1N2HA

Crystal structure of a pantothenate synthetase from m. tuberculosis in complex with a reaction intermediate, pantoyl adenylate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
288
structure length
288
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pantothenate synthetase
publication title Crystal structures of a pantothenate synthetase from M. tuberculosis and its complexes with substrates and a reaction intermediate
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 96
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2002-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 1n2hA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1n2hA01
2QTRA 1O94D 4U7JA 1EFVA 2YXNA 4MVCA 2J07A 2XRZA 3D6VA 1PG0A 4XFDA 2DUMA 1WXIA 1U3DA 4MUNA 2QTMA 1O0BA 1QU3A 3I05A 1G8GA 4CDNA 1KAQA 1K4KA 3SEQA 4MQ6A 2J09A 1MAUA 3COVA 2Z09A 2QTNA 3CLSD 3FWKA 1S4MA 1SURA 3RJZA 1LI5A 1O97C 4PY2A 2IP1A 1IQUA 1KKUA 1TQ8A 2O5RA 2CYAA 3QE4A 3S3TA 3ZIUA 3X1MA 3KT8A 1EFPB 2E0IA 3FNRA 1GTRA 4PBTA 2E89A 4MUJA 2A86A 4MWEA 1GPMA 1T6ZA 1O5TA 1JILA 1OBCA 2H2AA 2VTBA 3AG6A 2BYTA 3MLBA 3X1JA 1X6VA 4R2MA 4WSOA 1IHOA 3FG9A 5IJXA 4K0RA 1NUTA 4EFKA 1NUPA 4G5FA 1PG2A 1ZUNA 1G8HA 5DASA 2C5SA 1WQ3A 2A84A 1QJCA 2WQ6A 1N1DA 1OWNA 2E21A 4HJRA 4OUDA 1NP7A 3X1KA 3ISJA 1EJ2A 4EF6A 1VL2A 3CLTD 3DO8A 4G5YA 4YMIA 2JAXA 3DV2A 4L2IA 5DK4A 5H16A 3P52A 5K0SA 1PFVA 5KCMA 3IUEA 3COWA 5TGTA 1WY5A 2PZBA 5FNZA 3A4IA 4NZPA 1WXFA 2AKEA 4DDMA 1OWMA 2O8VA 4P2BA 3UMVA 5LFAA 2OQ2A 1WZ2A 4KPUA 4QBTA 1NUUA 1K97A 1O94C 3CR8A 1N77A 4KKVA 4KR9A 1F7VA 1F7UA 5TS2A 1PFYA 1KP2A 1KP3A 1O95C 3MXTA 3P0HA 5K0TA 1N2IA 1N2BA 4UZEA 1JZSA 1M1ZA 4ZT6A 2RD2A 3IVCA 3CVXA 3G59A 3Q4GA 3VGJA 3DPIA 1R6UA 4HK4A 3COYA 4ZT7A 1H3EA 4PBRA 4JXZA 4MLPA 3CLSC 3KT0A 1M8GA 1QU2A 2QJFA 3INNA 3GLVA 2CT8A 1COZA 3A2KA 2X0KA 5KHAA 4MWCA 2QUJA 3H9CA 4ZCTA 1JEDA 2QJOA 1Y42X 3AL0C 1JIJA 1GN8A 3AIIA 5DEOA 2R5WA 3A04A 2PIDA 4EG4A 2J08A 3IVGA 3ZXIA 1JHDA 2DEUA 1GLNA 3PNBA 3M5WA 2HGZA 4F3RA 3IOBA 1H1TA 3H99A 3IH5A 3PRHA 2OV4A 3KFLA 1RQGA 1X8XA 1N2JA 4AS1A 2ZUFA 1KORA 1IFXA 1J20A 3IVXA 1J1UA 4XSVA 1IH8A 3CLUC 1J09A 4RPIA 4TS1A 4YP6A 2PZAA 2CYCA 1T6XA 3PNYA 4OJMX 4ZT4A 4MVYA 2IJGX 2H29A 3HMQA 1J1ZA 1K92A 3RK0A 1TYDE 1JGTA 5AHWA 2QUHA 1U7XA 1VBMA 2WSIA 3CLRD 4ZT2A 3IODA 1IQ0A 1NSYA 3KT3A 4MVWA 4KR6A 1KAMA 4YBRA 1P7PA 4ZCRA 3ZJUA 3NBAA 5J58A 3UY4A 3VRHA 1BS2A 3TZEA 3NV7A 3CVWA 4MULA 4E1AA 4ZT3A 1XJQA 2TS1A 3N9IA 1MB9A 1T9GS 3RK1A 3FOCA 4MUKA 1Q15A 2PFSA 1TFUA 1EFVB 1KQNA 1O0CA 2CV1A 4NATA 1N2OA 4DLPA 4ARCA 2J4DA 4ZT5A 2VXOA 3HFJA 1Q77A 1G59A 2D54A 3IOCA 1VBNA 3ZUGA 4ND6A 3TS1A 3KT6A 1O96A 1T9GR 3ILVA 3PNVA 1WQ4A 4I6JA 3LOQA 1WJGA 3F3MA 4WNYA 2DLCX 2GKSA 1N2GA 1IQRA 3IDFA 1G8FA 3AKZA 3FETA 3ZGZA 1GAXA 1YUNA 3PXUA 4EGAA 3L92A 3UC5A 1HYBA 1JZQA 3SDBA 1UFVA 1QNFA 2JANA 2G36A 4MWDA 2AZXA 1YI8A 1QQTA 2IELA 4DDKA 4AQ7A 4ND7A 1M83A 1TEZA 4MW0A 4Q16A 3IOEA 3ZJVA 3RFFA 3A05A 3RHSA 2DETA 2DPLA 3FIUA 3MMXA 1NUSA 1NURA 3LE8A 4ARIA 4NAHA 1TYCA 3ZXSA 2VTBB 2PZ8A 3U1VA 5FO1A 4JYZA 3UOWA 2X1LA 3FI0A 1N78A 2YWCA 3FY4A 4S1OA 2PG3A 3N05A 4I6GA 1MAWA 1LW7A 4HJXA 3G6KA 4MUFA 4MW7A 1KH2A 3FH0A 1OD6A 2A1UB 3K9WA 1ZJWA 2DR2A 2NZ2A 4YP7A 3IUBA 1M8JA 1MBZA 4J75A 4EG5A 4F4HA 3VU8A 4ZCQA 3AFHA 1NYLA 4DE5A 3SP1A 3TQOA 3CLRC 1PFUA 3C8ZA 3HZRA 1M8KA 1N3LA 5IHXA 3H97A 1XNHA 4MVXA 4DDHA 5LLTA 1H3FA 2Z08A 3COZA 1MC1A 2CUZA 4GU5A 1QTQA 1T6YA 1M8FA 4JFAA 3D6UA 2EJCA 4KPUB 1I6MA 1JIIA 1OWPA 2ZP1A 1WKBA 2HZ7A 1KH3A 1LI7A 1R6TA 1VBKA 2PXHA 1EUYA 1QRUA 1N2HA 1KR2A 2CFOA 4FZJA 4U63A 3BL5A 2YWBA 1OBHA 3ND7A 4A91A 1JECA 4MW2A 2V0CA 3TZLA 1TYBE 4DJAA 1H3NA 1M8PA 3OTWA 3RBAA 5EKDA 1EFPA 4KR7A 4NDAA 2X1MA 3QTTA 1U3CA 2D13A 2XRYA 1OWOA 3CLTC 3TNJA 2D5BA 5TEWA 4R2LA 3E27A 2JA2A 4MW9A 5J5AA 3ELBA 4MWBA 2QUIA 1WOYA 1J21A 4QREA 1O95D 1WXEA 1N75A 5HUHA 2I1LA 4BWVA 3HV0A 4EG3A 3N8HA 1KQOA 1K4MA 1O6BA 3K32A 4RUKA 4DNXA 1OWLA 3HL4A 3ND6A 3L93A 4MUEA 1V47A 4CDMA 3OP1A 1IVSA 2A1TS 2X3FA 1I2DA 3H05A 3SYTA 1FFYA 2QJTA 4NAUA 2CV0A 4CQNA 3CA8A 2HMAA 2J5BA 2DERA 3H9BA 3UK2A 4HPWA 1EE1A 1YULA 1R6XA 4GRIA 4G6ZA 1NZJA 4H3SA 1NI5A 3CVVA 1FYDA 2V0GA 1QRSA 1GZUA 2A1TR 4I6EA 4PBSA 3SEZA 3FHJA 3HGMA 3JXEA 3IMCA 2WB2A 2A7XA 5KWVA 1XNGA 3N2YA 3TQIA 1U7DA 4MW1A 3CLUD 3NBKA 4EG6A 4EG1A 1Q19A 3AG5A 2BTEA 1N2EA 1A8HA 3G5AA 2A1UA 2A88A 2DXIA 1U0BB 4MUIA 1JIKA 4MAFA 1EXDA 4NX2A 3IMGA 1I6LA 4K03A 4MW5A 5BNZA 1F4LA 1PFWA 3ZJTA 4JXXA 4X0EA 4EG8A 5DB4A 2GM3A 1O97D 1I6KA 3ND5A 1YIAA 3CVYA 2GOYA 1O96B 2E18A 4Q93A 1GTSA 1MB2A 1MOPA 3MLAA 2A4MA 1KQPA 2NSYA 4U8HA 1ZH6A 4XFJA 4ZCPA 3QTBA 2Z3VA 2WQ7A 4OUDB 2CV2A 1D2RA 4MW6A 4MW4A 1ILEA 1EUQA 2RE8A 5J59A 4L2IB 4MUHA 1DNPA 4YP5A 2AG6A 3P0JA 1KH1A 1JEEA 3GMIA 3MUEA 1TYAE 4CT0A 1JMVA 3IMEA 1IRXA 3CVUA 4QRDA 4R0NA 3FDXA 5H7XA 5TEVA 1WXHA 4JZYA 5FO0A 1V8FA 5LM3A 4MUGA 5HUJA 4J76A 3Q10A 5JBNA 1NUQA 3GUZA 1MRZA 1Q11A 1QRTA 4UZFA 1CT9A 3DLAA 1ZH0A 2YY5A 4ZCSA 3LCJA 1ULHA 1YUMA 2CSXA 2EL7A 1F9AA 1VLHA 2ZUEA 5HG0A 4EG7A 3SZ3A 1MJHA 1J70A 3SZGA 2B7LA 3P0IA 2CYBA 1B6TA 1XNJA 3Q12A 5F23A 1YIDA 2QUKA 1WXGA
