1N2OA

Crystal structure of pantothenate synthetase from m. tuberculosis, low occupancy of beta-alanine at the pantoate binding sites
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
286
structure length
279
Chain Sequence
PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a pantothenate synthetase from M. tuberculosis and its complexes with substrates and a reaction intermediate
pubmed doi rcsb
molecule keywords pantothenate synthetase
molecule tags Ligase
source organism Mycobacterium tuberculosis
total genus 93
structure length 279
sequence length 286
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2002-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 1n2oA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1n2oA01
2Z3VA 5TS2A 2TS1A 1QTQA 1J70A 1Y42X 5IHXA 3COVA 4FZJA 1N3LA 2A1UB 2HMAA 1ULHA 1TFUA 3CLUD 1M8GA 1KH3A 4U7JA 4YP5A 2V0CA 3ZIUA 4PY2A 2VTBB 1YULA 1PFUA 1OD6A 4S1OA 1JZSA 1F9AA 3AFHA 1EFPA 1VBNA 3FI0A 4MW2A 3ISJA 1TYDE 3CVWA 2J09A 3PRHA 2CYBA 4HPWA 5HG0A 4L2IB 1YUMA 4RUKA 4DDMA 3VGJA 3INNA 4UZFA 1MAWA 2D5BA 2J07A 1O95D 4HJXA 5DK4A 5FO1A 2IJGX 1COZA 5LFAA 1S4MA 3AG5A 1F7UA 1DNPA 3ZGZA 1O94D 1WXGA 3PNVA 4EG7A 4ZT4A 4MUIA 3UOWA 4I6JA 3OTWA 1J21A 5TEWA 4XFJA 3S3TA 3QTBA 1KQNA 1OWMA 4ZCSA 4NAUA 1JMVA 4DJAA 1N2HA 2DLCX 1GAXA 2O5RA 3KT6A 1HYBA 1QNFA 2PZAA 3LCJA 3FIUA 5EKDA 3TQIA 1M83A 2QUIA 3RK1A 2GKSA 3ILVA 1I2DA 1I6LA 4MW1A 4I6EA 1M8FA 3P0JA 1NYLA 1KH1A 4EGAA 3PNBA 3NBKA 4MWBA 2ZUEA 3UK2A 4ZT2A 4U63A 1N2IA 4AQ7A 3P52A 4MUFA 4Q16A 1U7XA 2DETA 4ARCA 1K4MA 3IH5A 1QRTA 4DNXA 2YWBA 3FY4A 3OP1A 1MB2A 2E18A 3JXEA 3TNJA 2RD2A 2DXIA 3KT3A 4J76A 2CT8A 4JXZA 2E0IA 3SP1A 1JIKA 3FDXA 3FHJA 3I05A 4GRIA 3PXUA 4MVCA 1QJCA 3CVUA 2DUMA 4R2LA 2A1TR 5F23A 4KKVA 1GN8A 2IP1A 5DASA 1KH2A 3Q4GA 2WSIA 1LI5A 4GU5A 2CSXA 4CT0A 3L92A 3E27A 3FWKA 3HFJA 1PG0A 1KKUA 1JEEA 1TYAE 3GMIA 1M8KA 1U7DA 1OWLA 1MJHA 4DLPA 1TQ8A 5HUJA 2QJTA 4TS1A 2OQ2A 3CLUC 4ZT5A 3CLSD 4H3SA 2I1LA 3LE8A 4ZT3A 3N9IA 2CYAA 3K9WA 1K4KA 3H9CA 3TZLA 4CDNA 1YIAA 1QRSA 4PBSA 1KR2A 3Q10A 2Z09A 5H7XA 1OBCA 4BWVA 3SEQA 1K92A 4MWEA 1R6XA 3IVGA 3PNYA 1MB9A 4PBRA 3RFFA 5K0TA 1O95C 1N75A 1N2GA 2PZBA 5J5AA 3SYTA 3VU8A 2QUHA 1PFVA 2H29A 1EUYA 1N2EA 2ZUFA 1T9GR 3DO8A 3P0HA 3KFLA 1VL2A 2A88A 1T6XA 3CLRD 3CVVA 4YMIA 5K0SA 1NZJA 3N05A 3SEZA 3HL4A 2AG6A 4MW9A 4MWCA 1MC1A 1H1TA 5DB4A 5TEVA 2XRYA 3K32A 2EL7A 3ZJVA 1JILA 2CV0A 3X1JA 4MVYA 4K03A 4JFAA 2NSYA 1R6TA 1F4LA 5HUHA 5IJXA 1JHDA 3IOBA 4EF6A 3MLAA 4G6ZA 4NATA 1O6BA 3AKZA 2PXHA 2ZP1A 4MULA 4OJMX 4ZCTA 4JZYA 3X1KA 1EFVB 1JZQA 2D54A 3MXTA 4MUGA 1WOYA 3CVXA 1J20A 1IQUA 1MRZA 3GUZA 1NUPA 3ND5A 4MUEA 2XRZA 2DR2A 3SZ3A 2A86A 4Q93A 2X1MA 1MOPA 1TYCA 3COYA 1H3NA 5DEOA 3C8ZA 3ND6A 3IDFA 3IMEA 1M8JA 3P0IA 1JIIA 4MUHA 1N2OA 4G5YA 4CDMA 2A84A 4ARIA 1K97A 3ZXIA 1N1DA 3NV7A 1EXDA 4A91A 4XFDA 2A1TS 5H16A 2CV1A 2PIDA 2VXOA 1IRXA 4NDAA 3IVCA 2D13A 2JAXA 1JGTA 1OWPA 1GPMA 1ZH0A 3MMXA 4YP7A 4ZCQA 1WXIA 2QUKA 2DEUA 1KQOA 1N2JA 1EE1A 3ZJUA 2WB2A 3IMGA 4MW6A 5LLTA 1O97C 1O96A 1I6MA 3QTTA 3FG9A 2HZ7A 4NAHA 1O5TA 3U1VA 3VRHA 1XNHA 1Q15A 1H3FA 3GLVA 4ZCPA 2YY5A 3RHSA 4ND7A 1FFYA 1LW7A 1ZH6A 1EFPB 3H9BA 2EJCA 1IVSA 1VBKA 1WKBA 2HGZA 4AS1A 3ZUGA 2YWCA 4F3RA 3DPIA 1JECA 2JA2A 1KP2A 4EG8A 2QJFA 3IUBA 4MUKA 2RE8A 2J4DA 1MBZA 4UZEA 1XNJA 4MAFA 4MVWA 1T9GS 2WQ7A 1IQ0A 3M5WA 1NURA 1KAMA 1NUUA 2X0KA 1KORA 4MVXA 1G8GA 3D6UA 2O8VA 1N2BA 1GLNA 2OV4A 4ZCRA 2G36A 3H05A 1QRUA 3Q12A 4KPUA 4EG6A 2PFSA 4J75A 2PZ8A 3TZEA 4EG4A 1KQPA 3RBAA 4MUNA 4MW0A 3FOCA 1R6UA 4F4HA 4ZT6A 3DV2A 5KCMA 1WQ4A 3D6VA 2A7XA 3AG6A 4HK4A 4MLPA 1ILEA 1O94C 4EFKA 3NBAA 5JBNA 2AKEA 4R0NA 2QTNA 4WSOA 1B6TA 4OUDA 1WXFA 1J09A 4QREA 3N8HA 3SZGA 1KAQA 1GTSA 1BS2A 2H2AA 4DDKA 1JEDA 1J1UA 1XJQA 4WNYA 4EG1A 2GM3A 3G6KA 4U8HA 3UC5A 3IOEA 1EUQA 4NX2A 3COZA 3HGMA 1TEZA 1U3DA 1VLHA 1GTRA 3CLTD 3QE4A 1J1ZA 1NSYA 4PBTA 1RQGA 3CR8A 4RPIA 1V47A 2AZXA 2CFOA 4ZT7A 1G8HA 4QRDA 3SDBA 3H97A 4HJRA 3N2YA 1ZUNA 1OWNA 3A2KA 3UY4A 1G8FA 2QJOA 2CUZA 2CYCA 3TQOA 3IVXA 1V8FA 5J58A 1MAUA 3KT8A 1F7VA 4DE5A 1M1ZA 1PG2A 2DPLA 1ZJWA 1N78A 4KR9A 1PFYA 2V0GA 1O96B 1VBMA 4ND6A 2A4MA 1WXEA 3G59A 1WJGA 4CQNA 4X0EA 4DDHA 2YXNA 2JANA 1X8XA 4MUJA 3BL5A 4MWDA 1NUQA 2A1UA 1TYBE 4YBRA 3COWA 1GZUA 1X6VA 1CT9A 1WXHA 4MW5A 4JXXA 1O0BA 3A04A 2CV2A 1WZ2A 2VTBA 4K0RA 5J59A 3HV0A 2E21A 3AIIA 1O0CA 3MUEA 1QU3A 1QQTA 1WY5A 3A05A 2Z08A 1KP3A 3LOQA 2BTEA 2R5WA 4EG3A 4EG5A 1M8PA 3ZJTA 2J08A 4L2IA 2QTMA 1YIDA 2X1LA 4KPUB 4R2MA 3KT0A 4QBTA 5FO0A 1LI7A 4I6GA 5KHAA 5LM3A 1SURA 4XSVA 3CLSC 3MLBA 4P2BA 1A8HA 1QU2A 5FNZA 1NUTA 5KWVA 3L93A 3CA8A 1EJ2A 2QTRA 1IHOA 4KR6A 1P7PA 5TGTA 2J5BA 4MQ6A 1NI5A 4OUDB 2WQ6A 2E89A 2QUJA 3HZRA 1EFVA 2PG3A 1IQRA 1WQ3A 3IMCA 1FYDA 4MW4A 1OBHA 1JIJA 3RJZA 1Q11A 1YUNA 4G5FA 4JYZA 1IFXA 3DLAA 3FNRA 3H99A 3CLRC 2NZ2A 2C5SA 3FH0A 1UFVA 1D2RA 2GOYA 4KR7A 2DERA 1NP7A 1I6KA 3ELBA 1N77A 3UMVA 3IUEA 1OWOA 3ND7A 3HMQA 1G59A 3AL0C 5BNZA 3CLTC 2B7LA 2IELA 3IOCA 4NZPA 2BYTA 3X1MA 3A4IA 1U3CA 1Q19A 3G5AA 4YP6A 5AHWA 1T6YA 3TS1A 1NUSA 3IODA 1O97D 1Q77A 1IH8A 3F3MA 4MW7A 4E1AA 1PFWA 3CVYA 3ZXSA 1H3EA 2X3FA 3FETA 1U0BB 1YI8A 1T6ZA 3RK0A 1XNGA
