1N2OA

Crystal structure of pantothenate synthetase from m. tuberculosis, low occupancy of beta-alanine at the pantoate binding sites
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
286
structure length
279
Chain Sequence
b'PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pantothenate synthetase
molecule tags Ligase
source organism Mycobacterium tuberculosis
publication title Crystal structures of a pantothenate synthetase from M. tuberculosis and its complexes with substrates and a reaction intermediate
pubmed doi rcsb
total genus 93
structure length 279
sequence length 286
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2002-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 1n2oA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1n2oA01
4DNXA 1OWPA 2V0GA 3FNRA 3KFLA 2H2AA 1JIJA 1YI8A 5FNZA 4EGAA 1OBCA 3D6VA 2CYAA 1JECA 3FWKA 2RE8A 1EUQA 5DK4A 1EFVB 1O95C 1VBMA 4MUGA 4JFAA 4QRDA 1O0CA 1OD6A 1N2OA 3A2KA 3X1KA 4Q93A 3G6KA 1NUQA 1O0BA 2DERA 3P52A 4ZCPA 1T6YA 2J4DA 3FI0A 2DETA 1T6XA 1OBHA 1UFVA 1F4LA 3PNBA 2QUJA 1WXGA 1R6UA 2VTBA 1GZUA 2GKSA 3COYA 3IUBA 1IQUA 2X3FA 3UK2A 1KQPA 1H3FA 3FIUA 4K0RA 4MW1A 1R6TA 1EXDA 2DPLA 3INNA 3IODA 2IJGX 1HYBA 3X1MA 1N2EA 1WOYA 1JIKA 1O5TA 1TFUA 5J59A 3SP1A 3FHJA 4MW7A 4ZT6A 5HG0A 4PBSA 4DJAA 3C8ZA 1OWNA 4GRIA 1LI5A 4DDHA 4L2IA 1KQOA 1J1UA 2QTMA 2HZ7A 4ND6A 3CVXA 3CLUD 5FO0A 3IOCA 2WQ6A 2AKEA 3MUEA 3VU8A 1ZUNA 5H16A 5LM3A 1G8HA 4MUEA 1I6KA 4MVWA 4MVYA 4MQ6A 3A4IA 3DV2A 2IELA 1ZH6A 4R2LA 1M83A 4A91A 2YWCA 3SEQA 2VXOA 3SZGA 3IOBA 4XFJA 4U63A 1K97A 4OJMX 4MUFA 2IP1A 5IJXA 2AZXA 3FG9A 1Q19A 3IUEA 2CT8A 3CVYA 2Z3VA 1QTQA 3AG5A 3GMIA 4DLPA 5HUJA 5TEWA 1WXIA 2I1LA 3HFJA 5AHWA 1QRTA 1N75A 1VLHA 4PY2A 3G5AA 1N2IA 1J20A 4GU5A 1O94D 2Z08A 3ZIUA 3CLTD 5KCMA 4U7JA 3COZA 2WSIA 4YBRA 3PRHA 2HMAA 3MLAA 4BWVA 1N2HA 1F9AA 2O8VA 5F23A 3SEZA 1ZJWA 3N8HA 1IFXA 1M1ZA 1TYCA 4WSOA 3CVVA 1NUPA 1NSYA 4MWBA 1YUMA 3G59A 1EJ2A 4OUDA 2CV1A 3Q12A 3RJZA 1Q11A 2H29A 1KORA 1OWLA 3AIIA 5LFAA 3N2YA 3SYTA 1NI5A 1TQ8A 2PZ8A 3RFFA 4P2BA 1NUSA 4CDMA 1NURA 2A1UB 1IRXA 4JYZA 1KR2A 1H3NA 1U3DA 1IQRA 4YP7A 5LLTA 3IDFA 1GLNA 1PFVA 1WQ4A 3ISJA 1OWMA 4NZPA 2G36A 3IH5A 4FZJA 1J09A 4EG6A 1KKUA 2WB2A 4X0EA 1NP7A 4HPWA 3CVWA 3M5WA 4ZT3A 1KP3A 1S4MA 1GAXA 4EG4A 5BNZA 4DE5A 3IMGA 3FY4A 2HGZA 4KR6A 1P7PA 1WXEA 4MVCA 2J09A 3X1JA 2JAXA 3U1VA 4R2MA 4ND7A 1TYDE 3QE4A 4MW5A 4CQNA 4EG1A 4MWDA 5FO1A 3UMVA 1JEEA 2ZUEA 2PFSA 1GPMA 1KH1A 1PG0A 2QUHA 4F4HA 4MUHA 1QJCA 1WZ2A 4MW2A 1ULHA 2CUZA 4HJXA 1QU3A 1MRZA 1FFYA 3TNJA 3CLSD 4NDAA 3CLRC 1IQ0A 3HV0A 4MW9A 1VBKA 1JMVA 3Q10A 2DXIA 2A86A 4DDKA 1PFUA 3FH0A 4YP6A 5KHAA 2RD2A 3GLVA 1KQNA 3HZRA 1MAWA 1M8FA 3PNVA 1U7XA 2QJTA 5J5AA 1N2BA 1PG2A 3GUZA 2D54A 3BL5A 1YUNA 4MULA 3IOEA 3UOWA 4ARIA 1PFYA 4AQ7A 2Z09A 2DUMA 4I6EA 4KKVA 2NZ2A 2O5RA 1M8JA 4PBTA 3COWA 5TGTA 3RBAA 4KR7A 1VL2A 1MC1A 2OQ2A 3PNYA 1U3CA 3H99A 4XFDA 3AFHA 3COVA 5DB4A 5K0SA 1N77A 3ND6A 1N3LA 4NX2A 1V47A 3AG6A 1H3EA 1X6VA 5EKDA 3DPIA 4H3SA 3JXEA 1O94C 5TEVA 1QRUA 1QQTA 4NAUA 3K9WA 4TS1A 3MXTA 3H9BA 3DO8A 4I6GA 1GN8A 3IVGA 3LCJA 3NBKA 3P0IA 4YP5A 2DEUA 2NSYA 1OWOA 3ZJVA 1YIDA 4MUIA 3TZLA 1V8FA 3IMCA 1KAQA 2A7XA 3CVUA 1QRSA 1EFPA 2E89A 3A04A 2A1TS 1O97D 4I6JA 4S1OA 2ZP1A 2TS1A 4KR9A 4MUNA 3E27A 1NYLA 1G8GA 3UY4A 3CLTC 2X1LA 4MAFA 2X1MA 1YULA 3TQIA 4Q16A 1VBNA 1O96B 4ZT2A 2GM3A 2J5BA 1T6ZA 4HJRA 4CT0A 1O6BA 4OUDB 1EFPB 1U0BB 1EE1A 2JANA 2QUIA 3D6UA 3NBAA 3SZ3A 4EF6A 3ILVA 3HL4A 3ZGZA 1NZJA 1R6XA 1G8FA 3ZUGA 2E21A 2VTBB 1I6LA 3HMQA 3IVCA 2BTEA 4QREA 1MJHA 4ZCSA 1I2DA 