1N2OA

Crystal structure of pantothenate synthetase from m. tuberculosis, low occupancy of beta-alanine at the pantoate binding sites
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
286
structure length
279
Chain Sequence
PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pantothenate synthetase
publication title Crystal structures of a pantothenate synthetase from M. tuberculosis and its complexes with substrates and a reaction intermediate
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 93
structure length 279
sequence length 286
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2002-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 1n2oA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1n2oA01
5TS2A 4UZFA 4MUKA 1N2BA 1IQ0A 4ND7A 4ZT3A 2A88A 1TYCA 1JIKA 3DO8A 2WB2A 2D54A 2A84A 3ND6A 3PXUA 1N3LA 3INNA 3SP1A 1O97D 5FNZA 1GAXA 2IJGX 4TS1A 1YIAA 1G8FA 2J08A 2H29A 1H3FA 1U3CA 2CYCA 3P0IA 3HGMA 4Q93A 1MAUA 4MWCA 4R2LA 4JXZA 5J58A 3RJZA 3A4IA 3CLRD 1T6YA 2QTNA 2A7XA 3ND5A 1M8KA 2QJFA 2ZUEA 4U8HA 2PIDA 4ND6A 1JEDA 5LFAA 4YBRA 4MW1A 1JIJA 1PG0A 2R5WA 3DLAA 5DK4A 1MBZA 1WQ4A 3A05A 4HJXA 3UMVA 3P0HA 4G6ZA 3PNYA 2EJCA 1VBNA 1K4MA 1KQNA 1EXDA 3X1JA 1O94D 1EJ2A 4J75A 4PY2A 2D13A 1N2EA 1G59A 4G5FA 4DJAA 3IUBA 1ZH0A 1J09A 2YWCA 5J59A 3ZIUA 1N1DA 4WSOA 1IFXA 2QTMA 3L93A 4HK4A 1M1ZA 3ZJVA 1KQPA 3ZXIA 1CT9A 3K32A 2X1MA 3IOCA 2CYAA 2QJOA 1HYBA 5HG0A 4MW0A 1WXIA 3JXEA 2J5BA 1I2DA 4ZCRA 5IHXA 4I6JA 1KKUA 4CQNA 4NDAA 1NUTA 1EUYA 1K4KA 5HUHA 4MUGA 1VL2A 3E27A 1LW7A 1F4LA 4MQ6A 4F3RA 2CV1A 1M8JA 4MW4A 1QU2A 4RUKA 1GPMA 1NURA 1UFVA 3ZXSA 1P7PA 4X0EA 2OQ2A 4MW5A 3TS1A 1OD6A 1IQRA 1VBKA 2DETA 1N2JA 3U1VA 1NUSA 4ZCQA 2DXIA 1K97A 2YXNA 3TNJA 4ZCPA 5IJXA 2GKSA 3ZUGA 1O0BA 1O97C 1GLNA 1EFVA 4MW2A 2YY5A 1M83A 2PG3A 4MVCA 4PBRA 1WJGA 3CLRC 3N05A 1JMVA 1PFYA 5TEWA 1O96B 1KP2A 2A4MA 3G59A 2QUJA 4ZT5A 4OUDB 3CVUA 4EG3A 3LOQA 3AG6A 1U7DA 4U7JA 3SZGA 2BYTA 3FWKA 3N2YA 2E18A 1IVSA 3ZJTA 1MB9A 4ZT4A 1ZJWA 1YUMA 3COVA 4MUHA 4XSVA 1I6LA 2PFSA 4NAHA 4PBSA 3HL4A 3MMXA 4HJRA 1O94C 3HMQA 1GTRA 1TYAE 3H05A 4KKVA 1R6TA 3H99A 1JZSA 2V0CA 3F3MA 1KR2A 3FH0A 3I05A 3KT8A 3KFLA 1DNPA 1MRZA 1GZUA 1IH8A 1O96A 1WXEA 5DASA 3CVWA 4OUDA 1MAWA 1J70A 2E89A 3SEZA 5F23A 4EG4A 4MW6A 4ZT7A 1F7VA 4MWEA 3SEQA 4KR7A 1J1UA 2XRYA 1QRSA 1NUQA 4NAUA 1KAMA 2Z08A 4R0NA 3KT6A 3TQOA 2O8VA 3AKZA 1XNHA 1WKBA 3NBKA 2HMAA 1JGTA 4MUFA 1EFPB 3D6VA 4FZJA 1ZH6A 1NZJA 5H16A 2XRZA 4F4HA 5TGTA 1D2RA 3IVGA 1N2IA 4JFAA 4EG1A 3SDBA 5KHAA 1X8XA 3NV7A 1WXHA 4K03A 1U3DA 3RK0A 3IVXA 3PRHA 2DLCX 2X3FA 2CV2A 2A86A 1LI7A 1T6XA 3FY4A 3IOBA 3IH5A 5J5AA 2OV4A 1PFWA 2DERA 2DPLA 4BWVA 2X0KA 1V47A 1T6ZA 1TFUA 4MWDA 3IVCA 1Q77A 3K9WA 4RPIA 3P0JA 1QRUA 1KP3A 4ZT6A 1MJHA 1QJCA 2J4DA 1EFPA 3H9BA 1JILA 4MUEA 1VLHA 1N2OA 4K0RA 5EKDA 4EG6A 1RQGA 4DDKA 1XNGA 3VRHA 1N77A 1EFVB 5KCMA 5DEOA 1TYDE 3ZGZA 1PG2A 3S3TA 1FFYA 3QE4A 4DDHA 3X1KA 3L92A 2NZ2A 1IQUA 4CT0A 1PFUA 3HZRA 5LM3A 3A2KA 4MVYA 1KH3A 2CUZA 4DE5A 1OWNA 2J09A 4G5YA 2H2AA 3CA8A 4MW7A 2E0IA 4MUIA 1J20A 3HFJA 2QUKA 4NX2A 1S4MA 3G6KA 3H9CA 1COZA 3FHJA 1QRTA 1V8FA 3BL5A 2QTRA 2VTBA 2VXOA 1T9GS 1BS2A 3OP1A 3ISJA 1H1TA 2PZ8A 4NZPA 5FO1A 3ZJUA 1U7XA 3COWA 1QNFA 3AIIA 1M8PA 2AG6A 4EG8A 1N2GA 3M5WA 3N8HA 1VBMA 3TQIA 4KPUB 4WNYA 2RE8A 3A04A 1YIDA 1H3EA 3MLAA 2AZXA 3FG9A 3RHSA 2DEUA 2O5RA 5AHWA 1Q15A 2JAXA 4GRIA 3NBAA 1MOPA 3TZEA 3RBAA 3CR8A 1EE1A 3G5AA 4E1AA 1NUUA 3PNBA 2JANA 3CLTD 3UC5A 3X1MA 2CV0A 3MUEA 5DB4A 4DLPA 2BTEA 4MAFA 4PBTA 3FETA 1XJQA 1TYBE 5K0TA 4MWBA 1OWLA 1G8GA 3D6UA 4KPUA 2WSIA 1MB2A 3C8ZA 3GLVA 1YUNA 1NSYA 2DUMA 2ZP1A 1R6UA 2DR2A 4MULA 1YI8A 4MVXA 3DV2A 4A91A 5LLTA 3IMCA 5FO0A 3LCJA 4YP7A 2CT8A 4EGAA 1WQ3A 3QTBA 5BNZA 1F9AA 2AKEA 4I6EA 4AS1A 2V0GA 3RK1A 2NSYA 5K0SA 3COYA 4I6GA 4MLPA 4AQ7A 1ULHA 3GUZA 4J76A 2J07A 4EF6A 2WQ7A 3DPIA 4ARIA 1I6MA 1NI5A 2CFOA 4P2BA 1X6VA 4ZCSA 5TEVA 2PZAA 3AG5A 3IMEA 4MUNA 4YP6A 2HZ7A 3N9IA 4QREA 1OBCA 5JBNA 4QRDA 1O95D 2CYBA 4DNXA 3KT3A 4XFDA 3P52A 1LI5A 3Q4GA 4Q16A 4JXXA 3COZA 1A8HA 3ELBA 1J21A 4EG7A 4L2IB 4ARCA 2A1TS 4OJMX 3IMGA 4EG5A 1T9GR 1SURA 3CVYA 3IUEA 1Q11A 3CLUD 1EUQA 4NATA 1JIIA 2VTBB 2X1LA 4MW9A 2A1UB 4R2MA 2JA2A 4MVWA 4MUJA 3SZ3A 3ILVA 4U63A 3CLTC 5H7XA 1N2HA 3TZLA 3Q10A 3UOWA 2CSXA 3OTWA 2B7LA 1Q19A 1O6BA 2IELA 3IODA 1M8GA 3FOCA 1TEZA 3LE8A 1OWOA 1GN8A 4YMIA 1NYLA 3UY4A 2IP1A 3UK2A 4EFKA 3CLSD 4H3SA 1KQOA 1WXGA 3FNRA 1QU3A 4L2IA 1O0CA 1N78A 1ZUNA 1OBHA 1M8FA 1R6XA 2C5SA 1MC1A 1PFVA 1WOYA 1IRXA 1G8HA 1WY5A 2A1UA 2QJTA 1ILEA 2RD2A 4HPWA 2YWBA 5HUJA 4GU5A 2E21A 4CDNA 2EL7A 3AFHA 2TS1A 1QTQA 1TQ8A 2Z3VA 1GTSA 4YP5A 3MLBA 1O5TA 2HGZA 3IOEA 3FI0A 3PNVA 1FYDA 2GM3A 3VGJA 3QTTA 4ZT2A 1JHDA 1O95C 1QQTA 1KH1A 3KT0A 3IDFA 4JZYA 2I1LA 3Q12A 2PZBA 1JECA 4DDMA 1K92A 3VU8A 4JYZA 3GMIA 1JZQA 4UZEA 4CDMA 1KH2A 2WQ6A 3H97A 4S1OA 1H3NA 3MXTA 1OWPA 4ZCTA 2D5BA 4XFJA 4KR6A 1J1ZA 3CLUC 3FDXA 1F7UA 2G36A 2GOYA 3ND7A 3SYTA 3FIUA 1WXFA 2ZUFA 4QBTA 2Z09A 2QUHA 1YULA 1KAQA 1KORA 1NP7A 2A1TR 1OWMA 1WZ2A 3CVXA 1JEEA 4KR9A 1NUPA 1B6TA 1U0BB 3HV0A 1I6KA 1IHOA 3RFFA 1XNJA 1Y42X 5KWVA 1N75A 2PXHA 3CVVA 3CLSC 2QUIA 3AL0C
