 4JUIA 3BK2A 3KSRA 2D06A 2JLZA 5L7WA 4L6AA 4KDCA 4OHKA 1HLPA 1HKHA 2P11A 1EFUA 1OWOA 4RLFA 4FT4A 4TUYA 1PWHA 4F86A 3UMMA 4H6XA 1CJTC 2G77B 5ENVA 3IR5A 4QO7A 4L5CA 2DU8A 2HA4A 2PJUA 1UP6A 4DMLA 4EVIA 4CMIB 3OPMA 4AYTA 3T5BA 4XCQA 1YK1A 2PX6A 5BRNA 1ZG3A 2VXOA 2A3NA 2C8VA 4NLLA 3OLWA 1I2DA 1RWQA 4ALJA 1IONA 2ZJBA 3ZHVA 1NURA 2H1RA 3ZNPA 5DMXA 4ZCIA 2ZIFA 3V1UA 4Q18A 3IEVA 4DLSA 1PT9A 1RJ9A 4H3HB 4B5KA 3EDYA 4INOA 1OV6A 1U1FA 1MR3F 1YNOA 3D6FA 4FD3A 3K7EA 4BO3A 2PTHA 4GQIA 1A27A 2AE2A 1DHTA 4AZWA 1WUKS 4ND8B 1FFXA 1Q44A 2BMDA 1YOVB 4L4UA 2NU6B 2NUTA 4D9MA 5JALA 2AK2A 2QVBA 3DBVO 1P1CA 1V8PA 4NYIR 3DYIA 4PAQA 1G0NA 4XRGA 2QSJA 4N9WA 4PW0A 3D4NA 3PUHA 4PF1A 2GDJA 3U17A 4MCAA 4EJ6A 2P6OA 2FI1A 4ETWA 3WKCA 3G02A 3OIWA 3OWOA 2OXCA 2ODQA 1Y0BA 1JLKA 4GLLA 3CLUD 3NQ41 3QVGA 3LVRE 4N0QA 2NT4A 3ND9A 3AR8A 2PWYA 3VISA 3DBHB 4XB1A 4MDFA 1ZDMA 1LBSA 1PEAA 2ILTA 4K5QA 3CR8A 5EQFA 3ZXXA 2GD6A 4P32A 1U0LA 5JANA 3QUAA 4KXWA 3V1LA 4RF5A 3W4IA 4B76A 4NMXB 3PEVA 3TDMA 4V02A 3JAMA 1FFSA 2YWGA 3O38A 4GUDA 1G3MA 3QLEA 3F1LA 3HJUA 4CWAA 1FW8A 4FCWA 4IIUA 4JT4A 4BU1A 1YJXA 3OX1A 3CISA 2IWRA 4CGYA 3UK1A 3H87A 3IAXA 3KVNA 3OECA 2PKCA 1CY0A 2AFVA 1JDJA 5FUMA 4V0KA 1RCTE 5I45A 4QUJA 4FUQA 2BC9A 3BRWA 2ZYAA 1MO5A 3OBIA 4P58A 1C7RA 1W4LA 3MYRA 3P97A 3CUTA 3OFNA 1GG5A 1X14A 2YL2A 1RDFA 4GPBA 2B2CA 5FFMA 1RM5A 3W90A 3DMDA 2FPIB 2BUCA 4JZYA 1Q0UA 2C88A 3LPLA 3K5HA 3NHMA 3SICE 2KMLA 1YJCA 2X8JA 4X5OA 4BQRA 4CM5A 3IOEA 2AZXA 4ZCRA 3DEIA 2EBWA 5K0BA 5JSZA 5JYDA 4R4JA 1XL0A 3P2YA 2O1EA 2C82A 1MABA 2H92A 1JQ5A 2IXGA 2QVYX 2V7XA 3O1IC 3BM5A 4GX0A 4LYGA 1KYIA 1N2HA 2JZNA 4KQJA 1WHSB 5IBRA 3GUYA 5CDGA 3H2BA 3MQFA 5EOVA 5L3SA 4LNUA 2EJUA 3WGOA 2QTMA 2PQ2A 2ZIUB 2GLTA 4BDTA 2DTDA 2CVHA 3FCEA 3R24A 2YZ2A 2KW5A 1PZMA 1M67A 1ZCFA 3TNLA 4A8PA 