chains in the Genus database with same CATH superfamily
5B3KA 1KERA 1P7WA 2DF8A 4FZ5A 5AXAA 4RXMA 4DABA 5K3AA 1MO4A 1ODFA 1YL5A 1RLTA 4HAVA 1TM2A 2DGDA 4JT4A 1P2UA 4U1RA 3WQSB 1FUIA 1VKNA 4O4HB 3O4GA 3JQAB 5EIBC 2K87A 2RB4A 2RHJA 3BSYA 2QAJA 3QFSA 1KNXA 3EVCA 3HABA 3PTLA 1Q7CA 4PXAA 4BNMA 4FWTA 3QNMA 1G8GA 2NVOA 4C04A 1UIRA 5KQMA 1UANA 1RPAA 3NWOA 2AC2A 4QYXA 4CMEC 4DA8A 4AJJA 4NZYA 1QXSA 4K26A 1RW4A 1SOVA 1M7HA 2HREA 3D8TA 1G3UA 4L85A 5HIKA 4OXXA 4DM3A 3VNVA 3C5WP 3J7TA 5B30A 3G68A 3PDIA 3WQBA 2ZAOA 4ISCA 3RVLA 3BTVA 3BGOS 1WUKS 3RIGA 5JAOA 1TAQA 1YIOA 4ZA2A 3LWZA 4Z0TA 1U9YA 3DDSA 1TX4B 1Z0KA 5JS7A 3ZE6A 1DKRA 1E3DA 1FTYA 2FXIA 3WGKA 3OZSA 4PLTA 2VEDA 2X4IA 1POXA 1JNXX 4X62B 1DIGA 4G9GA 4J9UE 3H4VA 4LDZA 4M7PA 3BREA 3T3EA 5LU9A 1AHIA 3OU2A 3K30A 3I04A 3TQCA 1JVBA 1EDOA 4H3HB 2Q07A 3SJAA 3JAWB 2ZVJA 3IEIA 1EFTA 1Z34A 5AO9A 3IUQA 2YW2A 3THWA 1LCIA 3RNLA 4JYAB 3H9EO 3GQBA 4DCPA 5K3OA 2BYTA 5FH9A 2YMPA 4TWBA 5IWCA 4UEKA 3BGWA 4RHFA 2Q99A 4K0RA 3RS9A 1C4KA 2Q5FA 2AHRA 2CKDA 2XQJA 4ZCMA 5BRAA 4EFKA 2VT3A 3DF9A 4B2LA 2VPXA 1DKNA 3HXPA 3IJEB 1FTNA 1G8HA 2FW6A 4WKPA 3V4SA 7YASA 2ZJ5A 5FWAA 2ZOSA 3K09C 3IP9A 4QKQA 2C5SA 4I8DA 1RAIA 2VK1A 1ISPA 1NLYA 3ZV7A 2XRFA 1RVDA 2CL5A 3ELWA 3PUVA 4HL6A 3SC4A 1CBUA 1NP3A 1XDUA 3F1LA 3PFCA 4O1IA 4TXJA 4RHTA 5LP6B 1HNXB 2XZDA 2LE0A 3V32A 3GHHA 4IIYA 3CLTD 2DHQA 4IR7A 4GDMA 2PMKA 4OM7A 2X22A 2CEAA 1U8YA 3THYA 3H5TA 3R9WA 1UBUS 3EXHA 4G41A 4F4DA 2J4FA 3VISA 2P3QA 4G65A 3ZGYA 1E6CA 1WSDA 5AHOA 2YYZA 2AJCA 3S99A 3CRW1 3NEAA 1PL6A 3AKYA 3STUA 1WXFA 1X77A 3VH3A 2O8VA 4N9WA 4GX0A 2RI0A 4KRYA 4RD2A 2HK7A 2Q2VA 1QQ7A 3KU1A 4CTOA 3QX8A 4HN4B 4PX2A 3FR7A 2HTFA 3UMSA 2JFXA 3HY6A 1Y7HA 2X9NA 2O2GA 1FPMA 2P9QA 3CKLA 1QGAA 3D6MA 4JGGA 2ZB3A 1NMZA 3LI2A 5IVIA 3AI2A 1KP2A 3Q7PA 2EFCB 5TNXA 3I61A 2IT1A 4WJLA 2XCLA 5DSTA 5K3FA 1LH0A 2XZTA 3WNCA 1T29A 4F5WA 3LY8A 1KWGA 3MJEA 1RYNA 4E07A 4HLUA 3B2EA 1FSFA 5EYPA 4ZT7A 4JXZA 1CQWA 3BIFA 4PBRA 5EKSA 3V4PB 3KE9A 3KR1A 2GUGA 1YBMA 2ISQA 3KYCA 4I66A 3U7FB 3ICEA 3ZHZA 3BHMA 3KHUA 3TJRA 3DZIA 4CF7A 4FW8A 3A1SA 3VKHA 2GAIA 3MTIA 3Q2KA 2G9RA 4HDSB 4LZLA 2JKYA 4MS4B 1BNCA 1XQWA 2YV2A 4M0DA 4ALMA 1E32A 3ZD8A 2OXFA 4G4SO 2RFLA 4CM9A 4PYKA 4B4VA 2NUPA 2JHPA 3U3DA 3L4SO 1GKUB 5KNBD 1VB3A 3KALA 4F2PA 1FVHA 1E2UA 3BWBA 3B6KA 1KBQA 2WW8A 3BZWA 1T9CA 3W79A 3RR2A 2QRVA 2R97A 5DCLA 2P90A 5FA6A 3P0EA 2I52A 3TIXB 4ACBA 2GXQA 3OJLA 2WBLC 3ROQA 1T2DA 2IQ5A 4CMCA 3Q5GA 4QAQA 5IJ9B 2WJ3A 1S8NA 2QR2A 2WIFA 3AFIA 3QE3A 1KORA 3NP9A 1IM2A 4O4JF 4YI3A 2G71A 3LX8A 1BWQA 3CLUC 3KWFA 1E3WB 1RXCA 1BEZA 4RVHA 2ZAMA 5F5LA 1E99A 5A3RA 1VKRA 1MHPA 1KYTA 1DFIA 1VC2A 3DE5X 2WLSA 1QIKA 3GAFA 3GOQA 3IBFA 3KD3A 4IEEA 4DILA 3ZZ0A 2ILVA 4NDNE 5EY5B 3ABOB 4HAYA 4RETA 5CK5A 1Q0QA 3UJPA 1SKQA 4BTVA 5CA1F 1ZNWA 2D2VA 3VQTA 3RK0A 1V5WA 2O14A 4MRMB 5EZYA 4E88A 3RS0A 1TYDE 5IH7A 4MA0A 3WXMA 1W581 3VR6H 3OWHA 2H54A 3ANSA 3ZE0B 1JP7A 4UPVA 1VBMA 3UXHA 1VYVA 2TMKA 3L02A 3WIDA 4TTIA 4F6RA 1N6NA 3AY6A 3OPVA 5TIIA 5IULC 4YBRA 3BILA 2B0JA 2RBGA 3ASUA 1K63A 1Y3CE 3U4GA 3AVTA 1U2RA 2WHRA 4DR3B 3TZEA 3CVWA 1G98A 4MULA 1XAGA 2RGBA 3KJNA 4IXWA 4NPAA 1OIWA 1GDDA 2B8TA 3Q85A 2ZTVA 4CGYA 3RK1A 4DEVA 3OIYA 2H7VA 3T06B 4MUKA 2I8CA 2IYFA 1IMOA 3AP3A 4KJZA 1V1JA 2B78A 1LNZA 1ZN7A 3NPMA 2I34A 2TRSB 4TKVB 2HNKA 3HJFA 5FLKA 2VZLA 2AEEA 2PTHA 3VHXB 4F5EA 3KKZA 2NUAA 2Z2XA 1MX1A 1V9SA 5HKAA 3Q40A 4ZT5A 5A71A 3RGWS 3OE4A 1GTG1 1LPMA 1SJ9A 1WNTA 3DKIA 1FFHA 2GF9A 3FCSB 3HS3A 3MIIA 5JO0A 1FFGA 4AXBA 5J23A 2QP3A 2W2QA 3VMMA 3HYCA 3N39C 4V0RA 2OBMA 4FE7A 4X66B 3TUJC 2A5DA 2I4LA 2YWHA 3GMDA 4YJHA 5AK4A 2J3QA 3LOQA 1AZLA 1WJGA 2IITA 5AW2A 1YTUA 2A52A 5K4AA 1CD5A 3L0SA 3SXUB 5BURA 1RZRA 1MO3A 1PWHA 3S8YA 3TPCA 4XWWA 2Q9CA 1YU6A 4EVRA 3WIOA 1NG9A 2RC6A 3NBZC 3AZPA 3V55A 3VGPA 1P2FA 4XVUA 4WVLA 4HEHA 3B1WA 2G1KA 2JIRA 4QULA 3LQ4A 2OHFA 4EX6A 2AH5A 4EF5A 3DMTC 1IHPA 3CXRA 1IXRC 4MWDA 4CT5A 4DBZA 1AA9A 2QE7D 3DMNA 3Q15C 2VPPA 1Z6ZA 2HPAA 2XYGA 3LGSA 4OQ4A 1BMFD 2QRLA 1P33A 1H2AS 4G0XA 4C0WA 4ZK6A 3OMXA 4ZC8A 5JXIA 3RHSA 3QU9A 2DPLA 4PZPA 4YDSA 1Q20A 1I5OA 4JC4A 3I32A 1XN4A 5BR4A 3LGXA 4RTJA 2ZBRA 4JI5B 3HZOA 1TOAA 3AM1A 1NF9A 4US0R 1LDBA 1DLIA 2KQUA 2XADA 3HY3A 4HTFA 4JOCA 3VAYA 2X1LA 3FI0A 3NTVA 1ZK2A 3P2IA 4MCHA 1X1RA 3USZA 2JLSA 4X1YA 3IIJA 1UBGA 1FX0A 2O2ZA 4M2LA 4V24A 5IUKC 1OC2A 5D00A 3TL6A 4CL8A 2GNPA 5CX1A 4E15A 3T1YB 3U3MA 1OB5A 4F2WA 5I7FA 5IZ4A 4IJMA 2FFAA 2GN9A 2OAEA 2YXEA 4CMGA 1ZJWA 2AG1A 2NXCA 4J75A 5IT5A 3CFHL 1FEZA 3DV9A 3IHTA 2JBAA 4KX5A 2BFOA 3WO0A 4PICA 4X94A 4EW1A 1V3UA 3PQEA 4NOLA 4CM9D 4EW3A 2A9JA 4WK6A 4XVCA 4PPYA 5D3MB 3NM5A 2OXIA 1WU8A 1K4YA 5E9WA 1OLXA 3HZRA 1HDIA 2GW4A 1YJXA 2C29D 1DELA 1T2CA 5EWMB 3GCZA 4D6YA 2O59A 2IUUA 1HZJA 3UV3A 4C78A 3ZWKA 1FU4A 1AGNA 2E1RA 3ZLBA 4CKYA 2I7TA 3H97A 4NE2A 1P3DA 1U90A 4DBLC 2C5GA 4MDYA 3BWYA 2UUCB 2IX9A 3S2IA 3WNVA 4QTXA 2FR8A 3QTLA 3S68A 4AD8A 1DU4A 4N3BA 2DBRA 3B3QA 3EXEB 1HLDA 3T7TA 3OPYI 3FNBA 2VZ8A 4NL4H 1YTLA 4FYYA 2C8KA 3KEGA 4DY6A 4IJQA 3HCAA 4A8JB 4TKZA 4WA8A 1C4XA 3N2EA 4YK7A 5LZ2A 