chains in the Genus database with same CATH superfamily
3EXFA 3W2GA 3T0IA 5C52B 3LUHA 4CMEC 3LY5A 3IQIX 3MWKA 5A1TA 5F2NA 1XFDA 4L8FA 4EJSB 4JT8A 2JJ1A 2WHEA 3GFRA 2JJMA 3EB9A 3NT4A 5SYNA 4O4JA 4B9AA 3U6KA 1TTPB 4QTUB 3PL5A 3RR2A 2YBEA 3E8MA 2V0CA 1N8NA 4PY2A 2R5NA 3TOVA 3GN2A 4XB2A 1NVMB 3K8OE 5CA1F 2ZRIA 3KX2A 5IEJA 1NI3A 1T8TA 1L5QA 3I34X 3C3WA 3TQRA 2GEUA 1KEUA 3JS5A 3CVWA 1XRRA 2CYBA 4FSXA 3RAJA 4YEDA 4GWKA 4GVPA 4UZFA 2NU7A 4BNYA 4QXRA 3DKIA 5CEFA 3LLCA 2M6RA 4J1TA 1BXGB 5DGHA 5JFGA 1LVHA 3KKEA 1W0KA 2I6QA 4JENA 3G49A 4E2WA 2CFIA 1OXSC 5F1PA 5AIBA 1ZEJA 3BGDA 1E2MA 2QRPA 5EVJA 2W2VA 2B2XA 1A9XA 2HK6A 3GJ7A 4G9GA 5E1OA 2ZM6B 4ZT4A 4D3SA 2A50A 4HVLA 1FPQA 2C77A 2ZQZA 4XRRA 4YGYA 2IE0A 3S3TA 4JC0A 4C4AA 2V97A 1KQNA 4RTKA 3PFHA 4LOAA 1FSGA 1XAGA 2JIDA 1HLFA 1S6YA 4LNHA 4B6FA 1GFZA 1WUTA 2O5RA 1KE1A 2HSDA 2DTXA 3E6AA 1P60A 2FPIB 4PGMA 4US0R 3G1WA 1KFBB 1FXWF 3AWIA 1FA9A 4HUQA 1QH8B 2NACA 2G0TA 4RV5A 2E5FA 4LKOA 2EL9A 2R4TA 3QX3A 3B1YA 1CVRA 1KS9A 1Z4IA 1IY0A 2XEDA 3ZDYB 1P6UA 4XIJA 1D7AA 3WLHA 2ZUCA 1RBZA 3DBRA 1VE5A 1G2OA 2C88A 2GLXA 2IF2A 3UM9A 1HNWB 3AU9A 4DZZA 2B92A 4MGYR 4CLEA 4RMHA 5MGNA 1WP4A 1DRJA 2Q0XA 2W8BB 3O94A 4PTYA 1A5SB 1XX6A 3FYUC 3L1HA 4OBBA 3UG7A 3FPAA 5CNJA 4RTMA 1ZGZA 2Q2VA 4BVFA 3C6MA 3MMSA 2Y4OA 4HWRA 5E3IA 1SHKA 1C3EA 1H5NA 3MA0A 4MUFA 2EP8A 1QX3A 3QMMA 4QBFA 5DVZA 1N1MA 4GEGA 1HQYE 2GYVA 5BMVF 2QRGA 4PPFA 1K4MA 2PUFA 3WQBA 4PW0A 4QPCA 1SU4A 4RPKA 1E6EA 1QHEA 1HR0B 2AEFA 1ZJYA 4KWCA 4DMRA 4ZI7B 1YUBA 2E0IA 5DW3A 2NUBA 2G1JA 5DMHA 4QDOA 4KP7A 3TD9A 1E62A 2F3RA 1NNI1 2Z9CA 2QTLA 1HA3A 5I6DA 4LA4A 4X9XA 1RPAA 1QANA 3KSZO 5CD9A 4G5XA 1YVRA 3T3EA 5DOVA 4AXXA 3RUIA 4E2XA 1I32A 2N0SA 1Z2CA 2JFVA 2PMKA 3G8AA 5F1OA 1TJ4A 4OH1A 1P3Y1 3QWHA 4RVOA 2Q1UA 2YINC 3I9LA 5FH9A 5SY9A 1J8QA 1MCZA 3V8QA 3G0IA 4AYTA 3CUTA 3PJEA 5CVUA 4QELA 3WRVA 1PUIA 5J4YA 1PNRA 3PC4A 1GUAA 3FYSA 3HI4A 1M2EA 1R9GA 1XRJA 2HU5A 2P2LA 3E3MA 1X7XA 3ESBA 3ETDA 1KYVA 3F5MA 2FP4B 3FJOA 4WCFC 4E09A 3RVQA 2IHNA 4C0HA 3TLGB 3A2MA 1UP7A 1FVOA 3M1AA 8ABPA 4FE4A 1FU8A 2H31A 3PCXA 4YMLA 5JUWA 3EGEA 1QWOA 1JMKC 1SD5A 4M7PA 2F1OA 2OBNA 1T6NA 1N5KA 3NWJA 3TW8A 4GP6A 1FFDA 3DG9A 4CMGA 1FUEA 3LW7A 4M7RA 3HYCA 4IIYA 3T61A 4D8UA 4E88A 1CS0A 1QRSA 1CVIA 2VK2A 3HJRA 1Q1QA 3SYRA 1SUFA 2FXVA 1WMFA 4DWVA 4CMJA 2B94A 3PE3A 3RADC 1E2KA 1B1AA 4F1WA 3RFFA 3J81A 3CE9A 3OE7A 2PUCA 3JATA 2B9VA 4ETNA 3Q0TA 1EZ4A 4A8JB 4PNEA 3BPSA 4XD2A 4QG3A 3FCAA 1IWPB 2FZCA 1WUHS 3MTQA 3KHSA 3CZ4A 3CFFL 1T9GR 3G2IA 1T9DA 3AWDA 4KX3A 3M2PA 4YROA 2F2TA 3ANLA 3QVGB 5HF8A 3T7KA 4BO6A 3NZEA 4Q9LA 5FBKA 3E82A 1JHYA 2D5IA 4L51A 5FEUA 4N39A 5L7YA 3CNOA 1NVVQ 2WWFA 3EAQA 4JX8A 2E85A 4EEZA 4JZKA 3FCOA 1E2HA 1HT3A 1K1EA 4PWYA 1DJNA 3LT1A 4Q82A 4YIKA 4BGIA 1R0RE 1F6DA 3O75A 4QDZA 1RM5A 2OO7A 3P2IA 1JHVA 4PEVA 4QSMA 4S35A 2IHYA 5T6MA 3K32A 5DISB 2A9PA 2QG4A 3I9FA 3KYCA 1SXPA 2G28A 4TWZA 4F6LA 2HA5A 2RGUA 5AIAA 1IY2A 2XZPA 2YN0A 3GT3A 3HVUA 4OHMA 3TTWA 4CG1A 5C7LO 3BXPA 1UBRS 3K72B 4JYAB 4BQNA 2AN5A 3JD1A 1YB4A 2MYTA 5JS1A 3EYAA 2BLLA 4WZ6A 3N74A 5IJXA 3W6ZA 4O63O 2RI1A 2JIBA 3ABIA 5BSRA 1KEPA 2XMGA 2R0QC 1MX1A 2YJGA 5FPKA 3JWIA 1W34A 4RTLA 5A4JA 3HS3A 3TQQA 2O5CA 1NVGA 3DO5A 3B1VA 3OM9A 4DANA 4J2OA 1QDUA 2QSUA 1F38A 4FHGA 4YMTA 2GM5A 3BE5A 4LZLA 1SIWA 2R3SA 4Z3KA 4MUEA 1QRDA 2ZXUA 5LOVB 4AG5A 2ZT6A 4XUGB 3SZ3A 1V9LA 1YTLA 5CB0A 4YJFA 4X00A 1CRLA 1HK7A 1P33A 1W8DA 1UK6A 2YIDA 2V5VA 1IB0A 3WGLA 3FLAA 5HNKA 1MA3A 3LBFA 1WBJB 5DHQA 5GADl 4U7DA 3F8WA 5IKPA 4NU0A 4H6VA 1URPA 3IDFA 3LCVB 3HBNA 2OG2A 2XW6A 3MHTA 3DZIA 1DAPA 1DQYA 1M72A 1U8ZA 2R7NA 3FTNA 3W7BA 3B85A 3TRHA 4HAVA 3RVSA 1U2DC 3UT5B 3E84A 1KI6B 3ABOB 2Q0HA 3HQ4O 1OXTA 1JU3A 1MJ5A 4CUKA 3UANA 4I08A 2P1ZA 4A91A 3SLGA 2CV1A 4UBOA 5FHRA 2P2DA 4OXKA 1IBMB 3CLHA 2QZZA 1PR6A 1V48A 1PZNA 5DIZA 3GQBA 1JR6A 2LKCA 5E6RA 3RAEC 1GKLA 1KMNA 3UHOA 1RVV1 1PVVA 7MDHA 3FTFA 3UUEA 2W6JA 5FAXA 4CJXA 4ZCQA 4UDXX 4XVRA 1Q0SA 4HB0A 4A0RA 3K05A 1TZJA 4YAWA 5B7QA 3OFNA 5L4SA 3OD5A 1OLXA 1U3UA 3THWA 1JDJA 3QYAA 4MW6A 4DUGA 2Y1EA 4HUJA 2CN1A 4RD3A 4HVTA 2GAOA 3D59A 4P31A 3QEOA 3LFHA 2Z6UA 4QASA 3DT6A 1DAHA 1JG2A 4JU9A 4TSKA 3BGOS 5AOAA 3VBCA 3WK7A 3E23A 3GMTA 4F2PA 4MWSA 1NXOA 1IN7A 2PX5A 2IP2A 3UBTA 2C7RA 4FS3A 2ODQA 3EZ2A 3OBIA 4IVRA 3WGVA 3RBXA 2NYRA 2QP9X 2PT6A 2NXJA 3DHVA 2C8LA 5JSYA 3GFGA 4X6UA 4BP8A 2CXUA 1KZ4A 3GB9A 4R0VA 2TMDA 3DMTC 4F3RA 4KRFA 3OSZA 1RWXA 1EK1A 4G1UC 4Y2TA 3RROA 4YDQA 4PC1A 2I7XA 4FGZA 1RHUA 5DNAA 1W76A 2G63A 3NOQA 1T2CA 2P27A 4BMYA 2DT5A 1M2OB 3DEAA 5CFPA 1JAZA 1XMQB 4MVWA 3NNDA 4MR9B 5IEBA 3KSRA 3QPCA 1C0KA 3OCZA 4HDMB 4KVFA 2WQ7A 5T3UA 3FRJA 4AY2A 3LKVA 3O93A 3P2YA 5HKAA 1SCKA 2AXNA 4OHBA 2UUBB 4KKXB 1HDYA 4HLUA 4GX5A 4R9SA 3DTNA 3T9BA 3TVYA 2YCBA 4LDJA 2G7ZA 4O6VA 1OXVA 2ENWA 3IL2A 1PFGA 1HY3A 1XZAA 1ZICA 2XOKA 4LS3A 2BFNA 1G8YA 4QM6A 1GGVA 1TPZA 4KLAA 1KQPA 1U8UA 4P1ZA 4BTLA 1LRLA 1O89A 1U7OA 1KNQA 1RXYA 4RA9B 4Y2JA 1TM1E 3X44A 3H13A 2XBUA 3IT2A 2IPAB 4C0JA 5IPFA 3AR9A 5ALKA 5JVDF 1EUCA 