3B5EA 1LDEA 4GX5A 4XVHA 2P35A 3ME5A 1F2UA 5HGJA 5LYJA 2NTJA 4F38A 1DAPA 5CD1A 4CYMA 1V3QE 1TT7A 1L6RA 1MNAA 3PJEA 4YMIA 1K06A 5EHIA 5FLYA 1QZZA 4YXWA 3SC3A 2G5ZA 5F5LA 5A9SA 3SZOA 1APBA 1WZIA 2VT3A 2VF7A 3ADBA 3LGXA 4BASA 4JMLA 5BR4A 1G3QA 2WA2A 2WIKA 5I7UA 1FMFA 4TUYB 4HADA 2UYCA 1ML3A 5C37A 2VWPA 3NT2A 5BNWA 2P1ZA 4JUCA 1PJZA 4YI3A 4MPDA 2R5NA 3N8HA 1P31A 2X9GA 3B51X 3E9ZA 4N5IX 3S2EA 3K6SB 5C4GB 1DOAA 3IOYA 3ZUGA 1MJGM 2PO7A 2ZTLA 3NATA 4PSDA 3D3KA 3N8IA 2P4HX 4GPAA 2HBRA 3DULA 3LBYA 4OBWA 5KTRA 5I9SA 1LZLA 3A6ZA 3KT6A 4YJ3B 1RXYA 2FZ4A 4F84A 3GJ8A 1A9SA 2XWPA 3AINA 3FCCA 4NBNA 2EBHX 3B1ZA 3AONB 3ZQ4A 4Y98A 1J5PA 2COEA 2O4CA 2X2EA 1Z0IA 3NTVA 2HF2A 2I87A 3WB0A 1CZLA 1E3JA 1JMYA 4TZKA 4D44A 4C4OA 1Q1QA 2BBTA 2J6CA 3D8RA 3KUXA 5EWJB 2II6A 4ZTUB 3LSYA 3RVBA 1AKEA 3VVBA 4B31A 3GZJA 2H5JA 5BUCA 1M7HA 2N9UA 4WLVA 5CVTA 1ZYUA 1BU8A 1HY3A 1ONBA 1ZOSA 3SQNA 5D7NA 3QPDA 4URVR 3S0JA 2DFNA 3A1WA 2QRPA 5C7IO 2OZEA 5EIOA 3ADCA 2FEMA 4XTCS 4O4JA 1S5PA 2FFAA 1JDSA 4KX5A 4MI1A 4E21A 6NULA 4AKSA 1IB0A 5EE3A 1PJAA 3R8CA 1LJLA 3DEJA 1FSZA 2G70A 3TL6A 1LA2A 5LQUA 1VDZA 3CW2A 4Q7MB 3Q8MA 4Q4HA 2DLCX 1UAYA 2Y0EA 3LZCA 4YRAA 5IEBA 2CSXA 1CDDA 4ZJYA 1F1BA 1SXGA 3ND5A 2V7TA 3QBDA 4Z7OB 1Z2NX 2B7CA 3RC8A 1E6CA 4PANA 3ND7A 5JMOA 1V9CA 1GZDA 1JFRA 1L8AA 4LI0A 3PNLA 4Z86A 3SI7A 4IDDA 1MJFA 4Q37A 4ZT2A 2IHBA 2Q6KA 3NGXA 1IM2A 1Q6ZA 1NM5C 4WOPA 3Q7TA 1GUYA 3X1XA 4OVKA 1RKXA 4ER5A 6PFKA 4CN8A 5JAPA 1V9LA 4ZQEA 1ZA2A 4HAIA 5BW6B 2DBZA 4BJHB 1XLUA 1O9BA 3H9GA 5E6UB 3U4DA 4O1HA 3K0BA 4CR6A 1D3AA 2GO1A 3UXYA 4LVUA 1C3EA 1W5FA 2HJVA 2UYYA 3MMNA 3IOBA 3W6NA 3KJQA 4UVGA 3DXFA 4IDAA 4HGZA 4KIWA 1MFPA 3DBRB 4RZHA 4CVNA 3LUFA 1TZMA 4L8GA 1AGNA 4HWTA 4D8YA 3FFTA 2MYPA 621PA 1TX4B 3O95A 3UKJA 4CIVA 1UWLA 3T5PA 5CHEA 4CF6A 1MT3A 1XDGA 