chains in the Genus database with same CATH superfamily
3PNMA 3O2JA 4RTRA 5KJCA 1N2BA 1VC2A 1TCBA 3ZZTA 1IAVA 4S04A 3B60A 2I6FA 1VYVA 3O0TA 5IUKC 5IKPA 3DO8A 5D2CA 3C4JA 3LWZA 5BW0B 4R8VA 2ZCJA 5LQRA 1JA1A 3BJIC 4DC9A 4DJDC 1SU7A 4IIJB 1G8FA 1I01A 3DLPX 3GUHA 5BNIA 2Q49A 1XU9A 2AC4A 4QWWA 3SEAA 4MUYA 5CLIA 3DM5A 3EZYA 4FZRA 5BW5A 1SKBA 1ZL2A 4GKBA 4AIIA 5EFOA 1NW6A 1T36B 2P8JA 2Q5QA 3R6WA 1G8MA 4UNQA 2QJFA 1M2KA 1T26A 4NZZA 2WA2A 4LIPD 3E82A 1UPTA 3BCSA 3H9QA 3RBVA 4YXWA 1WMBA 3BIFA 5H5JA 3C1UA 4FNGA 1EPUA 3DL7A 4CODB 1ZJ5A 3CJRA 3A05A 3CX6A 2W2NA 3GELA 3OFKA 1FC0A 3S1LA 5DULA 1K6MA 2H0QA 1JU3A 2P2CA 3GEHA 3NWBA 2AQKA 4L57A 2EJCA 1WNTA 4YAGA 3ANNA 4MVJE 3S6JA 1K4MA 4OLFA 1VPVA 3UK0A 1XXHA 5E8RA 3F3KA 3VDXA 5BYJA 4X71A 4ZO6A 5JS2A 1S8OA 3AR9A 5KNBH 4G5FA 2XCIA 3NBFA 5JH7A 3OC6A 2F8TA 2YXEA 1YR1A 3DL4A 2XCSB 5F3RA 3TOSA 3EZFA 1HE1C 3NHSA 2CJYA 2YR0A 4WSOA 1P4JA 4G4GA 5LZ5A 1H4SA 2UXDB 1C7ZA 4Y7CA 4M53A 4OKNA 4KXYA 2FRXA 3MOSA 1H8EA 2XB4A 1V9CA 3Q11A 4HSGA 2BCGY 4MVJG 2EERA 1Z45A 1KOLA 3I5MA 5FBWB 2W93A 4OJYA 3UFXA 1G3IA 4JWTA 4PYMA 4DV4B 4CQNA 4MUAA 4X7RA 3MINB 6Q21A 3HYRA 4E21A 5AUQA 4F3RA 2XAAA 4X91A 2PYDA 3PQ8A 3D9QX 2BUAA 1NP6A 1DJOA 1GPMA 2J0EA 2IX3A 7MDHA 1E7SA 2RBKA 4OBXA 5AT1A 1R50A 4MVJF 4H4DA 4CKWB 4L8WB 2MR5A 1E2LA 1JQLB 1ONOA 3VU0A 2OBNA 4QIHA 4AS2A 2ZVDA 3E18A 1N2JA 1KYYA 4LW8A 3MK31 3CI0K 1IUPA 1EDBA 1VCHA 5CH8A 3GJ5A 1ACLA 2QB5A 2RIPA 2W2KB 4WESB 2FZVA 2P9GA 4KEAA 4DV2B 5IJXA 4MQ5A 4ID9A 4D98A 5LA6F 1DAPA 1VI6A 4S0ZA 2XWQA 4CG2A 3DPSA 3OE7A 4Z99A 2DFVA 1V96A 3I92A 4WZAA 4BVLA 3LPDA 1MQ9A 2HU7A 2H1OA 4W7IA 3DKPA 2BMAA 4EX7A 5F52A 1RQLA 4N40A 2DR0A 3PUVA 2Z4SA 2UVPB 4A8HA 1N3YA 1CQJB 2CL6X 3CIFA 1CP2A 4WLNA 5L7YA 4ZD6A 1N8TA 3DMTA 4LEIA 1EUZA 2WLSA 3OWOA 2AW5A 4OUDB 1KI9A 4B3IA 1QYWA 4JBGA 2X8WA 5A0FA 1U7DA 1QB8A 1XEWY 2EBHX 1BOFA 1KEZA 5HOEA 1RS0A 2PZMA 1IUNA 3A9TA 2NTYC 2WU0A 3LLUA 4QG7A 3WWZA 4F2WA 4MKZA 5I4BA 3C5HA 2WSBA 2BEUA 4QOSA 2KBEA 1C7RA 4A0GA 4F04A 5ETJA 4W7SA 4G0NA 3G9QA 4OB7A 4G25A 4CR7A 4CYMA 1LWNA 4GR5A 3MMXA 5IYZB 2LE0A 5LDDC 4WFKA 1NW7A 2I87A 1DMRA 2ODBA 5E3HA 4D0NA 1EVYA 1Z08A 3A6LA 3L6RA 3LUCA 3D0KA 3F4BA 4KQIA 4X60A 1CUVA 4C2BA 2Z56A 1Y4UA 3T5MA 2O8FB 4ZFNA 3KUKA 2AHOA 2XQIA 2QVCA 3OZDA 1KR2A 3ABZA 3AB3A 4N0MA 1L7PA 1NY5A 3ORSA 4R81A 4TMTA 1EUDB 4E46A 3FTFA 2OEPA 2F1RA 4GLJA 2WEKA 3U3ZA 3U4MA 1FU4A 1KYVA 3D8SA 3OPYA 5CXQA 2GTIA 2ZJ7A 3MFYA 4CCYA 4D9GA 1MAWA 1DEKA 1XMPA 2Q3HA 4J4HA 4A4DA 4IINA 2QVZX 4EG4A 1GCOA 4MCAA 4MWEA 4Q9DA 4ZVKA 4CI9A 3IAXA 1TT5B 2F62A 3PXAA 4G2NA 4LYGA 5F1OA 2ZJ6A 2HO5A 3T9AA 5KYNA 3WSVA 4O2BF 1I0LA 2AEJA 1X80A 4IZOA 5JMTA 2O2YA 1A2QA 3KHKA 3DTVD 3OZVA 4EZEA 2VAVA 4KGZA 1THGA 1Y3CE 1UK6A 2ZBQA 3PV0A 3VZQA 1LJLA 2GJ9A 4MZXA 5JAUA 1ZSVA 1SUAA 4G0QA 3KQOA 4A8JB 4L50A 1XKQA 3KFVA 5EIAA 1DCMA 2YFHA 4C07A 3L41A 3A11A 2GLXA 1Y3FE 1PR2A 4W9RA 3CZ5A 3K30A 2XT9A 4TKUA 2ON6A 4ZQGA 1BW9B 3KVOA 1P1HA 3AP2A 2WUWE 5GZ3A 3WDKA 2OB2A 4X1YB 4OLAA 4YUYA 4AURA 1SCQA 2QNBA 4W8HA 5KC8A 5G4KB 1AHNA 3IOBA 2GYYA 4F6LA 1Z4MA 4U1RA 3AVUA 3NVAA 2QMOA 4I4IA 1XXHE 3WYCA 1W87A 2PZFA 3IDZA 3HCCA 3BRQA 6ABPA 1DDOA 1AMNA 4H1HA 5AI8A 4MRSA 2GZ1A 3BMCB 1KK1A 3OEED 3AF0A 3S8MA 4BV3A 2F43A 5C37A 2DHDA 1XRSB 3H1GA 5T4HA 1K0UA 1MJHA 2NXNA 3CR7A 3QFSA 4O2AA 1F6WA 4OBWA 4PO9A 1EFRA 3DVRX 3AEZA 3ES9A 1WA5A 2AR7A 1N2OA 1I0IA 3ACBA 2WBLC 1C7FA 4ZVNA 4MV1A 1NR5A 3ZLBA 5BSEA 3FR7A 4P3NA 4N8EA 3W2GA 1NJ5A 2B0CA 2VHCA 3QBEA 2HRCA 4Q6BA 3MWFA 4ZV9A 4L9WA 2E82A 1Y1LA 1JVBA 1ZM7A 2AOTA 3RIGA 4C7MA 3Q87B 3PUXA 4BFWA 2RGWA 5KOJA 3KQSA 2D2XA 4MB2A 1FFEA 1D6JA 1MVLA 3LVQE 1VDMA 1IQUA 1M2FA 2CLKB 3HCAA 5HGJA 1HL7A 1KOFA 1ZKDA 2HF2A 3P9ZA 5F9MA 4D57A 1BS9A 4ER0A 1H0KA 3PE3A 1HZZC 2FQXA 2Y92A 3OQIA 1PQWA 1QE0A 3BB1A 4MW7A 4NU6A 1EFLA 5C53B 2XMSA 1EEXB 3JQBA 1FRFS 1D6SA 5ESXA 1DBWA 3N0RA 2JAUA 3OCUA 2I6UA 3QEMB 3T9CA 1VIMA 1VSVA 2OSBA 2BR5A 4P86A 1XTZA 2PZ8A 3TTSA 4EFLA 1ZD9A 4X8OA 1PGNA 2F1OA 3S70A 1LWOA 3MGBA 2PD4A 5G0VA 4BO2A 4D6YA 1RZRA 4YA6A 1KSHA 4LDQA 4Z4GA 2XITA 1X0XA 1YDMA 2QR3A 1H2XA 2R7MA 3BXHA 3O3MB 4LI3X 4N5DA 2E5FA 4OQXA 5CDYA 4BLSA 2FNAA 3A04A 4WZAE 1H3EA 2EG5A 4LJ7A 2V7VA 1BMFA 3O9VA 4GE0A 5IPFA 2C4MA 3RHSA 1G64A 3A2LA 3CX8A 3QQPA 5AM2A 4GRIA 3TSAA 4ZGWA 5A0TA 2M98A 4XTCS 1UFOA 5AJUA 2C58A 3TZQA 2R8OA 5EA2A 3ZDFA 1MOPA 1RSZA 2PH5A 5LU8A 3AKEA 5CX1A 3BEDA 1P7CA 4G5HA 4D0RA 1QR6A 4KLAA 1MB4A 2C8VA 2RGNC 1V11B 2XMCA 3CLTD 4PZYA 3ICPA 4C0BA 5K0CA 4LYJA 5M34A 4FD2A 1FSZA 3FPSA 1RCUA 1LPSA 1GFWA 3B6IA 1I94B 3AESB 2ZSJA 2C7PA 1E2HA 2OLJA 2QRVB 3RAJA 2BKVA 1JIQA 2BWJA 3BBLA 4KMOA 4NS1A 2IEZA 1XJQA 2NO5A 4OREX 1VRWA 4W4TA 3E1SA 1V7PC 2R6HA 4YXFA 1LK0A 1IMJA 3KUXA 2IUEA 2QN2A 4EA9A 1XZDA 4S05A 4I4TB 4INZA 4PZAA 2IF2A 2R0QC 1YUNA 4B85A 3NI2A 4BMOB 2DR2A 1TE2A 3R41A 1AQIA 1J56A 4GSLA 4RF5A 3RF6A 4F5ZA 1XAJA 3DV2A 4TYWA 1WTAA 1ZZGA 2XWBF 4BN4A 3LCUA 3UCEA 1JMKC 1UOOA 5I8ZA 5JJCA 5HIJA 1NLYA 3QTBA 1BO6A 1H2FA 1P5JA 3EZ2A 1CY4A 4K81B 2B5VA 2J6IA 4DB2A 3O74A 5H9WA 1LJ8A 4WBNA 4ER5A 5DLPA 