1EKXA 1Z83A 1N6LA 1RWPA 3OY2A 3UBMA 3VR6D 5BSWA 5C8XA 3DLBA 4BASA 2I78A 4WSOA 5EG5A 3EGOA 1X87A 4QOJA 1V1JA 4ZDKA 1JEAA 1L3CA 3LBYA 4JYPA 4IVQA 5TQ2B 4QA9A 3BEOA 1Q3HA 1S2NA 3LBHA 4HN2A 4MYUA 3WGZA 4EB0A 2XCSB 4HDKA 1SNYA 3FDJA 3AC0A 4PAQA 2E4UA 3M8KA 5DYIA 5ECDA 4PGGA 4CN8A 1FFSA 5BR8B 1H4VB 2QB5A 4R40A 1ONOA 5JPCA 3QVJA 1NZFA 2YIVX 4BNHA 4HB2A 1JFLA 2K2WA 2PX4A 3MIIA 3O2JA 1GTRA 1J49A 1YS1X 3OZCA 4RV9A 1GADO 3TMAA 1WZEA 3I2KA 5ALMA 3RC7A 5KS2A 1DAMA 5CK5A 5H1YA 4XSGA 1XAJA 2JFGA 2CCKA 2QTWB 4HGYA 1IBLB 3I32A 3HN7A 4LYDA 3VOTA 3SMVA 3AFOA 1GSOA 3I1YA 1U5BB 3NHFA 4L5IA 1QFYA 1CEEA 3KHUA 5IFLA 4DJEC 3WE7A 2Q1XA 5J4LA 3DSRA 2BFBA 4OYRA 5LUBA 2DCMA 3K31A 4H3VA 4POAA 4MGHA 4WV3A 4ZEXA 4U2DA 4Y6QA 2PWAA 3RW9A 2ZRGA 3SVZA 5G1OA 1MORA 1SUCA 2BM0A 2Y1DA 2W2TA 4NP6A 3ULKA 3KE9A 2OEPA 3K1YA 1LZLA 1N4DA 3R41A 1WZUA 4BHTA 4Z1OA 2W4IA 2NPFA 1G60A 3LTEA 3V5NA 2C04A 4RK7A 2KHZA 3GLQA 4TQ9A 3IEIA 3AERB 4RDIA 1RD4A 1VG1A 1WMSA 2FGJA 3W6PA 1U11A 1V5FA 3F6BX 2YXPX 2LCFA 3JVDA 5FYQA 1M1UA 2V6MA 2RGDA 4IYRA 2GEDA 4M38A 4MJLA 4X0EA 5JG7A 1PJ8A 4C2UA 2EFGA 3HY6A 4B3JA 2A3NA 3BFJA 5TPZA 3IHTA 4LXIA 5BWMA 1M1YB 2H1HA 1T8SA 1U81A 1F3LA 4XX0A 4RF4A 3SGLA 4NMMA 2V7QA 5KPJA 3GXOA 1WPRA 3EBOA 1DAEA 3OQPA 1F20A 3JWHA 4LG1A 4WAUA 4BBZA 2BUAA 3NHLA 2V7VA 2C9YA 4G0ZA 3WSVA 1VDZA 2ADFA 1GU0A 2FP3A 3IP1A 2I5PO 3PX7A 2GD2A 1YQWA 2WEKA 3OEED 1Z0IA 3PU6A 4J7UA 4WZAE 3QYPA 5EZYA 1FDIA 1MC4A 3NIFB 1WCYA 2YQ5A 2MINB 3MPOA 5JYEA 3EZGA 1Z39A 1X38A 1ZVQA 4R68A 3VO8A 2JCBA 3NJ4A 1R8XA 2DECA 4D9MA 5B5SA 5K99A 1YCDA 1LI7A 3VPAA 5BNTA 1NWHA 2DPMA 5EFZA 1I3LA 4FFMA 1E7SA 4U2CA 5ITZA 3QE9Y 2XSZA 4C01A 4NCXA 1UKBA 1LNSA 4U4AA 4MXDA 4CTJA 2NVOA 2FSVC 2QAGC 2K7ZA 2ZJ8A 5JYCA 4LHZA 3D7NA 4J1SA 2PYIA 4D6PA 3M5CA 4G5QA 2O3SA 4EITA 1S2LA 4LN1A 5H83A 2FPXA 3SM9A 5A4IS 4KR6A 2YUTA 3ZLUA 2GB4A 3I6MA 5JRJA 1GTL1 4GXRA 2P9BA 3VSAA 5AM3A 4ZU6X 3NIDB 2HX1A 4O4LA 5HPYB 2JI6A 2A9KA 1ZCJA 3GCXA 3D6MA 2H4WA 1B14A 2XX3A 4QL3A 4YAJA 4GBED 4M9ZA 1Z7BA 1RYZA 4IV5A 1KPGA 3DWFA 2ECFA 3EVBA 4V0SA 4KGXA 3R9XB 2FFAA 1W4LA 5AK5A 1DHTA 2B4YA 1OASA 4C9BA 3T7EA 3CLRC 3UCEA 4C3VA 4X65B 4LY0A 3ESZA 4INPA 1T2EA 1UFVA 3WOVA 5KOJA 2D1RA 1FDUA 4ZQEA 3UJHA 4WLVA 3WZMA 4IKPA 5GONA 5BQ3A 4GBGA 1E3DA 4K0KB 4M0KA 2IDZA 3UMBA 4GPZA 3Q1LA 4G0PA 1HRDA 1L7VC 3AU8A 5F77A 1E1MA 5JSUA 4FT4A 4AKGA 3EGXB 4GM4A 1PJTA 3VO1A 4BMCA 4YV2A 3NHRA 2HF8A 5BQOA 4B6PA 2DWUA 2NZXA 3UFXA 3IV9A 2Z6AA 2V6GA 4ZKDA 3N2NA 1MDFA 2X2EA 4BYMA 4EO7A 2OL4A 4CCSA 2PZMA 3T4EA 4HPJB 1RNLA 4LAFA 5JNTA 4KRYA 1V0JA 2G88A 3H5LA 4KN9S 2B9EA 2QLLA 3FCUB 4KFTA 5T8KA 3RS3A 3BF8A 4LJLA 1WAMA 3GGOA 2J5QA 2RI0A 1ISMA 4OLBA 3IKJA 1ZD3A 1WY7A 2QP3A 1X80B 4L0MA 4S2EA 5CCBA 5GWXA 1IU9A 2GSDA 4XZ3A 3TECE 4FZJA 1PUXA 3VZSA 4HNGA 4EATA 3O47A 1JDNA 4EIWA 1LJLA 2RAUA 1R6DA 3IEXA 4CNBA 2B4TO 2JBAB 2PXAA 3OZAA 5F3DA 3WWEA 4QE3A 4EYQA 3H7AA 3ZHYA 1JLRA 4RZQA 3GW8A 4Y30A 4BKUA 5LYYA 4FNGA 4PC2A 3W7AA 1L5HB 5L6MB 1FMTA 4J0IA 2YYAA 2G5PA 3AVYA 1XRNA 3NONA 2WIAA 5E9AA 2V59A 1POXA 2CHUA 1P39A 3A9TA 2J09A 1G7CA 3OU2A 3QWAA 1NIPA 2WM8A 3HCEA 4UPVA 2VDKB 4WZAA 3INNA 1OFHA 5AI0A 3ZK8A 3EOBI 5KAMA 3VR5D 4YJHA 3CZ5A 5CEEA 3JVIA 1S2DA 4TWRA 4RC9A 3HXMA 2G4CA 1P2FA 5LA6F 3B6EA 1BDMA 3BIWA 1F0KA 1PCXA 2C82A 2GCOB 4K9PA 4LZWA 5IJAA 4YUYA 1XCJA 4JDUA 1HFWA 1WXGA 2DFKB 4JCOA 4MUIA 4IXJA 1P9OA 2ZTVA 4HZIA 1UOPA 1ZM3A 1KI9A 2HHAA 2BEUA 3FMOB 4XFJA 4E22A 1TM7E 3EASA 3UMMA 2XGMA 3MINB 1PR2A 3NYRA 1DJMA 3FUVA 4YS6A 4D42A 1DQNA 2DLDA 1NX6A 2VATA 3H75A 2PMEA 1C7QA 5TVKA 5A5EA 1NNLA 3CRW1 2CLSA 3OO0A 6PFKA 1H94A 2CLFB 1QIGA 2AR0A 1IZ8A 1GU1A 1I3CA 4KOAA 4BCDA 3BRCA 4P8RA 2QVGA 2AFIE 2G8LA 1DV1A 4RPCA 4UVEA 3CVJA 3DOOA 2V8BA 1QAOA 3IEMA 1IUKA 2XB8A 3OT1A 3RUDA 3RH0A 2VRCA 1MPTA 2C54A 4II7A 1D04A 5C7OO 2EG5A 4F3CA 1PZXA 4FQ5A 2BFDA 3S1LA 2QF7A 4DBZA 2CXRA 1H2RS 2WFZA 1E9AA 2H51A 3U1BA 3QG1A 4OPMA 1Z0FA 1CZOA 3H17A 2O14A 2FDRA 1ECCA 1W6UA 4QGBA 3QI7A 3ZNQA 1L6IA 2NXNA 3IAM6 2V45A 4DRYA 5KO2A 2VJYA 4PX5A 3I9JA 3GYGA 5IANA 221PA 1GNTA 3G9TA 4D56A 1MRNA 1VLQA 1ATZA 1XD2B 3ZV3A 2DETA 2QP4A 3OOSA 1PV2A 1VMEA 4KIGA 1UJCA 3WRYA 4TKUA 1A9YA 3LHKA 4JB8A 1X0VA 3ETNA 2ATIA 2JCXA 3GRAA 4N5NA 4A7PA 4JHLA 2E18A 3LNCA 4I3GA 4IMPA 3SQOA 2OOSA 4X1YB 4ZKEA 1KTIA 1SFRA 4PR0A 2UZAA 1OFUA 4CL8A 2C78A 2BY4A 1H1LB 1BHO1 1ZCFA 2DFTA 2MYPA 4FMCB 4OLJA 3EXFB 2ETVA 2HA3A 4RZXA 3OWXA 5CLHA 3AI3A 1K8QA 3QOXA 4I1RA 3RIHA 2BBOA 2HSJA 1XCPA 1FMJA 1V6SA 1YMVA 2NNLD 3WAGA 2CSXA 1WMEA 4MGKR 3E7FA 1SELA 1BO6A 2FUCA 3ND8A 3FKSA 4B7AA 4QFDA 5KQMA 3U3DA 1RDFA 2QMZA 1SUEA 1PG0A 1TFRA 1XE3A 1M7HA 4PFQA 3DBLA 4KMMA 1EWKA 4MWOA 1BDHA 1SQ5A 2PSFA 2QSYA 2EQBA 2QVLA 2X7HA 3NX4A 3NYWA 3O8LA 4E5VA 2WVHA 1M2VA 3EA4A 4JSRA 4E4YA 1J8MF 2VTVA 4TS9A 3USZA 3DFKA 1U7TA 1CUJA 4M4SA 4GFDA 1SBZA 1U2PA 3FBWA 3P26A 1ICIA 1NM5A 5G0WA 4WA7A 4EA7A 1Z6PA 2PDAA 3GCGA 1LB1B 3FGZA 1H6CA 4A10A 1NJ2A 1G291 1YL6A 3K9WA 2WVAA 1GARA 2FQWA 3OOHA 4XB6B 4CDNA 1A9XB 4B46A 2IIVA 4BEBA 1PZGA 3SEQA 1K92A 3JV7A 5C8VA 2PKEA 2WMYA 2PX0A 2YQZA 1PDOA 1MKYA 1ZN9A 2WF5A 3PNYA 4FE7A 3QEAZ 1S9HA 2EAUA 2XGOA 