4F71A 1IIRA 4RA6B 3X1MA 1VMAA 1X3SA 1QFYA 1IQRA 1X80A 3A3KA 3L7YA 1J99A 4N3GA 4B4KA 3V48A 4QD3A 3AFNA 4H16A 3R9WA 2A84A 2R96A 5TPZA 3KQNA 1OFVA 3FRJA 3KQWA 4KN8A 4P08A 4F1JA 1FDIA 2RHGB 5EXPA 3A28A 1TUBA 3KWLA 4BGDA 4REQB 1QQ7A 1LS6A 2PBZA 1T9HA 2XRFA 3LMKA 3P71T 1B16A 1W4RA 1JEQB 2AG1A 3GVXA 1J0CA 4MW2A 4NENA 4UM5A 5G3ZA 4IMIB 3W5IA 2A9PA 2C61A 3DOIA 3V1KA 3FF1A 3OE7A 5E7JA 3TE7A 2C3PA 3GI1A 3NKFA 2Q1SA 5DZSA 1ABFA 1GQOA 5HJ5A 3IIMA 1IZ0A 1QXSA 2QJOA 4GMFA 4EG8A 5A0VA 1YCHA 2AHOA 2P9JA 3UTDA 3SIWA 4F2GA 1NXWA 4DSTA 2YW2A 2OCDA 4NYMR 1E2BA 2RB4A 2Y3IA 5B4TA 3RS0A 3IKMB 5C18A 2FN7A 4XJVA 4M1MA 3KB2A 5C32A 4NXMB 2HU7A 3IESA 2MSDB 2H1OA 5LWQA 2JBHA 2Y67A 1RXUA 5B6IA 2HRCA 4PHHA 2JVKA 1BHSA 2OYCA 1RAGA 2P9FA 3AI1A 1JVBA 2KWIA 1FFAA 2UZ1B 3GJZA 2I3GA 3UKOA 2HT1A 1ZNWA 1THTA 3PIDA 1VZ2A 3DZHA 4TZTA 3BQNB 2QLBA 5TE9A 2QZ9A 1O1YA 1MENA 1TGVA 3MFYA 5LU8A 2XW6A 1K8QA 3OJFA 4IV0A 2YIDA 1V45E 1Q20A 1QVVA 2VHTA 3CRZA 1YJ8A 3CZRA 3ETLA 2OZLB 4N65A 3HG7A 1Z0KA 1VI5A 2ZBEA 1W34A 4E14A 3KELA 5TS3A 3KKNA 4AY5A 1DOHA 1N2SA 3LRXA 3SX2A 4ZDJA 5KU7A 1CJKC 3C2QA 1JR6A 4W1QA 2JJ1A 5A1TA 3DJYA 3FFAA 3JR7A 4Y0VA 1K4KA 1PR6A 4WBNB 1SU4A 2JGLA 2P9CA 3MGCA 4XDZA 1KJQA 4M9ZA 4XM0A 4KRGA 1LBQA 4PZLA 2VYNA 1MJNA 3GUVA 1YQGA 2QRVA 4WMLA 2VKTA 3PCTA 4YJFA 4IYJA 3VOSA 3OC0A 5TX7A 1XMPA 3COWA 1NJFA 2VSXA 1YRBA 4MR8B 1L5KA 1YJAA 1SH7A 2VJMB 4HJRA 4L4XA 1BXGA 3OEEA 5DBHX 2AW5A 3LQ4A 4FEYA 1D6JA 5CIYA 2JAXA 1X8LA 3PRJA 4WERA 4N40A 4Q9HA 1Y3DE 1DKLA 3BE6A 3P52A 1T8SA 4RBNA 3ZDFA 5FFFA 1RABA 5T41A 1INLA 3V8RA 4E4YA 3CUWA 1CVLA 4BKQA 2F43B 4KR3A 2DT8A 1DKPA 4NBTA 5EIBD 5A9RA 2A33A 3A2LA 4Q4AA 1HA3A 1PE0A 4RDCA 1XPOA 3GZ4A 3IT1A 4RSRA 1TUGA 4S1VA 1U31A 2WSSD 3WMFA 2GZSA 1O5IA 4X1IA 4INAA 4RD0A 1MG0A 4LGYA 2AJBA 1MB9A 2MTBA 1JXAA 3TW8B 