2E5LB 1RHMA 3H4TA 1YQQA 3QKRB 3H5RA 3HJCA 1ODSA 3PICA 4MROA 4ZARA 4QJ3A 3PJRA 1KJWA 2E2WA 4XWWA 3DFFA 4D3XA 5ESWA 1AGNA 1K63A 2CNOA 2J07A 3DDCA 2EZ4A 4I5GA 1E7QA 3NHLA 1GGFA 4BB5A 1OZHA 2WSLA 2R6GA 4RZ2A 3TLAA 4B8ZA 1DPGA 5ARCA 3NWEA 3P1JA 4UNSA 4FDAA 3ZD6A 2DMRA 3TLMA 4YP6A 3IPYA 2OLEA 4FIZA 3REOA 4LA4A 3TIIA 1QV6A 2EJUA 3KBOA 3LNTA 4OIMA 5LQDA 4C6HA 2RGGA 4L28A 2C4WA 3EA5A 2GHTA 3HUEA 2F8MA 1SHKA 3KT3A 4POAA 2V3WA 1I2CA 4BQQA 1OZGA 4UTNA 1UPCA 2XKJE 1MZVA 2JFFA 4BO4A 2B4KA 4MYRA 3BM5A 2VT3A 1EK5A 2IHTA 2NX2A 2J1LA 1JDVA 4FDMA 4Q48A 3TE6A 1GZ7A 4B48A 3D6FA 2QL7A 1L1FA 4US0R 1RAAA 1XCGB 1L6RA 1PEKE 2Q0SA 3MCTA 1EUQA 5WRFA 2OMKA 2DWUA 2FXIA 4H77A 4DSZA 1W36B 4D9JA 1AUXA 1L1RA 1WPRA 4C5AA 1DZ3A 5HFAA 1TJ3A 3I72A 4DPMA 2Q1WA 3W0LB 2AL7A 3LM8A 3PIIA 3OEEA 4MRMB 1JAZA 2PZKA 3MSXA 1CZOA 3NDIA 3UCXA 3UN1A 4EECA 3FDIA 3OJEA 1HOTA 1Q19A 3IL2A 1T1RA 4QJBA 2O8CA 3C8UA 4BVAA 3D2CA 5IAOA 4HT3B 3ETCA 3THSA 4RTKA 2NVUA 1GT6A 4Q5IA 4ZREA 4L8LA 3WGVA 1J0AA 1K6JA 3OLQA 4JR0A 3L0PA 2D2VA 5C1DA 1KI8A 2EVWX 4YJDA 1KRHA 1KMHA 2H7CA 1MFPA 1MMFB 3KAJA 5KVQA 3RTGA 4BMSA 3HCDA 1BROA 2Z95A 5HXAA 4KGXA 1DLIA 5IDVA 1L5HA 3RSQA 2ERYA 1T8SA 2OAP1 3ZGNA 5FA6A 3B20A 1M8FA 2D6FA 1XJ5A 1G21E 3IQEA 1QLJA 4NZOA 1KY5A 3T5PA 1I5EA 5T4BA 3WJ7A 5FHQA 1OAAA 5HS4A 4TL6A 2Z04A 2ZG6A 3A0RB 4K46A 3SX4A 2C29D 3CTMA 3QBJA 4LOKA 3DEAA 3ORYA 1LNQA 5SZJA 1GA1A 1CHNA 2GILA 3AEQA 1I51A 4M1YA 5B58C 4L5JA 2OCXA 2RGAA 2QAIA 4JBWA 3ELYA 1W44A 2EL7A 4AJ2A 3HKEA 3Q9NA 1HK7A 2Z4RA 4RU1A 4GQAA 3HGQA 4UUMA 1P2UA 3S2FA 5SYAA 2JI8A 2Y1WA 4XX0A 4N48A 3M6VA 2PZGA 1TA4A 2NTJA 4FK8A 2VYQA 3MC1A 1OI4A 1P72A 4JJ7A 2ATIA 2V45A 2HBRA 4KH0A 1P1BA 1SELA 2K2WA 3ZX4A 3ZCQA 1CQZA 1NV8A 1T9ZA 1YU9A 3EUWA 5IM4A 4UXJA 2WMNB 1PDWA 5SY6A 4OLJA 4J3JA 1QOZA 3ZY2A 1PCXA 3RABA 1UK7A 4Z4EA 1L3IA 2Z9CA 2J3HA 1HI9A 2ZSDA 2VXYA 2DFLA 3VMFA 4YCCA 1N1MA 2B8TA 5DX1A 3RNLA 4B5KA 3AW8A 1JTEA 4XUGB 3TTUA 5A5VA 3WZ2A 1H8HD 1ODCA 3BZBA 3HO8A 4LSWA 4M0UA 4M46A 5IAEA 1K92A 4D4HA 4FDTA 4R54A 2QZSA 1BS1A 1ZD5A 3TCXB 4K3UA 4PYOA 4L0MA 1GKUB 3RADC 1H3NA 2BJVA 4YFVA 2JJQA 5FWNA 2EBUA 3SBOA 1Q7GA 5KVVA 2H08A 2PRZA 2YV5A 4JP3A 4R1MA 5FULA 4X1OA 5BWNA 4GPTA 4WJZA 3FDZA 4UQLA 3BX1A 2JH8A 3ND7A 3RR2A 3FIUA 4AJEA 1CZHA 3MCZA 3O3OB 3NP7A 5G4LA 3GYGA 3AM1A 1F1JA 2I0FA 2IHJA 4GBJA 3SHWA 4BXOA 1WZUA 1TU0A 3LHFA 4F5WA 5DT2A 4LNAA 3H2BA 3TGLA 3ZWOA 1LTKA 5DE3A 3PUYA 3GVCA 1ZM3A 1SC3A 2XBLA 4FEAA 1XZAA 3IC5A 1Q6YA 1J8MF 5BSMA 4X65B 3BD7A 2LIPA 3PIDA 2EF1A 1U9CA 1YA8A 2OL4A 1RQ7A 2WIAA 3QX3A 2VPWA 3W6ZA 4F92B 1ZOLA 2O2DA 4D79A 5KTMA 1NVKA 3MCUA 2ZYIA 3L7OA 3LBFA 2R47A 4MUKA 4JFRA 2Q3EA 5DIFA 5EAIA 5CHEA 4ZEOA 2WD8A 4ND7A 2CJFA 5L3RA 1Q50A 3C45A 2GD6A 4Q9IA 1SB8A 5DPMA 2J0QA 3JW8A 2NU8A 3UMSA 4RS3A 2WB2A 4J2HA 1XXHB 5TSDA 3ZW8A 2JAOA 4M9ZA 3VR6H 1BHSA 1VKOA 3EWNA 1LZKA 5JH7B 4N3CA 3V8VA 2RKWA 3WK7A 4BO9A 5BSFA 5ALXA 1E9EA 3A58B 3PEVA 4OKIA 4QFDA 3VX3A 2QTNA 4Z51A 1QP0A 1FUEA 4AP6A 4IQGA 5EQDA 3S5UA 3A4YA 1LDNA 1KXJA 4XB1A 2A0YA 4OI0A 2JVIA 2V6MA 3UJCA 4KCGA 2XUPA 1ZL0A 2HOQA 3UFXB 4GUAA 1ZHOA 1C41A 1JIJA 2V9ZA 3L7YA 1ESDA 5FLKA 3DLAA 5CK5A 1UMCA 5HR5A 2PTHA 4P81A 2R6JA 1FNBA 2WK1A 1JJAA 3T0IA 4QX6A 4FIDA 4BP9A 3V7UA 3P8ZA 3ICEA 3QYPA 3WBBA 5EMNA 3CG0A 5JJ5A 4MVJP 2FSHA 1JR6A 1WDTA 2WHYA 4OGFA 4U7GA 4DZZA 7REQA 2PU5A 3HHPA 5JY6A 4ZA2A 3M5CA 2QTGA 3I9NA 3AF2A 3AM4A 3R6DA 1YT5A 3G2KA 5EQFA 4ACAA 1XJCA 2EFCB 2Y1OA 5E2AA 4BKOA 3EVDA 3M4ZA 4Q00A 1O94A 5BSGA 1MDFA 3ZE1B 1Z25A 1DXHA 4A5SA 1N1DA 1YIOA 4AYXA 4NCBA 1M1ZA 5HJEA 3M1AA 3VKVA 5DGHA 1KC1A 2VUUA 4X92A 3F6SA 3R2JA 4RVNA 3KQVA 4PNHA 2O9JA 3FJOA 2AEFA 4YRZA 4TSKA 3T3PB 3K96A 1MOQA 1CY2A 3RRJA 4WZAB 1THMA 3JQ7A 4PCVA 1CUEA 1MT3A 1YBMA 4N82A 4BVKA 5AW2A 2IA5A 2GX6A 4KN6A 1QP4A 4R8MA 1Y63A 2IPMA 1G7RA 3E4CA 4MV7A 4PXAA 3T1HB 2MSLA 3E27A 5DBGA 4ANFA 3S81A 5DW3A 2UYQA 2O7SA 5G3YA 2IIVA 1FJGB 3D2BA 1PS0A 3AI7A 1AK9A 1EE9A 4GW3A 3UJBA 1OH7A 3RSZA 4N7RA 3GB9A 4L3OA 4X41A 2QYOA 3QEKA 1EVQA 1RLJA 4PICA 3LWDA 5G02A 4BNTA 2DETA 4E70A 5ITZA 1O0SA 1VCMA 1V7CA 2ZDHA 3D8RA 3IHKA 4RJJA 5DHUA 1YBFA 2FMKA 3ONFA 5FA8A 5KKAA 3TNJA 5CFLA 3RJMA 4E88A 3H1AA 1XLWA 1W73A 2PX8A 3VOBA 1A76A 1A50B 2H06A 4Z2YA 4B44A 2NQ8A 1Y3AA 2GWRA 2MR6A 3PDUA 2YY5A 4OJTA 4QPPA 5A9SB 2Y9MB 3IS3A 4MVCA 4CIWA 2I7VA 4MRNA 2PX4A 3VR5D 2CHVA 4X85A 3RBZA 5I7SA 2X6RA 2COUA 3N2ZB 2MSNA 4BAUA 1SKMA 2BF4A 1WKCA 5FJJA 4ZJPA 1Y80A 4CKZA 3OPYB 3U7EB 3UYKA 1H8HA 4CCYB 3QPBA 4Q37A 5JPIA 2H07A 3FBGA 4QYIA 4AF6A 3HCWA 5CG2A 1M9NA 4KITB 2PDAA 3LFHA 2BKUA 4JI5B 5TLSA 2PCLA 4QL3A 4MSUA 4IDQA 3L8YA 1I7LA 4K6HA 4BEVA 3V48A 1C3OA 2C8KA 3K5PA 4ZVUA 3ZZNA 3UGQA 3IIJA 1PT5A 3CPSA 4AB1A 3L7NA 3FXAA 5DTJA 1TCUA 1ZM2A 3GJ4A 4IUBS 3CEPB 2FPRA 3FMFA 1TKCA 1ZAYA 3L4BA 1DXYA 4ZTBA 3OETA 1DRKA 5AM1A 2ES4A 2IQIA 1V71A 3K9QO 4TTTS 1QIIA 3F3MA 4KI0A 3WICA 1KDVA 3WGTA 3MD9A 3FH0A 3KVVA 4Q1DA 4KSCA 1ZISA 4BVBA 4PLZA 2OD7A 3BSFA 3H65A 4D02A 4QICA 3V1UA 2FR8C 3CVWA 3WL6A 3ESBA 2X9LA 3LCRA 4X6UA 1NXSA 2HIHA 2Z30A 1DO2A 1JJ7A 2FRDC 1YZNA 4MW6A 5BSWA 1FXSA 3A2MA 2VH2A 1KAMA 3M49A 3MTAA 3A36A 4H4CA 2XHEA 