3BMQA 2RB4A 1T91A 3ZZTA 1GT91 4TKMA 5F1KA 2IYUA 3CX8A 5C1DA 4UNIA 4O3FA 2OFXA 2JFBA 5K8VA 1UKZA 2M98A 4HUQB 1E4EA 3LPLA 1QHHA 4KZKA 4WI1A 1HDCA 4YCJA 4JJ7A 3KFLA 5ALUA 1V3VA 4M0LA 4WBNF 3QU2A 1L5GB 2Q3JA 1IBRA 4L28A 1O5OA 1LSUA 5KNBD 4K05A 4QYMA 3JY6A 3DBRB 5DLQC 3IP3A 2MYUA 3CZAA 5KVSA 4IDQA 2AFIA 2WUFA 4ANFA 2CL5A 3SOPA 2UUAB 2XWQA 1KAHA 1QBKC 1AUOA 2I65A 2ZOSA 1MTZA 1RZVA 3H9EO 1LUAA 3JW8A 3OM8A 1RYEA 2XRYA 5EXSA 5M3BA 2NAPA 3B8HA 3C7TA 1RYBA 3WMGA 5AOVA 2ACKA 3OLWA 4PSDA 5L45A 2OV6A 3U3KA 1Y8RA 4P92A 3I5UA 4NSNA 4Y2YA 4TMYA 1YOVB 4RADA 1I2AA 1NKVA 1QZ3A 2FPWA 3RFUA 2OGZA 2PMCA 2RG1A 3SJ7A 4G1BA 5K03A 3P9ZA 4L4RA 1XZDA 3EPKA 2AA3A 2XDQA 4UTXA 3OPYB 4M9RA 4R1PA 4LBZA 2PXHA 4MULA 1ZLYA 4GQAA 4CNQA 2QXUA 1SMKA 3WJAA 1Z0KA 5F98A 1IONA 1JZQA 5JC8A 3T06B 1KR5A 3O91A 5B1EA 4MUGA 3VO9A 3WGKA 5EIAA 1ESNA 4NJEA 3RSCA 3UMFA 3VU9A 2AT1A 5C80A 2B30A 3AJRA 2VEOA 4XE5A 3ZVRA 3W06A 4Q7JB 4W5NA 1R00A 1SVMA 3H83A 3N76A 3K9LA 4GUDA 4Q93A 3P7MA 4WVFA 4WOJA 4OX9B 4WOKA 5EHZA 3COYA 1H3NA 2OAP1 2YZGA 3REFA 1CEQA 3DMGA 3PHCA 4RIIA 2JB9A 2O1XA 2GUGA 2PUHA 4PM4A 2E9SA 3W5IA 3Q8XB 5A3SA 3DB1A 3ND6A 1IDN1 1XDGA 5CG2A 1MV8A 1X7XB 3ZIAD 5BR4A 4MUHA 1C1YA 3FHTA 4PZ9A 1YQUA 3V1LA 2TSYB 4X20A 2YZMA 4KQFA 4TMZA 3ZXIA 3LX5A 2WWTA 1PJLA 3CB4A 1L7NA 3VZDA 3D2CA 2J31A 1QQ6A 3RNOA 4Z53A 1D2MA 4BGDA 3MJCA 3TW8B 4CM7A 3GJQA 2IUUA 4E14A 3ER8A 2CGEA 4KQCA 1CS0B 2BSXA 2XNHA 2OAGA 5IDYA 3MFQA 1E99A 1D6SA 4G0OA 2JH3A 3SD7A 3L05A 3K6SB 1DXQA 1WUJS 4ZO6A 1QUFA 3CT6A 5COQA 3H84A 1XVIA 5LBUA 5ECGC 1OMOA 4FCCA 4NNPA 3JATB 4RKYA 2ISSD 5TPWA 5CB4A 5DNEA 3A9WA 5F73A 3GVPA 3JQRA 1O96A 1OH6A 2BMVA 4OXIA 1SBYA 1JUDA 5DTRA 3TLEA 2INGX 2P5UA 4WL0A 1M2HA 2XEXA 3WGUA 3RVBA 2ZJ6A 5JQGA 3FOZA 1UOEA 1Y3HA 2PZKA 3IALA 1OT3A 3IHWA 4B09A 4E5KA 3ZE2B 4DV0B 4P3KA 2XTZA 5GJVC 4K46A 4EUKA 3DONA 1R5NA 4UU8A 4ENSA 1M6WA 5HZHA 3FLBA 3P1JA 3Q7TA 3D0QA 4FYYA 5K0LA 1XVLA 3M4NA 4M1SA 5EWLB 4YRMA 4B6SA 3QXCA 1B8UA 4TTTS 5HS4A 2B4KA 4LHXA 3LYLA 3HWWA 1T2VA 3B9QA 2FN4A 4I55A 4QGSA 3A4TA 4RGQA 4INAA 621PA 1EWVA 4F3KA 1ST3A 2GT1A 2YWHA 3A1UA 3FTDA 4FN5A 4DJJA 4UBJA 4RPGA 2OCPA 4EPYA 3W5CA 3V9AA 3PQ8A 2V03A 3I62A 1XCBA 1UPBA 3GZNA 3S7ZA 4DT1B 5A7HA 2OR3A 2RHLA 4CTMA 1SEPA 2XMRA 4J75A 1P2TA 3E58A 4P98A 1L4UA 1WO8A 1WU7A 4KIFA 1PZEA 2IHUA 5FL7D 1XTSA 5DHFA 5FTNA 2ZYWX 1YONA 4JYMA 4XLLA 1MO2A 3ZN2A 5J2TF 1ILEA 2XYRA 5K01A 5JBNA 2CWWA 3D8UA 2PRYA 4F5YA 4CG2A 5CRIA 4NCAA 3AR7A 3GA7A 3SM3A 3TNDA 4C3UA 2XUGA 1TRKA 5JAUA 1WF3A 1ZG3A 2X5XA 4PO3X 1ESEA 2YYZA 5EN4A 4AJEA 4K5QA 3U16A 5AKGA 3UXMA 3UC5A 3WAJA 2HW8A 2CW5A 2VJOA 1X9HA 5BVGA 1GZ5A 1P3JA 4H59A 4EY7A 2O5EA 4AO6A 3IIKA 4URUR 1QHYA 4RQAA 4PHCA 2CWDA 1CYDA 1SC4A 1XZ8A 3PXCX 4RHTA 4S24A 3TDKA 4Z1MD 1E6KA 4DUYB 1RKXA 1E63A 2FOLA 4J3FA 1QK3A 2ZPUA 2PUWA 2X41A 5BSKA 4S04A 3AY0A 3L0PA 1T3SA 3PC7A 2NSDA 4Q3BA 1N2SA 2GDJA 3WNZA 2D3TA 1QO0D 1PR0A 3GEMA 3HXLA 3PE6A 4WLNA 5EIEA 3GQBB 3PQDA 5E6RB 3WGTA 4CQMD 5ALSA 1G16A 1U80A 1UP6A 4NK4A 2C5AA 3D1JA 3O4RA 2RGAA 3DMNA 1H85A 1A9SA 1Z5VA 4RE6A 1JTEA 2N75A 3ON5A 1OLXB 1SBHA 3THWB 3YASA 1YFZA 2JIRA 2QQGA 4U7WA 2XVMA 5EP1A 3AXTA 3T7TA 2JIZA 2WF8A 1Z74A 3I5MA 3RT9A 4FYKA 3EIHA 2F00A 3GQVA 3X1YA 2KM1A 1RZRD 4JQCA 3VPDA 3SAJA 2FR8A 2J3IA 1O94A 3E9DA 5EHQA 3LD9A 1KS2A 4DDHA 2NUPB 3G3EA 1A7JA 1PN3A 4RK0A 2PFGA 4AJJA 4BUJA 5EKSA 2DBZA 1YZ3A 1FS5A 1ORVA 4MWDA 4BP3A 4L4YA 3AR5A 3LDGA 2A1UA 3AFNA 3ENVA 4M6WA 3ONNA 2P9JA 1D6JA 3QIVA 3ESXA 3H04A 4EL5A 1FSSA 1TF2A 1Y80A 4OJTA 1NL3A 5BMOA 3WGHA 4Q3LA 2JLUA 3G8BA 4DMFA 3H9QA 3AIIA 3WB0A 3TIVA 1VHJA 4JR2A 2I1VB 1QQTA 3HADA 1EAMA 2VWHA 2QY6A 3KKOA 4L5CA 4ZAVA 2R5WA 3HDYA 3I6QA 4TLLB 3UNXA 1NXWA 2ZJFA 3L0DA 4C5BA 5EXPA 2VJQA 4JJKA 2K7FA 5I7WA 5CHEA 4DQKA 2WJHA 1KERA 2ZQYA 2BFEA 4ZXFA 2AUTA 5EHGA 4B35A 5CNMA 3UGQA 5H9WA 5KWVA 1HSZA 4G0VA 3L93A 2IX3A 5CIYA 2JGJA 4PSCA 1FBNA 4N49A 4Q4DA 5KNDD 1J2EA 2QE7D 3IO3A 4B4VA 5G3ZA 3HEMA 1CJCA 3M7IA 1SXJE 4Z51A 2QUJA 1VI2A 4ENUA 1R2QA 2DY1A 1TKBA 2Y99A 4HDKB 4BDTA 4LK2A 1BMTA 3TR6A 2YN2A 4ZICA 3WC4A 2VJAA 3JQAA 2M1ZA 1UJ4A 2A30A 5KYWA 3ABZA 3I42A 2CFRA 2I3BA 1I80A 2XT9A 4CKYA 4G0YA 2PS3A 4G24A 2BW0A 4G5FA 2DTDA 4G1EB 1MA0A 1IFXA 3G5LA 3I76A 3IV7A 3NORA 4MA4A 4Q05A 3DLAA 4G5GA 3S28A 1Z7GA 3RAGA 1I6KA 1OX4A 1QIHA 3KL2A 2OCDA 3DKKA 3TJZA 1RMTA 1U4SA 3AKDA 3D64A 2NO1A 4AF6A 3CPJB 3Q5EA 4AJHA 3ND7A 4EB3A 3AL0C 3LC1O 1QB7A 3BE6A 1H2WA 1M10A 2L0XA 3DFIA 5BNZA 3INYA 1ZGHA 4BEWA 1U90A 2ZTHA 2QUAA 4GWLA 4QQRA 2BFBB 4ALJA 1AA6A 3F9IA 4BV2A 3N75A 4HNRA 4I9FA 4TRJA 3WV5A 2WIDA 4PSVA 4KXYA 1E3SA 3WNBA 4RX1A 2ADOA 2IU6A 2XRMA 4HEHA 3PITA 3H5OA 3DC2A 1EZ1A 1MXHA 3UPDA 5L7TA 2QD4A 3MYRA 4M88A 4UFNA 1PFWA 4OGWA 1OHHD 3LQ1A 4II3A 1U9YA 3ZXSA 3KEOA 3CVYA 1P1BA 1R6VA 2X76A 4C6TA 4OVKA 3HR8A 5AJWA 2C2YA 1QOPB 1E8MA 2R11A 2X40A 4FD3A 4ZO9A 3U80A 4YAKA 5IC4A 4YJ3A 1RYYA 5JAQA 5JW6A 1IBCA 2I9KA 4KOEC 2VJBA 2Z3VA 1IJEA 1BJTA 2TS1A 4KX5A 4XX0B 1RKQA 5HZGA 3PFIA 1PYOA 4WOCA 1PR5A 1RXSA 2D4HA 1AN9A 1PEAA 2WZCA 3EIWA 4KL8S 2P91A 2OORA 3OCVA 4LCBA 2IUFA 4MKRA 2R87A 4YP5A 5AKZA 2N3ZA 1RYHA 1XKTA 3LQFA 5A4MS 