4QBTA 2R5WA 4UZFA 3CR8A 2OV4A 4MW4A 1X8XA 2XRZA 4RPIA 4HK4A 5IHXA 3AL0C 3MLBA 3S3TA 3CLUC 3ZXSA 2QTRA 4J75A 1K92A 1Q77A 5H7XA 3KT6A 4EG5A 1IH8A 1WY5A 4K03A 2A4MA 1WJGA 1JHDA 3H97A 2QJFA 4JXZA 1TYBE 3IMEA 4EG8A 2A1TR 1EFVA 2J08A 2YXNA 1Q15A 2J07A 1PFWA 1FYDA 1MBZA 3KT0A 1O95D 1J21A 3SDBA 1I6MA 4MW6A 3ND5A 3UC5A 4EG7A 1QU2A 4G5FA 2CV2A 2B7LA 1NUUA 3ZXIA 1JEDA 2E0IA 1KH2A 4EFKA 3A05A 1H1TA 4KPUA 5DASA 4NATA 3RK0A 2PIDA 3F3MA 4MVXA 2PZAA 1JGTA 3KT8A 4PBRA 1TEZA 2ZUFA 1G59A 3FETA 2X0KA 3K32A 4F3RA 3ZJTA 1TYAE 1JZSA 1KP2A 1M8PA 1B6TA 4MWEA 1QNFA 4ZCQA 1N78A 1SURA 5TS2A 3DLAA 1ILEA 3H9CA 3TS1A 1JIIA 3TQOA 5K0TA 3PXUA 3N05A 4MLPA 1F7VA 4JZYA 3N9IA 2WQ7A 3CLSC 2XRYA 1NUTA 5HUHA 1WKBA 2YWBA 2E18A 3ZJUA 2V0CA 1J1ZA 3OTWA 1RQGA 2PZBA 1F7UA 1J70A 1O97C 1WXFA 2YY5A 3LOQA 4E1AA 4ZT5A 2GOYA 2AG6A 1LI7A 3CLRD 4MUKA 2A88A 4ZT7A 3QTBA 1U7DA 3VRHA 1K4MA 4WNYA 2CV0A 3FOCA 3QTTA 4JXXA 3HGMA 5JBNA 3LE8A 1K4KA 1JZQA 4ZT4A 2DR2A 1MOPA 4J76A 1XNJA 2EJCA 1JILA 4AS1A 4MUJA 1WXHA 3ELBA 3KT3A 4ZCTA 1XNHA 1KAMA 4XSVA 3I05A 1IVSA 2CSXA 1BS2A 3FDXA 1M8GA 3ND7A 4MW0A 2A84A 4G5YA 1N1DA 2QJOA 4RUKA 3Q4GA 1EUYA 1GTSA 2BYTA 2JA2A 3P0HA 4EG3A 2D13A 4KPUB 3NV7A 2QTNA 3L93A 4NAHA 1COZA 1A8HA 1O96A 2QUKA 2CFOA 1IHOA 4ZCRA 4G6ZA 4ARCA 1KH3A 2CYCA 4CDNA 2DLCX 3RK1A 1CT9A 3AKZA 4R0NA 1Y42X 2PXHA 1N2JA 4MWCA 1ZH0A 4L2IB 3RHSA 2PG3A 4YMIA 1MAUA 3H05A 1D2RA 3L92A 1GTRA 1XJQA 1LW7A 1YIAA 3VGJA 1N2GA 1T9GR 2D5BA 3P0JA 5KWVA 2C5SA 3OP1A 1T9GS 2A1UA 3MMXA 4DDMA 1MB2A 2CYBA 1DNPA 3CA8A 1MB9A 3TZEA 5DEOA 5J58A 4U8HA 3IVXA 4UZEA 2EL7A 1WQ3A 1M8KA 1XNGA
chains in the Genus database with same CATH superfamily
1TCVA 4KO4S 3BHIA 4ZVSA 2DG2A 1G55A 1C7IA 1GXSA 1LF0A 1SHLA 4B8YA 4G84A 5F7XA 1EM6A 3WYEA 1XLUA 2MSEB 3OZCA 4K46A 1DC4A 1P5HA 1UMKA 2QQFA 3H5WA 3K0AA 1N2OA 3OWHA 4DJ5X 1MABA 2HMWA 1E62A 1FDOA 2QRKA 3M4ZA 3A1DA 3G13A 2H0RA 3AZOA 4JEHA 4ER6A 5K8TA 4LZLA 5EJ2A 3QU9A 3CUKA 2HO4A 2R6DA 1Z35A 4HN4B 2WYWA 1DIAA 4PYRA 4BVAA 3WZLA 4N0PA 4Q18A 3N0VA 2BW0A 4UM7A 1FDWA 2AI1A 2X14A 5FULA 1DG9A 4UNIA 2RKOA 1EWTA 1RKXA 2QTCA 5CVEA 5ECDA 1XPJA 4POOA 4V1CA 5A7GA 1SHZA 3W79A 2I9PA 1BZYA 2VQ3A 3W9UA 4BIIA 1UK8A 4K0RA 4NI5A 3JVIA 5HKOA 5JWRA 2K2WA 4MI6A 2W98A 5KWSA 1X2EA 3MWKA 2ZRGA 1MABB 2CDAA 1CJVC 3DXZA 3MTIA 4ARAA 5AOAA 5LMZA 1TFUA 3EDMA 4D8TA 3GZNB 1PE0A 2FG7C 2WIBA 2VSOA 3TE7A 2IEBA 1N1EA 4DLYA 3EGEA 4U7FA 3V8EA 1CVLA 4QOJA 2P91A 4PTYA 1LDYA 3EZ2A 4ZAWA 3UWMA 2W42A 3B7GA 1QXSA 3F3YA 3WGOA 3D3EA 2VPQA 4QHYA 4C7OB 3AQIA 1AQJA 4XIFA 4IIJB 3CLUD 4NZNA 1VJTA 2IQIA 3ANTA 3TKYA 3WB9A 1GNQA 1FUKA 5FTWA 1SC9A 1WMEA 4OQMA 1A4RA 4ARBA 3C5HA 2JLXA 1P5ZB 2QORA 3K9BA 3VHXA 1NIPA 2J3EA 1H6BA 2QLJA 3WS7A 2YZKA 5K8VA 4EPXA 1NNEA 4A8PA 3NR2A 3O47A 4DUGA 2W22A 1DOZA 2IGTA 3KOOA 1EFRD 1JLKA 1X3LA 1MOQA 1L8AA 1GFIA 2NUAA 1RMYA 3Q6IA 5LQMA 1KR5A 1SOAA 1Z12A 3IBTA 3KALA 4PLFA 5LL6P 4RL6A 3RROA 1QNLA 3RBZA 4AP6A 3QV2A 4W8OA 2ZYAA 4ER3A 2PXCA 5IJXA 3F5SA 1EUCA 1S3FA 2FOIA 4MO2A 4EJ2A 4MHTA 2Y4OA 4GWGA 1Z75A 4N1AA 1NTRA 2D1YA 2GZRA 1ZMOA 3GJ5A 1T9ZA 1YC5A 1Z5PA 1N5KA 4ND5A 3VH4A 1Z5NA 3HP4A 2FPLA 4JFRA 4W5JA 3NTRA 3H6KA 2C00A 4I1YA 1JA0A 4E94A 3KLOA 2CLIB 1DAKA 2CGEA 3LC1O 3WLFA 1Y5RA 5C81A 1KWKA 1HT1E 1L2TA 1UMBB 1YDWA 2P8JA 1QYRA 1BQ3A 4IV0A 4UUAA 3SLGA 1FNBA 2YHUA 3D64A 3QBVA 4OXKA 5FQOA 4CKXA 4BDTA 4KO8A 3UTCA 2GR7A 4NE2A 3LUHA 5EJGA 1TLFA 2YWDA 4WZZA 5DGXA 3LC7O 5L3VA 4QVGA 4CQMB 3JQGB 2C95A 2QSJA 1S9HA 2ZETA 5AKIA 3D7SA 1V5WA 3UAVA 1RYDA 4HFRA 1PJRA 3GUHA 2X19A 3AR2A 2O7SA 4MCIA 2C84A 3TD6A 1VL8A 4C2AA 2E7ZA 1KVQA 1A5BB 1N3BA 5DGCA 5JPIA 3AUYA 