5E0OA 1U8YA 2C2MA 2QVYX 3UENA 4LF6B 1H42A 1Q0PA 2F43B 4NAVA 2W8ZA 2A9PA 2PKXA 3ZEAA 2OYRA 3IERA 4O2AB 1NBOA 3PEWA 1NF3A 2R96A 2VS1A 1TF2A 3HXPA 3L0CA 1LX7A 4NY1A 5LSAA 3D4OA 5TGTA 1GOTA 1UT8A 1M0WA 3GXOA 1N2IA 1HSOA 1OY1A 2ZBEA 3JAMA 1SUEA 1YJCA 4GX2A 1SVLA 3LIIA 3CUUA 1NASA 5B7QA 121PA 4M2LA 2AN9A 2AOTB 2OHHA 5TV2A 2FPGA 4M0LA 1UPUA 3HYTA 3IVXA 1XTVA 2QTFA 2M9MA 5KOJB 2HLPA 2IU0A 3I8XA 2NP7A 5ELLA 1V6SA 1O3YA 2QPTA 3CUKA 2R84A 3VPSA 3ZXUB 2JKVA 2OAGA 3FY4A 2JGJA 3OQIB 3IDAA 5J5AA 2HQBA 1YJXA 4XQCA 1U0SY 1KEVA 5HCUA 2EZ9A 3F6RA 1P9LA 2Z1NA 1XELA 4MWSA 3N7TA 4URUR 2F3UA 4B4KA 3BAZA 2LUOA 3BHMA 3CKLA 5EIBD 3JV7A 3NHUA 3PFFA 4TWJA 3QJYA 1XR3A 1KP3A 2FUCA 4KGVA 1BDBA 1CK4A 2MYPA 2LCFA 3V9PA 3FPGA 2AJDA 4HB0A 3E3OA 1F48A 2Q6TA 1D1SA 3K7EA 4RDIA 4Y2PA 2OXRA 3OHMA 4RKFA 2Q5IA 3B52X 1DS6A 2CFSA 2Q2NA 1KWKA 4MA0A 4L6AA 4G8BA 4NNPA 4NOLA 4RMJA 5B36A 3LQ2A 4EELA 3WA6A 2QL9A 3B48A 2H63A 4Q39A 1YD7A 4G63A 4S12A 4RVFA 4XLLA 4GPD1 4CEIA 4J7CA 3MWKA 3U3KA 1QFXA 4GH5A 4HDRA 2W90A 1BN6A 2JVJA 3B51X 1RR6A 2FFBA 3CTPA 3DJYA 3C48A 1KH3A 3MOGA 3QI7A 4MVYA 1T4BA 1B6RA 3R9KA 5CX1B 2WHXA 3T52A 3WNQA 3AVVA 2QSUA 4YJFA 2OT3B 1OXTA 2WSMA 4L0DA 4IS2A 3CPEA 3G6KA 4QXMA 4X97A 1COZA 2Q5CA 3KKKA 1V8FA 6YASA 4P3OA 3C3YA 2VXOA 5CIYA 3SFVA 1NMZA 3ZQUA 3FKQA 1P6QA 2D0DA 1QNFA 1B7GO 4YV1A 5LL6P 3FSEA 3RT9A 1SXJC 2R2GA 3FVRA 1V7QA 1YIDA 3I5UA 1U94A 1FLAA 5MN4A 4Z8XA 1PF7E 3LKDA 4LISA 1O2DA 4R2IA 3QBTA 3DNPA 4YI3A 3VR5A 3UANA 1F8YA 2WVGA 4CMGA 4EARA 3AF6A 4EMUA 1AQLA 3BHJA 4WBNB 3UC5A 1J8QA 1QHIA 3DR5A 4KTVE 1H5QA 2JZCA 5TPZD 1BHJA 4YWHA 5TQ2A 4BV9A 1NJ2A 5TNXA 3DG9A 4DLXA 3MS7A 1VBFA 2GI4A 4O33A 4QXQA 4GBED 5JAQA 1Q6ZA 3KQKA 2OORA 5C1BA 1YZLA 1IHYA 1ID1A 4TTPA 3FCEA 5B4VA 2J9XB 1FRQA 1JHOA 1UDRA 3E58A 1T6BY 4P38A 2O7NA 3WAJA 1C0LA 1I0ZA 3IEIA 3K0FA 1DG3A 2P68A 3ZGYA 5JIBA 3SR3A 1HDZA 1JNXX 4NESA 1E3WB 4OFBA 3EPRA 2FHSA 1F2DA 4CMCA 2BRUA 1PTKA 1PV4A 5ECGC 2GXAA 4G0OA 6AT1A 4OHBA 2CB9A 3OY7A 2IEAA 4XGIA 3FIJA 4US2R 4R1OA 5K6AC 2A67A 3UT6A 3L5OA 3ASZA 5F35A 4X44A 3U40A 3L0BA 3RUDA 3LD9A 5CK4A 4EOGA 2QLTA 3NNNA 5FD8A 4MJLA 3EW9A 3A25A 2M1XA 1HYQA 1S2GA 5FF9A 4YRNA 2IKQA 1FDIA 3FUUA 1EGAA 3Q7QA 1EVIA 2Q2WA 4I8XA 1CSEE 4ASUA 4EO4A 1LKZA 3OEHA 1USVA 3EVCA 4F1JA 5IUJC 2H2FA 4R9VA 4RHYA 3LHSA 1MEJA 2IZ1A 2I2AA 1TCCA 2V9PA 3CKYA 3IHLA 1DX9A 4FGUA 4Y1GA 1MVNA 3GARA 4JUIA 3P2IA 1M6VA 1LRJA 5D00A 4MUNA 1WU8A 3IKVA 3NT5A 3OIDA 4MXDA 3A9WA 1CRWG 5JO9A 4DJEC 2HKIA 2AFIE 1SKUA 2H5LA 4KQKA 1UC9A 4CKBB 3UJDA 3E9RA 4GXTA 4XR4A 1OCEA 2EX4A 4C30A 4W9MC 2O8CB 1L5RA 1O95D 4IVQA 2NVUB 3EEOA 3P52A 3MQFA 5A6SA 1DZIA 5FV4A 1ORTA 1OYVA 3COZA 2FYTA 4B3SB 1LVUA 1PTJC 1KMHB 1E8DA 3A3NA 1L9KA 2YVKA 1RIIA 1VCNA 3GJSA 3NHBA 4HLCA 3UV3A 5ISMA 3QKTA 4DV5B 4XQGA 4E30A 2VR1A 2VT7A 1L5HB 1X94A 2CXSA 2A9QA 5AOCA 4EW1A 1A5ZA 1ZS9A 1TQDA 4RFLA 3FFBA 4OGLA 3JX9A 3F2IA 3WYEA 4MEJA 3L5KA 3CLUD 4OFZA 5JSUA 1U28C 4AO8A 4RD1A 1H0SA 1L8AA 1T0JB 4ROTA 4CCAA 4G07A 2A0WA 2EQ5A 4LBWA 5K05A 2C9BA 3PEEA 3QEOA 4QGSA 5K0ZA 1PJSA 3FGZA 1GARA 3AEQB 2GZ2A 3C6QA 3DE7X 3EK2A 3L43A 4QBGB 2VQEB 3ZVRA 3BWDD 2L42A 2YOHA 1YKSA 3CN7A 4KFRA 5JDIA 3TXYA 2JFOA 4UVHA 3HKEB 4B3MB 4XGKA 1L6IA 2YS7A 1M8GA 3F3SA 3H5LA 5H3LA 4X1KA 1IM5A 4L08A 4XX0B 1PZEA 4PX2A 4N65A 1I33A 1U1GA 2H4YA 2ZUCA 2JH9A 2Y1EA 4U3JA 3FWHA 4CKBA 3REGA 3SU8A 1E9VA 1OFGA 4H3SA 5LIPA 3SSNA 3WFIA 2R48A 1U0RA 2H11A 3IR5A 5LD2B 3LC0A 1NFRA 2N46A 2VQDA 4IR7A 1XK6A 2YQZA 5IABA 5FXMA 2OVFA 5A9TA 1T0IA 4CRWB 1FS6A 3NDJA 4D26A 2BSXA 2D4HA 2O3QA 3KB1A 1WOYA 5JXWA 2NAFA 2XGMA 4CR6A 2FFAA 5TR9A 1X13A 4HPWA 3SJUA 4YAEA 2QR5A 1WHTA 1NPTO 3NJ8A 3MWGA 1HQKA 3ZHYA 3E9NA 4DM4A 1VE3A 4PGAA 1U98A 3V34A 4AWBA 5M29A 2YICA 1DV1A 2GA9A 4MV9A 2RETA 1UEIA 5A4KA 1OLOA 1Z9BA 4NWIA 5KTNA 1IXRC 1QGYA 2YHIB 2J3QA 3B2EA 3T95A 1QOPB 3UWOA 3FDZB 1IC6A 3AVYA 3K9HA 4RDHA 3WYFA 2AX3A 3CGWA 5TC4A 4LZNA 4XVHA 3CPHA 3CZ9A 4GEKA 4B9EA 5H3HA 4UTPA 4YP5A 1LDGA 3V4RA 3ZWWA 1ZGGA 4XGRA 4G81A 4BXOB 3MMSA 4NMWA 3IOEA 2QGFA 4EYEA 1BX3A 2C8LA 5K3FA 1GT91 4AKEA 2JCVA 3OWXA 1JHPA 4Q7JB 2GN0A 3I8OA 1S02A 2WNHA 4MDFA 2Y68A 3CNNA 3BERA 1XG5A 2IPOA 3ZU4A 4D92A 1Z2AA 1Z56C 3WISA 4LGVA 1OF1A 3R7NA 4D6PA 4LF9B 3K4HA 4TMWA 3KG2A 5TPZA 5IBQA 1YJBA 3HN7A 4DJ5X 5BNFA 4NI5A 2DBZA 3P2YA 4JR2A 1E9AA 4LY3A 1OJ7A 3O8QA 3MXTA 2SKDA 4U00A 2C00A 3G85A 5CP8A 1F1BA 2JARA 4YRTA 2CEAA 4LYFA 2ZSHA 4MUMA 2NU8B 4DRXA 1GSAA 5ES4B 4RJKA 4PIVA 3FZYA 1FDTA 3N59A 1USUA 3EEIA 5JYDA 2ZBGA 1P81A 1OROA 2ZRGA 5E1DA 2YMMA 2E5WA 4QBTA 3EIEA 2Z09A 5DM1A 3DWEX 2I78A 4GEGA 5EXEA 4TV9A 5DOVA 1VMEA 2QTWB 4FBMA 5AW8A 4KQCA 4HRVA 4GDMA 2DX7A 2B20A 2VJYA 5BYBA 1T2AA 1NUPA 1XRPA 4DCSA 1XKXA 3UA0A 2XYPA 1HOXA 1XTJA 4C01A 4IIDA 2O4CA 1BX1A 2YIJA 4DC0A 3MB8A 3L1KA 4LSGA 4ON9A 3RYCA 2BMWA 5AM5A 2JFVA 3LSYA 2AHRA 2YZMA 3S2YA 4R1NA 1TQ2A 1UMCB 5SZKB 3Q3IA 4KSYA 1O87A 5E7MA 5DEIA 4HDAA 1IDN1 1CVRA 3LVRE 4GL4A 3HO1A 4GD3Q 3IEKA 5EHQA 5IDQA 4NOJA 3EQ9A 4QSHA 1Q0QA 2HDOA 2Q1UA 1JDZA 3OM0A 7REQB 1RKXA 3NTUA 5ALGA 3SP1A 4G1CA 4KPYA 2HT1A 2FLVA 4TS1A 4EI2A 1WW8A 1YIAA 2CXHA 3IJEB 1FFGA 1JHMA 3A9CA 