3GP8A 4BNZA 5CM8B 3S44A 1HQCA 3F97A 5EZYB 5BYJA 4D97A 2RB5A 1EFPA 2HREA 4BHRA 2CVZA 4C76A 4DCUA 3ETEA 4D3DA 4PAMA 4NNJA 2WFLB 4H3HB 1DUIA 3GPCA 5D3MA 1E1NA 4L4ZA 3NYQA 4RHYA 3ZHRA 5IVDA 2VJKA 4R1UA 4G4SP 3BJIC 3C1UA 1OV4A 4AM8A 5ITZB 2OBMA 4JBWA 2AYZA 4QRHA 3A25A 4D9CA 1KWKA 2JF0A 4FGSA 4YVFA 1NVEA 2F1RA 1PNTA 3OQOA 3HJTA 4UQOA 4K2HA 2DZDA 3KC2A 2BGRA 2FRDA 4F46A 1JP7A 1H23A 4ZMBA 1EE2A 2NUAB 3CIFA 2YS7A 1EBFA 4JLJA 2JCYA 1RXUA 4DLXA 3FTEA 2ZJ4A 4FQ7A 5JPDA 1Y82A 2NUTA 2LW7A 1J5XA 1Z2AA 1JJAA 1NYTA 2IXGA 3AUUA 3IB3A 1FDRA 1G5HA 1SXJA 2R8EA 3RC9A 3NRJA 3T4XA 2WP0A 2G0NA 3FIUA 4Q4LA 4N48A 3NI2A 4GIBA 2RGXA 3NTOA 4IYJA 1F2UA 2GKGA 1MGPA 3WJ1A 5KBYA 4OSOA 3FFWA 5DGIA 3RIMA 5KOJB 3VM6A 3A6EA 4MW1A 1BXRA 2V58A 4HDAA 5GONB 1TXGA 1MVNA 4NBVA 3DC7A 3IEKA 2FZEA 1BD3A 3F4BA 4JMPA 1ZI8A 4UXJA 3IAS1 1KRHA 2CXXA 3BWDD 5E38A 5CG1A 5IMSA 4LZAA 4ZZ2A 4NJMB 4DCVA 4N1AA 1D9ZA 3BHJA 1N5LA 3NEAA 4EJSA 1HG0A 1KNXA 3BRWD 2LCQA 2PGAA 4QJBA 3DZJA 3HUFA 2PH5A 4IQ0A 1G3RA 5H3HA 3UAVA 3FOFC 3KB8A 5AW4A 4QPDA 2A0XA 4ARCA 1QGOA 2V6JA 4G5SA 1B43A 3OX4A 4PLCA 1B0PA 3MWYW 2LDBA 4V3CA 3FY4A 4DXHA 1IHYA 2KS6A 3KT3A 2POQX 3NHAA 3RS5A 5B2FA 2WJYA 4P32A 3GDFA 4RLQA 4WWHA 1UZMA 3U7JA 2X4DA 1OFTA 1TF5A 4DLUA 2GPTA 4GKVA 2ORWA 2ZSJA 1U6IA 2UZIR 1X7GA 2Z8ZA 1N6IA 3CF0A 4KKVA 1WOMA 4M99A 1AMOA 3UGJA 3EBPA 2WR8A 5CCXA 1NP3A 3LRTA 4HEA1 5D00A 2RFLA 3ZQ4A 1Z5NA 4Q18A 1ZISA 4EWLA 1X2BA 2NO0A 1SVUA 4MB0A 2C3MA 2QRVA 4PO1A 4YJKA 3OZ7A 4BMPB 4DL9A 4EY3A 4LQCA 2XMSA 5K0ZA 3V4OA 5EERA 1NVKA 4IWNA 4E5PA 4B3TB 2YVQA 2FEWB 4AKEA 2D5LA 2O2IA 4FOOA 5FWXA 2G25A 5BWOA 1W36D 2H16A 2VK8A 1TB4A 4MHOA 5AKHA 3TGWA 4BP9A 1M5UA 2JI8A 2AMLA 4WZAB 3H9GA 3ZKAA 4EQZA 1TKAA 4Q7KA 4ZT5A 4BLQA 4YJHB 1DKLA 1VP3A 4C7BA 2C29D 4AZ0B 2OY0A 1D2EA 2BE7A 5K0EA 1SHUX 2WWYA 1O6GA 4CM1A 1Z13A 4LHEA 5G02A 2HJVA 4BVGA 4H7JA 2Z09A 2GK3A 3KEQA 1WVMA 3IYLW 2WYIA 3GRFA 4BWVA 5DU2A 1DQPA 2WWVD 2AMJA 2BEUB 2MU1A 4ZMRA 5K8UA 2CNBA 2WNIA 3ZWKA 1ST2A 5JCXA 1HXHA 1WSAA 3I4LA 1ZD8A 4UHJA 5E4TA 1IE3A 4C4XA 4HWPA 2MT9A 2NAFA 4MJXA 5I7HA 4ZV7A 1NN5A 3CRVA 2VP5A 3R0JA 5HBRA 5HYVA 3PK0A 4LBYA 4EKNB 2GAAA 3L8CA 3CZPA 1T6XA 3OT1B 4DBVO 1NHWA 5A4KA 3H4VA 5DLPA 2ODEA 3K1AA 5AHXA 5DGCA 5BSTA 1LLDA 5E2BA 1P7CA 3LC7O 5BVHA 5DNUA 5FA8A 3NRCA 2CVPA 3KKZA 1N2XA 4B80A 1VYTA 2EV9A 3EIFA 4IDOA 4R1MA 4DQDA 3GZTB 5HWSA 2O5VA 2FN8A 2PSEA 3ZQJA 4WNIA 2IHKA 1RPZA 1J0DA 2QMHA 3K2BA 3SBOA 1BNCA 2Y3IA 1P77A 3R5KA 4GG1A 4OFWA 1P8AA 1T8PA 3R24A 2NSYA 3BTOA 2OILA 1QP8A 2H59A 3JQ9C 1BDJA 1JDSA 3KO8A 1UWCA 5HUHA 4LWPA 3DA8A 4A73A 4TKUB 4BNTA 4E70A 4G41A 2GXAA 5KSWB 4NATA 4ZYTA 1MTOA 5TE9A 4BJ6A 4E3ZA 4GOLD 3LZDA 5AVVA 5IVHA 4ZI3A 2B35A 5BXQC 5DWDA 3BBLA 2ZULA 4D92A 2Z2XA 1EFVB 3VA7A 4IWXA 4LRUA 5I7OA 1Q12A 1CJVC 5HQ3A 3P0EA 2OD9A 2R68A 3M6XA 3OMLA 2GN0A 3EHDA 3PR1A 5HGJA 3AB3A 1W25A 3DFUA 3NGLA 1DOZA 1R88A 1A9ZA 3L0IB 3GD7A 3B6MA 3A9UA 4D0RA 5K6AA 1AGPA 3A2NA 3BSSA 3DWEX 4TXJA 4YK7A 2P9FA 2JLYA 1CYEA 1Q1NA 4I0WB 1Z0AA 3JQ7B 4QPJC 2JLQA 3DBLB 1KC3A 2W00A 2ZT8A 3Q0EA 4QDKA 4BLSA 3F5QA 4Q02A 5AKLA 1SK8A 4TTRA 1M2VB 1NBEA 1NUAA 2WE8A 1WR8A 4YRLA 2R9VA 3JD3A 4MYHA 1Q1ZA 2GZSA 4DWJA 4NOLA 3LF1A 3B5IA 5CT6A 1AK2A 4IX1A 1B6RA 2Q3BA 1K08A 1AG9A 1E92A 4IS3A 2HT6A 5IH7A 4P80A 5K0NA 1PGJA 2GK7A 2OAEA 3Q3JB 1JXOA 1EP1B 1H2EA 1DC7A 2PK3A 2RSLA 2UZ0A 2WMDA 3OTGA 4IDGA 3DJFA 1E0DA 3I3SR 4Y9RA 4YBZA 5B2EA 4P53A 3BB1A 5JWHA 3ZE8A 1GITA 4IFEA 3TJRA 3S2GA 1Y33E 4K8OA 1E2JA 1A8SA 3CUUA 2J59A 1NDQA 3AY3A 3OZDA 4DQLA 3BMQB 4BQIA 2PGLA 2BEKA 4BXOB 3NVAA 3HB1A 3MJEA 4ZJUA 4GYKA 2AZ4A 1XDSA 1EE9A 3O2SB 4MAAA 4OKNA 4ZTUB 4O0MA 3D6FA 1IOWA 1V6AA 1E4EB 3HKBB 1QHHB 2WF9A 5DKFA 1DKUA 1R0BA 3OH8A 3VR1A 4CU2A 4MICA 3CUWA 3IQEA 3JQGA 5E8JA 4ON9A 5AI9A 1EFCA 5DWVA 3DYBA 4KQKA 4ZVTA 2Z5LA 3JWPA 4XYMA 1X8JA 4M0PA 3U7GA 3VR6H 1PO7A 2OZKA 1P5FA 4K9QA 1SB9A 2AFIB 3K9GA 1CDDA 1O3YA 1NQWA 3ZUGA 5AVQA 1SG6A 3DPIA 3OCYA 4R16A 3S2EA 3Q88A 2A4KA 2X0NA 3L3BA 4B3XA 2XAUA 3VSEA 4BMNA 3SIPA 1DKQA 1NLZA 1Y8RB 3DT9A 3O5AA 2WJZB 3URMA 1NW7A 2R00C 3WIEA 4BATA 4GM1A 4F8EA 1T2DA 1T9GS 2VOJA 2VPQA 3JYLA 3JALA 4B8YA 2AN3A 4YRZA 5HF6A 1Y6RA 3HJBA 1ND5A 1MEOA 2O8VA 1PP4A 3QUAA 3ZJ5A 2VUIB 1DWOA 5CH8A 2ZROA 5L3RA 1YNOA 4PZAA 5A3JA 1YK1A 3AJAA 3AR2A 4MTCA 3KLPX 1LJUA 3FMFA 2E4YA 4Q39A 5KNCH 3C8UA 4KQGA 1P19A 3HP1A 3DV2A 4NJEB 3VU9B 1IK6A 2I3DA 1V2HE 4AWXA 3AG6A 3PFFA 1N0UA 3IRUA 4BB0A 4B3FX 3AL3A 1SBTA 1HQKA 4LVUA 3R23A 4Q01A 3DE4X 5ER6A 3GG9A 4D4LA 2JI7A 5BW5A 4QREA 3OZWA 2AKYA 4Z7OB 1N1EA 5GM2A 4CETA 4FM9A 1FNDA 2FMUA 1CZNA 2RKWA 4EG1A 2GXSA 1IJKA 4GDMA 1PQ4A 1X1AA 3ELWA 4U8HA 5HTOA 4ZXPA 1ECGA 2FJPA 3RVLA 2DPYA 4DIKA 1OAAA 4YV0A 2Q6VA 1RU3A 1NDHA 3JU3A 2R1ZA 4KO8A 4EKDA 1T8YA 5E2AA 1PI3A 2YNMA 4PBTA 1N8SA 1ZKDA 3R09A 4X20B 1UFOA 2IDKA 4GT1A 4H31A 4U7FA 3NHMA 1XPUA 2ZETA 4EL0A 5LIRA 1ZM2A 4IF6A 1Z73A 2YV1A 1QGDA 3TTUA 5IF3A 1AS2A 3MB5A 1J0CA 2DBQA 4PYIA 4FN4A 2JJ2D 3W0LB 4RSHA 4C1NA 3A2KA 1E9CA 1Q2UA 5FWAA 2VFAA 4KTVE 4DG5A 4YYZA 1Q7CA 5LMUB 1PJ4A 1VKJA 1A96A 1G19A 2FFBA 3BRQA 3KZVA 4KQJA 3V3TA 1ZM9A 3WL7A 2HCRA 4C0SA 3DFZA 4P0QB 1L6RA 