2X8AA 3JYNA 1N4DA 2Y2VA 4LE0A 3SIWA 2BTQA 3UHOA 1KK1A 3WTCA 2VBCA 1CCWA 5K0LA 3U9LA 5KJFA 4PICA 4MKRA 3FZQA 3R0QA 2O7VA 3CX4A 4KZPA 3ZWXA 2LE0A 4DC1A 2DPYA 3AR4A 5BQXA 3OQJA 4PTLA 3N58A 3SFZA 4L8LA 3TLBA 4WADA 1J9GA 4RE5A 5B6JA 5BXYA 3RVDA 2HWWA 4BGVA 1B0ZA 2FEWB 3KHKA 3LLUA 1YT5A 2NU8B 1Q11A 1PX2A 1U0EA 3PBKA 3IUMA 2C5HA 4D4HA 1K27A 5DHPA 3HI4A 3VSDA 2HXGA 2WYIA 1PL0A 5B1DA 6ADHA 3DF9A 3L2OB 1ZGGA 4OQXA 2Q62A 4RQBA 3K70D 3ICCA 2YJTD 2GWHA 4KQWA 2WF7A 2XYPA 3HJHA 3K53A 2MCFA 1LZLA 4XPIB 5ICEA 2O54A 2WNIA 4OGGA 4E2FA 3RSOA 3NKVA 1ADJA 1T5OA 4FI3C 4S3MA 5BSHA 1EP3B 4L15A 2AD1A 3MMSA 2AMFA 3OY2A 1Z29A 5ALTA 1X39A 2D5CA 4CDRA 5EE5B 5I7HA 1YL6A 4E6EA 2XR1A 3K8ZA 1D1TA 1SUPA 4Q1VA 1FRZA 3HHEA 3HGQA 4A03A 5CDFE 1G8SA 3NAMA 1NR1A 2G25A 1N6PA 1TRKA 1WS6A 3O8OA 5DKFA 3IP1A 3R7NA 4KACA 5ICSA 1NF9A 3IYLW 3ESXA 5KPJA 4N3CA 4AZ3A 3QTLA 2J5KA 5AW9A 2JPDA 3DCYA 1USGA 2ASVA 2XUZA 3FY4A 1CF9A 3OTHA 4IJQA 1M73E 1TM7E 4CIXA 3EH1A 1KSFX 2ORIA 1E5QA 2ZIZA 3DW1X 1ZHFA 2ZYRA 2XWQA 4JEUA 4CGYA 5M34A 1ZIDA 4LHWA 1EG7A 1CUGA 3O1HB 4WZ6A 2FWMX 3QE4A 3LBYA 1KGSA 1IVYA 5CNIA 3VR6H 4OUKX 3LWDA 1JEEA 1NMEA 1NPDA 1GPMA 3G5MA 2BZGA 3H1AA 1G5RA 4A1OA 4BLVA 2DVMA 5FTLA 4JT2A 1SXIA 3SHWA 1FFDA 3HUEA 1I2AA 1AXEA 1E6MA 2JLQA 3O8OB 4Y1RA 3ZWQA 1PJQA 4NDAA 2ZRIA 3AQ4A 1P8JA 1P6XA 4AZ3B 2VP9A 1AURA 1GZVA 2ZTSA 3I6YA 3MJFA 3QLUA 4AN0A 2P2GA 1KYYA 3A9VA 5EG5A 3UK1A 4D0RA 4ZEVA 4XQEA 1JDPA 1WKVA 3GUUA 4B4KA 2EC5A 1ODIA 4INZA 4AP9A 2WU3A 3I01A 1KXZA 1VYUA 4MRNA 5ER6A 1ARZA 3D31A 1ICEA 4FHEA 4YECA 1M8FA 1C3OA 3MILA 3MBKA 1GQRA 3R9IA 2WSSA 3BL5A 2FPIA 3OEED 2G83A 3MWLA 3B8HA 4DWVA 2OHVA 3R75A 4KAAA 1NV9A 4Y6GB 1RQNA 1O3YA 5BMOA 3SHOA 3ZD7A 1C7JA 1BG6A 2PKCA 4CHGA 1S1MA 1VSTA 1RPNA 1GZSA 1WUYA 3OT1B 2FN3A 5TQ2B 1VL2A 4RKQA 1FJ2A 2PUHA 3PL1A 5AVVA 3KO8A 4ZO8A 1FB5A 3HP1A 4DNPA 1CDEA 4MDHA 4Q3DA 4KI0A 1IB6A 5AIAA 3M6WA 4ITRC 2ERYA 3B1ZA 4G9GA 2OXEA 5BP7A 5AVWA 3RT1A 4W8GA 1ODKA 5BW5A 1I7DA 2IEAA 2HA6A 3FKSD 3HA2A 1EQ2A 2NV0A 1VG9B 3D7KA 1GT6A 1GUFA 2IUTA 1YB4A 2RGWA 4P34A 4EARA 2ZTHA 1BDBA 4QJ5A 1UL1X 2PMBA 1I7QB 2OK7A 2PMKA 3I62A 4JGBA 3FGNA 1YU6A 3HVIA 2BGIA 4NAUA 5GMOA 3RW9A 2WJAA 4DCGA 1YVUA 5JSZA 1BGWA 3MXTA 1O95A 4GEGA 2OHHA 4GYWA 4DNQA 1UBCA 1UBOS 3NBKA 3RREA 2R1VA 4FYPA 1H0KA 1NLYA 2P9TA 5DW3A 1J99A 2AX4A 5CTAA 1Q50A 2JVIA 1JXMA 2EKQA 4FS3A 3PKJA 4BNYA 2HUNA 4D4MA 1N33B 1S4QA 4I6JA 3JZFA 4PSVA 2M6LA 2ILVA 1NBWB 2TS1A 1WWKA 4DEXA 2A2ZA 3NJ4A 1I2CA 2VPTA 1WZUA 1XDZA 3EVDA 2HO5A 2E4AA 1P2BA 2AG8A 4FNOA 7REQB 3BVPA 3LC0A 1HYHA 1FZQA 2GFQA 5LA6A 2XAAA 4NZZA 1TFRA 1QO9A 2B69A 3ZQUA 3K20A 3KU4A 4RO0A 3DDZX 2R6AA 5JFOA 1O77A 4O4JB 2FN7A 3B9PA 2R751 3H2ZA 2C2ZA 3Q2IA 4RM3A 3JQQA 2V03A 3WQHA 4BKQA 5KQLA 3LDAA 4MQMA 1F3OA 4DV5B 1SRQA 3NBAA 1Z0JA 3AU9A 4DJEC 4EQZA 2WJGA 5L3ZA 4HVCA 1J22A 4DRXB 1KI6A 4KGVA 5CLJA 5KKCA 3PV0A 4E14A 5AW4A 1Z4MA 2JK0A 1U7OA 3ICEA 1E2KA 1FP1D 5SYMA 3GG2A 3LBHA 1WA5A 4IZHA 4R2JA 4JX8A 3V1MA 4A23A 4IHAA 1U2EA 1OI7A 2PU5A 3RS5A 4XWTA 3EPJA 3CNQS 1UWKA 2XA9A 1SC4A 1AMNA 2O8CB 3DD5A 3O38A 3E9YA 3FTEA 4RDXA 3GFSA 2GZMA 4MUMA 4MMXB 2ZRHA 3DWEX 3ER6A 4TZKA 3P94A 2EFHB 4UOEA 1Z8FA 4FLEA 4J4TA 5AK4A 4INJA 2GS9A 4C0JA 1KYQA 3KT6A 3OLZA 5IMBA 3ZCTA 1DEXA 1YV9A 5K8CA 4KRFA 3R5XA 4B8ZA 2A4MA 2GBPA 1RI4A 5E7MA 5JEDA 1AGNA 5GQSA 1YZUA 3WP1B 3ZWPA 4PV7A 3H97A 4GNKA 4RJTA 2O1WA 5B7GA 1C4KA 1Y0BA 3CEHA 5IEJA 2EEPA 4HN9A 4C7MA 1N34B 1PG5A 3FGZA 4NKRA 1W8IA 2ZE8A 3IXQA 1BEEA 3T7SA 1G5QA 2IT1A 3A6KA 1DRVA 2F1OA 2E82A 5TQ0B 4F6LA 4CLRA 1PJ4A 2EHDA 3OPYA 1DU4A 2ADMA 4LGYA 5E4FA 4B6RA 2V6BA 3NBUA 3WLHA 