2SICE 3LYUA 3ROKA 4CI9A 5F77A 1MO2A 1THGA 3C3AA 1O6CA 1Q14A 1TGVA 2Y1EA 1M6VB 2V0CA 3OCVA 3KR0A 4FLMA 2GN6A 4RKYA 4KAAA 3RBAA 3TSCA 3GRAA 3D8BA 5KU7A 1ND6A 3IVRA 4AAYA 3P26A 2UVPA 3TNYA 5JAQA 1JXOA 4TV9B 3EGDB 2OA0A 2QVCA 4LY3A 3VZQA 2V1UA 1HT3A 2WG2A 3I9V1 2MSCB 3LT0A 4ILEA 3WDLA 2QS9A 3KLPX 4M83A 3AP1A 3QG5A 4R2LA 2QK4A 1E4YA 1U8UA 1LY1A 2B7CA 2VA8A 3C7KA 3FPLA 2ZRGA 4OF4A 4QFCA 1XVIA 5HW0A 3U3JA 3IEMA 2XMDA 1TMOA 3LVRE 2JLQA 5FWYB 2XOEA 4B8ZA 1S2DA 4ZU3A 4MR9A 3PPWA 4G4SP 4MKFA 3E82A 4RK1A 3WWDA 4GSKA 1TZ2A 4P93A 1DUIA 1GQOA 4YT8A 4B87A 2DSNA 4FOSA 3R3YA 3VVCA 2NNWB 3EDYA 1VE7A 2ATIA 1T8TA 2ERYA 3OFNA 5AXDA 1L7XA 2NT4A 4KIUA 1HO3A 2G63A 4GRAA 1EQAA 1KVQA 5HDBB 1VA5A 4CDMA 5BN4A 5A5DA 1YQTA 3N5KA 4CKZA 1N6HA 5FWXB 1SB9A 1RLIA 4RXTA 1KK3A 3QVOA 2EDCA 1SHUX 1K86A 1Z6AA 2QLNA 1IG0A 4DLXA 4YRJA 5IFKA 1JYEA 4I50B 1RZRD 1YCGA 4TMVA 2Y92A 3ZCUA 4I1YA 5KU1A 4BE4A 1NC3A 5G1OA 1UMCB 1LFDB 1QH1B 3SX2A 3TD6A 4RVDA 1OB2A 2RGEA 4QQ8A 4GKBA 1A5SB 5AQEA 4BLWA 2IS4A 4Y1EA 1PVVA 1MW8X 2C54A 4CETA 2IYRA 1DBWA 3LMKA 3BL6A 4NXMB 3M2PA 2H9IA 2ZIFA 1LGYA 2QOEA 2YY7A 2A1TR 1JSLA 1KJNA 3TB6A 1OZ0A 4FFSA 4F0JA 3QBEA 4IJUA 4H17A 2A7XA 5FBKA 2RCYA 1KAHA 5HZGA 3MZ0A 4MS1A 2IK8A 4NQZA 2XNHA 3KOYA 5TQ2A 1TM3E 3C74A 2NO5A 2VP3A 4R1SA 1JH9A 5AMXA 3ZNNA 1JHUA 1D5WA 5ALUA 1PR2A 3AG5A 4GH5A 2C78A 5U4QA 2ODEA 3EAQA 3WL8A 2E4AA 2E9SA 1EGQA 3RAEC 1E2GA 2XXAA 1LX6A 1F20A 1P39A 1T9ZA 4LDQA 2VOJA 3JWHA 3IUYA 4M7OA 3U0BA 3S2YA 5KX5B 1W8IA 1M2FA 1ZAKA 3QHAA 1UKEA 4XGNA 4OP3A 5DHPA 5BYAA 2FMIA 4FFVA 4UULA 1USVA 1WCWA 4FYXA 4UUNA 1M2HA 5JCOC 2PEZA 4BU0A 4RK0A 5TPWA 5E6SB 3KBBA 4RM3A 4KDRA 1O1YA 2O1WA 2VRCD 4L07A 4MV1A 1AO0A 1LZLA 4HDKA 2G0AA 1E3QA 5ALGA 3EISA 1YDWA 1YNOA 2PUHA 4P22A 1DRUA 5DHQA 5FFNA 1FFDA 1E1NA 2A4MA 2V4MA 1KQPA 3E22A 1PS8A 1V39A 4JLBA 4NZZA 1SD1A 3FTQA 4N65A 3WO1A 1Z56C 2Y2VA 2JBWA 3ME5A 4DRZA 4O2AF 3GBSA 2HA7A 3L2OB 1ARZA 3LHSA 1FB5A 1WB4A 3I9MA 2WUVA 2NV0A 3F9CA 4C08A 2WP8J 4YCJA 1SPXA 3E8SA 4XXHA 5JXHA 1YZLA 4AUKA 3PHHA 2VN8A 1L5MA 4JITA 4TZTA 2JRCA 3QW4B 2X76A 4UE6A 3MUEA 1SCQA 4RLFA 2Z2YA 2OLEA 2PGJA 5KYKA 3GGCA 3FDXA 4F9EA 5FPKA 1YQUA 4FEAA 4NZ9A 1JHXA 4L0CA 4S1WA 5BQOA 3AM4A 3LD9A 4RZSA 3SYMA 4UE3S 3SICE 3LPMA 4OFZA 3W9UA 1RPJA 1K8ZB 1Z5WA 2ZUWA 3QLVC 2R6GA 2RB5A 3AJDA 4JJ6A 4JEHA 3H84A 4D5GA 1PNQA 1ABEA 4JYCA 1SQSA 3UV7A 2QHXA 5DCWA 1O87A 1Z6GA 2HJWA 5A06A 1JLSA 1RHJA 4G3XA 3L18A 3DS8A 2F17A 1KO8A 3L0DA 4MR7A 1GUFA 3IDAA 2IWHA 1RI2A 4QDKA 3NALA 1U4SA 5AI6A 4BEJA 4HH3C 4ZDJA 5LLSA 2NVBA 5L7WA 3LKZA 1IJKA 4JB2A 3S1LA 1UZNA 1P1CA 4I9NA 4KHZA 4XVQA 1B0PA 4LYDA 7REQA 3PX2A 4M1EA 3NIFB 4I5IA 4DJ5X 2BKVA 4JVMA 2YXNA 5EJ9A 3LBIA 1R9MA 4HXGA 2WJWA 4LNUB 1AHPA 3C7TA 4I9HA 3B1FA 3OCUA 1YB7A 4NXNB 2VDLB 3JYHA 5CM8B 5FFMA 3UOAB 5DYNA 3CCCA 5JCXA 3IQZA 1CQIA 2FE1A 4MYRA 1UBEA 4GQIA 1W52X 1V5IA 3CO5A 4Q15A 1GADO 4WNCA 3T3GA 4EPRA 3AVVA 1R3UA 2HXYA 3O4FA 4JBYA 3KFVA 5AUOB 1ZG3A 4FHCA 1E9RA 1HNWB 3E3MA 1NOKA 4F72A 1AKUA 3DPUA 2HT1A 4GE0A 1T2AA 3JVEA 4NYIQ 3RJ5A 4HV4A 4HPXB 4XIFA 8GPBA 1T0BA 4PAMA 3H2SA 2H6EA 3G0DA 1J0EA 5BSWA 3DOIA 2FG6C 1DB3A 1DMSA 5K0GA 3V3TA 1GTRA 2I6QA 4PBTA 4EJSC 2H11A 4WVFA 4NCKA 1T2UA 3HWRA 2VJCA 3KG2A 4L4SA 4UNPA 2PRIA 3NATA 3D4IA 2JI8A 1JTEA 3KQTA 1R74A 4YONB 4LTDA 4EF4A 1CSEE 3VYTB 4C9BA 5CDFE 1U3FA 3AI3A 2F9FA 3HKEA 3QE0A 1FVOA 1HDCA 1GTZA 2J9RA 2WSLA 3M4ZA 4GQBA 4LJRA 3E9QA 1P3JA 4NTZA 1P4JA 4K3VA 4QUIA 5LA6A 3LPLA 1L4LA 3QE9Y 2GM5A 1HE8B 4MI3A 2HTEA 4JI2B 3SIRA 2YJ6A 4GPAA 5TLSA 3OLWA 1V16A 2EDAA 2MINA 2PAAA 3M83A 4YJ2B 1RMTA 1KJ8A 1F6DA 1YFZA 4U3JB 2B2NA 5CCXA 2R1TA 3DNPA 1NLZA 5D8DA 5KQSA 1DXHA 1JKFA 1BDJA 4ZQHA 1NUTA 3UCEA 3BTSA 4C14A 1SCJA 1VZ3A 4ALLA 3FMGA 4LV5B 2C98A 4C0HA 4S3MA 2X8WA 4XD7D 3R0IA 3WMXA 3DBRB 3FAKA 1FIUA 5ARDA 3ZWPA 2WQ6A 4X97A 4IIJF 3DZDA 1WETA 1VECA 3RVPA 5CFOA 1Z5OA 2H4HA 2R1VA 4RH0A 2I76A 1INLA 3R6GA 4CFYA 3DO8A 1UP6A 2NXWA 3DDHA 2LRHA 2VTEA 3RABA 4DXDA 3GG9A 1WKVA 1XI2A 2VR1A 1C7ZA 4EDFA 5DTEA 1KEUA 4IXMA 3KDPA 4QU9A 4Y2RA 2WRZA 2XIQA 2P41A 1ZBDA 4E94A 1WY5A 2LIPA 1J5EB 3DZFA 4YCBA 1WPXA 4X6XA 3W8DA 1SMKA 3T4UA 3ER9A 2CL0X 2F9LA 3N7TA 4IUDS 4MP8A 2CHQA 5CVCA 3C43A 1WEKA 2JH9A 4EVIA 1C81A 1WZ2A 1VIYA 4KTVE 5CTJA 4UUQA 3GLKA 1G7CA 5H70A 3TE7A 2FPPA 1TVCA 3L05A 3A1EA 2PANA 5T4HA 4QGSA 1N77A 5TQJA 5LXTF 4K3UA 1XQXA 5DISB 5IM4A 1KI3A 1G1AA 1LTHR 1E6LA 2AV6A 3K5WA 4MGZR 4UQOA 2G25A 5FNVB 1N2BA 5LC1A 2G72A 1ZCAA 4HPJB 4Q9DA 1EVYA 3Q98A 4B7CA 3DE6X 5GV8A 4N76A 2DFDA 3C1OA 4ZAFA 1V5GA 2JJ8A 2XUIA 3VAAA 5FHRA 5H02A 1U5BA 3AX6A 3PJDA 5HS6A 4IHKA 1ESCA 1T1JA 3BFJA 1J2JA 4J0CA 4PZUA 4DEYA 2VATA 2J0SA 3KKOA 4R2KA 3HDQA 5IH3A 2GR8A 4MLZA 2A0WA 5L40A 4GMGA 5CPFA 3IT1A 3LLMA 3DBIA 5DHAA 1L7AA 2ZRJA 4OP1A 2ZCVA 1RFLA 4PG7A 2QUJA 1Q1EA 2CZCA 4FOPA 3GBPA 1NFFA 1P19A 3BHIA 1CIPA 2GEFA 3QPBA 2IYAA 4KMOA 1QHHB 3U7RA 4H6XA 5KTNA 4CDGA 4I14A 2PIDA 1YT5A 1KKLA 4JR1A 5BSTA 5AUPB 4AUMA 1Y5IA 2CLHB 1YZQA 3E48A 1O7JA 1M6YA 3LS2A 3PRHA 2AX3A 2PA0A 2FUCA 4QUBA 4JQOA 4FBLA 5K01A 3S8EA 5DGCA 1Z2OX 3DDCA 1H6BA 1QIHA 2HU2A 1UADA 1XDWA 1Z8NA 4QUGA 3RC1A 