5EIBD 4C89A 3BIOA 2KBEA 3K16A 3PFKA 5CFQA 5TPWB 3W1WA 5CB4B 1TE2A 1ZRHA 2ACVA 5HJ7A 1E7RA 1WDKA 4URWR 1O96B 4UHCA 1NWCA 3PX2A 2PH3A 5BUSA 5KQRA 4TZTA 4L8VA 3U7IA 4LMBA 2CMGA 2YV3A 1IMJA 3C74A 3NG1A 5JQGB 3V7UA 2JD0A 4U2KA 4IVPA 4LHYA 4Y2XA 1GP2A 4QBKA 4DYHA 1ZM4A 1DMSA 2IU0A 3P5SA 1RWMA 3OEHD 3IBFA 3SE0A 5D86A 2E1PA 4NS4A 1U1EA 4YBRA 3VSDA 2GGSA 5B7PA 2P5SA 4J6FA 4PZLA 4PYJA 1NLYA 3AHCA 5DDIP 2V7TA 1YMQA 1T0BA 1WXHA 2FY8A 3NAMA 5A2GA 3G7UA 4RS3A 3IA2A 1M7GA 1Q50A 2XNJA 4O4HB 1PL7A 1YA6A 1W5EA 2DFVA 1EP2B 4JVSB 4LOHA 3UB2A 2GXQA 4KN8A 5HKKD 4MR7A 3A05A 2VSNA 3KKKA 4LMPA 1Y5NA 4WQMA 3RYCA 4DCSA 2D7CA 3BSFA 2NO9A 4FQ8A 1AIPA 3GZNB 1E9SA 1TADA 2R47A 4OMFG 1RP1A 1Z4KA 2XUOA 3G9UA 1OYYA 3L7LA 2YHBA 1E4VA 2GESA 4ASUD 5BUCA 5FUQA 5TLSA 3L7OA 4Z6KA 3O4JA 2XKKA 1OBVA 2OENG 4DR5B 3ZR4B 4RSRA 3UWKA 1Q0TA 3AVOA 3CLSC 3MLBA 5KU1A 3U7HB 1ZR2A 4FB4A 4CIBA 1PJ3A 2D7JA 5JXGA 1J8VA 4ZYZA 1YQXA 3CA8A 1JFTA 2VHXA 3GGCA 2BD0A 3BA1A 2F4VB 2EFCB 4Y7DA 2OT3B 1QIKA 1L4EA 2HK9A 4AROA 2E89A 5T3YA 3VDXA 2DG2A 3B36A 1NU8A 4PFKA 5PNTA 2H08A 5CYGA 3FVQA 2A9RA 1NAIA 5LQNA 5AHRA 4RTPA 5BVGB 2D2IA 2VPIA 3W5JA 1FYDA 3ZXYA 2Q45A 4PG6A 5T4EA 3WRXC 4G3XA 4U6NA 1HYGA 5ECYA 3VISA 4BFXA 1YCHA 1NW4A 4FEAA 4BUCA 2AC2A 2JFZA 4DA7A 5A1JA 5C5IA 4PN3A 4ZI7F 1L8OA 2WYWA 4NOJA 3HJAA 2NZ2A 3NRBA 4AMGA 2YFKA 2EVWX 1DB3A 2DERA 3UJAA 4OHKA 1B23P 3O3NB 1QO7A 4Q1CA 1ADJA 1V9CA 1TCBA 3WBKA 1GPDG 4DN6A 1QV7A 1DRWA 2ZQ5A 3T1QA 4OQDA 1G59A 4HRYA 1GO2A 3LK7A 4MIYA 3IJPA 3NVDA 1MU0A 1G41A 1YQEA 3CUYA 4LYHA 2ZIXB 5C9ZA 3FWHA 1IY1A 1Z7WA 2GK4A 3BKWA 4CG3A 4F5EA 2R8YA 2VYVD 1IOVA 4FLFA 3WMFA 5HE8A 4DA6A 2PLNA 4NTZA 3A1NA 1U8CB 4LZNA 5G40A 5LWHA 1O0SA 1ORHA 3O4GA 4LYYA 3GT7A 1XAIA 4KXFB 4UNPA 1R16A 1NQAO 3VR5H 1MN6A 1G17A 3ZY6A 5KOYA 3FETA 4EYKA 4F9EA 1TMKA 4JLUA 4ZVPA 1SXQA 2I52A 3ZWVA 2G83A 1JDUA 2B37A 4EUHA 2VIIA 2XQJA 5F35A 5DULA 3UXEA 1GKYA 1AMUA 2X0FA 1QTQA 1SHJA 4E03A 2A1UB 4M6WB 3LP5A 4ZEVA 1S2IA 1ULHA 5MHTA 3KB1A 3TOZA 4C03A 2R6HA 4ZVUA 4YIHA 4MQUA 1FS4A 1MW9X 1FF9A 4GPTA 4JJIA 2CKMA 3UT0A 2YV4A 3VYTB 5G3YA 1ADBA 2YY7A 4RIGA 1JPNA 1QGUA 1UZUA 3L43A 5IAGA 3T1NA 4BLVA 2E82A 4TT3D 1F9AA 1P0PA 4ARUA 3BJRA 4E5SA 1N5JA 1LBQA 5E0OA 3TBHA 3SJUA 3KJFA 3ZOZA 3ONVA 3PZBA 3ZDEA 3ISJA 5A4DA 2FUKA 4Z0NA 4GR9A 2OWEA 1TEVA 1GGNA 2PGIA 1KIMA 1YUMA 2ATEA 2ZR9A 1RLJA 3C7AA 3CONA 3DBVO 1MAWA 1EX1A 2FE4A 2VOEA 1JHPA 1PQPA 2XXBA 5CJPA 3WHPA 5JNRA 4KE8A 5DK4A 3E9ZA 1Z34A 2BFEB 5DGXA 5BPHA 2AJ8A 4NBTA 3SC3A 3FWZA 4M8IA 5F2EA 3OHSX 4P3YA 1RWBA 1Y6QA 2Q3DA 2O2EA 1V8DA 2QD5A 2X6RA 3DULA 4NI5A 3DLIA 1Y1QA 3GIWA 2FH5B 4UJ5A 1RRKA 4ZU3A 2IIPA 2C61A 3PNVA 4MX8A 7ABPA 3OC6A 4OB8A 2BV3A 2JIQA 4EKEA 1HDGO 1HT2E 5AVXA 2X9NA 4J16C 3QTBA 4X61A 1I7NA 2EJVA 2FN3A 5KB3A 1PHPA 2Y0BA 5ESWA 2IDMA 1V71A 1X92A 2RCNA 2YZ2A 3JQAB 2CXHA 4MV0A 5JCJA 4LFCB 5KYWB 2DR0A 4MR8A 1EWQA 4R7ZA 2Y4NA 4MSUA 2BHSA 1VRVA 1GVHA 3VQTA 4QKQA 2XOXA 4BVKA 4ZK2A 5IYZA 5L3SA 2P6MA 3LP6A 3OF3A 1OX4B 5EEHA 2DQZA 4TV8A 4C2TA 2YRXA 2WU1A 4PQRA 3F78A 3NP9A 4MZDA 3E48A 4DLVA 2XKBA 5LOVF 1Q84A 2H1SA 3NHUA 4P5PA 3NPMA 5CW1A 1DG3A 3GDOA 5DCYA 3S0JA 4OJYA 2XODA 5EWMA 2ZRPA 1WV0A 1XP5A 4Z54A 1A97A 1J2YA 1TC1A 2HHLA 2IWHA 2GF2A 2ZSBA 3WGJA 1E89A 3BDAA 3GFQA 5C8YA 1W5FA 4BJ1A 1FVHA 4U0JA 3PUYA 5P8WA 5TC4A 2BC9A 3B3JA 5ICCA 4ZGWA 4E4TA 4J29A 4Q19A 4AKIA 4G25A 4YO8A 3ROEA 4HVCA 1WB9A 4C6TB 1YR2A 1XCMA 3JQFC 1E6MA 4UCQA 4Z2AA 4TXMA 3OE5A 2BGMA 2C7OA 1DJQA 1LV8A 3MT0A 4YJ3B 1L8AA 3SP1A 1Y1SA 2QRJA 3DNFA 4RZIA 3AHHA 4DFDA 2Y27A 1IIBA 3KV3O 3HJHA 4IZHA 4WPGA 1O4WA 5F23A 2ZI4A 3HM9A 1LTKA 1KH2A 2EWWA 1ENYA 2WSIA 5FUWA 4GU5A 2HJRA 2JHPA 1D1SA 1L4YA 2C9ZA 3BICA 4Z7JA 1T13A 3EVNA 4M54A 4YI5A 3B9BA 1OW3B 1CHDA 5CVEA 3BDVA 4UAGA 1COWA 2QWXA 4WDRA 5AVOA 3T7CA 2DFLA 3W6OA 2O8EA 4CKCA 1YJCA 2LD4A 1EXWA 1F0NA 2R7LA 5FPPA 1OWLA 3U1TA 1Z2OX 3HGQA 2OCBA 3F96A 3I1FA 5D3MB 3WNVA 2HK8A 2DU8A 2IYEA 1N1GA 1BDBA 3O3MB 1PGNA 4J0DA 3TLBA 4IDBA 1RFGE 2WHRA 1DOHA 5EE5B 4K9SA 1YAHA 1N7IA 5HDQA 4F7WA 4K9MA 1IY9A 2M32A 1D4OA 3VU3A 3ZTTA 3AF0A 3GFBA 3JARA 2VDOB 3H9CA 3A6DA 1SUDA 3LGSA 1YIAA 5TS3A 3W8EA 3ZGXA 5B4VA 2XUIA 2YFHA 4XASA 1BCSA 1NN1A 4Y6LA 5F76A 1HZZC 2GCNA 3L8ZA 5H7XA 3FD8A 4JI1B 1AH2A 2PY6A 3DQQA 4X8LA 4Z4IA 3JAKA 2O8FA 1WSBA 1RXWA 1UUFA 3GPIA 4B9EA 1XPJA 2NUTB 5H68A 3VX4A 3QFSA 4HDNA 1CB7A 2F43B 4XDGA 2HDOA 3DQZA 2G6BA 3KL4A 4EJMA 1EUYA 1N2EA 1SXJB 1W2WB 2DJ5A 4Q5IA 5EXEA 3WR5A 1HE8B 3ROQA 3GRCA 1DCTA 3FHCB 4LBWA 3Q8LA 1F2UB 1NGSA 3MJRA 4OCZA 3R7WB 4BQFA 4E5NA 1DBVO 1L9KA 1Z25A 2FWPA 5AW9A 2R79A 2O8CA 2F6RA 2IOFK 3HL4A 2CJYA 3CX3A 4PS0A 1WD5A 1U94A 4UDNA 1R8YA 1PGPA 1YKSA 1MC1A 4LJ5A 4E31A 1YQGA 4LC9A 5EY5B 2AEMA 1R0ZA 2C98A 1JR2A 4RNDB 4QXAA 2HJHA 3SOZA 2KLHA 3HKEA 1EI9A 3QOFA 3QGMA 1JILA 1ZC3A 3AIOA 2Y1CA 1VRWA 3B60A 3CMMA 3SIRA 2E5LB 1EG2A 1GGMA 4JFRA 4DGSA 2Q50A 3KP1A 1X1RA 3A6HA 3LFTA 3QHAA 4G9BA 4LJ8A 5EIOA 3CRMA 1H69A 2XGJA 1VA5A 1YT5A 2Q99A 1JHUA 1A7KA 1P5HA 4I1IA 3UO8B 1NBIA 1ZSVA 3VYUB 1SKYE 1TW2A 3Q5DA 3R7NA 3LVFO 1AXGA 1QKIA 2C3YA 2RGNA 3PC3A 3PNOA 1XVUA 4F6CA 4CMBA 5HQTA 5IABA 2GD6A 4C7JA 