1R0WA 3TSYA 5L6MB 2CVZA 4KFCA 4B4WA 1LQUA 3DG9A 4J91A 5BW8A 2ZBFA 1IWOA 2WMDA 3EYWA 2GEUA 3RF6A 3UC5A 3EGXA 2HIMA 3PHGA 2OCGA 5A3RA 1NUUA 2O4CA 4B84A 1VRWA 1U02A 1RR6A 4W1QA 2DH6A 2HD4A 3C7KA 1AT1A 1ONOA 2V7QA 3GX1A 1PW5A 3AK4A 1HC7A 2VF2A 5FFMA 1SK8A 3CFYA 4GI7A 3TIIA 1TZBA 2BOVA 5FWNA 1W59A 5IARA 2ZUFA 3CQ9A 2BM0A 3KLBA 1JL3A 2GYVA 2OKGA 1V8PA 3QV1A 4N12A 5HF9A 4D6XA 4QPZA 2HYDA 4DSNA 3BUSA 2EBUA 4LCEA 5FA8A 2PKWA 3KSAC 1XFDA 1ZOSA 3N6RA 4W7IA 3TK1A 3VVCA 3AHJA 5TS2A 1RM3A 4KXFB 1JIIA 5C34B 2GLUA 2GO1A 3NVMB 4QBKA 4REMA 5H59A 1LBEA 3DZIA 3ER8A 4CG2A 3F5DA 1YZLA 4O33A 2DLDA 4CL0A 4B80A 1GPKA 4RD1A 3FNGA 4LHSA 2H4WA 2PZBA 1OU0A 2X9GA 2XB9A 2VQEB 1QFYA 2A5YB 3BK1A 1QIKA 4KXQA 1VL6A 3STYA 2IYSA 2YWRA 2DP4E 3J7TA 4YV1A 3WJ2A 4WEOA 3CTPA 4E4RA 5D00A 1WMAA 3N87A 2XYVA 3C15C 1OYYA 3I9MA 1T5HX 2FZ4A 1QO7A 2JGLA 1K5PA 1EVIA 3ZC3A 3QE2A 4DM7A 1FZTA 1CDZA 5J2TA 2CSUA 3BC1A 2IHTA 1HL3A 3DZFA 4XSHA 3NALA 4FKMA 3JASB 5AHOA 3CYFA 4JLBA 3WGHA 3DLHA 4FYYA 4F12A 1P2FA 1KK2A 2H5JA 1C50A 5BWBA 5ERGB 3UA3A 1NP3A 1YRYE 2P1RA 4YJ3A 1RWQA 1MG0A 2OG2A 1Y63A 3D8NA 4I4LA 4LJ4A 4PX2A 1V2GA 4ZCTA 2WICA 5DTRA 1S0UA 4BC1A 5E7JA 5J2TF 3T5AA 3VPHA 2R47A 5D7NA 1J23A 2W8BB 2Q8PA 2QJOA 2I34A 1A95A 2IZ6A 1MC4A 4KBFA 1EUYA 1NP6A 2Z5GA 3BD6A 4F2WA 3B48A 1GCAA 3QXSA 4G0NA 3G2QA 4R7ZA 1ZK2A 2CZCA 2M32A 3RNOA 3A3OA 2IXBA 1BGVA 3HSKA 3O91A 3D1LA 3GAFA 1TT5B 2LNDA 4CODB 3AUSA 5DM1A 5KNDH 1JDJA 2WTXA 3BS4A 1W85A 2CYCA 3NOOA 3NTXA 4QXAA 1IK6A 3ZW7A 1NY5A 4JKOA 1KO1A 7AT1A 1QQ6A 1ATZA 2O48X 4PGAA 5DIZA 3EZGA 1GPUA 4OHMA 3RUAA 1GGEA 1U04A 1FS6A 3KJHA 1VLLA 4LUCA 1P44A 2WY2D 4UD2A 5BVGB 4Y8VA 2O50A 4NBRA 3DVAA 1TC2A 4HGPA 1C9EA 5KDOA 4CGZA 2UVPA 5LU9A 3ZVNA 2BEKA 1IMOA 3NVAA 1HFJA 1QIEA 3KEOA 1HX7A 4A9AA 1A2BA 4S1VA 3VPDA 4JGIA 1T9GR 4TGLA 1C30A 2CY0A 2AUNA 1TT5A 3RVBA 4P7FA 4EA7A 1V3UA 3QA9A 4X54A 3NGLA 3MTDA 5AJWA 3TCKA 3KETA 3U3RA 3IEUA 1F20A 1AY0A 5JCPA 3FMGA 5JPCA 2BIFA 3K35A 3C74A 4I8IA 1YQEA 4EVRA 1EFHA 5LWHA 3Q41A 2Q45A 4XYLA 1AGYA 3L4BC 5IBRA 2QNIA 4YIKA 4R2HA 4F8JA 1FX0B 1O0CA 2BI8A 2DKNA 2SBTA 1QIGA 2H2AA 1O94A 2LDBA 2ZXEA 4X6LA 1NMZA 4I66A 3DLBA 1KSHA 2OXFA 4ZI5A 3D6VA 3FWKA 1FYFA 2RE8A 1H2EA 4Q7MB 5ALXA 3DOFA 5E6SA 3VU3A 1E9RA 1PTJC 1EFVB 5DK4A 4EVSA 4W9NC 4HZGA 2DUJA 4MOWA 4D3XA 3KYIB 1NLUA 1OI2A 1NL3A 2QD3A 3B70A 2W7TA 4I4IA 4IQ0A 5F64A 3CJRA 4Q93A 3HC7A 1TW2A 3FI9A 5T3UA 3C3DA 4G4SO 3CKYA 3DFUA 1OI3A 1ULTA 5IKOA 1STOA 1E3SA 1FJXA 2DERA 2PH5A 3QU5A 5CEFA 3IAEA 5FOSA 4P2GA 4RSGA 1XAIA 3T38A 1IAVA 3V4LA 3FOEC 5EPUA 2IYTA 3HBFA 1OT3A 2O3QA 2VTVA 3CO5A 3AF1A 2I6TA 1E0KA 1NSFA 3RUIA 2VRBA 5IKPA 2R8YA 4X1OA 4XYEA 1VB3A 3DEIA 4ZWNA 1HG0A 1M66A 4H6XA 3R7BA 3H87A 5AJXA 3F73A 1YI0A 3LBFA 3FUXA 1H3FA 4KIFA 5IXJA 5K6AA 1Z37A 1RYFA 3UB4A 1OFVA 4P54A 1U1DA 5BYBA 1QGYA 1X7YB 2Y1OA 1Z08A 2HDNB 2OQVA 4CJXA 4ISCA 1XBTA 2JHFA 2GJ9A 1PR2A 2LPMA 2XCUA 4OHVA 3T3NA 1GQFA 1CUUA 1JVSA 1OYVA 3RLIA 5JCXA 1L7OA 3CFAL 3M5DA 5A2QA 2KHZA 4DA6A 3G9TA 3PIIA 1VZ3A 2HDWA 4ALMA 1WOMA 3K7EA 4PWZA 5B1SA 3BXEA 1E1NA 1GRQA 1WAMA 3CV3A 4HNAB 3PGA1 2I3AA 2R60A 1R4NB 1NVMB 5G2OA 3CX7A 3ZR4B 3EEOA 4ZVNA 3DHVA 1ZSVA 3LI2A 3QBTA 3KCQA 4NV1A 2SNIE 4L0MA 2Y1CA 3IDAA 4XWYA 1N57A 1HLPA 4QUBA 4CWAA 1X3SA 1HNNA 1BS9A 1I13A 1WMBA 1PBTA 3GRYA 3ZBQA 3IQFA 1QTRA 5E3HA 1RXUA 1M3SA 3EDRA 2HF2A 2GCPA 5C8VA 5AM1A 4ZO9A 4Q9NA 4GC5A 1Y6GA 3DV2A 1KFJB 3EUEA 1K6EA 3UTDA 4RIHA 3LU1A 2XCRB 1DKRA 2VXOA 1P2SA 1PKXA 9LDBA 1YJBA 1CQIA 3R23A 3LZCA 2QG9A 3ZNQA 4Q4CA 1N2ZA 2DM6A 3M1LA 5CVDA 4Z4GA 1C0EA 3AU8A 3HH8A 3WFZA 5FWDA 4BNWA 2BM9A 3R7SA 5CYGA 1NF8A 3I9V6 