4CE6A 4CHTA 3TG8A 1T26A 4OLAA 1C8VB 1WBJB 3UAOA 4H4CA 3ZQKA 1IDOA 3MAGA 1KI1A 2JIBA 3H1PA 1TJPB 3GVIA 4B6EA 2OG2A 3LWNA 3VKWA 1A2OA 3HMQA 3VU9B 4RA6B 1EVQA 2EKPA 4Y1RA 1PJRA 2H5EA 4UFNA 4L6IA 5JTUA 3QY9A 3SQLA 4GBJA 5SY6A 1GFWA 2BMWA 4K6HA 2AFIB 3MD0A 4NP6A 3DKVA 1EA5A 5BT8A 4ND4A 4OVKA 2GN1A 5A0TA 5FKJA 1C4WA 4F6CA 5FLEX 3AF4A 4IOMA 4MVWA 2BEKA 4CG3A 1OH5A 1RD4A 2N46A 1SXJB 3D2AA 4HWTA 1H2YA 4RPLA 2D1SA 3PNQA 4CL0A 1C14A 3A58B 4DHEA 3PR3A 2RGGA 3UY4A 4DBLE 1JMKC 4NOMA 4ZTBA 5FI3A 1WTAA 3N07A 1K08A 2VNHA 4E1AA 1SIWA 3QU7A 4BCBA 2YZMA 4QE3A 4KBFA 4HATA 3IEPA 3VZPA 2VWQA 2FZVA 2G09A 3WLQA 3C2QA 5IDXA 4DR4B 2CXOA 5EXSA 4LJYA 2WU3A 2HFKA 5JAUA 5GWXA 1SGWA 3O1LA 1X87A 2VJYA 3UJHA 4GX2A 4XUDA 4C3VA 4D92A 1OQAA 1B7GO 4L51A 4CLXA 3CNEA 4TWAA 5F73A 4ARCA 1E2MA 3EXIB 2A50A 4DNQA 4LW8A 1KRHA 1N2SA 221PA 2CK3A 2Z9CA 2O48X 2VRBA 1GPJA 1G63A 1VMEA 2K7ZA 3QHQA 3TS1A 3IP5A 2B9VA 1BHQ1 1JU3A 1SKAA 3HU1A 3K8YA 3PNVA 3WADA 5C5DA 4RQUA 2X0FA 4JP5A 1MVNA 3I1FA 1Y34E 1G6OA 2EFDB 1V0JA 3W2IA 1C50A 1HZZC 2H48A 1N4DA 1GZVA 2HQ1A 3QMVA 3DE4X 2MSLA 2RK3A 4GOOD 4OHKA 3ESZA 5L3QB 3BULA 2XE4A 3DQQA 3O8RA 4IMRA 4HDAA 4I55F 2BEWA 4AY6A 5KB3A 3EZLA 1AUOA 1E4EA 3SDBA 1FSSA 3UENA 4Z0PA 5CMLA 1L5FA 1UKCA 1VI2A 3BIOA 4F2DA 3P4XA 2AZXA 4YUWA 2P0AA 4KVFA 3C6QA 2ZXEA 1Q1AA 1DFHA 3JZAA 1EMDA 4Y0NA 1YI0A 5AM2A 1S8AA 3OTQA 4HEQA 2IV7A 1PQPA 3MCVA 3GFVA 1F6BA 1M2OB 4M99A 2DETA 3MMXA 2EJUA 5FCDA 5EGNA 2NVUB 3ZVRA 4EZEA 2QTWB 5EQFA 5I4KA 1YS9A 3DUFB 3RTBA 4E3ZA 2PZ8A 3FJYA 2FLWA 5JG7A 4D82A 4JYZA 1PFGA 1DZ3A 2P9CA 3TZBA 4C20A 3GZJA 2GBGA 2ZJ2A 3PFWO 1U11A 5DNDA 2Z1NA 2G6TA 3F3YA 3N05A 2OAQ1 1P0MA 4HJXA 2B92A 1N3YA 5BW0B 1YQ9A 1VG8A 1GPH1 1OD6A 3O91A 2J3IA 2YX1A 4UNQA 4G1FA 4BWFB 5HWSA 2O2YA 4CQLB 4GMHA 1WB6A 4ND8B 4FK8A 3W9BA 4ED9A 2VHCA 4CIYA 1A77A 2A14A 3TQOA 3PC8C 2E37A 4BVEA 2CEKA 2VHVA 2BBTA 1CY6A 1WDTA 1NQTA 2HLNA 1Q2UA 1RRCA 3SBOA 1MV5A 1GPLA 2C1EA 5AHRA 4DR5B 3IR6A 1CQPA 3N7AA 4DAEA 3DH0A 1SU4A 5IHXA 3SHQA 2LXNA 4HZUA 4QBKA 4DDHA 1RWWA 1VQ1A 4Z4QA 1OH8A 3B6IA 1KDTA 4TRRA 1RC8A 1MC1A 1Z35A 2HDWA 1I9GA 1JQJC 2DH6A 2F4NA 1NVTA 2ZBFA 1LDEA 3HBMA 3HBNA 4R2HA 1BE0A 2PFGA 2VDJA 3CNNA 4LGYA 3A28A 3LCMA 5DLQC 4EB3A 5CXQA 3LYHA 4UCQA 4NWIA 1TGYA 1ZBQA 2JHFA 3Q1KA 3PGVA 5KYWB 3IDOA 3S2GA 2WTBA 4C21A 1JDSA 2YNMA 4E08A 3NFYA 5IG2A 1RI5A 3DMYA 1VLLA 2DAPA 2LTAA 3P9NA 1NJ5A 3CX3A 1GGHA 3ZKAA 2NU6B 3OWXA 1K7XB 3BMCB 5F1YA 1D2NA 2OENG 1G55A 2Q5QA 1I1OA 3OZGA 1PP4A 1SFRA 4RFSA 1JWBB 4IKPA 2R62A 2W6CX 1N0WA 3KJEA 1N7IA 4MGYR 3OTWA 1T4BA 5E2IA 2XJ4A 4MJLA 5EKDA 4B32A 3AEZA 5EMMA 1XEAA 1P1RA 3UJBA 4DLYA 1P4GA 2QM8A 4A6XA 1UBTS 3QRWA 3KR9A 4IFTA 1WW2A 3BH6A 1XXHE 3DOHA 3SR0A 3HEBA 3L6DA 3NNNA 5HE9A 3VH1A 5K8VA 4YRCA 1AY0A 5FUXA 2WJZB 2Q1WA 4YACA 3ANTA 4MWBA 1NX6A 3N0TA 5L4LA 4LGMA 3BCHA 4GEGA 5JEDA 1Y9AA 3JS5A 3IS3A 4MGHA 5GJCA 4KYTA 3V42A 4O4JA 2EQBA 3MINA 5CDHA 1CJSA 2IU3A 2QTVB 2FE4A 5A04A 1AUQA 2NADA 1FS6A 5HTOA 1ULZA 4BWVA 4LE0A 1A5ZA 3PVSA 4LV6A 5FPSA 2Z8XA 4P4GA 4EG3A 4AMUA 1EDDA 3QELA 5KJFA 1LF0A 4RQAA 1PWZA 4LOIA 4F97A 5CA1A 2KX7A 2NYVA 1C2TA 5IXSA 3BK7A 4HDQB 1CHDA 4O59O 4RHCA 4IGEA 3LG2A 4OOFA 2FEWB 5FOTA 2QJTA 3NHRA 1OTHA 4TTVA 5FDFA 2VZ0A 1C4OA 2FW9A 5CW1A 1GDHA 3GF4A 3WYFA 2GERA 2XE7A 2XSZA 3RSFA 3C8HA 1J23A 4F3KA 2HMAA 3M9XA 2FDRA 3WGOA 2VJOA 4KXVA 4PZZA 4BFLA 4L4RA 1VB5A 4EHIA 2HQBA 4P8RA 1RYHA 3WLKX 3AYXB 4DCSA 4EFDA 3V4FA 2C9BA 1S2LA 2ZYVX 4QYIB 1XROA 1S7CA 4A4DA 2C7BA 2J7PA 5B2ZA 1H5NA 4HCJA 3CVVA 3OQPA 2X7JA 4CLRA 4L76A 5JZ9A 4OBXA 3LT1A 2DLDA 4O1HA 3VR4A 3B1YA 3GEMA 4GLJA 5T8KA 3H5AA 1MW9X 4P80A 5PGMA 2PH3A 2YS7A 3OCZA 1KEEA 4EITA 5DI3A 2DFNA 3KQVA 4FGUA 2IVZA 4ENQA 3AV0B 2ZJZA 4IS3A 4XX0B 1TT5A 3IBSA 2IF0A 1W1UA 1B00A 1B8UA 1GAEO 1HE5A 1IOVA 3BMQB 3AB3A 5TGZA 2J45A 2EW2A 3QLUC 2GUWA 2IKQA 2ZRHA 1ZEMA 3PHJA 4RTRA 2D6FA 4RGQA 4EY5A 1E69A 3TRHA 4DR7B 3E7XA 1GU7A 1QYXA 1SWWA 2H92A 1SBYA 3OCYA 4MQEA 4BZZA 1NMYA 1BVRA 1H1DA 3PC7A 1IN5A 2RONA 5EINA 1I6KA 1WR8A 3PHCA 3QP9A 1Q7GA 2YS6A 2VDNB 2ZLBA 4G0QA 4DT1A 1LQTA 1ZUNB 3AEKA 4CIBA 1ZD1A 3AEYA 3ET5A 3JZIA 3RFVA 5LDDC 2Q45A 2WJJA 4FNOA 5BORA 1TMGE 1WV0A 3STYA 2VJQA 3ANXA 4IJVA 5E4YA 2YN2A 1VLZA 4YRDA 1OOEA 1HH4A 4ZZ0A 4XASA 1TLFA 1RM0A 4B4OA 3D4NA 2RHGB 1D2RA 1KSJA 2Y0DA 5AWFC 3DA8A 4RCYA 2RE8A 2QRMA 3AB7A 4Q3OA 2Z3ZA 3CXUA 5BUCA 3IIKA 3WC4A 4WKNA 3HKDB 3DAOA 4B9AA 2VHQA 4KN6A 4I4IA 2FZGA 3WB1A 3DEZA 1M1NA 1XT6A 2YNMD 1E2LA 2FX5A 3NOQA 1NXOA 2F8TA 2COEA 1JG7A 4CWAA 2OUKA 4UKDA 1RXEA 2FSGA 3AP2A 3QEMA 3AW8A 3F6PA 3E7DA 4YFVA 3EC1A 1IIRA 4QXOA 2OD7A 5JBNA 2PUVA 2J9FA 4PN7A 3O8LA 4TX1A 2IRWA 4NJEB 3WLNA 1LDMA 4Q4JB 1UPXA 1Y4ZA 4RVNA 1Y4SA 5C31A 2W2XA 2A3RA 1PX0A 3HYTA 2BCGY 2FPOA 3EXG2 3OOJA 3K9NA 4A5SA 1E62A 2IP4A 2WFZA 2CZGA 4D8WA 3E9CA 5JJKA 1QCZA 2JFHA 4XLTA 1Z0UA 4NMLA 3TCKA 1U0RA 3PC4A 4P54A 3WZLA 2H5JA 3KX2A 1JEYB 2ZRCA 1A7UA 2JLVA 1NN0A 3A4YA 2ZBDA 3GFRA 3R0QA 1RJ9B 3G85A 4PY2A 3DFMA 4U7JA 4G9EA 1OC4A 3QKUA 2W6ZA 1P45A 3X3HA 4PCUA 2V9ZA 3TLGB 4YXFA 5JVDF 4CM4A 1VJGA 5FBHA 1KAOA 3V1TC 2BELA 4EYKA 2XYPA 2D3WA 3V8VA 1IDN1 4URHA 4UNIA 