1GPKA 3DQPA 4JASB 4B48A 4OI4A 3E2IA 5JT1A 2B8TA 2WTEA 2WHRA 3HN6A 4KVFA 2E49A 4RY0A 5AQEA 1JR3E 1EVIA 4IUDS 2D13A 4PO8A 3AXSA 3V4LA 4CW7A 5IZCC 1E3IA 3WGJA 4EKGA 3GHHA 2W58A 4KIGA 1KWKA 1WXFA 2CLSA 2HUNA 3IXMA 1E77A 1HTBA 5ALOA 2WJ4A 2BHRA 2DETA 3PRYA 5IKOA 2PD3A 3FGNA 1DJPA 1SXJD 3HUTA 3IVXA 2C42A 2NZWA 1XZJA 2EYQA 4FYMA 2O8FB 2ZBPA 4BRSA 1EWYA 3DZBA 4WD3A 3AZOA 2VTDA 3IPCA 3OPYB 1QPGA 4TRMA 4M6WB 4J29A 3W7AA 1MAHA 2COKA 4ZOLA 2VUHB 4D0GA 3HTXA 4WKNA 1U7ZA 2GK6A 1I0LA 4YJGA 4DJ5X 4MR9A 3PIRA 3C4QA 1WBBA 1NP7A 2Q49A 2VDWB 3UJAA 5J40A 3LT2A 2FRXA 4FNGA 2XUKA 2G8NA 2JIMA 3D54D 2DPLA 4UU1A 4UCXA 1NTOA 1UR5A 4R05A 3V4PB 5J58A 5LLSA 5FUQA 1PFWA 3NEJA 2GF9A 4ND7A 5H1YA 4MWSA 1MN6A 5K09A 2JGMA 1A8IA 2LPMA 3E53A 2F8LA 5CM2Z 5D86A 2AI3A 2JFNA 5C2JB 5JBQA 5LSAA 1EP2B 5CJPA 4ER7A 4M88A 1WY5A 5EE1A 3L7CA 1JVSA 2GTIA 4HZGA 1CIJA 3PC2A 3AO0B 3TTSA 3ABSB 4LYEA 4UDYX 3WLNA 4B17A 3MHTA 4JI4B 1U81A 2DSTA 3LGAA 3LP8A 4FQ8A 1JSXA 4MA5A 4QDJA 4NPCA 3QOWA 5AJXA 2IZOA 1CU1A 2P41A 3ESYA 4HB3A 4HF7A 4PIPA 4X93A 3ZXSA 5A7HA 4D1YA 2R7MA 1G21E 2YNMD 4LVNA 4Q4LA 3ZTTA 2X5JO 4MYHA 1UWVA 3I2GA 1T9ZA 3AZPA 3TINA 4RHFA 3RIXA 3ROEA 5JXIA 2PKQP 3LQRA 3KLPX 1C41A 3H1BA 1T4MA 1Y3IA 1OX4A 5LUAA 3DM9B 4Y1EA 5EPOA 3U4QB 5H81A 4L08A 3T3DA 1OX4B 3EXEA 5ALRA 1Y42X 4OA8A 2GR8A 2IPOA 2XTNA 3ZDZB 2IYWA 3DDUA 1Z4JA 2EGUA 3HNRA 3U5ZB 3IEPA 3U7JA 4KXFB 4PO9A 2P2CA 5AMXA 3VH1A 4P7KA 4RD6A 4G85A 1RFLA 3BMOA 1RP1A 2O2HA 4RZXA 3AYZB 4EARA 3NV9A 4QOJA 1KEPA 3ESQA 5JDCC 2OGSA 1X42A 1SUPA 1C1XB 1E60A 4D97A 2BMEA 3DXXA 3UWSA 3R0IA 3C3DA 4LF9B 4GF5A 2PMKA 3A7DA 4HYEA 2NSHA 3FOWA 2QROA 3O2NA 4G5FA 2B9EA 4YDSA 1P1FA 4KPGA 3KKQA 3H5OA 1R0YA 3ONFA 4CT0A 1PNVA 5CYGA 2IOFA 1KR5A 2FFRA 5JPDA 4HUJA 4YACA 1TYCA 2O8DA 4DFDA 1WMBA 4JKOA 3SJ7A 2OFXA 2MT9A 4YJ2F 