1C4OA 1VG9B 2AH5A 4YTEA 1J24A 3QEJA 3LXUX 4MINA 1V1MB 4WXRA 4R3WA 2OBBA 4XWOA 1QIEA 2Q9CA 4Z4HA 3AJ9A 2EYUA 4FFLA 3CNBA 5BWLA 1CUAA 1GZ3A 2F3UA 2LIPA 3FTPA 3GUCA 2P9CA 2D06A 2A86A 1JEQA 1T2FA 1EFKA 3PDWA 4N82A 5GP1A 3UK1A 2I76A 2PV7A 3R0QA 1T9CA 1L7XA 1MUUA 5MN6A 5KOHA 2W4QA 2NWQA 3ZHQA 2BI8A 3HO1A 1VL1A 4KXVA 4WKBA 2ZB2A 1YRHA 2B1IA 1Y4ZA 2O0HA 1KI8A 2QRVB 3U0VA 2KJQA 2XE8A 5I4IA 4DB4A 3IE2A 4H7IA 3STYA 1ZBDA 1E1CB 3I04M 4Q3DA 5DM2A 4UVHA 2VP0A 4OI2A 4AFNA 2R8XA 4XIIA 3N70A 5FWXB 5C46F 2D2FA 4D96A 1HOXA 4S0ZA 3W9BA 2RHBA 4WY8A 4W63A 1EFAA 4ARIA 3PDCA 2I2WA 1N5DA 1OA0A 4L8YA 3FZQA 4MVJF 5B37A 1FRQA 1JQKA 1U6KA 3HZHA 4TKLA 1VSUA 2BR3A 1Z0ZA 2CDAA 2B3DA 3DAYA 1VGVA 4B40A 1SUWA 1OWPA 1Z45A 2GHRA 4M1KA 4Q3EA 3PJGA 5EEGA 3GEGA 5F2OA 3L4JA 3WLPA 1ES9A 3F2VA 4LV6A 5DCLA 5U4XA 2YC2C 1DARA 4DVGA 3F49S 1XYYA 4BGVA 3A1FA 4UNQA 4XIFA 2CLOB 2EDCA 1TAHA 3FVVA 3TZQA 3BWMA 4IR7A 3GJRA 4E15A 3T41A 4ZOEA 4XIYA 4NAHA 5I3ZA 2IPNA 3PQEA 3FLMA 3FI9A 1I7QB 3W3AD 2HMWA 5H9VA 3WK6A 2L18A 2XDYA 1LQTA 3C6KA 3KBBA 4FONA 2P11A 3IMKA 1PSZA 4FNMA 4KGZA 3F7NA 1JHZA 4QECA 1ZH6A 4TM7A 3BG5A 3K1AB 4JBHA 3HBAA 3RAPR 3VVBA 3KUKA 2O2SA 4O0LA 4AWAA 5BVHB 1RMYA 4JXKA 4KQWA 4Q34A 1QAQA 4AO7A 3V1TC 3P4XA 4UZEA 1MBZA 2QMEA 4QUIA 3LX6A 5F78A 2J9YB 2BRUA 1QCYA 1WEKA 2AMVA 4FHEA 4G4SO 1KIFA 2YV2A 3LSYA 1TVCA 1QIFA 4ES6A 3TOSA 1FZQA 1LDEA 5FKJA 4JLMA 1B6SA 4ZCRA 3W8DA 2G36A 4K81B 4DJFC 1UANA 2VDLB 3CWQA 4G0QA 3A11A 5CP8A 2XUKA 5LQMA 1A9RA 2AN9A 4TV9A 4WCVA 3PXGA 1FQJA 3LYHA 1G5FA 1SA0A 1XDZA 2TMYA 4IV8A 2YOGA 5HQ3B 2AYXA 3GI1A 1V4NA 1XUOA 3EC7A 3EWSA 1WQ4A 3IV6A 5KCMA 1V9SA 3G0OA 4FOLA 3M6UA 2W6ID 4EFKA 1GUDA 1FYVA 4GMXA 4UKDA 1OB2A 2NYUA 1VE6A 4NS1A 1IXRC 4H35A 4IH4A 1SQGA 3UKDA 1XVVA 1DWQA 2VJNA 2J3MA 2BKAA 1E0SA 1T4CB 1YZYA 2C5HA 1PL8A 5JSFA 4WNYA 4PLHA 1AQNA 3GLIE 2ZAOA 2RMKA 3BIFA 3VKWA 4KYUA 3ZGYA 4PNZA 4YR9A 5DXJA 2AN4A 1O4VA 4HX5A 1RQGA 4A0HA 1YR7A 2PM8A 3KSDO 3L6UA 1DP4A 3TL6A 3C24A 2OFWA 1JWLA 2AZXA 4K40A 3QF4A 1Q5PA 2FZWA 2H9YA 1NLFA 4HJRA 4R8SA 1QONA 1VIVA 3GROA 4JVMA 5FOVA 4FIZA 4LF8B 2H7VA 1ZUNA 1OWNA 3TIXB 5JI2E 1Q95A 2O0KA 4KAXA 3FNFA 3PJDA 1XZCA 1YZUA 2IZZA 2ZIAA 1NW9B 3LYUA 4HX9A 1BKYA 1M67A 3RBVA 3DAOA 3FB4A 3KT8A 5A04A 1M1ZA 1SIUA 4MO9A 2H65A 2ZU0C 1EM8A 3G2HA 1C4WA 1IUOA 2I4NA 4Z7NB 2MSCB 5SZHB 5HOEA 4DCOA 2A56A 1MHPA 1PW5A 5ESDA 3OIYA 3T5MA 1UIMA 3KETA 3OC0A 4WXHA 4M7WA 5ABPA 2ACEA 4NZOA 3OQ1A 3P9XA 2NP6A 3ZVKA 4Z8XA 1SM4A 1U04A 3CV3A 3U7EB 2A6PA 4CT5A 4KWTA 3QBEA 4MW5A 3C4QA 3BX1A 4N0QA 2HL6A 5CT5A 3TNFA 3HV0A 3EEQA 1FUKA 1I4EB 4IG4A 1O0CA 1BVUA 1SUBA 1C9NA 3W4JA 4BVLA 3ZLJA 2GARA 2FN7A 4XWKA 2XQKA 1T0PA 3CH4B 2OFFA 4F5WA 4EUFA 1GFIA 2XMBA 2P3OA 1OH7A 2D2XA 3FCEA 3PFNA 1GUFA 1VCNA 3R7DA 3ETJA 4BNMA 3WP1B 4JGIA 3PB3A 4OU5A 3VVLA 4HAWA 1JIXA 3TO5A 5C5EA 1LBIA 1S1CA 3H1FA 4P4UA 4UM8B 1HDEA 1YR8A 4JYCA 4AYXA 1FFCA 2QD2A 4PXSA 4PTLA 3QELA 1TQ2A 2FSPA 1XKQA 4X92A 1J23A 2WNHA 2J5BA 2VLIA 4BMDA 4YONB 5L3ZA 4LZOA 1E6CA 3QU4A 1OA1A 5BWCA 3AIKA 4L7VA 5B55A 4G1CA 3T0GA 3EZ9A 2R44A 4H0CA 2HXGA 3ZLTA 1KJ8A 3NQ41 4WOPA 2VNSA 4HNSA 4KJXA 4NK5A 2B5WA 3G6WA 4MUXA 2ES4A 1YCFA 3S2SA 1NBOA 4JYZA 2CL6X 3QE0A 5EXXA 5TVGA 5GZ1A 3R9KA 2CVOA 1NRIA 2QIPA 2YXDA 3VOBA 4QNRA 1SUIA 3OZTA 1ENPA 3GZJA 4M8LA 3GLIA 4M0CA 3RKSA 3ELBA 1N77A 4DM4A 1E69A 1OFUX 3K70B 2O57A 4U7GA 4BKMA 3S7TA 1H22A 1MQ9A 2XVZA 1DZIA 2X9LA 2KQUA 1GA1A 2I2XB 2ZVPX 1U2SA 2JI9A 3RS8A 3HJFA 1RE0A 2Z98A 3Q7PA 4O4JF 1Z0JA 1N0VC 5G0SA 2VYFA 3K6JA 2I99A 3B7GA 1W1UA 2QRLA 2PD3A 4RD4A 5EE1A 1XDUA 4B3DA 3HYLA 5FV4A 5AJXA 4Z3OA 3ZY4A 1OVMA 2AZDA 4QULA 4BMXA 5IX8A 5ELXA 3IODA 5EJEA 2H48A 3LX8A 1SOWA 1NOIA 5C1BA 3Q7IA 1MP0A 3TLYA 4FOPA 2JVKA 3TQSA 4OA8A 5K3EA 2CDBA 2J5XA 5IWCA 1WXQA 2HU8A 2NTEA 5NLLA 2OYSA 4Q66C 4QD3A 5DNWA 1YDMA 5ALOA 2FWBA 3UUGA 4CWAA 5FQOA 5HM6A 5JZOA 2FF5A 3LM8A 2DQSA 4FHZA 1KRWA 3T4UA 1A50B 4JNCA 3PHBE 1TJ5A 4LWZA 4TWBA 5DOZA 4N01A 1Q1AA 3EAFA 1SQ6A 1CZHA 1T2UA 2HMAA 4RULA 4M1WA 3U4QA 4JB0A 1IN8A 2FFHA 2WWRA 5WRFA 2JAPA 3T34A 4CT4B 1KH3A 1RQRA 3OT4A 4RZUA 3RYIA 4E6EA 4Q9KA 2CLLB 4RK4A 3FMVA 5CNKA 4S1OA 1GQSA 1OYOA 4KCGA 3ZD8A 5ICEA 2IPMA 4YRRA 2EFDB 1Z6QA 4MR7B 2XMDA 2ZRMA 3RYCB 3U09A 2C2OA 2FPMA 3ISVA 4FWIB 1ZVKA 4QARA 3SF8A 5ADHA 4RCYA 2D1TA 3F71A 4JQOA 1DQSA 1KDOA 4P08A 1S3IA 2ZDGA 4UOZA 4R41A 4JI3B 1JR3D 3P20A 3EPLA 2PUBA 5EE9A 1E9FA 1UADA 4TX1A 4ZPXA 5H82A 2YASA 5BP7A 5JS7A 4YJ2B 5J2TA 4YHHB 3BL8A 1IJFA 1YRAA 3JQQA 1CJUC 1E6UA 1AGXA 4PYRA 2OKCA 3OETA 1ATIA 1SWVA 4QG7A 1JHRA 2IYXA 4LOIA 2J6CA 4RVNA 2JGMA 3Q6NA 4J0QA 3SYMA 1AOXA 5K9ZA 2GD1O 4V0KA 2O2HA 4F06A 5B1YA 4BV3A 3G1UA 1XZFA 1KZ6A 1ZHOA 5JJLA 2ZK7A 1DT5A 1HTTA 4J3NA 3LRPA 3WL4A 5C1OA 4KXXA 1GRRA 4L07A 1FTYA 2QXTA 5LC1A 4EUEA 1SAYA 1XZJA 1K2WA 3V34A 3N8IA 3ZU5A 5FR1A 1IUPA 4K6GA 4ERNA 3EPHA 4Y2HA 4B3SB 2P4HX 4OAQA 5EKDA 4X62B 2QUIA 2ZBQA 4RXTA 1QLJA 1J7JA 1H8HA 3ILVA 3PTAA 5FDFA 3OESA 5IDVA 1O9HA 5JAPA 1ZD2P 3TG8A 4DA0A 5KVVA 1Z75A 4NV0A 4ZRMA 3HWSA 1SUSA 3EXHC 1H4TA 3CMCO 3OQBA 4OK5A 4MPJA 2A0YA 2DRIA 3CWZA 5G2FA 4R2XA 3VYVA 3ORSA 2V3WA 4QLBA 4N5HX 3CKYA 1G2IA 