4LI3X 4HQFA 1X94A 1RCUA 1ZVJA 3I05A 2V6MA 2HIMA 3PQDA 3DAHA 4G97A 4QECA 4U2DA 4E6PA 2EX1A 1RRPA 5DNVA 1I51A 4YH1A 1AE1A 1IONA 2QTNA 1SD5A 4BDTA 3CLSD 4KYIB 1NATA 1F6WA 3BXZA 1DG3A 3LBHA 1KZYC 1W8DA 4WOKA 2FPGA 2GPWA 3GNQA 4GR4A 2VNKA 1RKVA 3CFFL 3S2UA 1XZPA 3U7QB 3C6YA 1KE2A 5E7QA 1CUCA 4HKTA 3PE3A 4LXTA 4C3ZA 2J7PD 2ANBA 3JR3A 3QUCA 5BSHA 2PKCA 3QEOA 4WJKB 4HYTA 1YE3A 4V0NA 3R0JA 2ZT6A 5G02A 3VR4D 1R50A 2HH9A 2Z57A 5CLLA 2EARA 2Q1SA 4GG1A 2I1VB 1G8KA 2GVDC 1JILA 2CJWB 2FOLA 4N39A 1SVOA 4U6SA 3KTOA 3L1UA 2IYWA 1VP9A 2WVAA 2RG7A 3DLCA 1UMBB 3LFUA 3NASA 3VZCA 3TD9A 1U4OA 1CYEA 1Z3CA 1T5DX 4J0QA 2WIAA 2IEBA 3WGYA 1N1GA 3AG6A 1FOEB 3PK0A 5CYFA 2SCUB 3TUIC 1X6VA 3VPDA 3L7OA 1KJ9A 2HU8A 4GYWA 3ZWDA 4EECA 4TM7A 5P21A 1NSTA 3L0ZA 1BWRA 3HCPA 4S24A 4L7VA 3UN1A 4DANA 1PJLA 2PZEA 3TZQA 2XKKA 4HD8A 3CLHA 3GU3A 3H6HA 5B1SA 3UQYS 4BJHB 3RVQA 1QK5A 3RHFA 3UHPA 3TKAA 3IP3A 4GOKA 1NDHA 1T1SA 3WBBA 1QJCA 2WTMA 2IW1A 1U2QA 2W11A 3GZNA 4PIPA 4CBVA 1G8AA 2C20A 2ICAA 2Z5VA 2PKXA 2PZLA 1VL2A 1N6IA 3ESBA 3IT3A 2IEYA 4ZVTA 5T7BA 1D7AA 4WZAE 3MBIA 4G5YA 3MOIA 3VO9A 3ZG6A 1WBBA 3MRVA 2ASEA 1TU0A 2APJA 3F3KA 4LKRA 3JVDA 5B3AA 1PFVA 1X2EA 2XQVA 3VNQA 1AG9A 3G9XA 1E3IA 1RWPA 1QVRA 4GX5A 5LU8A 2HV9A 3Q0EA 4J0DA 3CV3A 3EQ6A 3IQHX 3W5VA 2O8EA 2AKEA 2VPZA 4BAGA 1EQ2A 1H05A 1TUBB 1C9EA 4D8TA 5C37A 2BGTA 4QARA 4W8OA 2OQ2A 1E96A 4KN5A 4KPUA 4M8KA 3U5TA 2JZOA 1Z0JA 1K97A 3G8CA 4QJ3A 5JRZA 4OLHA 5JXWA 2VBFA 4CCYA 2TYSB 3DWIA 3PPYA 3LWDA 1A71A 4CCSA 1ZHHA 1F7VA 1ORTA 2IGTA 4HQ6A 4KXXA 4MS3B 2BKUA 3MXTA 3P0HA 3CF4A 2O3JA 4M1WA 4Q7EA 1JNYA 3OFKA 3QWHA 1FS5A 1QHYA 4UZEA 4ZT6A 1JA9A 1OX4B 2BGWA 2GNAA 5JJLA 3FIJA 5ALWA 4M6WA 4H31A 3NM6B 1EFRA 4FIZA 4IIXA 3AK4A 4YECA 3ZV4A 3WYEA 1RTTA 1T34A 3WV4A 2OCGA 2FPLA 2FWPA 4FSHA 2MOKA 2SHKA 2VHXA 3NKFA 1XU9A 3NFRA 4ITRC 2Q3HA 4Q4HB 1XYGA 4LN1A 3II6X 1SNYA 1LD3A 2R1ZA 3RGGA 1SBZA 5KNCH 4O2AA 1LWOA 4H6PA 1Z68A 5FFFA 4BNXA 3MUFA 3STTA 4RGVA 3DQZA 4CTNA 2O5VA 1E5DA 4MUXA 3RYTC 2FMFA 1PGPA 3RVDA 1HFWA 4ND1A 5E4JA 3B5IA 2N0SA 3A8TA 3GFOA 1S2MA 3D31A 2J6IA 2FZEA 1NQXA 1R4NA 2J08A 5EZSA 2UUBB 2KW5A 2P9GA 2GBFA 1AUXA 2M9MA 4PFJA 1GLNA 4J7CA 3R4VA 1URPA 1CXZA 4ER3A 2PD4A 5JY1A 5A05A 3IOBA 2C2HA 4HR7A 1W0JA 4R6WA 3H99A 4FFNA 1JR4A 3TXXA 2BGGA 5FORA 3CHYA 4AKSA 5BN3B 1G2QA 4QT0A 2GHRA 4JUIA 4C0SA 1DX4A 1U0FA 1X92A 2ZW9A 1JI3A 1EYZA 1JIXA 2F3QA 5I4BA 3A31A 3LC2O 3K70B 1OLUA 3PNYA 2Q0SA 1C3JA 1C7QA 2WF8A 2AG8A 2OBLA 2GEJA 4QUKA 4D6XA 4MYSA 3ZW8A 4RS3A 3ZHCA 1PI3A 3KB2A 4QJIA 4C7OB 5IBRA 1J9ZA 1AN9A 3FTPA 3KKQA 3D7MA 4M8SA 1BQEA 3BPSA 1G2IA 2RSLA 5B4VA 4LYYA 3BF7A 4FQ7A 5KDOA 1WLYA 3AERA 3GYBA 2Z2KA 3TRJA 2FR0A 4E46A 4GW3A 3ZIDA 3NH6A 3UBMA 4GLBA 5AH0A 2W8BA 4LCBA 1X19A 4ZOCA 521PA 1MHTA 1XJQA 2BJWA 2O7SA 4N4AA 3AJ8A 4RK6A 2D8MA 3ZU4A 4EYQA 5JXGA 4LGCA 2V6IA 1ZI6A 5EJ2A 3PNLA 3VVBA 4Z9YA 4KUGA 3M2TA 4ZXPA 3A6FA 3BMOA 4XPIA 1HE4A 2B2CA 1P6XA 4AO6A 1OSNA 1PJ8A 4F86A 2IEGA 3S29A 5LOVF 2MSWA 4NATA 5LD2C 1VL5A 4DLPA 3GI1A 3ZBQA 4N1AA 3HKCB 3OF5A 4TYNA 4HLQB 2J5RA 4LXUA 4FBMA 1Q77A 4MA4A 5FL3A 1JV2B 1G59A 4EB0A 4D0GA 1I4EB 5GZ3A 2JHGA 1NVUQ 1OE0A 1RQ2A 4REQB 3L1JA 2I9KA 5ECDA 4L78A 1M34A 5DLDA 1IBSA 4V0QA 1MGOA 3ILVA 3LY5A 4OHYA 4YLGA 4W8HA 3EFHA 1U0OC 4FLFA 3EH1A 4DDVA 4XB2A 2VNAA 3FWYA 3UGQA 2BE7A 1X0XA 1JEJA 1CY2A 3P45A 3CH6A 3M4YA 3NBFA 1CDZA 1XZEA 4WNIA 3OH8A 3TW6A 4F56A 1S8OA 2GILA 4RPHA 5A3SA 4F06A 5HOQA 4MP3A 4RE6A 4ZPJA 3AR2A 4B7ZA 1GD1O 3MMZA 1Z4QA 3BBLA 1WMFA 2R84A 2IHKA 2JW5A 3G0GA 4OAPA 3L84A 2WINI 3PGJA 5G1PA 2EJTA 1VPLA 3AONB 3QEBZ 2FWIA 3DJYA 5ENDA 3GRZA 1N9GB 2RHDA 4M1SA 3SHFA 3TXYA 4LY9A 1M83A 1VRCA 4ESHA 1DWUA 1YR9A 5DX8A 1SQ6A 1VL6A 2IOHA 5CHEA 2OQVA 2DUNA 3CU5A 1F0NA 5E4TA 1HQDA 4MHOA 4FBGA 5H83A 5F7OA 4TUYF 1X9HA 1OXTA 2V98A 2YZNA 3LE8A 4BTLA 5M29A 2I29A 1Q3TA 4I3HA 4EMBA 3KJZA 2BZGA 4TL7A 2PMCA 1Z8HA 2HX1A 1HOXA 1SIBE 5EIHA 1SHLA 4IIJA 4EVQA 4FS3A 1N78A 1EFRD 2VC2B 5ALJA 2FUNB 4IFEA 4BYMA 5KYXB 2XF2A 3VR5A 1ISMA 2F1IA 4Z4HA 4JI8B 5BV0A 1O9HA 2W42A 3WBKA 1J8QA 2JEZA 1SRRA 3PDJA 2XGJA 4RF4A 2HIAA 4BZXA 1HFEL 4RESA 5I4CA 1LVGA 2P7IA 2OGZA 2R8XA 2INGX 2QJWA 5K2OA 2JH8A 1Z39A 4Q18A 1C1DB 2ZYHA 1PFUA 1GFZA 1POWA 5HKKA 2JAWA 4UBNA 4ETNA 4DMLA 1II8A 3EWSA 1W5SA 3GGPA 3KQWA 5EHGA 2B7BA 3Q7SA 5SYAA 1JJ7A 1N3LA 4FYIA 1Y9JA 2CJXA 3RK4A 2BFCB 2G0TA 1W0JD 5LXTA 1XXLA 4FT4A 2D4HA 4EBFA 1KO1A 3R7SA 4KFCA 2F3PA 4XIGS 1R6DA 2BT4A 2P6MA 2JFFA 4MJXA 1MZVA 2W71A 1M8FA 5KNDA 2XXJA 3KL2A 2A9VA 2EJCA 4I8XA 2ARKA 3CONA 2JATA 3OIDA 1OFUA 3BWVA 3L8YA 4FIDA 3MWEB 2C9OA 4B33A 3T5DA 1ADBA 5CK4A 5FOXA 5SYMA 1G8YA 2CFOA 3L0OA 1CRPA 3IO5A 2NV6A 3CVJA 5DRTA 2QRJA 4P7KA 3BZBA 5DSZA 2OQIA 1OBHA 2Q3JA 3QYAA 3LXRA 4CQMA 1V37A 3U7IA 1JEAA 4IO0A 2EWWA 1N6KA 2G3YA 5K99A 2MYNA 3WHKA 1ECPA 1I1NA 5HBGA 3TPFA 6LDHA 3CH4B 2XAAA 3IE1A 5FL7D 1TAGA 1P1IA 1JAIA 2WIKA 4YFYA 3FZNA 5K8UA 3X1XA 2XGMA 4TQGA 1GA6A 4CMAA 2Q49A 1V25A 3I64A 4YA6A 3VKVA 1WZIA 1W85A 3QKSB 5A1TA 1YVPA 4IJ6A 3OPMA 4P6VF 1FNCA 4DCVA 3TI7A 3K5HA 3QVGB 3S2SA 3AHCA 1R5JA 3RH0A 1Y8QB 4TTJA 4XVRA 1C9YA 3OURA 4NU8X 2QAGC 