5AOBA 3KU1A 4K40A 2D4AA 1LLUA 1KEZA 4N3CA 3EASA 2ADMA 3O82A 4HAXA 1GDHA 2WFZA 4IXTA 2HSWA 4KXLA 4LSWA 3R7SA 4CPDA 4B34A 2PUBA 2HXGA 1JDZA 4PC7A 4CEJA 1B26A 2H7YA 4GWGA 2PGOA 4X45A 2ZIZA 3HABA 4MQFB 1Z0FA 1QZXA 5JADA 1V4NA 1VKJA 3COZA 1M72A 2C0QA 3LL4A 4CKCB 3FPBA 5AESA 1QORA 1UXIA 3T7KA 3FDZB 3DMPA 3AR6A 3JATA 4L75A 5DP1A 3RJ5A 3EZGA 1QE3A 1U4SA 4AZSA 1QU3A 3BXZA 2Y0CA 1CUYA 3N3BC 4GMXA 2AN3A 4JJAA 2M1ZA 1E3QA 3FPEA 3LUAA 3P20A 5AKEA 5EZ5A 3EDMA 3ZIUA 4HLQB 4LAFA 4KOEC 2BGWA 3SZRA 4IFTA 4BAGA 4Q6WA 3EODA 4BO5A 4Q4CA 5JQWA 1JFTA 4B3MB 4TM8A 2CVFA 1TUBB 1SVWA 5CK5A 5DSTA 4BX2A 4H7PA 4MVWA 2BM9A 1UOEA 4TT3D 4RHEA 2G5CA 3B1KA 2ON6A 4XIGS 4MV1A 1GSHA 5J4KA 3SEQA 5KMGB 1U1EA 4HP8A 4JYAB 1HE8B 3F67A 5EZQA 5J4VA 3FJOA 3E81A 2C29D 4XYEA 3VKFA 3RYCA 2JLQA 1FSPA 1SBZA 1NVFA 2QTGA 3H9EO 4NESA 2JFPA 2W7TA 2WNHA 1ZJ4A 4R1PA 4AKGA 1AQJA 1Y8AA 1JILA 1X8JA 1UJ5A 2PBRA 4URWR 4ZVOA 1T6YA 2ZUDA 1L5FA 5JFGA 4DR3B 3OZIA 4UOQA 4UU7A 3R23A 4OJNA 5AW5A 5A4DA 1JG1A 1KO7A 1T34A 3UOAB 5CB8A 1H5QA 1J6UA 4Z49A 5EKUA 1X0XA 3PF8A 1EQ2A 3JXEA 1P2GA 1PSWA 3TIIA 3U40A 4NG5A 1GYQA 3SR4A 3GVPA 2R11A 3I5XA 2PRSA 4ED9A 2WJ3A 2AR0A 4M7RA 2ODTX 1ZUNB 2AOUB 1G1MA 3DP7A 4JGBA 3OOSA 4DV3B 2EP7A 2FSVC 4DE5A 5F51A 5AM3A 3IR6A 2Q4TA 4N76A 4H27A 1AKWA 3HP7A 1W29A 4ND4A 3EXAA 1D9XA 2VJAA 2GJ9A 2WMYA 1CX9B 4JJ8A 5TPWA 1OJLA 5JI3E 4W9MC 2OGUA 1WMSA 3A4LA 2J5RA 4A03A 1ZI6A 4OLFA 2ERCA 3H3FA 4B9AA 1F51E 1VIDA 1X1SA 1DIGA 2M98A 4K6OA 1NT2A 1FFGA 5REQB 3TH5A 3EK2A 3WK9A 2JASA 2OSBA 2WHXA 5B7GA 2LXNA 3CBGA 3LPMA 5FTJA 2GM5A 4E1BA 5DCLA 4E5YA 2VNAA 1UWCA 2CUZA 1UBLS 2O7SA 3WK5A 5KINB 1ZGBA 4IG9A 1C7QA 3TNDA 3EQ8A 2NSDA 1GKUB 3OZTA 2C3MA 3SIXA 3VKVA 1CZNA 1DAFA 4HB4A 4X8LA 4RHUA 1OLOA 3R3UA 4F3YA 4LBYA 3UXHA 2A5FA 2XHEA 4ER0A 1OTHA 2FWMX 5C4IA 1MX9A 