1P7YA 2HA4A 4Z4FA 3E1GA 2I78A 1YU9A 3AXTA 3NKFA 4S12A 3AF0A 2D5LA 4DLPA 4YMTA 2RHGB 3PICA 3IHTA 3A1WA 3DBOB 1TKCA 3OLCX 5JS6A 1KKLA 3JD3A 1T8RA 2XTNA 4GL4A 2X9VA 3NOQA 2RHJA 3F8SA 4BQNA 4INOA 4LJ6A 1TVCA 3RIGA 5JNSA 2OCBA 2XVYA 1JDSA 1AO0A 1EX7A 1KAGA 3AKDA 3OIGA 3OO1A 3ZUPA 1KZ4A 5KOHA 2DGDA 3ZHSA 2BFOA 4RQAA 2JVKA 4JA2A 4JI7B 4C1NA 4MR8A 4KTTE 3HA3A 1V3VA 4O4HF 4R68A 4ZI7A 2BSXA 3JATB 2EQAA 2XB8A 4I1IA 2WSIA 3OZAA 3VR5D 3DWGA 1GL7A 1Z2NX 4HDCA 2PGJA 2JFPA 4L7VA 3H4IA 4OHOA 2ZJ3A 4ROSA 1ZMXA 2CNWA 4Y2YA 1Z5ZA 2CJPA 5BVHB 4W9MC 5FTNA 1EB8A 1HY3A 2P65A 3EXG2 3T1VA 5A1JA 4X7PA 4JJ7A 4DPKA 2C4HA 2EATA 1N7HA 2GESA 4WJKB 5KQGA 4U2EA 2VYNA 1AQIA 1SOUA 3L0OA 5JHHB 5KX5A 2XY4A 1NVWQ 3L8ZA 4O4JF 2D6FA 3G59A 4YAEA 4ZGWA 2WU8A 4LPSA 1ZKMA 1L4KA 4KQJA 4TT3D 2BGWA 2PN1A 2DTDA 4ILEA 1Z6ZA 4QX6A 4P32A 4MP3A 3OJ0A 4ZQFA 3AIIA 3TJZA 3EUAA 4EKDA 3A9UA 3L1JA 3F78A 3MS4A 4X6UA 4EZBA 5LNK1 4E88A 2L69A 1IHUA 5CIQA 4H7HA 3P9SA 4C0LA 1C3XA 5C2JB 4GRAA 4OL9A 3U4GA 5JTTA 4PPQA 4J16A 1NUHA 3K9FC 1TA9A 4DV3B 2FMXA 4G0PA 4EW2A 1LXCA 1VPEA 3ICQB 1XKLA 2NVWA 3WP0A 3VOSA 4B85A 4DLXA 1EZ1A 2QG6A 1GTZA 3LQQA 4TKVA 1EWVA 4MXDA 4QQFA 1RJWA 4QU9A 2CHVA 3MIZA 3QWBA 1S7GA 3H16A 3LA6A 1T5SA 4G5XA 5KNBD 5UKDA 3A0RB 3OPXA 1JIXA 4NMLA 3M5WA 3MPOA 4KIUA 1JYFA 2XJ9A 4C21A 1B3RA 4OU4A 1Q1GA 4IO1A 1HE4A 1WPXA 5HE9A 4LGCA 4G09A 4OI2A 4PVCA 4JL8A 3VBCA 4JVLA 3PSHA 5CU7A 4A5SA 2WU0A 4F5EA 2IS6A 1NFRA 2IZ7A 1W4LA 2I2FA 2VHJA 1RYMA 1VZ2A 3EIHA 2EDCA 3DV9A 4IR7A 4RFSA 4KMRA 4CCYA 3DULA 4NHOA 1JIVA 5ILGA 3R0VA 3ZEIA 1V37A 1CKEA 2AGVA 4WFKA 4EG1A 4XVUA 1PV1A 1DL5A 5HCNA 5EN4A 5REQB 2B1IA 5LP6A 2F3UA 5LVAA 3K15A 1YACA 2RGCA 3K0KA 4MW2A 3IVMA 2CUZA 1ISMA 5KSPA 5D1HA 3VC2A 1NMQA 4FJ1A 2QM7A 4FFSA 1PNQA 1EJBA 1XTPA 3IBGA 3ZY4A 5IHPA 4JLPA 4LJSA 1YDGA 4LY6A 2JVJA 1TGYA 5D86A 2A86A 3EASA 5KTKA 1CY7A 3E7XA 5F12A 4V2IA 5G3YA 1ZM4A 2JIZA 1I5OA 4U2CA 5JMTA 2I22A 5CB4F 1O8CA 1QAQA 4OIMA 3GVHA 1NOJA 2I8LA 3EFHA 3FNBA 2WM9B 3PZBA 1GPJA 2D54A 221PA 3SXUB 1KJWA 4LSGA 5EJ9A 2OZEA 3VHQA 3HKDB 3F6BX 1PGJA 3L7AA 2ZUSA 3THXA 2V9PA 3Q9NA 4ZYTA 3ZV6A 4IHJA 4Z4CA 4ASUA 4C4RA 1D2GA 3LUBA 4D3FA 2C96A 1YVDA 1V3QE 4EUHA 1IL0A 3OZFA 3AFHA 4TV8F 1U7HA 5KYNA 1W46A 4CT4B 4QBIA 3GVXA 1XVTA 2OGUA 4Y2XA 1J7JA 3D6TB 3ACBA 4HB0A 4WXYB 5DLEA 3W9YA 1W5FA 3SAJA 4ZI7F 4WLFA 2AYYA 3C8MA 1D2MA 1Z74A 2W83A 2HU5A 4UM8B 2C9CA 3E0XA 3BCHA 3LUJA 1W581 1WP9A 1R6DA 1O4WA 5FNVB 4IDHA 1VLMA 2BJWA 4BP8A 4R51A 2C5FA 4Q9HA 1Q44A 1NVKA 2IOFA 3JXEA 3SBEA 4U6QA 1X80B 2QAGB 1K88A 4IILA 2A54A 3GCWA 5BT8A 1QIFA 2X3YA 1GFSA 1SEVA 1V11B 3LHKA 3R3UA 4JUAA 4N7JA 5FIUA 3TO5A 5C7YA 1XJWA 3ETJA 3WXMA 5I7WA 1EFDN 3QE9Y 2BGMA 3KQTA 1M6WA 3FPHA 4JIMA 2N0SA 1IJEA 2AXPA 2YVKA 1FUUA 1OX6A 2PKRA 1A9RA 4NMWA 3IP9A 4PX9A 4EOGA 1TJYA 3LJKA 4PLWA 3AVUA 1R9NA 4P35A 4UHFA 2EYUA 5EA2A 5EE3A 2CD7A 2HA5A 1AUQA 4MUNA 1PJSA 1H94A 3E27A 3GLTA 2WAOA 1J8VA 4TWBA 1J90A 2QXYA 5EP3A 3CG0A 1QCCA 4BFVA 1ZCZA 2QU7A 3KKOA 2EGUA 5T64A 2JBHA 1CFJA 3F0TA 3R8XA 3NATA 2JJ8A 2AFHB 4FNAA 4G81A 3TQIA 4RH0A 1IM5A 4RHEA 4WBSA 3ANNA 1JI0A 3Q3JB 3CG4A 4A0RA 4RADA 1WPQA 2J5BA 3D7MA 3JWHA 5K1ZA 2A52A 3WZ2A 5KTYA 1Z39A 3I5UA 2IYYA 5CB6A 2SCUA 1V39A 1EE1A 4YAGA 2UDPA 3I4CA 3ZZ1A 4AYXA 2ORYA 2Y1GA 1R8QA 2ZBRA 3ZGZA 4QPCA 2G8LA 1UKBA 1H42A 4P98A 4O3MA 4DABA 4ERNA 4M0CA 4PYLA 3MOIA 2NZWA 3CSSA 3H4MA 3Q98A 4QQRA 2ZKIA 4UNSA 3W6OA 1YBMA 2C03A 4JI1B 5KZMB 1LFDB 3KQQA 4P80A 1T9AA 1D8TA 4D0GA 4P0TA 2W71A 3V33A 1QP7A 5ADVA 2JZNA 2QY6A 2R7NA 3UMMA 4TV9F 1RRGA 5LP6F 4WD3A 2AF3C 4IS3A 2Q99A 1AO3A 4GQBA 2EKPA 4PCVA 4UU8A 2PJUA 1E0AA 