4EVSA 1UZMA 3NIWA 5E6RA 1NAIA 1T9HA 2F90A 1SUBA 3G1WA 2XNJA 4ZO4A 1RWXA 4WZBE 3S8MA 3UEOA 2K2QB 4QYTA 4OHPA 4ER0A 5KMGA 1WZEA 1P61B 4BEBA 1L5WA 4CEHB 4RTMA 3DHNA 3HC7A 1DJMA 3F96A 4UXIA 1DOAA 5ILGA 3S2EA 4HFJA 3BG5A 3G5MA 4KEAA 4C4AA 2VJMB 1SKMA 3U9LA 1M5TA 3E9DA 3PXDA 1TNDA 1M9NA 4F8JA 1PV4A 3H19A 1FDIA 2P3OA 4JELA 4URYR 4B3HA 1YZTA 1CJUC 2NUTB 3UMYA 3PA6A 3FGNA 2ILTA 3EIXA 2A8YA 2I4TA 1VMIA 1A9XB 3QMWA 1CLUA 1W36D 2O4CA 2OXTA 5JC8A 5F52A 3ZDCA 2CVQA 2ZAGA 4HMOA 4DWJA 3T95A 3C24A 3CA8A 3C98A 2XWSA 3LPDA 1BXGB 4TVOA 1MD9A 1Q7RA 4KVAA 5KOJA 3WAJA 4CFSA 1JXQA 5IS2A 4B3SB 3UK2A 2HSDA 5JAZA 2AFHE 3HA5A 4IVQA 5JARA 1L8XA 2HADA 5I5GA 5JU6A 1L7PA 3LC0A 3QQPA 3J81k 1T91A 3A36A 4WBNB 4X8MA 1EE9A 3IAHA 3AGQA 3HNPA 2D0OB 3KCNA 3PDIB 2NP6A 2I6GA 2PBFA 3SEZA 4CM8B 4R1UA 4YRLA 5EJ5A 1H4QA 1YJ5A 1IIBA 3WLPA 3R7WB 2QQ5A 5ECGC 1JKXA 1OAAA 2IHJA 2PMBA 3IRVA 3FPCA 4DB4A 1ENZA 4YCAA 4PIMA 4H7PA 3ZQ4A 1EKXA 3KD2A 4BV2A 2E3JA 3KKKA 2ADOA 3MTQA 3T5AA 3OKPA 4R6XA 1OUMA 1B4DA 1NR5A 2HCFA 3WTBA 1WUIS 1YZFA 5T4BA 3HCEA 4QRHA 2OHVA 2QLTA 4I1PA 3VHLB 3QYJA 2OWEA 2R4UA 3B8HA 4I36A 4TKMA 4K46A 1WDKA 1R3DA 2BKLA 2V4ZA 1LXCA 3VR5D 3SS7X 4G0YA 1ZNQO 1A27A 4KPFC 4LRQA 5BYKA 4WCFC 3CTPA 1SBIA 4JB0A 1AOXA 2YJZA 4LXHA 4OB8A 4JXXA 3AVWA 2P2GA 3HUEA 4ML3A 3IUNA 4URXR 5JWRA 3DBOB 2G08A 4I55A 5EWJA 2CJPA 4W7SA 3MQ4A 3R8XA 3EG9A 3I9KA 3OETA 1Z17A 2E18A 2WM8A 3I5MA 1CHNA 4IM7A 2GPTA 4C1NA 5CBKA 3HXTA 5BV8A 3GMTA 4KMRA 2FOXA 3PWZA 5HKKD 4U7GA 4C5AA 1LX7A 4BATA 4ESEA 4TXLA 5BW5A 1HTWA 3QKRA 1AF7A 4PX3A 2AJLI 1HLGA 1H8ED 1CF2O 2F1HA 2HNBA 4AJLA 4B48A 1L2TA 1QCYA 5F98A 5CYPA 1AM4D 3B53X 3T9EA 3THYB 2A9KA 1W30A 3EXHB 1KO7A 1KYWA 4H3KB 4KDCA 5KNDD 2P8JA 2HCJB 2CSUA 2PS3A 4MV5A 5LSAA 2Y4OA 1QPZA 4WXEA 4LZJA 2OKCA 2REOA 3UMBA 4H35A 4OGGA 1V2GA 2RKWA 1KVSA 5IBQA 5K0EA 4MX8A 1TYAE 1UPBA 4TLCA 1ZVVA 1JHPA 1VPEA 2H1SA 2O57A 3DFZA 3IILA 3IMEA 1IRXA 1WXQA 2CFIA 3WGHA 3T8YA 2PSSA 2B25A 2RHHA 2Q3LA 2BF7A 4WDQA 3H16A 2PJUA 1U80A 3WNQA 4RV9A 4MHTA 4K87A 1JQDA 5F1KA 4DV1B 3DBVO 4DR6B 3ZK9A 1XA4A 3OEEA 2KBFA 3BUSA 5K3FB 3EW9A 2PPLA 3EGOA 3CZAA 3B9QA 4RGBA 5KO2A 4GGPA 4DXAA 3X2FA 2I65A 3M49A 4LX8A 8LDHA 2J0UA 2PMDA 2NACA 5I7HA 3N76A 4YAGA 2BDEA 1ZNXA 5EYPB 5KDLA 4XTRA 4BKRA 1DT3A 5B1YA 1TRKA 3RFUA 3MM4A 4KC0A 3VZSA 5EJ7A 2CY0A 2O8FB 2ZIWB 2VF2A 1MA0A 1U2DC 1ZJ4A 3PXAA 4RE5A 5K1ZA 4HAXA 3RU2A 1MOZA 3ZGOA 4B73A 1X9IA 2PT9A 3Q6NA 3QFHA 2K2WA 3C85A 4W8GA 5LB2A 4RK7A 2LGJA 2GN2A 4M76B 4TVSA 5IASA 1DJQA 4PGMA 4ZYXA 3BE5A 4PZ0A 3FZGA 3OQBA 2PUBA 4LFAB 3FLEA 4JKIA 2NUPB 3ZE2B 2Y0BA 2PUAA 4CF4A 4NQRA 1U3DA 1YR2A 3NKLA 4G8BA 1N0IA 1NMSA 1SVMA 1VPTA 4MRPA 1RLJA 3VI3B 5JADA 1L4KA 4PQEA 1YACA 2GA9A 2DOKA 3RJTA 4CPDA 1JKJA 3PEEA 3TCXB 3ECAA 4CKEA 1XZMA 4TLAA 3RRXA 5GZ1A 1NPYA 2IOFK 4E22A 3TGPA 5THQA 4I4LA 4OLJA 3ZDAA 3D5QA 3NQ41 3MGKA 3P2OA 3GIDA 1IQUA 5C8XA 1N92A 3ICPA 1U2ZA 2ZI3A 3I42A 5MGBA 3TAXA 2IY9A 2W2KA 5D5QA 5AW7A 1F2TB 1EFPB 1Y7LA 5JTTA 4WNAA 3RYHA 2H0RA 3BOSA 3QI2A 5HRUA 4H1UA 5EZYB 3PEUA 1EJ0A 3GD5A 1KYIA 4M21A 3LSTA 4A15A 3JQRA 1CZRA 1Z4JA 3MYRA 3UXYA 3P2KA 3W6UA 4NK5A 2QW1A 3BE8A 3NUZA 4D9KA 5MDHA 3VU3A 3WOHA 4EW6A 2HA2A 2UUOA 4G8CA 5G4LA 3VX3A 3MOSA 1P8AA 1QVVA 1AHNA 9MHTA 3TVTA 4KH0A 2C5FA 1WQ1R 2C7VA 3O4JA 3MLBA 1IUOA 2ODAA 4BFVA 3A9CA 4ZZIA 4HDOB 1Y82A 3U48A 1P1HA 3TM5A 3U9SA 1RAAA 4X93A 2CLCX 3AM5A 3C3WA 4NEQA 2BHTA 3KWLA 4OGWA 4GOJA 1J8VA 2A58A 4RCVA 1NUPA 5AVKA 1JE0A 4NU0A 1JQKA 5EIAA 4EKDA 4DA0A 3GT4A 2VDKB 5DWDA 1PUJA 4GC9A 1BGVA 3EQZA 4BEVA 1UM9B 1A9SA 4GMXA 2NUAB 3O84A 1IZ7A 4DZTA 2GH1A 3IBGA 1UWVA 4LHEA 4LC9A 4N0MA 4RIEA 3AF2A 3HRKA 4ZZ3A 4MPTA 3GCDA 1G66A 3M7IA 3MRTA 4C7BA 1XPOA 2M32A 2Q6OA 4DREA 2B4AA 4NHOA 2CLFB 2W4MA 1XX6A 3HEAA 4YJHB 4IGAA 4AY5A 4BPRA 3BB1A 3VJKA 3I6ZA 4B3DA 4JOQA 2PZKA 4OO3A 3WL5A 4OYRA 3E0XA 1R4AA 4NENB 4O2LA 4OK5A 2W83A 4JLNA 4WEOA 3SYRA 5LFAA 1VMKA 3HM2A 1GL3A 2XODA 4ZI5A 4OB7A 5CJ2A 4YAEA 1KZ4A 3LF4A 1JX6A 2FWBA 2NVWA 5HF9A 5BR1A 2WOJA 4B4WA 4Q3KA 2O2CA 2QN7A 4OFWA 3G0BA 5K0TA 3A10A 3AJEA 1VIMA 4OI4A 1C7RA 5IF9A 4DV4B 3DOCA 3PQ2A 3FYCA 1KZ7B 3K0HA 3OY2A 3UFXA 3ZI7A 5LYJF 4XCQA 5M5BA 2WFLA 4RZQA 3VGJA 4JC0A 5ITVA 2OB1A 3OEED 1LSOA 2VHZA 4IW3B 4MRVA 4OMUA 2PLAA 3HLYA 5B3JC 1QIMA 3RWBA 2X4DA 4AP6A 2ZI4A 4HTFB 3HP1A 5IPFA 4LCJA 3A9UA 4HXEB 1DAKA 2GF2A 1JSRA 1U9CA 3UMRA 3GJ7A 3T94A 1O8BA 2YFYA 3L8MA 4XIIA 5C3UA 16PKA 3HJBA 4ZCTA 1ZWLA 2R6AA 1L4YA 3AIIA 3TSWA 3KOOA 2QNIA 3BWCA 1TCAA 2HLPA 3FCCA 1R8QA 4RACA 3TR0A 1LBEA 4I9UA 1Z6TA 2PNJA 3G2IA 3W7AA 2GT1A 1SVKA 2VDMB 4A36A 1NVGA 1NRIA 4ZAVA 1F06A 5I9MA 4QDUA 4AURA 2JBAB 2JJYA 2QL5A 3ROZA 1CKEA 4N6OA 3UAXA 1KEKA 3KFLA 4NLLA 1GKYA 1OLXB 2C0PA 3RUIA 5ALHA 3V1LA 4ZEVA 2VQSA 2J5KA 2ZFUA 1PJ3A 2FQQA 3TLEA 4J3FA 3THRA 2GXAA 3L06A 3ZWMA 1TRHA 4O4LF 3PEWA 4Y3UA 4DYDA 3W4KA 2PMWB 1KMHB 2IJGX 2A0YA 2OKGA 1ZSNA 1J24A 2JAPA 1Z13A 4FYPA 4NBVA 5JCOA 5IAOA 5E3HA 3AL3A 2C97A 4BGEA 4CUZA 3LC7O 3NC1C 5JE8A 4PYJA 1RAEA 4JI6B 4D80A 2JIMA 2IIBA 5JBIA 4FDUA 1OLSA 1U0LA 2BVNA 3W6ZA 2OCKA 1EM8B 5HZMA 2GZAA 5I7WA 2RGNC 5GPBA 3DZCA 1KKMA 3LBAA 2XW6A 