2OHJA 1NOKA 3ZKAA 1JTFA 1S5PA 3A6GA 3ESYA 4EFMA 7ABPA 5KEIA 2WJIA 3EXIA 5H4GA 3CLRD 4N6GA 5J23A 4FS3A 4OA5A 2A54A 4A8PA 5K7SA 3IJPA 1WUTA 2QW0X 2ACVA 1E96A 1H69A 1SU6A 4JIGA 1Z06A 4BB0A 3ESRA 2PKQO 2WFAA 4AMVA 1FW6A 1JSZA 4PWZA 4A2WA 1J9GA 1MD9A 1S6YA 4OV6B 5FUXA 5HE9A 4C21A 3OIVA 5L3QA 5ESRA 2AUTA 1F12A 1UBCA 5D3KA 4WZBA 4C1BA 4E5VA 2NO4A 3C8DA 3EPPA 1EQAA 3LLSA 3F7TA 3S27A 1VYHA 1BJKA 3C5VA 3E84A 3LOPA 3MA0A 2EGUA 4K9MA 3TTTA 2J3IA 2XYHA 3D4IA 4U2DA 4PN7A 3CZMA 3GFGA 1D09A 4LXTA 4N5LA 2G9RA 3FTDA 5CJPA 1WDKA 3BDIA 1NKVA 3VNSA 3LUBA 3M3PA 3O31A 3VV2A 5ALZA 4AUMA 1RU3A 3KS9A 4J75A 2NYAA 4DWOA 3CISA 4Y30A 3L9WA 3L1VA 5CVUA 1QCCA 3E9DA 4LRUA 2D2EA 3NVKI 1Z6QA 2G1UA 4YJGA 5DCYA 5HIIA 5AK3A 2ZR8A 5ITZB 2PL3A 1QH1A 2MMGA 2YV3A 3EODA 3DTTA 1SBIA 4HN2A 4N0PA 5B1IA 3TSOA 3ZNNA 2XCLA 3H0EA 1WCV1 2QGZA 2IYQA 4EY3A 2P6RA 1RWWA 3AFOA 4R31A 3ODGA 1QANA 2CYAA 1XD2B 1M5UA 2JKZA 1U5BA 2I8LA 4Y7DA 5FFFA 3UCFA 2EJBA 4BJHB 2J5BA 5ALHA 3PR1A 2ID4A 2RC5A 4P5DA 1I8TA 5K8CA 4L6IA 4LDNA 2GA8A 1G1MA 4EVQA 3C24A 1DVRA 4M98A 3HVRA 1RJDA 3PVZA 3V46A 4Z3KA 1Q1NA 2JBHA 3IEMA 1UKCA 1NIJA 3CXRA 4JP1A 1UDAA 2RMKA 1TIPA 2ZTHA 4PG5A 1MB3A 1MX5A 4QYIB 3EVZA 4K86A 3R5TA 1IXZA 3BL6A 4GPZA 5B37A 1VLZA 5CH3A 4J0IA 3MS4A 4RC9A 4MINA 3H2KA 4FOLA 1IJKA 1IQRA 1C3OB 4H7FA 4Z4HA 2PT5A 3EIWA 3W5JA 4ARBA 5LYJA 2WT8A 2C2HA 4YQZA 3TM4A 4MDYA 1ADCA 1E64A 4W5TA 1V1RA 4NZYA 1ETUA 4EK9A 1K7EB 5IZCA 1UQTA 1QVWA 5CLJA 4QXOA 4XJSA 3N05A 1ZLYA 1F3LA 1JMVA 1X1RA 3LVFO 5D1HA 3ETJA 4EJ2A 5L3ZA 3E35A 2A4MA 2NXWA 3GPCA 3H0CA 4HKTA 3N75A 2VP9A 2YYZA 2LV8A 3CRNA 3STHA 2Q0HA 5CAEA 4XOUA 2F4NA 3A1SA 1KNQA 4I5EA 4RVGA 2H1RA 2KM1A 1E59A 3ZJTA 5A3QA 3K0HA 1QRAA 3V1KA 1ZJWA 4KH1A 3P9KA 3WTBA 3KYDA 4NXNB 4PYJA 3DH0A 3L82B 1QG2A 5CNKA 2BEKA 5E1MA 1KAHA 1AN9A 1RPZA 1H9CA 3QOXA 3LPMA 4LYEA 2GR9A 1U5AA 2F3RA 1W93A 3UJ9A 3BZUA 1E5QA 1YOVA 2FMXA 4RVUA 3HMQA 3KYIB 5BW4A 3LDFA 2YH2A 2WG0A 5B1YA 1DEAA 5EZQA 1CZRA 1FP6A 3U81A 2OXFA 1EDDA 2GQ0A 1I36A 4Q1VA 1RABA 4IQ4A 3H99A 1JZSA 1U3TA 2GO7A 4RSHA 1NQXA 1C0KA 4F3TA 1DIHA 1O9HA 1Z0AA 1RFGE 1N3BA 2FPGB 3GDHA 3LBAA 5KSYA 3PDHA 1TJNA 3JTEA 1JU4A 4S1NA 1DNPA 1E2DA 1MRZA 5C8YA 3V4OA 4DNPA 2ZIFA 4N3NA 2FKNA 1ZJJA 1E2FA 2IXGA 3O6VA 3WFZA 3KP1A 1R00A 1NW5A 2XVAA 3OH8A 4C88A 2X5KO 4ES6A 1S9HA 1AKWA 4B34A 3OF3A 2CFTA 4J1NA 1CEEA 4NDZA 1WLSA 2HMTA 4NAUA 2Y0CA 3K53A 1JHXA 2HDHA 1MXHA 3H5AA 1I10A 1ZD1A 2QNRA 3BORA 3FCXA 2HA4A 4JB0A 3D6TB 1ID8A 1XNHA 4JLPA 4AU1A 3BRSA 3GIWA 4EHIA 3G02A 5JAOA 2AXQA 4LCEA 4EGSA 1V8OA 1RRVA 1YFZA 4FNAA 1JBEA 4XIJA 1H85A 1QWSA 1SB9A 4GWGA 3RIHA 2CNWD 5HIMA 4ND8A 3GLHB 2JFWA 1CS0A 1XLTA 2PU7A 4ZQCB 4V0KA 4ZYYA 2GK6A 2KS6A 4N5HX 2GGSA 4WZBE 1BWPA 5F2OA 4AZWA 1KYZA 1PN3A 1FNNA 2R1TA 1PJ3A 3W2EA 4IH4A 3Q15C 4CEIB 5K6TA 3QUSA 1M7HA 1ZRHA 1XCBA 4HDRB 4YCMA 1WCIA 2HWUA 1AV7A 1XTTA 1Z82A 3HBAA 2MT9A 4N1AA 4YV2A 1ZP6A 4Q03A 4RX1A 4JP2A 1ZI6A 5YASA 5C9ZA 4O0MA 2ACWA 2W6JA 3KD2A 3PPIA 3L8CA 4HQKA 4IVPA 4YJFB 3WZMA 4EEZA 1M67A 3R0JA 2VCHA 5GAJA 4RDXA 2W8BA 2J5RA 5LQUA 3NJ4A 1R0ZA 3K9WA 4X3PA 1W4RA 4DADA 2DT8A 2YXBA 4C3OB 2C7BA 1VJCA 3OLVA 1SU8A 2JB9A 4PZDA 5GOZA 1MW9X 1ONSA 1QFZA 4FGZA 4F7WA 2C5GA 5JFGA 1SNYA 1VMKA 2GF9A 4XQ0A 1D3AA 1PD0A 3GFTA 1H0RA 4HOYA 4RTMA 4UUPA 4I5IA 4YC7A 2Y05A 3BK1A 2G9UA 2ASVA 3BXEA 3ROMA 1PL8A 4OHUA 3VRHA 2K6GA 2XB9A 3I2YX 1ZEMA 3KJHA 2BH9A 3F9RA 3OHPA 3PC8A 3ZGZA 3EZLA 2H1WA 1OX5A 2AV6A 2PYZA 2I4MA 3GBVA 1QQ7A 4G65A 4DUGA 1B1CA 2C95A 1PNRA 1LLFA 5ALWA 1CX9B 5JCZA 5FOTA 2VBGA 3HZRA 4NAHA 1W52X 4GPBA 4PPGA 2P90A 4R7ZA 5TMDA 3IBSA 5DLDA 2F3PA 1NU8A 2IFTA 1PNQA 3AR5A 3NBXX 3G1UA 4G5YA 3P9XA 4RM2A 3ROQA 3BWYA 3F6PA 4I0WB 1W7AA 2LPMA 3JAWA 4MLZA 1BD3A 1NN5A 3FUCA 3NVDA 3FTNA 1KARA 2X8JA 3FDJA 3LF1A 3MJSA 4K28A 4Q82A 5TQ2B 3BL5A 4K9PA 3FHTA 5BUCA 1GUFA 5A02A 1PT9A 2NYRA 4RLHA 5EI5A 5FPKA 1H1TA 5EEHA 1CUSA 4W6QA 5JEEA 2XMGA 1UMBA 2A35A 1BSVA 1WZNA 3WLFA 4YMGA 3ELWA 4W99A 3ICOA 4E33A 1T29A 1LBIA 4E2YA 2EKZA 3T3HA 2QN8A 4YAFA 1QPZA 4FMCF 1BGXT 2OECA 1B8NA 2P9JA 1J33A 1SC6A 3HVKA 2PQ2A 3PYMA 3WMGA 1V3QE 3W8NA 1VIDA 4OGKA 5AK0A 2MYTA 1SXHA 4PYNA 4FDLA 1ZICA 3NBAA 4GVXA 3QXJA 1HYEA 2WUDA 1L7BA 1OX4B 1P7ZA 4FGJA 1ZK0A 3AF4A 3RBAA 4ILKA 4LY9A 3OUUA 5B2FA 3U49A 3UAZA 2XNSA 4A6DA 5LUAA 3V6LA 1QO0D 5DHSA 2FPOA 4BO1A 2W42A 1Y3DE 4ZXFA 1IY1A 1E5LA 3HCPA 3DAFA 4BPBA 4O3MA 5E2BA 3MSCA 2B34A 5B4UA 5BN5A 3UAYA 3MF4A 2BTEA 1N6OA 2C7GA 4L16A 4BFUA 3TLBA 4OGGA 4EPVA 3MGKA 4PPFA 5IJWA 1I14A 4ISCA 3LUFA 3CCCA 2X0EA 3O82A 1SK8A 1M6VB 5CB6A 4NCJA 2YN4A 4TRJA 2C4HA 3RGGA 1HT3A 1PE0A 2EWMA 1BQ3A 3G8BA 4LY6A 4B0PA 4AYWA 1MA3A 1A7KA 1Z7BA 3FM9A 1ADJA 1OV4A 1WWKA 2DUMA 2J9YB 1R6UA 2CNKA 4AC9A 3U56A 5EG5A 2WFLA 3UQZA 3WGIA 4A5OA 1FDRA 3QMWA 5A6SB 1EM8A 3I9OA 1DC7A 1C3JA 1NULA 3UQYS 3UUWA 3R09A 4XPIA 5C5CA 2VZLA 1CEYA 3W9YA 2XECA 5CIWA 3TUZC 4ZVLA 2N3ZA 1JW9B 4TN5A 2B7BA 2WIKA 1YQXA 1ZGJA 4MJ7A 4F4UA 3RK1A 1Z68A 3WRVA 4YRKA 3UW1A 1IHUA 1C1YA 1Z6AA 5ER9A 2B1RA 3SS9X 4IMIB 4JNKA 4ZAVA 1U1DA 2Z8XA 2ZUUA 2RHOA 1JFLA 2JEZA 3UFBA 5PGMA 2C88A 4P7BA 4UTVA 2QN9A 1CUAA 2W2VA 4YFYA 3W8FA 4AMZA 