2HK7A 2Y1DA 4CQMA 1FFBA 5PNTA 1XKQA 4ACAA 2HJGA 4U1RA 4KR2A 1CJKC 3C85A 3KZCA 4JBLA 2PZKA 3TTVA 2OCXA 3VDRA 2H57A 1LLUA 1TA4A 4BO2A 4MUYA 1I10A 4ZAYA 4DXHA 3SJUA 3K0BA 2YBDA 4CG1A 4MINA 1EP2B 3KWFA 3ABQB 4LRXA 4KQ9A 2A94A 1UQRA 2A1TR 2UYGA 4JYMA 1W0JD 1ZM9A 3T7DA 4ETIA 6Q21A 3ROTA 1PFWA 1SU4A 5A9SB 4W9RA 4I19A 4M7OA 3NWJA 4Z2AA 5MN4A 1CZKA 3K1JA 1K8RA 3FFBA 1XELA 2PL9A 3TJRA 3UUEA 3W5SA 4LC9A 4H77A 5B57C 5I9LA 1JPUA 2WZQA 2I4TA 2NWQA 2HUPA 3H13A 2P1ZA 3QG5A 4FIDA 3AIOA 4PNZA 1M1XB 4R6WA 1TDJA 3KSMA 3QWHA 2RCNA 2VCHA 4MGIR 3AOGA 1UR5A 2ONCA 3F9CA 4EFKA 1T3SA 4QYIA 1GNSA 3F7TA 3PJFA 3MXOA 1GKYA 2IYRA 2Z1DA 3AW8A 1RAGA 1L7DA 1A82A 3GT3A 2BM1A 2W4IA 4EVQA 1OUMA 5K3OA 1TGVA 3CFFL 1CHDA 1RBYA 4R9NA 2MHCA 1H4SA 2BELA 4LK2A 3BGOS 3W7VA 2ST1A 4Q7QA 4F7WA 3AVOA 1ZK1A 3ADBA 4YIHA 4AKSA 1L5FA 1WU7A 2FP4B 2A9RA 3GYGA 5B58T 4IJMA 3DT6A 1Z26A 1KEVA 1RSZA 4TKMA 3B78A 3SR3A 3B1JA 3PC8C 2YNMA 5JR3A 3C4JA 4GLLA 4KE7A 2CJXA 3CLSC 4FZRA 5M2QA 2VOJA 1XI2A 3C5VA 3GLGB 2PK3A 4HH3C 4YNBA 5DHUA 3AEUA 4BXOA 2G7ZA 3DBHA 3R9WA 3DZDA 1TEHA 4R2KA 4ALLA 1YO6A 4BUZA 2C20A 4E1AA 5IRCD 4O29A 3KKZA 1GEEA 5FJIA 4JU9A 3REQA 1II8A 2VJPA 5B3JC 2E4VA 2IW1A 3BMOA 5I7OA 1UK9A 5GV8A 4LC1A 1JLLA 3M81A 2P11A 4RJJA 1I1NA 3WQBA 3H8WA 1MC5A 1MVNA 3N0RA 4FJ2A 4D4LA 2WM3A 4NV3A 4K6OA 1S7CA 3ROMA 2AQHA 3NNDA 4LZZA 1BKYA 4LV6A 1JZQA 4OF4A 4GEKA 1ND5A 4I5DA 2D1RA 4CCWA 3DZGA 4ZT4A 3PC3A 3WLPA 4AJPA 3RTAA 4GZ6A 2BL4A 4MPDA 1P1JA 2ZJZA 4FFBB 5K8IA 1JILA 4U9UA 4E1BA 3BGVA 3HBNA 2RGXA 3I04A 2AKYA 1IOVA 1V7QA 4U5QA 1G2QA 1XNHA 4M22A 4PM4A 1II8B 2CBXA 4N7BA 3BWDD 4NU5A 2FCAA 5JLAA 3IAS6 3UM9A 4AQYB 1ZD5A 4DBLC 2Q0HA 2XQKA 4MW0A 4QYSA 4V0KA 4ZMRA 5LZ4A 2DKOA 1HK7A 3BM5A 4QFCA 1PK8A 3ME5A 3PJEA 3FF4A 3MQ2A 4BGUA 4FZ5A 5C0OE 5ITVA 1FXWF 4ALIA 1ZCJA 2QTNA 1YDFA 4EBBA 4G85A 1T0JB 2VBFA 3QOWA 4LFBB 3DQPA 4DMLA 2GA9A 3GNLA 4IG4A 1F8FA 2NTYC 1P77A 3SX0A 4EAQA 3FNEA 3U9SA 5D3KA 1NPYA 2O0KA 1A9PA 4TUYA 3RR2A 1DO0A 1YZGA 3E5NA 1NKVA 2J0EA 4MVJF 3QQ5A 2W0MA 4MWCA 3STHA 2PG3A 2IYNA 2Y0PA 2GXUA 2Y93A 1RABA 5BWCA 2HMYB 1FY2A 2WB4A 1W9HA 3LHFA 4OLHA 4XDHA 3SD7A 2HOQA 1XJQA 2P69A 3SK0A 3H04A 3WRYC 4ARZB 1GTRA 5KTRA 1P2TA 2LCFA 2VRNA 2CFRA 1NKSA 4J1QA 5CH8A 5KKNB 2Q1UA 3MTGA 2W90A 1JWBB 2GXSA 1U31A 4G97A 2AD5A 1XLTA 2EIHA 2Z2JA 4YRCA 4C01A 2OHXA 4GZ3A 1BHJA 3KELA 3KJNA 2Z56A 3OCXA 2WTBA 3BAZA 4LDJA 2V74B 1MORA 2WP8J 4RABA 3A6PC 1Z0SA 3CEAA 3PXDA 4Y0AA 4ZVLA 3MERA 4P38A 4PQEA 4DLZA 5IUKC 3G1TA 1X1CA 4GPZA 4HSGA 1MR3F 2HLDD 2W2LD 4IO0A 4Z86A 1Z06A 3WYNA 3DMYA 2A35A 3EGCA 1XZDA 1PJBA 3KOMA 3O1JC 1EUQA 3L5OA 2HA0A 1XJ5A 1VBMA 5JAPA 3DUWA 1Z16A 5FPPA 1MZVA 1OD6A 2CL0X 4ZA2A 3C39A 3D3QA 4YUWA 5CX1B 1CP2A 4AY6A 2WAXA 2DR3A 3G6KA 1KSJA 4Q0MA 3P52A 4LDNA 1K7YA 2DTXA 1HZZC 1NE2A 4FSDA 4YMHA 1BNCA 1S3GA 1NVBA 2AC4A 2ZRKA 4PTZA 4QUHA 1O6GA 4AAYA 2F4NA 2HK6A 2Z57A 4HP8A 1E8DA 1G21B 4BB0A 4BVFA 4XVQA 3AJRA 4URUR 3QLTA 5EMKA 1UK6A 3H3XA 4D9JA 1WM1A 4YRLA 5AUOB 3RVOA 1P4SA 4C4AA 5GZ3A 5M5BA 4CKEA 4UTRA 5ALVA 3F6YA 3DVQX 4Y0NA 3U4QB 2PLWA 4A3SA 2QBYA 1KY5A 2WFMA 3BH7A 2ODWA 4O63O 1OPXA 2WAMA 2WTUA 4LF7B 2GCOB 3CKKA 5AM0A 5I8PA 3PRKE 4BLUA 1N2EA 4PO9A 3ZHCA 2QAIA 5J59A 3AYZB 1JHPA 3FYSA 4MW7A 2LKDA 1OWNA 3C8ZA 4GRIA 3C14C 1LI5A 1XYYA 2IXTA 1N0HA 1NBME 1TTQB 3FSRA 4W5RA 1PHRA 4G41A 4ZU1X 2YFQA 2NX2A 5AK5A 2OFPA 2XQVA 3UUFA 2G9NA 3RARA 2FB9A 1KAHA 4HQ6A 2KPOA 4YMSA 4JBGA 2G17A 5JH7F 1FCJA 2BUCA 4DMKA 3MUEA 1KRWA 2JGDA 4R40A 2C4MA 4E08A 3U4QA 5H16A 4QXRA 4CTMA 1FUYB 2I91A 2WZBA 3ND9A 1RHMA 2J41A 2VN8A 3QIAA 4Y6PA 5C80A 1Q5PA 4GM1A 2FRDA 3K1ZA 3VTZA 4K05A 