1L7AA 5M2QA 1TQ4A 3OKAA 3Q15C 3HRKA 4QOHA 3RB8A 4Y8VA 4YJGB 1XALA 1OPXA 2FKAA 2FJ0A 3OE1A 4ZT6A 7REQA 1DKRA 1M5TA 3FCUB 1OBCA 3Q3CA 4UTRA 1H2ZA 1F2TB 1W5SA 3KK0A 1E1QD 3EARA 1BD3A 2XBUA 5K4AA 3ZDBA 3AEKB 2FTKE 3G0BA 3WYDA 4AN0A 2I4LA 2PBFA 1YVRA 3I0ZA 1DKOA 2B8EA 1NWCA 1E79D 2QTHA 3ZCTA 5CGZA 4RELA 1M2VB 3MBOA 5CBKA 4MS4A 4YCMA 3M5PA 1EXNA 3PI6A 3GHYA 3SZLA 4F92B 1CR0A 1R0WA 4BPBA 3L8YA 3SBEA 3LX5A 2NV2B 3VPSA 1QHIA 4NJOA 1EQAA 4LY0A 4ZZIA 2GCNA 4WRRA 4FQ7A 3IC5A 3RJ9A 4LMBA 3WXBA 2QL7A 2LW7A 2VTBA 3AX6A 1YR7A 1ZU5A 4FGZA 1H3EA 4B33A 1VG1A 1Q74A 5CIWA 1Z74A 1BN7A 3QKSB 5F2EA 4LYFA 4OQNA 4AJJA 3GT7A 3NO4A 1OREA 2ABWA 2YZGA 4ZO6A 1C50A 3ASZA 1IQUA 1NXVA 5KB3A 4GL2A 2NZVG 3T8YA 1EBFA 4DDMA 3CKMA 4ER6A 2QBYA 5B64A 1T6NA 4OKIA 1JG2A 1P33A 2IUYA 3S2SA 1ZY2A 2CK3D 3OFJA 5AK0A 5T4BA 4BVBA 1J8VA 4CMGA 1XJQA 3FHCB 1HDZA 3ESDA 4DMRA 3U4CA 2PPLA 3AJRA 4N82A 2A56A 2Q5LA 1NOJA 2LCQA 2Q27A 3INRA 3I62A 1JAXA 4PR0A 2H8GA 3INNA 2HO4A 3VH4A 3ZVNA 1WP9A 1DWQA 2QLTA 1NRWA 3ZLUA 2QM0A 4PQYA 4ZJZA 4W9NA 1TADA 5AW4A 4W63A 5G4KB 2AXEA 2ZSBA 4PCAA 2G1PA 3GARA 3GZNB 1JTFA 3ESCA 3GMIA 1JU9A 2MSCB 2QX9A 2WPDA 3U3KA 1CUHA 1DLJA 2QPLA 3VU0A 3VSDA 3GLHB 3C6XA 3NCTA 4JLNA 2ZYSA 3IDAA 4CN9A 4CEHB 4UULA 2CFTA 1W1WA 3JW8A 1N25A 1UM8A 1J90A 1JR2A 4G63A 1P73A 4BV3A 3KFLA 4TLLB 2WPDD 3ZHCA 4MAAA 3ZVMA 2JHCA 5G41A 1S3IA 5FFNA 2R1TA 2A57A 2JEZA 3F71A 3O73A 2QR5A 5LU9A 5HIKA 2ZRMA 5ALXA 3A70A 1Y8QA 1YZVA 4KQFA 4E3ZA 2FW0A 5EZSA 5K0CA 1SVNA 4WN9A 5LQDA 1NVVQ 4CL0A 2XB2A 4V0QA 2PZEA 3R9KA 1UQRA 3PHLA 4BNFA 3E35A 1ATZA 2ZWOA 5CNMA 2OPHA 2HEGA 4NAVA 1XZNA 3GLQA 3H2GA 3NXSA 3PG5A 5LBTA 4EA9A 1HZZC 1OILA 5AUNB 4HTAA 2XADA 4PN3A 1OJ7A 3JD2A 5FL3A 1A04A 1H2AS 2E18A 2QN2A 2ZRIA 4ALKA 4DLLA 3T1YB 5KI6A 1V37A 3G9ZA 3OIDA 1EUCA 1HG0A 1YU6A 4K1LA