2BE7A 2PZAA 3BULA 1K68A 1RI3A 2NLOA 1VCIA 1Q3KA 5CLLA 3ROGA 1TVKB 4U9IS 5A4IS 2X42A 1PW5A 5FEMA 1Z6YA 2F8LA 4ENUA 4OI2A 2B7CA 4IY1A 2UVQA 2CLIB 2WHEA 1KZ4A 2X0IA 3Q7PA 4MA4A 5DXFA 4BQIA 3M8KA 5T3YA 3H6GA 1Y7HA 1KEUA 4S1WA 4X1KB 2I2CA 3K05A 5EKUA 1FL9A 1LPBB 1T5HX 4ENWA 5LMZA 4YRIA 3VDQA 1WV1A 3K4PA 2YS6A 4U3JB 1UJ6A 1CYDA 1U0EA 5CFRA 1C8KA 1Z2OX 4IRXA 2OKGA 2PPLA 3DQPA 4K5QA 3O8NA 1B6GA 1U3FA 2AFRA 2IIQA 4JUFA 1XTRA 3GJ8A 2DKFA 2QLBA 5C8YF 2D0OB 4PHTA 3HSKA 3O9MA 5GONF 3Q8MA 4IZIA 1AKRA 3EEYA 2WYHA 2CZQA 4RANA 1MOZA 4LC0A 2OHFA 1ZM9A 3RJ5A 3VO9A 4EGCB 2Y2VA 2B99A 1SRQA 2X1LA 4P4GA 4IV5A 4TSFD 3U3JA 4EJMA 4ER6A 4J94A 4DUPA 2OCAA 1GDTA 3KV1A 1GUBA 1TM1E 1UP7A 1WHTB 1DP4A 1WVIA 3AV0B 4J0QA 1OW3B 4K7JA 4J2TA 1TF7A 1XLUA 3LCVB 1VIAA 3TZLA 3F5SA 5JZ9A 2PGIA 3RG2A 2MIIA 1XRQA 2IKSA 1UODA 1MG5A 1PS8A 4QXRA 3S4YA 2Q62A 1IEQA 2GCEA 1LPPA 1IN1A 4YMIA 3UY4A 5BRJA 1OI2A 2ZATA 3A1WA 3RYHA 4MPDA 3P9PA 4EUKA 3I9V1 3BQ9A 3D7KA 1YV9A 3CLSD 1IY2A 5EERA 4OMUA 4OHPA 5K3FB 4F4FA 4CIAA 2HUNA 1ODJA 2PKEA 3DZHA 4YVFA 2IXBA 1V1JA 2YXPX 3ICQB 5JD4A 1U2DC 2Y77A 1AH2A 1LTQA 2W70A 2YWRA 1AC5A 3SY8A 4D4IA 2QY6A 1W6RA 3AB8A 3PC3A 5CA0F 1P2TA 2EWVA 3OCWA 4M1WA 4F6CA 4FOSA 4B2LA 1C7JA 3VOTA 3T61A 5A5GA 2ZT6A 2QTCA 5H81A 3QEBZ 3W5HA 3DF7A 4PCAA 3JARA 3KC2A 4A36A 1HGXA 5DBOA 2R751 3MCVA 4MYCA 2P6OA 1L7OA 3O8QB 2PWYA 1W1IA 2XTAA 3I9MA 5CVJA 5L6LB 1T4CA 4DRXB 1M2HA 4RD2A 1ZESA 3FCSB 1YCFA 1QZUA 3B3GA 4RV5A 5A71A 1SCJA 3SJ7A 3LU1A 3OOJA 3FUWA 5KNDA 1SM4A 1TQ8A 2H5IA 3IJRA 3L7LA 4Y9UA 1NAHA 1O9BA 3PFKA 1NW3A 4RCZA 3QWBA 1M33A 5F7OA 4OLHA 4HWTA 4TV9B 4B7CA 4ZVQA 3ZWPA 5J4HA 2GM3A 3KPUA 3I1FA 2W48A 4U9HS 4B2YA 1A9XB 3M5DA 3OCZA 1YNOA 4G1BA 3TBHA 1VJRA 2P77A 2YY7A 5EIXA 4MTLA 1YO6A 3NGMA 2V97A 4GL2A 1Z63A 1CJSA 4CW7A 4J0DA 5FTKA 1R5OA 4LKRA 1JECA 1WV0A 4UHEA 3RYCB 1L8XA 5DWDA 4CCWA 5AIBA 2PX0A 2OFWA 2OMEA 2XMPA 1QIMA 5ITWA 3LUHA 5BMVA 1OU4A 4ZALA 2DGDA 1CUBA 2WKPA 4JUBA 5FOWA 4BFLA 3I2GA 1IAQA 1U1FA 2XD4A 3NFYA 3C0KA 5ICGA 1K7CA 5MGBA 1J1ZA 2PSSA 3MN1A 5BR8B 2Z2YA 3GUVA 1XUOA 3LQFA 4EHAA 2BI8A 1UJ2A 2PBZA 3GDWA 3TPFA 3FD8A 3JYOA 1DDGA 4RIGA 2D5AA 3TOXA 4ZEXA 2DAPA 2PUAA 3L8ZA 3EXIB 1XSEA 4HEHA 4ZZ2A 4H1WA 3KXKA 2G1KA 3HDQA 3ICWA 4ZVSA 3COPA 2J5QA 3W5CA 4N5NA 1GTG1 5K3CA 4LQDA 2CCGA 5HBGA 3AGQA 3QQ5A 3QYJA 1Q17A 5L3QB 1M1YE 2VO1A 2QMUA 3RTAA 4PYQA 3KEGA 1NVVR 2NG1A 4WZBB 2VSOA 1UDWA 3F74A 4JJIA 1FMJA 3G0DA 4OP1A 1N4AA 4F9TA 4D80A 1UL1X 3I0NA 2AWNA 2SKEA 4LMRA 1W8DA 4QEKA 2O7VA 1LXCA 3ZIAA 4CWAA 2X5NA 3C7CB 1ELOA 3U3OA 3AZQA 3O8LA 1GV0A 2GNOA 4MS3A 1E8MA 3C3KA 4TM8A 3UHAA 2DWOA 1JH9A 4OHOA 4ZOLF 3F7MA 4B7XA 1ENPA 1IATA 2QA5A 3PXUA 2IJGX 2YIVX 3E5MA 5P8WA 1G4UR 2OPHA 5KTSA 1FFSA 4FZ3A 1U3CA 3B9RA 4M54A 2PBRA 5HCIA 1RYNA 3B2QA 4YJGB 1WD5A 5AKYA 3W06A 4EKEA 3DBLA 3UMCA 2NN3C 3QUTA 2RG1A 1QH1B 2DBQA 2FQ1A 4QFCA 3FLEA 4URHA 5FWXA 5C35A 3GG2A 2GF2A 3U7HB 2RAVA 1ZVJA 1NU6A 2JD0A 3E03A 3ND5A 3QENA 3R6TA 1QH9A 4GZ5A 4MQEA 4RVOA 2ZZKA 2VJBA 1G55A 2IY7A 3TTXA 1U5BB 3UTDA 3N8IA 3C6YA 3EZGA 1NXVA 1JEDA 2XOKD 4Z9YA 4YX9A 5EIEA 1UJBA 2SCUB 3IE0A 2DRIA 2JI9A 4EF5A 4DIKA 5AW3A 5C8VA 2I4TA 3HUDA 3J80A 1PEYA 4KK4A 3H4MA 3TKLA 3EX7C 4Z0TA 3PCTA 4JQSA 4QECA 2C2OA 1T5DX 3QWFA 4WVLA 5COQA 3GZ4A 1EP9A 4O2LA 2HCRA 1GSIA 1WBJB 4M76B 4Q34A 1GTZA 3TXAA 4WW0A 1XCOA 4FBLA 2VDLB 3FSRA 3SNKA 4PF1A 5TF0A 5K0NA 5HKOA 1G59A 1YFKA 3LBHA 2EJTA 4LXQA 3SYKA 4X94A 3NOXA 4CIBA 3ITKA 3UH0A 2HCJB 1UFQA 1T9AA 2OFOA 4V3BA 3RKSA 3RW9A 3SOPA 1GUDA 2L0XA 1P19A 1CUGA 4MW0A 1V1RB 3UHOA 5JCOA 4LHVA 3UVEA 4Z7JA 5AJHA 1WR8A 4DNFA 1M76A 3WYDA 1L1EA 4GBGA 3Q9LA 1E6KA 2Q9AA 4FX5A 1KKUA 1NKSA 4MOWA 3VOAA 1CW2B 1FRVA 3GGJA 4C3VA 3VR4H 1G5IA 1PJAA 2XVXA 2ZS7A 4JI3B 2Z6UA 1QK4A 1DUIA 5SZIA 1HDIA 3EN0A 3BHNA 5AI5A 2II6A 4BLOA 1A5TA 1FDOA 5AM3A 1WTCA 1MJGA 2H1SA 4PG8A 3ZVMA 5CAEB 1XRNA 1WB4A 1XWIA 5FI3A 1MEOA 1FPMA 3QWIA 4YMHA 1OUMA 1X2EA 4MP6A 1YRBA 4R41A 4RYDA 4TYQA 4NFYA 1O9GA 1VLJA 3C6BA 5BY2A 1PKXA 1YONA 3WI7A 3KYDB 4GP6A 3RC1A 4DCUA 3IQHX 2ZIEA 1ZUD1 1NTRA 3FYSA 4K9KA 1UEXC 1C80A 2BM9A 2DHEA 2BFFA 3QUAA 4L02A 4UMEA 4JP5A 3V8BA 2G9QA 2ZXUA 1CJVC 2Q45A 3D81A 1WM1A 1YOVB 3NC1C 1NQUA 2GKSA 1JALA 3HCFA 4H0CA 3ZUGA 2A4KA 1O97C 1OAOC 1ZSYA 3E61A 3KKNA 4R5MA 2VBCA 4V39A 5IAAA 3WR5A 3W78A 1EFVA 2CN1A 4D0GA 1JEJA 4HAXA 1FNSA 1PZXA 1X9IA 1WVGA 2V3VA 2XB8A 3TI9A 5CT5A 4BB9A 3NHPA 1RYHA 4IF6A 3KAKA 4RTJA 2PXCA 1DRJA 3CB4A 3QLTA 4QUDA 5E0KB 5CT9A 1I5RA 2QL6A 1UBFA 1M5RA 1U0LA 3KU4A 2HRQA 2I22A 4R8RA 1IM2A 5LBIA 1DKNA 1RHJA 2O1WA 1I4TD 4YONB 4GI3A 4D43A 1C0PA 2EYUA 4KGDA 3UJAA 1QHXA 1PLKA 5F7XA 3Q98A 1C0IA 2R8EA 5T3UA 1A8UA 5D84A 4JKOA 1OR8A 1NJFA 4ZRNA 4CL2A 5ICSA 1Z3IX 4J2OA 4JLMA 4CV0A 4PC6A 5EPEA 1L4BA 2RBGA 1C4KA 2YZNA 2JFHA 2PGAA 2RG7A 4MQFA 3FYCA 1QTRA 5HF6A 4CF7A 4PLWA 8GPBA 2YBDA 3ZTTA 2EX1A 4HJRA 1RTKA 4A82A 1WXWA 3TL6A 3X43A 4XB6B 3G2LA 5CT6A 3HA3A 1GPDG 2WUEA 3AP1A 2H31A 4GOXA 1CS0B 1L7RA 5HPYB 3SICE 4NHOA 4BFCA 2V6JA 3AJ8A 4LV6A 3EQ7A 3KQWA 1O96A 2R1TB 1IH8A 2WA1A 5M5BA 1HZZA 2FDCA 3O38A 2Q5HA 3LP6A 1WCIB 2ZI4A 3GJZA 1N5DA 1JTVA 2XUGA 4OH7A 3SEZA 