5LZ4A 1XZBA 4UU7A 5JVDA 3GP8A 5IZCA 1GUBA 4K9SA 1Y3AA 4INAA 3P9SA 3SFTA 2ADMA 4FMDF 5IKXA 1ZXBA 1V6AA 3FWNA 4ZRNA 4F11A 4K6MA 3SPXA 2P1DA 3DKPA 3MWDA 1PW5A 2CKMA 1B74A 5LQNA 1CP3A 4I5FA 1Q15A 2RHMA 1I24A 4AMBA 4EUNA 1TCVA 3DFKA 1XNRB 3VPSA 1OV4A 4BO9A 2CV1A 1I6WA 1OYVA 2NO1A 5CTAA 1ECBA 1WZCA 2C88A 2FSVC 2W8ZA 4EARA 4PTYA 3ZHSA 4F3YA 3LLUA 2VXOA 5L7YA 1DT5A 5AP9A 5FRDA 1YB4A 2V55B 1NLUA 4WT7A 3ETCA 1B1CA 5SY4A 4CV2A 4MQMA 2LW7A 4QDJA 4W9NC 1W5EA 2BBSA 4IXNA 4DWOA 1G17A 4YT5A 2NU8A 2HA5A 4I6JA 2EBHX 4E5UA 1L5OA 1Q0HA 1WLSA 4QWWA 3U16A 2GKSA 4IWYA 4GX1A 4FD3A 2MMCA 3QENA 3TQRA 5C8ZA 4MMYB 1XTKA 1DOZA 3PFKA 2P3SA 3D7SA 2RHOA 1KA9H 2ECKA 2IYTA 3L79A 4EZBA 1P5JA 1BXRB 1L7EA 3IKVA 5HIMA 4D3SA 2JFQA 1TTHA 3A37A 2A0KA 1FFBA 1YI8A 3T12A 3QPVA 2QN6A 2L2QA 3TBFA 2J9ZB 2D5AA 1AS3A 1N5LA 3DCYA 3LBYA 1UJ2A 4MW0A 3GG2A 1ZK4A 2JGDB 3BJRA 4YJGB 5G4KB 4B46A 3RFFA 5B7GA 1GFSA 2R9VA 4BFTA 1CZOA 4FFOA 3FSRA 3RRNA 4CMBA 1JSXA 1SK8A 2IE8A 2OZLA 1UKVY 3I62A 1IY2A 1DEKA 2F62A 4Q9IA 5FO1A 3K1TA 2WK1A 2GM4A 1IU9A 4A73A 5CFZA 3KAQA 1HL7A 1M2GA 3L6BA 2QROA 3PR1A 3EGIA 3RSCA 4BV3A 5KQGA 3ABQB 1CJCA 1DO0A 4LTNA 3VSEA 4QDZA 4BQOA 2JJQA 1JHZA 2GZMA 3H87A 2GSDA 4NYIR 1SKYE 2DJ5A 2EZ8A 3AUTA 4WUVA 5DW3A 2R4TA 2AMLA 4E7PA 4U9IS 3V1MA 3LQYA 3RJ9A 3PQ8A 3DP9A 2A7QA 4MR8B 2X9LA 2ES4A 1EAYA 3P7MA 5CXSA 3EHEA 5JOQA 3FMOB 2NSJA 1ENYA 2X6QA 3KSDO 3ZEAA 4MV7A 4AS2A 4E14A 1GPNA 2BFMA 5GVSA 2QTBA 1JLKA 1P17A 4HYEA 4WMLA 4GS5A 2X5JO 3GLIE 4WY2A 3M6FA 1Q3KA 3I9LA 4MVJM 1NIPA 1Z7GA 1I32A 3I9FA 4N82A 4HDNA 5A4MS 3ZCSA 5BSUA 1J9EA 2H00A 1ACJA 2GCIA 3E22B 5J4VA 4KXQA 1QIFA 5ITWA 4EPXA 1YE5A 4JFAA 4J0HA 2WJ4A 1A4RA 1M2VA 2ZRKA 3D8HA 3JWIA 3KPJA 2X15A 4MI6A 3SHTA 1QIEA 5JEEA 3HL0A 3ZU3A 1N5RA 3AUFA 3BCSA 4QTYA 3EJWA 4D9NA 3RSGA 5JI3E 1KR2A 1JXMA 1L3CA 3B1XA 3BD6A 2QDXA 4JJAA 2WM9B 4CKBA 4FR5A 4URVR 3PYMA 3K4PA 2Q29A 1MF7A 2FN9A 2AOUA 1VLVA 2RAFA 3DTTA 1RM4A 2JGIA 5FOVA 2HJSA 2Y6VA 3WHPA 1HKUA 4RHUA 3WKBA 4CDRA 4E12A 4EGCB 2IW3A 4Z8XA 1V35A 1DC5A 4KOAA 2VRWA 5FWDA 4PYMA 1T3LA 4UM9D 1DIHA 1A2KC 1XDBA 3KOWA 1T25A 1XD9A 5CVJA 3ZLUA 3PFNA 3TECE 4GL2A 1QIDA 5CH3A 2VS1A 3SE0A 4HX9A 4EY7A 3IE2A 1PJQA 2EIXA 3O8OB 4HQLA 3HXKA 1A8PA 1MJNA 2D5BA 3OUTA 2P67A 4WESB 4BKMA 4A0HA 1C7JA 4QYWA 2W2VA 4UU1A 2JA2A 4S1NA 1BSVA 3SZLA 1TM5E 4CMHA 3L1IA 4WN9B 4FR2A 5AM1A 1Y6ZA 2IPLA 3BCUA 3HBLA 4IKOA 1HM5A 4KUHA 1J00A 1G9XA 4MR7B 2H63A 3G17A 3HMKA 1NMXA 3JQDA 3OPQA 4HQRA 4R1QA 2Z0MA 3RU9A 3PEFA 4RSHA 2Y0PA 3DFIA 5IC4A 4TYPA 3R23A 3NIBA 3ZWOA 5EP4A 1BEEA 2GO7A 1KQOA 5LNK1 5AM3A 2CNBA 3DKRA 3LQFA 1JHQA 3V5NA 3PWSA 7REQB 1OASA 1B26A 3KS9A 3PXBA 3HVIA 4N0DA 1KETA 4ZO6A 2I6UA 2DBQA 1NF2A 4R3NA 3O94A 1ZUD1 1Q84A 4QXRA 2MR5A 5LQDA 4NBWA 4BMNA 1TCBA 1ABBA 4BNTA 5ALRA 4R7GA 4XJTA 4CQNA 1H2HA 4N3NA 1CQIB 2AEMA 3IAXA 1ZKDA 1DG1G 2PS0A 3U4QA 5ICFA 1QV9A 5LDHA 5C5CA 3UXMA 1FMCA 2OYRA 3VDQA 3I9JA 3B89A 5J2TF 4FWBA 4HNVA 4O4IB 4BIIA 5AK5A 2GJ9A 2FQYA 3ADOA 3WIVA 3K1JA 1GZUA 1H8HA 2BAGA 3JQ7B 1U0SY 1JFFB 1EDBA 1TJYA 2EC5A 3AC0A 3MWLA 2Q4DA 2YRFA 1XMOB 4BXOB 4NCBA 3AHGA 3O3CA 1APBA 4EUHA 1EUZA 2J31A 5LOVA 3ZXYA 5K6AC 1MP0A 1N3BA 2DHRA 4DSAA 5IX8A 3PFIA 3QMMA 3E6AA 1QRAA 3LPNA 4MWOA 4JX8A 3W5UA 1Q19A 3Q8KA 4A5OA 1JYSA 1VCIA 2KSQA 2ODTX 1N2EA 1HE1C 3ZHBA 9GPBA 4KFUA 3O8QB 3PKIA 1UWCA 4BVAA 2IS6A 4MI1A 1GG9A 1AKVA 4XSHA 3ZZMA 4JP1A 3OFSA 2BR4A 3OA2A 5BNZA 1TJ3A 4X7RA 1E6MA 2XDYA 3LUFA 3SSOA 3F67A 1TL7C 1RR6A 1FXWF 2J3MA 4EP1A 1QLWA 2J3EA 3Q9NA 3MCZA 2N75A 2GBIA 5I9BA 3SSAA 3UMJA 2A1IA 1CYDA 3A9SA 3ILHA 2QVBA 4GBGA 1Q1QA 2CJYA 3H5OA 2QTGA 3ZU2A 4XUCA 3G9QA 5HXAA 2AJ8A 2F64A 2Z9DA 3BXGA 3LUBA 1E2IA 4XX1A 4JCCA 1YB6A 3ZCQA 5FB3A 2AXNA 4GKVA 3GH1A 3N2GB 1XA3A 1A04A 4EK9A 4KN8A 3CPHA 1YZKA 1F2VA 2P1ZA 1LPSA 4B7AA 4TUYA 5FJIA 1Z6PA 1LPNA 2Y0CA 2JCBA 3E58A 3TW0A 4AJHA 3GJ4A 3I53A 3BBPA 2IL1A 4DC9A 2XGGA 3BHNA 1Z0FA 4M9XA 3DEHA 4IXJA 1WKCA 3GP3A 3LQ2A 3OHSX 3QUBA 4G0PA 1M75A 2IVFA 4QOEA 1C9NA 5F4BA 3W9YA 3QOYA 3UYKA 4JLJA 10MHA 1GPWB 3RPEA 1NTOA 3WL6A 2QVXX 4N9QA 4FB5A 4DV2B 3CZRA 4KJXA 1XMXA 4LBZA 3TYXA 4CT0A 4CYMA 1ZICA 4YRAA 2CL7X 5K7SA 2I78A 5B12A 2V7UA 2RIRA 4YV0A 3F73A 4UDXX 4F6LA 5H7XA 1BTOA 1A9RA 3N53A 3IJ5A 4YJ3F 1JLHA 5FO0A 3L7BA 3RIEA 1C7EA 2H1VA 1JEQB 2XCUA 7MDHA 4ENVA 5IM5A 3UHOA 1IPHA 4B3FX 3RRZA 3I9NA 4RLQA 5TMBA 1IL0A 2UUAB 2QG4A 3X1ZA 2GCPA 1QE5A 1KIMA 1Q6ZA 4F60A 4A2PA 5AJTA 1ZH0A 1U1DA 3LBNA 3ZV5A 1U5BB 1FK8A 1SOUA 4ZRMA 2EF1A 2P4HX 4PPFA 4GBED 3RF6A 1YVEI 1PQWA 5D85A 3OIGA 1F0PA 2ZUVA 3K0FA 1X7GA 2CLLB 4OHWA 3H1GA 4GNKA 1RWVA 2W6QA 4PXYA 3E23A 3CYFA 1JTVA 4NNOA 3ICQB 4LZPA 4WH0A 1WVIA 2GQ0A 4HGYA 4YYZA 1FRZA 4RMNA 2PQMA 4W5TA 3GUYA 5EG5A 1GQQA 3D2CA 5L3SA 4FT2A 4YVFA 2CNNA 4HWRA 1KI7A 4PSVA 2R8ZA 3T5TA 3WLMA 4EMTA 1WXIA 4ZOQI 3QUSA 3NHWA 2NZWA 4RM2A 3NDRA 1O0BA 3A6ZA 3G9TA 4MZDA 4WV3A 4EFLA 2V7WA 3MK31 5JYBA 4JEIA 2ECOA 1PD0A 4YR9A 3PPXA 1MAUA 2WWYA 1W48A 2O05A 2C4NA 3T1OA 2V54A 1QJ4A 1XZJA 3RTDA 3L8EA 3SBXA 4UHHA 2OZKA 3SQOA 3GRCA 3OE5A 2WTNA 4LF9B 3UPUA 3GWZA 1UBJS 1Q92A 1T9DA 3GL9A 4KQ2A 5ES4B 3NHJA 5FV7A 3U4MA 4QICA 1Z88A 