3QVXA 3EZFA 1N2IA 4AKSA 4B81A 1YFKA 1J0AA 4BBAA 1RLMA 2OGUA 3QVUA 1ADFA 3R0VA 4ESHA 3K30A 4DDWA 4ZQGA 4IXTA 2DT8A 3K8YA 3IH5A 2PZEA 3TSWA 4MVJD 4M0DA 1TYEB 1U4OA 4PLTA 3OKPA 1FRNA 1ZDMA 4GZ5A 4U39A 5K8TA 1F4VA 2ABWA 3E7XA 3S5JA 4UZSA 1EMDA 1VPLA 1W5BA 1RAAA 2HGSA 3KAKA 3IX7A 3OHMA 5JSZB 1GYRA 2RK4A 3DVQX 2VXCA 1C50A 2PGDA 2V5AA 3VJRA 1QH1A 3RYHA 2YUIA 4IDPA 4S2UA 4NCBA 4Z2YA 3E7DA 5CUQA 2AK2A 4URYR 3EIQA 5EE3A 5D8DA 3EGIA 4QUGA 3Q9LA 4YDHB 3AONB 4GXNA 1YHYA 2XKJE 3BBPA 3E61A 1YR1A 2FG5A 3E27A 4XWTA 3MUNA 4AP9A 1QGUB 3COJA 4C7OA 1C3OA 3BMNB 4OH7A 4WJKB 4UTOA 3BWVA 5KDDA 2ZS8A 4GOXA 4AJOA 4ESOA 3VTZA 4ZO7A 2QZJA 1E5VA 1Y34E 2X8WA 3RVKA 2HWKA 2ZZKA 2BFMA 2B99A 1LSOA 4PYQA 3NM5A 2K2QB 2XUPA 3DMRA 5E7JA 1L5SA 2WB4A 3SQMA 3FW1A 3GUUA 3THXA 2NTVA 1K75A 1L7QA 2I1LA 3WIDA 2G77B 3H1EA 4H1VA 2VF5X 4M9XA 9LDBA 3U4AA 1PLJA 3PC8A 3D4BA 3PF8A 2MSKA 2P2YA 3EQ8A 4GC5A 3WX0A 4BFSA 3ORYA 4MEAA 3I8OA 2W7TA 4TL6A 3Q3CA 1RR6A 3M0EA 4E2YA 1MB9A 4AL4A 2QX8A 2XAAA 3N28A 5C8ZA 1DKOA 1O95C 3GPDG 3L0ZA 1N2GA 2JFQA 4BB9A 5B12A 3PWTA 3VHXA 1Q22A 2RKOA 3LDAA 2HKIA 4WA8A 1L3BA 3EY4A 3L8MA 2H29A 3HVRA 5IZ4A 3HA3A 4JJAA 2Z95A 4WX2B 4E94A 1NC3A 3JCZA 5C37A 1RAGA 3ZHOA 3COPA 1JEYB 1PV4A 4NHOA 4PIPA 4RMNA 5IYZB 2ZJ0A 2QMYA 2AB0A 3OBBA 5L3SB 4BJ5A 4YXWA 5ER9A 3QJGA 1X15A 1KYQA 3H8WA 3C48A 4TV8B 3IO5A 1QR6A 3S2UA 4YCLA 1DFGA 4D02A 3EFBA 1ZN2A 1EVQA 1CIVA 3RU9A 3UIEA 4ETWA 5AVWA 1GGHA 1SY7A 1XJ0A 5EWMB 4Q7LA 4Y3UA 3KRTA 3EDQA 3MAGA 1I4TD 5FRDA 5CDGA 1TCVA 1Q6YA 4GMFA 4N7BA 4MA0A 5JAIA 3K4HA 4MVYA 2QMOA 1PJCA 2I67A 3KOOA 4MV4A 5C8YB 5C53B 1NMQA 3C3MA 2J32A 2NW6A 4FWBA 3FUTA 4EX7A 4P0PB 2RBGA 3D7SA 1ZI9A 2AXPA 5EOVA 1R8SA 2H2DA 2Z6QA 2WAMA 3PEFA 5HF5A 3SG0A 4NCHA 4AICA 1FUYB 4HDCA 2IGTA 1OXMA 1P4RA 4MYRA 2XNDD 3ZW8A 4ZCTA 5KX5B 1EX9A 4IOLA 3TJMA 3AM1A 4I3FA 2R1TA 3C3CA 4YR7A 4TZ0A 3P9YA 5B6JA 4YCNA 5EUQB 1VZ3A 2IY9A 1KO1A 2LUOA 2Z1NA 4HO1X 3A9SA 4OXRA 4NZMA 1J06A 4S1WA 1MH9A 3CUKA 2CJXA 5CMLA 5CT4A 3VR3A 4XOIA 3KWMA 3C5CA 1E66A 4YMSA 4BNVA 2AWOA 3MD0A 2WUGA 5LB2A 4KNYA 3OA2A 3V80A 4BO2A 4QU0A 2V54A 4N5IX 4ZQIA 3VZRA 3LAWA 3WTCA 1P5RA 3WHLA 3P9IA 1OXKB 1WPQA 5EMHA 2O8EB 4CKCB 2DBRA 3GU3A 4L0CA 3MQ2A 4YQYA 3VR2A 2E6KA 4BVBA 4E5DA 2VP6A 1N2OA 1RC0A 3FPGA 5CVDA 3DTVB 2H2WA 3JPYA 3KPUA 1F9EA 4QGFA 4D82A 2GK6A 3ZG6A 4UM9D 4BNUA 3ZJYA 4CM3A 5LZ7A 2GEVA 4P35A 1IRXA 5D3ZA 2W4MA 3EZXA 1BXZA 1SD1A 3ZTWA 4QBHA 4RAQA 4KUHA 1HTWA 3JARB 4PSAA 5SY6A 3RVOA 1DZ3A 3VH4A 3NTVA 4H7FA 5H70A 3UAWA 3ZXUB 5JWRA 4R8MA 4YP7A 4WEOA 4UJ3A 1BWSA 1BCSB 3MTDA 2JKVA 5HMMA 3VJMA 3AQ4A 3K4PA 3QLVA 4UTNA 4TXNA 3QHQA 4WEQA 3QPWA 3JAKB 2O8FB 3ZJUA 2ZTSA 3G9ZA 4MIOA 2FMFA 3BCSA 4XEUA 5I51A 4RWEA 2V7GA 1G2QA 1RXEA 3G17A 3IJRA 4C3OB 4HDNB 3TVTA 3UV7A 1LPAB 1A5ZA 3GRUA 4NCNA 4B48A 3QTTA 2XR1A 5K4HA 4DR1B 3RYTC 3EG5A 2ISCA 2EHJA 5ALZA 3GLHE 3KR1A 3V7YA 4JOCA 1P7WA 3ZZ1A 3DHWC 3K0SA 2R6GA 5E7QA 2YY5A 3BWXA 5EJAA 4F45A 3ROPA 2G3DA 2SCUA 4KYIB 1VLMA 4DR2B 2O8CB 5JALA 1GCUA 2G4LA 1QF9A 2WP8J 1FNBA 1A2KC 2QT1A 5BRAA 3OCJA 2EF0A 4L9RA 5CA0A 1FSFA 4KHPB 2AX4A 4A8PA 3HKEB 4F5DA 1DOAA 2GZMA 3Q7QA 1XEWX 2P0AA 1KKMA 4G23A 1MPXA 2CJFA 3B53X 3IIEA 4R8RA 1EX6A 3VR0A 3ZQUA 3DMHA 1OFGA 4QYIA 2HWYA 3WYFA 4GEKA 1A4XA 3K09C 4DIFA 1FMLA 3V2HA 4LJKA 1ZOLA 3X1XA 1DJLA 4ZTBA 3EK2A 2IZ6A 2P1RA 1DDGA 5JJKA 1M6HA 4PQYA 1OJ7A 5A71A 2H07A 3AO0B 2QZPA 3O95A 3EZ7A 3ZBPA 3ADOA 2JFOA 3WGGA 3WV4A 3HL6A 4L3WA 4IJUA 1PS8A 3AY7A 3EXG2 4MV8A 3UWDA 1VI5A 3HXOA 1KDZA 1D7OA 3D4LA 3CB2A 4DG8A 1QM5A 3RSGA 5IC6A 4D7AA 3KALA 1FSZA 4JLAA 1JEQB 3T3HA 1ECFA 1L7RA 1O1YA 1UK9A 3A28A 3VBEA 1ZXXA 4JEIA 3VYRB 2A3RA 3II6X 4HLNA 5HM8A 5EKTA 5KOHB 1IDOA 4XR4A 5FI5A 1SC3A 2WSMA 4BKOA 3DAPA 1Y8CA 1A72A 3SJBA 3QPBA 3GGJA 4ALIA 4EABA 3D4NA 1ZD5A 4O33A 2IV2X 2LWIA 4EMUA 5MFPA 2EEZA 2I6UA 1TPYA 1P0IA 2HPAA 3TR0A 1UKVY 2ZR0A 4QODA 4ALLA 5KEIA 3E3NA 1J1ZA 5CBPA 1W0KD 2HU2A 2AJDA 1NJ5A 3D1VA 4CV2A 4KITB 7ADHA 2VJDA 2UXDB 1CNFA 1KJIA 5ALFA 3HY3A 2JJYA 5BSMA 2MSLA 1RLOA 4WFQA 1BIFA 1MEEA 1PS9A 5JHGB 1QG0A 5LXTB 1DTWA 3L9WA 2PE5A 1H2ZA 3NXKA 2GLUA 2WSLA 2C7GA 3WI7A 1EXNA 1ZNYA 2FCAA 5DSZA 3HLYA 3WLOA 3ZDFA 5KSYA 1GV1A 5J1SB 1TJYA 4U2FA 1M5RA 4ND5A 1U0NA 1MC8A 2YZ7A 3ASUA 4RHEA 4GPIB 1F7VA 2AC4A 2G1KA 2NXCA 2VQFB 3ICCA 3VTAA 2DPLA 2WWIA 5EZYF 2IYRA 1QIMA 2YV5A 3D4IA 4N8SA 5ICSA 1YA4A 1L5ZA 3CH7A 5DGDA 1PJZA 4BMOB 1H9AA 2FOXA 1PFYA 1TM4E 5FULA 4MV1A 5JMPA 4B7XA 2JHAA 2FK7A 3ZU6A 4IY1A 4CF4A 1H0RA 1JLLA 2HFKA 4ND6A 4UUNA 4PR3A 3P2KA 4YAFA 3OZEA 1ZIOA 2LP4Y 3G59A 4O5AA 3E9MA 2FB9A 2B1JA 3EEBA 4F2HA 2ZSKA 5HW0A 3Q98A 2QG9A 5HS6A 3RC3A 4QFBA 3P4YA 1AQUA 1B73A 1RI3A 2IIQA 3GLHA 3H5WA 2AOVA 4KMOA 4Y0AA 3ZCQA 4GLOA 4BJ3A 1JKMA 2BI7A 2TMGA 3KKQA 2EBHX 4IW3B 4P7BA 5H81A 2QM0A 3M5PA 2XPCA 2GD0A 3EIUA 4FP9A 2P69A 3ZYZA 1PZHA 1SZJG 1LBTA 2XF8A 2VPPA 4JXXA 2JLBA 2OTCA 4MS3A 3C16C 3MTGA 3RFXA 3WB2A 4WMLA 2IOFA 3U4CA 4EF5A 5M7EA 2Q9UA 4DEXA 4O4LF 3MUEA 1O77A 2GERA 3DEJA 1TD1A 4C0QC 2F9MA 2Z56A 2FFRA 3K6RA 2PQ2A 1RLUA 3QW2A 4LK3A 1MVOA 3E3LA 3UH0A 4BX8A 4PYKA 4D3ZA 4KXLA 3FF1A 3PC2A 1W75A 3AESA 2ZCVA 3A3PA 2GZRA 4Q03A