5F23A 4LZLA 4KR2A 4ZT7A 1KZ7B 2VUIB 2ZB7A 3NH9A 1HNZB 5BMVF 3ZE8A 3IUSA 3GN2A 1FPQA 4Y98A 1UM8A 2X2EA 1IB0A 1MUUA 4GG1A 2Y0PA 4I3FA 4N7JA 3CRQA 3MJFA 2O05A 1SD5A 3ZN2A 2HSEA 3KFXA 2CVFA 2BMJA 2ZJOA 4MI6A 4RENA 2DPYA 3IIIA 3VI4B 1GITA 4MYDA 2F3SA 2HHAA 1BGVA 2CMGA 1NZJA 2HJWA 1Z39A 1SUCA 4ZDWA 2OA0A 3UOGA 1KRWA 3F4LA 1TO6A 2QE7D 2AN1A 4JT4A 1KEWA 1UP6A 1DWPA 2FE4A 4LNUA 4OTZA 3TL2A 5LKAA 4GX0A 1XYGA 4ARVA 2JHCA 3UWKA 5JANA 4MKHA 3GT3A 1H0HA 4A16A 2QRZA 5ALYA 2L17A 5FNVA 2XQVA 3UMBA 1D6NA 2RGNA 2VWPA 4QBFA 4I5FA 3QVLA 4OHYA 3ECSA 3IH5A 1FP7A 5H1YA 1V5GA 4RCVA 2ROQA 3U48A 4BWVA 4RULA 3DW1X 3RAFC 1AUOA 1J39A 1T6ZA 4JOSA 4MWDA 1P2VA 3JAWB 1KAOA 3IVCA 3WIUA 1CJBA 2CXQA 3PD7A 3KEOA 1EMDA 1QGUA 1RMTA 1ESMA 1ZX1A 2X8JB 3INTA 3G5UA 4A2CA 3A8TA 3P9YA 1M73E 2Y93A 4OJKA 2GKGA 4QBIA 2CVQA 3C70A 2NTNA 4H0FA 4R8SA 4Q4AB 1Z5PA 4KP7A 4G4SO 1UMBB 4RMIA 3VH3A 1A27A 2OILA 4HWPA 1XPOA 2HNBA 1JIUA 4MRVA 5EVJA 3UHFA 2FGJA 4P84A 3HNOA 2I2WA 3EVTA 1DFIA 3IDQA 5LWHA 3HACA 1E3EA 1NRWA 3VR1A 4I19A 1PJTA 4KIGA 4GZ3A 4C2UA 1XZGA 4KYUA 4CN9A 4KHZA 1SQFA 2IYAA 3WNVA 1U8EA 5ARBA 5CPFA 3ZZMA 4LHYA 1ZIXA 3NPAA 4ILEA 1KOGA 5ECYA 3QP9A 3INGA 4BFZA 2GSWA 4CXMA 3E7WA 2L19A 3TOZA 4DRYA 4TWRA 4TROA 4EPRA 2C92A 2ODTX 1ECFA 3OT1A 5I7UA 2F59A 2P5UA 4PNEA 4QG3A 1Y9ZA 2ZE6A 4AZVA 4UHKA 4AICA 5EJ5A 4LBZA 4DS3A 3H9CA 3EQ2A 3ZCTA 5FP0A 3CLKA 4RMHA 2WE7A 1BS2A 1JQ3A 2AG1A 1ZMXA 4GWKA 2XZTA 3LZCA 3ISVA 3VPDA 4D9EA 2I67A 4U2GA 5EE0A 1Y6FA 1X0VA 4L73A 1DSSG 4OKSA 3F78A 2QJRA 3ILXA 4NYIR 3STYA 1VBMA 5B3KA 4BZXA 2YXDA 1NT2A 5EIHA 1TZCA 3LOUA 1R2QA 2M6KA 4BNMA 2C7OA 5JROA 2B9VA 1F9EA 3NYRA 1DC4A 2QRQA 2WFLB 4G85A 4NBLA 4A1FA 4KFSA 3A2NA 1NV9A 3JY6A 4FFNA 1PVDA 1XZQA 1B15A 2BJHA 2PK3A 5D87A 1KZ9A 5TMEA 5KC9A 2HJSA 1EM8B 2JLQA 4RZQA 2BMDA 5IVPA 4F85A 2C54A 1EX1A 1MTZA 4LXXA 4XPIB 1F5SA 1T3ZA 3C7KA 3N2NA 3TZEA 1NMQA 4HI0E 2VOJA 3VNRA 1DKOA 4B6PA 4BY9E 1UOPA 3F90A 4E1AA 1CNMA 2TMDA 4GFDA 2EYQA 4FHDA 4LE2A 5KS2A 4LHXA 1CG6A 3UEOA 1V26A 1RHKA 3C3CA 5CCBA 1NAIA 5JZVA 2CNNA 2JGIA 3OE4A 4M9UA 3R5HA 2EDAA 4ZVRA 1E0KA 1IPHA 1ECGA 3F5MA 3FMPB 3PXBA 3TN7A 4LWPA 1A7UA 4CMIA 4N7BA 5ESDA 2DH6A 1KI7A 3E0XA 4K6MA 2IP2A 1ISPA 2XMZA 3LF4A 2BL4A 1CJMA 3PGVA 2WFMA 2GFIA 5EP3A 3R77A 3V1LA 4HFNA 1RQ2A 3IKTA 4QFMA 3C8ZA 4UEJA 5G53C 4ZCMA 2NNLD 3PHHA 3PEUA 4TS3A 621PA 4PZUA 1I7QB 1SC4A 3DXXA 5BUSA 2JLWA 2WJWA 3KLOA 4MVXA 3KQHA 3WLQA 2BKAA 1AIPA 1VJDA 3LY8A 3PQFA 3SHOA 4FE7A 4DDUA 4IIYA 3OQVA 3CR3C 4TXMA 4WLVA 4CM7A 3F1KA 3QXGA 3I04A 2XTMA 3LH5A 3ZBPA 3QPAA 4ZICA 5JNSA 1TJ5A 5KAPA 3MAAC 5KNCD 3LYAA 2W2LA 3K5WA 1RPAA 1YS4A 5CB4A 2GCPA 4G4SP 1U4SA 3ENVA 4O3FA 4NL4H 4JDPA 1NFQA 2ZBPA 4KPGA 4KOEC 5FTLA 4I3HA 5FOQA 1C2YA 3WGHA 1YBVA 5DH9A 1GZ5A 3W5UA 4I55F 5KPDA 3DPIA 2PX3A 4IH1A 5LWQA 3KQLA 3TCKA 1W36C 3AG5A 1L3BA 3G8CA 3JYQA 1KPHA 5JLAA 3JQCA 1YRHA 1YHYA 2ADOA 1RI1A 1G8KA 3RVBA 3T5BA 3YASA 1WUYA 1NI4A 2D5IA 3PUHA 4LJ6A 1IG0A 2R6FA 2IWHA 4BEWA 2BN4A 4KW7A 3IMFA 4B4UA 3EWSA 4DEVA 4FMPA 4I1IA 4Q16A 4JLVA 2QE7A 3RYHB 1FP4A 4U6QA 3HNRA 3ZWMA 1J25A 3ORFA 1Z83A 1ECCA 3C43A 3TEMA 2PGJA 4OOFA 1GKKA 1QX3A 3DMYA 4C6RA 2VJNA 5BP7A 5JYBA 2A1TS 4ITUA 2AFVA 5BSTA 5I7FA 4JCCA 1YZQA 1LRKA 1V9SA 3QE3A 4KLCA 2XNKA 1GPJA 1W2HA 2GK4A 2P9BA 5JBQA 1JVSA 2JA2A 3MELA 4UU7A 3QK7A 4CZ2A 1M34A 1JG1A 1A8SA 4L0CA 3JARB 5CJJA 4Q3CA 4UNRA 4OXNA 1FMTA 1USIA 1T2EA 2P3SA 3DZIA 2YC2C 4XIYA 2W37A 1RQPA 3UOWA 2CSXA 1OLXA 3JSXA 1WF6A 3HADA 3LWNA 1T4CB 4M7WA 2AXNA 2BGUA 1R1DA 1G6HA 4LDJA 1Y34E 2BGNA 2H2WA 2K87A 3OT4A 4TS9A 1QE3A 2QUAA 3VR2D 3BTVA 3I5AA 2OBXA 5JVDF 1NQ5A 5AQEA 2EZTA 1ZXXA 2OENG 4NCNA 2EZ8A 3IVMA 4AJHA 4TT3D 3RFTA 1XTSA 4M7OA 2WSSD 4L2IA 4DCMA 1J4AA 5SZHB 1Z4KA 3E1GA 4K8RB 1E92A 2NXJA 2I4NA 3MGAA 4CL3A 4ETNA 4MHTA 2CLMB 4B76A 1F5NA 4M8LA 3AVOA 1BH6A 3OOWA 1JHUA 4BNFA 2HN9A 1IRXA 5HM8A 4TL7A 3CUEF 3ZDCA 5K8IA 2WOOA 3USCS 4R1UA 2W6NA 3HO6A 5IVKA 3G2QA 3V33A 1G63A 1BYIA 1CUIA 4YALA 5J2TA 3A6PC 2V9CA 3LUGA 1A2OA 2FEMA 1EEHA 1JYEA 1O4VA 4FQ7A 1LW6E 4PO8A 5T67A 5BMVB 3EF3A 2QEQA 3OQ1A 4OG2A 2O0MA 1FZTA 4MCHA 4F1KA 4ALLA 1U1IA 3CO0S 3AFHA 5AJXA 4U7FA 2J4FA 3E2IA 2KLHA 3WDSA 2XMDA 4DCNA 3GX1A 4TMFA 1EX6A 1D1PA 1CCWA 5LVAA 4JUCA 2HGZA 3HDHA 1TYZA 5D3ZA 3RYFA 4NEGA 4L8FA 2OFFA 4E5DA 2J3JA 2P30A 4YROA 2DE0X 4ESEA 1UFKA 2NTEA 2PX5A 1V41E 3A1DA 3LC1O 4PTYA 4QUGA 5K0LA 3R0IA 1SG6A 2GM9A 2X7JA 3OM8A 3MMZA 4RQBA 4GYKA 1GTL1 1QONA 3C3EA 3UMMA 2GPJA 3FTCA 1TRKA 4ZQIA 3NHAA 3SDZA 3TQSA 1Z0SA 5EYPA 3WNDA 4ABTA 1HE8B 1UJNA 2WRZA 4DDMA 2FWIA 2ZDGA 3ORHA 3ZIDA 5IWCA 4EUSA 4QYXA 1PVVA 2C8JA 3CW2A 4FR2A 2R4UA 1GRRA 1J2YA 2ODNA 2OK7A 2V55B 4G1MB 4I1SA 4P3KA 2H00A 2AMFA 1XA4A 4MS3B 4QOIA 2NU7A 3IAFA 4BUJA 3QKWA 1R6BX 1X1BA 4I08A 4EO7A 1YRLA 4G0UA 4NYMR 4JVNA 2NMVA 1K89A 1A3CA 4KXQA 3K0AA 2J46A 3PWZA 4UUAA 4MVJH 4GXRA 1AKMA 3EUAA 1QGZA 3V2HA 4HLUC 4FFSA 3S2GA 4YHBA 5FPPA 1E7MA 3DBLB 3NBYC 1EBUA 1K86A 5FWXB 4WUTA 1JEEA 2RB4A 4WDQA 4P9NA 3U39A 2XEDA 2WP0A 3QXHA 4MQEB 3URMA 4EVRA 3B5JA 1B6TA 3GJ7A 3K2IA 3I3SR 3Q2IA 1K8ZB 4WLOA 4E4RA 4HTAA 3RVSA 1C3XA 4QVKA 3IV7A 2C2YA 1C4WA 1E6LA 1D2NA 