3UH1A 1B16A 1IN5A 5IKXA 2H9IA 3GPCA 4O4LF 4FUQA 5D84A 1V48A 3U44B 3QUTA 1K97A 4LDZA 4MUFA 3M82A 5L3SA 2QX8A 2AZXA 3TR6A 3DMNA 2V65A 1VPTA 3AIMA 4ZZ0A 1ZOOA 2HQRA 2M9MA 3I2HA 3TCNA 3FAKA 1NM5C 3CSUA 1ESNA 2NO7A 4PO3X 1NKTA 4C3VA 4DV1B 4OMDA 5HUJA 1ECBA 1PRYA 4R9SA 4E2ZA 2G4LA 3WX0A 3CKLA 4X92A 1WHTB 4BY9E 4BC0A 4CMAA 2QSUA 1N75A 1NBMD 1Y3HA 2G71A 1G5TA 4QM6A 4TKUB 5AXCA 4WK2B 1O5OA 2QZSA 3SQWA 5BMVA 3WK9A 3UT5B 4GUDA 4QGBA 1ZICA 1WG8A 2ZR7A 1KZ9A 1QIMA 4EHHA 2IYLD 1SWWA 3T5TA 4HS4A 3U7GA 1XL0A 2QB5A 3ECSA 1TU3A 3OSUA 4MRAA 2BKAA 4UBKA 3PQ5A 3I12A 3CFHL 4DANA 1XYVA 4G65A 3VSBA 1WMDA 4E11A 4RTMA 2H9AA 4BWVA 2E6KA 3VGPA 3GP5A 4EPYA 3QX9A 1DTWA 3BH0A 1J07A 2V55B 5EL0A 2QM3A 2XCOA 1VP9A 4ZP1A 5LOVB 1APBA 4F5DA 1GDTA 4NCBA 3QLVC 3WL3A 1ITZA 1F8YA 2J4FA 2JGFA 4WK0B 4S05A 4A26A 4BKMA 5CGZA 4F60A 2PGIA 5HW0A 2VQ6A 3S7ZA 3F1KA 1GN9A 4P3XA 3UJNA 3GRZA 3CTMA 4ND8A 3LUGA 2H8GA 2CLKB 5JDCC 3G6WA 4HQOA 4QUJA 1P5FA 5ES3A 1DQPA 5JASA 3UT5A 1X1BA 3B60A 1ZGZA 3LSYA 4KGZA 4OBBA 3EFBA 4JJFA 1PT5A 1P9NA 4AY5A 4P4LA 1FSPA 1JW9B 3CWZA 2R8PA 3U62A 2DT8A 3TAXA 2B9VA 3HEMA 3CO0S 3K8YA 3O94A 4UJ5A 3Q8LA 1D2EA 4G4IA 1T9DA 1UXGA 3OY7A 2FUG6 4FHFA 4UBLA 4X1KA 5EJAA 3QKRA 2KE5A 1D03A 3AXSA 3ILXA 4K1LA 3PHHA 2FY8A 2WVHA 2XMDA 3PNSA 1VA4A 4KAFA 4QPPA 1YKGA 5IAOA 5FFNA 2VP0A 3C3CA 1FUIA 1K7SN 2RBKA 1KO8A 5EXEA 1PD1A 3Q0EA 1GLNA 2WHQA 4XTRA 2M6SA 5CM9C 3UC9A 1HRKA 3CJTA 3CURA 2QQ0A 4MVJI 4YCMA 5I7UA 2J6IA 3H9JA 2FFHA 2V8BA 1IY8A 3UKJA 1JSLA 3VHRA 4EG6A 3OAAA 3MFQA 1U7WA 3ESBA 4OP2A 5HCUA 5BQFA 1JFTA 1CRPA 4FWBA 1THTA 5ALQA 4UHDA 4XB1A 4X8MA 2Q27A 1C2YA 5HEKA 4LOLA 4BTLA 4EG4A 4PLTA 4E5NA 3CI0K 3I09A 4DLRA 2ODAA 3TPFA 1OH7A 2P4HX 2CLEB 2BBOA 1P7PA 1V45E 2VIIA 2QF7A 3K0HA 3V8RA 4MV8A 2MSNA 4DQVA 1ZI8A 2FWNA 1LPPA 4X3OA 3Q2OA 1C3EA 1TYDE 1U3TA 1FQKA 1X7XB 2GTPA 2KQUA 2FEMA 1ZESA 4A15A 3T1OA 4B3JA 2QUHA 3UMYA 3KTDA 4WLUA 1DSSG 1J56A 1NAHA 1IHDA 2PRKA 1V4NA 2HSGA 1E9BA 1X7WA 2QHXA 2RH9B 1FFYA 1O54A 1KK0A 4BL5A 1UDBA 4KQXA 1PLJA 2K7ZA 1WXDA 3UT6A 4V3CA 1FFXA 4UD6A 2VDLB 1LW6E 3RT7A 1ZD9A 2JLCA 2BGKA 2CJYA 1XF1A 3EIOA 4MS3B 4NRDA 4DDKA 1KMQA 1N0IA 2VF4X 2OYSA 3DT9A 3FH0A 3NIGB 4KWHA 1E6UA 4BBZA 5HIIA 4ZV4A 4TVSA 1I7NA 4OATA 1GPWB 3OD5A 2PRZA 4YJFB 2DB3A 3SLRA 4HSEA 3OCYA 1IULA 2R8XA 3LXUX 1J4AA 3JQCA 2CZGA 2W6JA 3U3JA 4GPIB 4Z49A 1WMSA 3GC6A 3IOEA 1SQGA 3MF4A 1D0SA 2J7KA 1JTFA 3ITKA 2QENA 4Q66C 5IULC 3ASVA 1DQRA 1KJQA 1MH9A 1DUVG 4XIGS 3FHCB 1TO6A 1CEEA 3A25A 2ZBUA 2B4AA 1UQTA 5FOTA 4RA9B 5F5NA 2JZOA 2VS1A 3Q2KA 4LNUB 4KMSA 2FETA 3HVUA 1RQXA 1BU5A 1N2CB 3WRWA 3OEHA 3IDOA 2Q0XA 1CHNA 3OX2A 1N5IA 1GCUA 3D8UA 3OE7A 5CRIA 2HI0A 3NHAA 4IDGA 5FR1A 2WYVA 2IUEA 1HDRA 4I1SA 3PPYA 1A8IA 3A37A 3KXKA 5C4IA 2G77B 2NAFA 3KU1A 1A1VA 1L4BA 2P7IA 2XWBF 1TRHA 1XN1A 4WE3A 3HFGA 1NDQA 3E0QA 3V4FA 5KSZA 1TJ4A 1ESCA 4JL6A 2HLHA 1T2NA 4JXKA 1OWOA 3OD1A 4Z8YA 1J00A 2RHOA 1YIDA 4NOKA 1QOPB 3QNWA 4LNUA 1EMDA 2CXPA 3W9SA 1G6HA 1RD4A 2MYNA 1Y4AE 3HDQA 3QVGA 1EFPA 3HJNA 5HQ3B 1RKQA 3IKVA 1OX5A 1S2GA 3VAYA 3QBDA 3TMKA 3SHQA 5DM60 2FW0A 2AI3A 3I1IA 1VYHA 1KZ1A 1WRBA 3HXPA 4C43A 1UC8A 3D6MA 3I9LA 2J6CA 5JHGB 1GYPA 3C3PA 1H0HA 3H7IA 1O5IA 2V7PA 4LZNA 4TM8A 2P68A 3DEFA 3ENWA 4Q15A 4DLKA 3JQ6A 2QD2A 3GMDA 1EEXB 1DQSA 3QE0A 4A73A 2IOQA 1VHTA 3P2KA 3AVXA 5FUWA 5HQ3A 5EIAA 4HDKB 2HMSA 3M1IA 3SZ3A 4EW3A 2LXNA 1R3UA 5AW1A 3UXYA 5KC9A 1T0IA 1JMKC 4OKSA 4LKOA 1G8FA 4BFTA 3LBIA 1A9SA 1E7YA 1BFDA 3N2IA 2EW1A 4JLVA 3E22B 3ZDXB 3DLPX 1TAUA 4I5IA 4CMBA 2HDOA 2QZZA 1JSCA 2JGNA 4BDSA 3F5MA 5JI3E 2PH3A 2QJRA 2ZU6A 2H1SA 4U2DA 4U7GA 3IUYA 1GT91 