1ZWKA 4LOAA 3S3TA 1ZA1A 5I9LA 2PKEA 3PDCA 4JJ8A 3FNRA 3R9KA 5CX4A 1SD2A 2V7EA 3X2EA 4OIFA 4GYKA 4S35A 1QVWA 1WB5A 1Z63A 3A11A 4P4TA 1ZD9A 2HWUA 1IPFA 1MH9A 4OHZA 2A3NA 1SQFA 3G5LA 1OBCA 2D74A 1RIIA 5EXEA 4PM4A 2WYIA 2O0HA 1Z5VA 4QPJC 3B2QA 3SC3A 4I08A 4XGKA 3FNQA 4K7JA 1O6GA 3RQSA 4TKLA 3TF5A 4FMDB 3GJRA 4HLDA 2IE0A 3X1JA 4C5BA 4ZYUA 3AF6A 1RXYA 2UAGA 3FDZA 2FY8A 4KR0A 3FOAA 4WWHA 2M1XA 3ESAA 2ISCA 5JZOA 1LLCA 3CM0A 3MFQA 3PEVA 1H22A 3SM9A 3R3ZA 4G0MA 3ZW9A 4J2TA 4JYPA 4YT4A 4ZVUA 2W6JA 3ZE8A 5JNUA 2QW8A 5ALMA 2A0XA 2E5LB 3SQWA 2F3RA 2XF8A 3MWFA 4PZDA 2VDRB 5BVGA 5A0VA 2ZCJA 4ALIA 4UHBA 4DCUA 2RHBA 3PUZA 2GDJA 3VTFA 3VPXA 4RMHA 5FUBA 1UL1X 2QD4A 1R0CA 2DBVO 3QZUA 3NAMA 5H16A 4WASA 4JBLA 3T7CA 2B34A 3DCIA 3WWCA 1WHTA 3NWEA 1KO4A 2YOHA 4BX8A 5TGTA 1TUEA 1H0HA 1E8DA 1R66A 2WSSD 5CA0B 3JR7A 3CZQA 2H7CA 2C7RA 3KHTA 4P2BA 1D0IA 1XA0A 1HLPA 5KSWB 1AQUA 1MEOA 2BEWB 3DW3X 2J33A 4FN5A 2C4MA 4LQDA 4M86A 4B75A 2BFNA 1IQPA 3SF8A 3DDUA 3EXFA 3ZCTA 2WUFA 5B1EA 2H51A 1TF2A 4ZOLB 4TWRA 1H2WA 2ZR9A 3IFSA 2DM6A 3JD0A 4C03A 3CMMA 5EHIA 4XE5A 3U4DA 1N6OA 5LP6C 3TNFA 1D6MA 3G59A 1E3JA 1F2DA 4U8GA 1HYGA 3Q4GA 2BM0A 4FX5A 2BONA 3L7DA 2KJQA 4GDFA 3GB9A 3FBTA 1RQPA 4E33A 3LNTA 3GOHA 3OZVA 4Q3DA 1UPFA 3BSFA 4TYQA 5G1NA 5CURA 2Q3CA 4R0VA 4A2QA 3PQ7A 3F5SA 4M0LA 2RETA 4DM7A 4M37A 1OXVA 4B83A 1P0CA 3IR5A 4FMPA 3M6MD 3HZHA 5CM2Z 4JP3A 4ER5A 1K7YA 5KZMB 1DXQA 1F17A 3BD7A 5HTKA 5BNFA 1ORIA 2R65A 2P6PA 2BRUA 3REOA 4EGJA 3GYGA 2O6LA 5FBVB 1TF5A 2Y9MB 1DAOA 4YI5A 2JHCA 2QXUA 1L5HA 3PXEA 3ZXIA 2Q21A 4ENSA 5IKPA 2DEUA 2YJ5A 3PNBA 3ECSA 4XQ9A 1MGPA 5AKJA 1QHNA 2YINC 1XRJA 4PSUA 2RGXA 2AMFA 2PX4A 5EKUA 2IZ0A 2QQEA 2C00A 3R3JA 4OQPA 4IVPA 4CN9A 1Q12A 1LBTA 2C5EA 3LQRA 1DQNA 1Z12A 4RLHA 5CIWA 3ZV3A 3KFXA 2VZ9A 2QZZA 3NS7A 5I7AA 4HZUB 1D7OA 4HS4A 4PG5A 1UXJA 1M72A 5AJUA 1KYVA 3EUFA 4S04A 2O3TA 1YQWA 3KQLA 4IP0A 2FN4A 3QIVA 1T4GA 5HJ2A 3AH8A 4D98A 3HPRA 1PHPA 1SG0A 1T0JB 4ZT4A 1FPQA 1I2MA 2PX6A 4R8LA 3O38A 3SKXA 4EAAA 3SBEA 3RHTA 3SEFA 1EWVA 2J85A 1LVUA 3CG0A 1VP3A 2GCEA 1X39A 2V6BA 4LC1A 4QASA 1C1XB 3SLGA 5KVCA 4PVDA 4GAEA 6NULA 3ZDYB 1DRKA 5HFJA 3TW8A 3WGTA 4OAQA 3WYNA 3ZCVA 1FZTA 3ORSA 3VU0A 1NU6A 4DMMA 5HKOA 3GPLA 4EA9A 1E63A 4HNUA 1VKJA 4KR6A 1FBNA 5IF3A 1EFKA 4F1JA 3E9ZA 1KBOA 1V4BA 2EU8A 2CBGA 1EWKA 3NDPA 3PDWA 4NU6A 3K4QA 1DJPA 1TK2A 4TS3A 4B3BA 1JG4A 2PX5A 3KXIA 3KZVA 3NPAA 2DQ4A 4IILA 2XQGA 2O07A 2WWHA 4ZT3A 4H59A 3R3HA 8OHMA 1FTWA 1T9GS 3LY9A 3TTVA 2Y66A 4JS0A 1F51E 5BMOA 3GW8A 3IVMA 4OXYA 3T15A 2QN3A 3D4LA 4NC9A 2CNOA 1N5OX 5ALPA 3R3UA 1KEZA 3ETJA 1V4VA 2UKDA 3IAAA 1GNVA 1VCMA 3MTGA 4W5NA 3Q87B 1DDIA 1R0XA 2HHHB 4BLSA 3FJOA 3HL6A 5EP2A 3NVKI 3RS8A 2Z9BA 4NMMA 4IVNA 1MPTA 3ZE9A 2OE2A 5C8VA 2QMEA 2RKBA 2ZUCA 3QPAA 1JB1A 5IT9A 1VBNA 5T4EA 4K28A 4XQ0A 3TKLA 2CLMB 1MPXA 1OF1A 2WYHA 3O3MB 3EGXB 3LCRA 2O3SA 4HDCA 4E2ZA 4EL5A 5ALVA 1SXQA 3I92A 2DFVA 1XIVA 4AY2A 4BBJA 1X7YA 1T6NA 4XYEA 1NUHA 1IM8A 5HM8A 4Z53A 1X9GA 5CFPA 1N5JA 4QLBA 2CL6X 1YZGA 5DNCA 2B83A 2NV2B 3M6VA 3LBFA 4GPIB 3V8BA 5JNRA 1LI4A 4UBIA 1ZXXA 3Q8XB 3MILA 2HLDA 4X20A 4YYEA 5JQGF 1DQYA 1Y9DA 4ZVNA 1I1HA 3A1DA 3PS9A 3I2JA 1GZ6A 4FE3A 3KJHA 4IH1A 1VJ1A 1GCUA 5DTQA 3CBQA 3HLTA 1GA1A 2LCQA 4FP9A 5F21A 2WWIA 1U8EA 1IEQA 4CLRB 5A3JA 5KTTA 4B4DA 2BMAA 5LMZA 3G79A 4Y6QA 3IPRA 5K0ZA 4DLRA 4AP5A 4A3SA 1CEEA 3VC1A 2P5YA 4R8MA 3SZUA 5IW8A 3R3WA 3M1AA 5AHKA 4P0TA 2B37A 5BUZA 5AKXA 2HZBA 4NR0A 2M6RA 1KEEB 3PUYA 2XH8A 1E60A 3IEUA 3ZY6A 5DI3B 4AZ0B 1WTCA 3ECCA 1AXGA 3U4HA 5AUNB 3KUXA 2LKCA 1LW7A 5KVQA 1TT5B 2ZRPA 4FCWA 5HF8A 1ULUA 4A6PA 1YCDA 1S2NA 2OZEA 3Q3CA 1X1TA 4EABA 3D0RA 2YKGA 3SFZA 1Z0SA 2BPOA 2HK9A 3GA5A 3MTBA 1IC6A 3CR3C 4TV8F 4W1PA 5IARA 3IUBA 4CLEA 1DO8A 1M8JA 3UUGA 1KS9A 1ZXLA 1WMDA 3M89A 2VLBA 4YCDA 1CY4A 3AFHA 4R1OA 5LWHA 3CG4A 1GIAA 2HRDA 2NYUA 3LAWA 3LRTA 4MQEB 2B3DA 2C31A 3C8ZA 3H1TA 5DYGA 1NBHA 2Z5FA 2ZS7A 3R3SA 1V48A 1QKKA 5JLAA 1XTVA 2HUNA 3PFBA 1EA7A 5TX7A 2R751 3RC3A 1Q7EA 3U4CA 4AF6A 5JMWA 4GOND 4V0LA 1W5FA 1H3FA 4J7XA 1Y4AE 4B1FA 4BLQA 4RA9A 1KPGA 1N7GA 5KYGA 2WHEA 3QVKA 4GSYA 3RS7A 2EL9A 4RAQA 4RY8A 2PBLA 5G0SA 5K0FA 4J2OA 3AI7A 3EPRA 5LYJA 4F2HA 4B8YA 4E7OA 2CXRA 1C80A 2AYZA 1LV7A 2PXHA 4NNPA 1TC1A 2HAEA 1GO2A 1I01A 1OCEA 1T8PA 1TVMA 2ACKA 2B1GA 2VAPA 3C1AA 3KUKA 1PDVA 3Q2OA 1NYQA 4FZJA 4H18A 1KI8A 1FP4A 1ZJ6A 3MRXA 3RSOA 4WK4B 2CVFA 3UTCA 5H9WA 1QTIA 3O47A 3U56A 4EHNA 4RTOA 2KI5A 3D3WA 2P1RA 3GRRA 2NN3C 3EBLA 3ZBUA 2ABWA 2ZE6A 3IUSA 3P2EA 3BB4A 3P5SA 1XNQB 1UQUA 2ID7A 3HBAA 3KAPA 2J3JA 1UPCA 3X0DA 4EHDA 4G0WA 1RU3A 2WICA 1P7ZA 3PC6A 4MO2A 4BHTA 4DGQA 4Q05A 4NDAA 3AF0A 4RIGA 2NXJA 4IUYA 5JSQA 3KLNA 4UAVA 2HXSA 3VJLA 5ICMA 3V3KA 1XB2A 2PVSA 2BZ1A 5EIWA 5B57C 5CNMA 1U1IA 1ECFA 1P44A 1EB8A 4Z4GA 3EWAA 3NGXA 4EHFA 3ELYA 2WJYA 1TUIA 2I91A 4PZCA 5J5AA 1L5VA 3QVXA 2J41A 2Y99A 1G64A 1J21A 2QD2A 3G9ZA 4JLUA 3O83A 1HE2A 3AJ9A 1WMAA 5TC4A 4O4LA 3DPSA 1K6JA 1DXYA 3QUQA 5KTMA 3KUCA 3N8KA 3BGSA 3M3HA 2JD0A 3CN9A 2I2WA 3ZWVA 3VR2A 2YASA 2RGCA 4L9RA 3L93A 5DF1A 1L9XA 4BASA 1XZCA 4PC6A 1E0KA 1HC7A 3HYSA 1H2ZA 4PQGA 4CM4B