1N5IA 1QO7A 2Z6QA 4P4LA 1Y42X 5KWVA 4ZYVA 3GA5A 1K6IA 1P2FA 3M7IA 2WDPA 3EB9A 4WHMA 1KWGA 2R11A 2AXEA 1YACA 2A14A 1TF5A 2EFDB 3AUAA 4Q3LA 1WNFA 3QY9A 4EPTA 2C82A 1MXFA 3AKYA 3NX4A 4ITVA 3TJRA 1DCFA 1YK0A 2ZUVA 4BP1A 3QPVA 4BBAA 3F98A 1H93A 1KJZA 3VSEA 4CGYA 4UFPA 5EJ4A 3RC9A 2Y99A 2OOKA 3WLRA 3GDFA 2D1RA 3ND6A 1II8A 4BO8A 5GWXA 3C2QA 4LYDA 2POQX 2PH1A 2P9HA 3ITNA 4ZO7A 4W1SA 3P0IA 1KFBB 2VTVA 4IRMA 4MWCA 1ABFA 4CLEA 3OHSX 1RBZA 3NWPA 2X22A 3ENKA 4I9GA 3QXSA 4G67A 4EJSC 3PQ3A 1J0BA 1SUWA 3PT9A 1RLUA 4AJ4A 4KZKA 4H7KA 3MMNA 2ORYA 4MRPA 4EENA 1MO2A 1XYVA 4ZOQI 1LUAA 3VXKA 1TC2A 3UYLA 4B73A 4BTEA 1UIRA 2VK2A 3B3QA 2F17A 5B6PA 4BQRA 2YJZA 3G89A 4NCXA 2GZSA 1JV2B 2FN9A 1L4KA 1WP4A 4KQFA 1M34E 3SAJA 3TNLA 5FT9A 6PFKA 1S2NA 3LMKA 2NZJA 3M33A 5DHTA 1ORVA 3G6WA 2FOIA 1EXDA 1GKIA 2VJOA 5HX7A 2JFXA 3BEOA 2FQQA 3OD1A 5I5GA 4Y6LA 3OQMA 3UBTA 3LT4A 3EMOA 4NOKA 3TLGA 1HLFA 3OESA 4P0PB 3AOGA 5EJIA 3EGIA 3KJIA 2Q1SA 3G2OA 3KLMX 1FTGA 5JEDA 1Z38A 4E5MA 4ZAZA 4BKMA 1K8YB 1IFXA 1N0WA 4XM2A 5JCJD 4LJKA 2BFFB 3RFXA 4G23A 2G5TA 4Q3OA 4UOZA 1QYVA 4HAUA 4M0EA 2Q50A 5C8ZA 1Q3HA 1QLHA 2XUIA 4LAFA 3I6BA 4TT3A 2ET6A 3RC3A 1ZA2A 2NVWA 3ZI0A 3S2IA 5U4QA 3SBEA 3WVNA 2OC9A 2FR8A 3V4LA 1FSGA 3UXEA 1EUYA 3W04A 1RP1A 2DQYA 2CLHB 2VAPA 4J90A 5JY1A 2H7XA 2FRDA 1LW7A 3BCRA 1PBTA 5HTOA 5IJAA 4GP9A 1UJMA 3MLEA 2GS9A 2HPZA 4HDKA 2EBWA 2XUZA 3CSUA 5ED4A 1FUUA 1DTWA 5CW1A 5DM0A 2WWHA 2O0KA 1T5BA 1TUEA 2E7ZA 2WTAA 1UXOA 3LECA 2ETXA 3L7MA 4LRSB 1HG0A 2ECKA 1OD6A 3FUXA 3N6VA 4O6VA 3GG9A 1JG6A 3LBIA 4QU0A 1XFDA 2J41A 4MQFB 4FHFA 4ZCQA 3HVJA 4YIHA 2NTVA 1OI3A 1JA0A 2YXNA 3OX2A 3TR6A 4EL0A 3RU3A 5B1SA 3F49S 2H9IA 3KXDA 3PC2A 2HO4A 2Q5LA 3WMXA 3ZYZA 2Q0XA 3L3BA 2WIJA 4HNSA 4D3DA 1IWPB 3S2EA 3QG5A 1FDSA 2QD2A 3EXHA 3S99A 2EJWA 3UM9A 4ZOCA 5IZ4A 3U6BA 5IVDA 1EGMB 3ZYCA 1C7EA 1DKQA 1E2NA 1W35A 3QMVA 4NARA 3ZDZB 4F86A 5EVCA 1IONA 2P3OA 1O96B 5CFNA 1DBPA 1TA9A 2ZUWA 3AL3A 2R60A 2QUJA 1R6VA 3T06B 3DBHA 4D56A 5I47A 1RRPA 3QOFA 4EG3A 1OLSA 4ZJZA 3TVDA 5B3JA 1H6DA 1ZMBA 3GGCA 2EF0A 1NNLA 2QG6A 2VDJA 2XIJA 2W2OA 1E1YA 4P58A 5LMNB 4OHWA 1QH0A 3AL2A 4RQTA 3W90A 5BSRA 1I6LA 1SBTA 2QQ0A 3KWFA 4ALMA 2REQA 4EPYA 1CY7A 4FC6A 5IWAB 1LZLA 2LRHA 2G9NA 2WJAA 4D6XA 3BFJA 4MGEA 4QBKA 2HA3A 2B2XA 1I32A 2AQHA 4Z7OB 3AJAA 3U7IA 1M2JA 3A31A 4I4CA 4KAXA 1U9IC 3R3XA 4KKVA 2ZRMA 4LBYA 2V0CA 3EFEA 1VOTA 4LNUB 4RADA 5KUTA 2WLTA 4MA5A 4EY5A 3BWCA 3AFIA 3T9DA 4BMDA 3DDOA 3FFTA 6LDHA 3BD8A 6REQA 1NBMD 1HO3A 4FBGA 1XGKA 5FNVB 5JNLA 3TBFA 4J4BA 5DYGA 5H02A 4O4HF 1U2SA 4U2KA 3K1ZA 3SEQA 4E14A 5KX5A 1TQHA 3PKJA 1Y1KE 4A10A 3GRAA 1FS5A 2RHHA 3P97A 2JHPA 2QT9A 1NVBA 2BDEA 4IFEA 1QGUB 3CZQA 2Y1KA 3E2MA 2EKBA 1J49A 4ZC1A 4B32A 4JT8A 1P9WA 2C0CA 2YVLA 4TYPA 3GWGA 3WJ2A 3JZAA 2BBSA 4PRLA 3ONEA 2FUG1 3W6NA 4KREA 3W4IA 1D2RA 3IVGA 3H1EA 4E31A 3IRUA 3S2UA 5IKMA 2I29A 4MYTA 1PNVA 3PDIA 4WGGA 1N7GA 5EESA 3TD9A 2GXQA 4R1QA 3N5CA 3TFOA 2ZU6A 1BDIA 3ILSA 4TN1A 2XSZD 1B14A 1CVLA 4QFBA 3WLKX 1VXRA 1U3DA 3AETA 3AFMA 1MIHA 3RK0A 4CUKA 2CNDA 2RAPA 1DARA 3PRHA 1G7CA 1JPVA 3WAGA 1GM5A 2JI7A 3AU9A 4F71A 4MH0R 4UDYX 1MV5A 3SKYA 3M1LA 3KB6A 1N5JA 3P5SA 1NYQA 4KACA 4LYYA 2XGOA 1XQYA 3DP9A 4EY6A 3VV3A 3OT1B 3WNCA 3ZW7A 5A2QA 2ZSBA 1OKKD 2YC4C 2XD9A 3AZPA 4CMJA 2WAXA 1MHTA 2ORED 2IHZA 4PAGA 2OD9A 2WHPB 1TAUA 3IQXA 3L7BA 3KPWA 5DNVA 4Z9BA 3VQTA 3BXZA 3ZDQA 1X1CA 5LZ8A 1H4TA 1MENA 3E9CA 4FXOA 5AW9A 1XZIA 2V59A 5KDDA 3DHEA 2GR8A 3U4DA 1GO2A 2C42A 3CC8A 4JYMA 4TTIA 1QIGA 4V0QA 3OKFA 4N7MA 5CDHA 5KQLA 4ND5A 1WL8A 3RFVA 2IUYA 2Z9BA 3QFTA 1RZUA 3IEPA 1OBVA 2FG6C 1JG2A 3P0EA 1W4CA 1U0HC 3C3PA 3PXDA 9GPBA 1FLDA 2QN3A 4NNJA 3C85A 4UPEA 2XI4A 2VP4A 3KZNA 4Q3KA 4CT0A 1LTHR 4C6SA 2DY0A 2QNIA 2IX9A 3FR8A 3OA2A 3L46A 3Q5EA 4FFLA 4G86A 4QSMA 2JLAA 3T7DA 2ISCA 1ORIA 1U2GC 3LX5A 2ZAIA 4YP0A 3WLTA 2CXUA 5A04A 2IZ0A 2XTJA 4P3XA 4CFZA 3HFJA 2V74B 2RBEA 3VSCA 3HZZA 4Q24A 2EP7A 5EE3A 3ZVNA 2H1LA 1AHHA 2XCUA 3W7AA 3QZUA 2IYEA 4F9GA 2XNDD 5J4VA 4YAJA 5AQ1A 4CMIB 2YINC 1B16A 5KOYA 3KR1A 1TOAA 2OE2A 3UB4A 5A5FA 1C8VB 1YRWA 4E1BA 3G3EA 2XCOA 1SQGA 1M6EX 4E51A 1PGOA 4I1VA 4PZEA 3HM2A 4CKCA 1NPYA 1N2GA 4QUJA 3VH2A 1JJVA 3DB1A 4QOJA 3RVPA 3ZY3A 3PA8A 3H8JA 4BTLA 3MLAA 5GOTA 1Q5PA 1U5CA 1RJGA 4U7HA 3NDBB 1QNLA 4NV0A 1PTJA 4AY5A 3I9LA 4NPCA 3FPBA 3DLHA 5CNJA 4IPTA 5EQJB 4EH1A 4TMVA 5KKNB 4JOQA 3TD6A 4D4KA 4U2CA 3ZWDA 2X8BA 3M6MD 5ALDA 1OXMA 4Z3DA 1S2MA 1H5UA 2W2XA 4B7AA 1WSBA 1PWZA 1MORA 2OGFA 1GPAA 1U28A 2IRWA 4ZIRA 4B81A 5CB4B 1XVLA 2W4MA 3RC7A 3WKCA 6CHYA 1PL7A 1W94A 3EMDA 4U7DA 1P45A 3P9RA 1QZZA 1R12A 3UK6A 1OB2A 4PAOA 2PRSA 5THKA 5CFPA 4MEAA 4C0XA 1P7WA 1P0FA 4WIAA 1Z16A 4CF4A 1KK3A 1Z8DA 5A4DA 4EZIA 1KVTA 1JQKA 3N3AC 3S8EA 2IC5A 4EITA 3GJXC 3GGPA 5LQAA 3DBVO 1OXVA 4TV8A 2DLDA 2ZJZA 5TT0A 4B4OA 1NI4B 4B71A 2QRLA 4NBWA 4HDSA 2HSZA 4P82A 1A97A 4PLHA 3ZHXA 4XYLA 5AVJA 3EVFA 4MKRA 5GTDA 3D8HA 4CPDA 2X5OA 4GOND 5K1ZA 4DF3A 1APBA 3CXUA 2CT8A 4RY8A 1FP4B 3E9MA 2QHXA 2VDQB 3ZXXA 1F9AA 2KQUA 4JI0B 5AK5A 1ST3A 2XKBA 1R4AA 1UH5A 3K73O 3DMFA 4LTMA 3VU3A 5I7EA 2VRCA 4I6GA 3RQIA 5JYEA 2BZ1A 2GAIA 4PIMA