1Z8NA 3H8SA 2XVMA 3GDWA 3ZD9A 2OYCA 2ZI5A 1SAYA 4K40A 3OC0A 1PZNA 3NP9A 4P3PA 4QVKA 1NRXA 1BFUA 4ESHA 1JSRA 2NIPA 4OSOA 1L7QA 1Q0RA 2E4ZA 3VUFA 3CEJA 4EKEA 3DZKA 4DCNA 4FDAA 4R5HA 2WILA 1SQ6A 3VJKA 5BPHA 1T2AA 1MQAA 1BXRB 1AGRA 4BQOA 4EKIA 5EJ8A 2GYUA 2P7HA 4D3YA 1HNWB 1WNFA 2JIRA 3P9QA 3W5VA 1H23A 2R00C 2ZVPX 5I47A 3VU0A 1X8LA 2GM5A 4TKZA 1TCCA 1F1JA 1LBQA 1H4VB 3UB3A 4EG8A 2IS1A 1FP4B 5I5EA 4DYVA 1KI7A 3O26A 1R4AA 4YONB 3T61A 1NVTA 3UT0A 2H1IA 2PRSA 4MGKR 5FR2A 4DIUA 3WRXC 4HUJA 4CKBB 3MTBA 3I1YA 4WZBE 4Q3LA 4NBLA 4NY1A 2QT0A 1N4AA 4HQRA 3KZXA 2WJVA 2H63A 2ZJ7A 5EMLA 3EK2A 3CSDA 1DQZA 3FTFA 5ENVA 1AKQA 3FFAA 1XPUA 2P9ZA 1IE3A 2X0RA 4RHFA 3U4AA 2IBSA 1VXOA 5B3AA 3IV7A 3H42B 5COAA 4YDSA 4NATA 1CXZA 4N5LA 3WWEA 3QU2A 1P2GA 3O03A 3G9QA 5BV1A 3AESA 1TEZA 5A9RA 4JVMA 1L5LA 1CR4A 4PHFA 3FETA 3I52A 1VIVA 5JTUA 2O2YA 3O92A 2FEAA 5D1NA 1M8PA 1K68A 3BAFA 3ECCA 4IXDA 5ABPA 1U2ZA 1QNFA 2F3SA 1S02A 2ZI9A 4ENWA 4TKVB 4UNRA 4LMRA 1F17A 4WJLA 1QV9A 4U00A 1HV8A 1FFEA 2F8LA 1QYIA 4RY9A 5JJKA 3TW8B 1F9EA 4HAZA 1T4CB 3LO5A 1GL6A 2YWEA 3OOSA 4HGNA 2C3UA 1TYZA 1U7PA 2XZOA 2X2OA 3GJ4A 4K0KB 3HVJA 1C9DB 4FX5A 5DFAA 5K51A 4HGQA 4GO1A 4ZVQA 3MRVA 1AXGA 2JIZD 1E7SA 3U7HB 3B5JA 4Z1MA 5SZIA 1K6IA 3B38A 3GEDA 3IV6A 4IIDA 2WPDA 1F2TA 4JQOA 5EQJB 1AQUA 2BZSA 3C4VA 4INAA 5DTMA 2A88A 4TL8A 5E1BA 4ZT7A 4C2UA 1ESEA 1U7DA 4MPPA 4BVKA 2X77A 3JQAB 3T34A 1UPTA 5D3ZA 4WNYA 4KX5A 3ROQA 2CNWD 2OZVA 5A1TA 5LCXA 1M2WA 1Y3DE 1YONA 3WKEA 1LD3A 3QTTA 4RKWA 5EMHA 3UFXB 3ZGNA 4JXXA 2JGMA 2WFAA 1K4KA 3R5HA 1SG6A 2FXVA 1FMCA 1ZQ9A 2Q1XA 3QEMB 4AURA 5BSVA 1PDOA 1R15A 4LQLA 5AHKA 5IVIA 3SX2A 3D8SA 5K0ZA 2ZU0C 2Q5IA 4BHRA 1R0CA 4BVBA 2BFFB 3PG5A 4JDPA 4CNQA 3LO8A 4EY5A 3ELBA 5DULA 2GBIA 4ZXPA 3LDUA 4JUCA 4TMWA 4BFSA 2FOXA 2FMTA 2BFEB 2FPKA 2XUAA 2JKZA 4ZTBA 4OGLA 3S7TA 2CWDA 2XYHA 5CLFA 2GETA 3G1WA 3H9EO 2O3SA 3IHLA 4MARA 2VA8A 1YMUA 4X20B 3DTTA 4EO7A 4ZK2A 1NR5A 3PIDA 2P5YA 3NCTA 1R4MA 4NP6A 5D51S 1EVEA 2PL3A 3NV7A 2GARA 1E5LA 3PQ3A 1CDOA 3QEMA 1COZA 4O8ZA 2YH2A 1HT0A 2QVXX 4ZHSA 2QUKA 1H1LA 1IHOA 3DTNA 3TW4A 1E9FA 3L0ZA 4DXDA 3WWCA 1UANA 4HLDA 3S8YA 3I2JA 3RSQA 1QPBA 3E2IA 4KLNA 2HDHA 1D0VA 1YQQA 2X5JO 4RSMA 1Y4DE 3FUTA 4EHNA 4R3UC 3AKZA 1DT3A 3GGSA 3ROKA 1ZH0A 2UYYA 4GOJA 3EWSA 2VJBA 2RGGA 1EFAA 1M0WA 1ADGA 1SA0A 1U90A 3D6HA 2WD7A 3FFTA 1XD9A 3H17A 3I8SA 1D2RA 4NJOA 3TNDA 3ORYA 1Q7BA 1EZZA 2GZHA 1DZ3A 3OX4A 4ENPA 4TYQA 5DP1A 3NMUF 3THSA 5AVKA 4ID9A 1WXQA 3BBPA 1QG6A 3QWAA 4FT2A 1BE0A 2KSQA 1GD1O 1Z0FA 2IOYA 2YJZA 4JLAA 5DHAA 1NVVR 1OILA 4XYBA 2R1TB 3HY4A 1PR4A 2W2OA 4KQKA 1C41A 4F9FA 2P41A 5ICCA 2R5NA 3PSAA 4EAAA 2PUJA 1U2GA 1LSUA 2R7AA 5AW8A 3GLIB 5LA6F 2QNRA 1TUGA 3RM3A 4IDNA 3PI6A 4M1MA 4N54A 2OBNA 3EF3A 3I30X 3WGYA 1H85A 1ADFA 3WIOA 5K6RA 3TLGB 3EXFA 1BX1A 2BEUA 2X4IA 1KAOA 3IA2A 4C6SA 2GHTA 3DJFA 2XITA 5FLXA 1T1GA 2B8WA 1E1QD 2GFHA 3HDGA 3BX1A 3AOEA 3C8DA 3JAWA 4EPTA 1Z5WA 3JWEA 1XTVA 1MJGM 3DAHA 2FX2A 4N0MA 1Y9JA 1ZVMA 4QHTA 1MQ8B 1D7OA 1WTCA 1Z2PX 4IDDA 1DEOA 4BLOA 3DR5A 4M0PA 1MO2A 4CM1A 3KSZO 5CNJA 3S27A 1MEEA 2FXIA 4ZCPA 3UQYS 3AHFA 1H2RS 3PGVA 4JA0A 4QBFA 1L5HA 1J8QA 3ZBTA 4J3JA 4ES6A 3R3HA 2ZJ6A 3KVNA 1G1MA 2GEFA 1MZPA 4O2AA 1BXZA 1KIMA 4IIHA 2GZSA 1NW6A 2OO7A 2XDAA 1RXVA 1A7UA 5HOEA 4Y30A 3JPYA 3LNCA 1GTJ1 1UEJA 3IKMB 1LBIA 2VP4A 3BILA 1UIMA 1I4OA 3GEHA 1YKFA 3PDUA 1PWEA 2HNAA 3UHJA 2Q3FA 3NWEA 1X7ZA 2HJVA 2J9XB 3C24A 5AVUA 1C0PA 2G09A 2EKDA 5IBQA 1IDN1 4QQ8A 1L5HB 2X5NA 2OBBA 2QZ9A 3LQ2A 3VTKA 2FN8A 1MAHA 3V8VA 3QH4A 4ZVMA 1JEAA 2I4OA 3G02A 1XQYA 3QVKA 4OLAA 2GKOA 1WO8A 3GLIE 2FR1A 2P2ZA 4PG8A 1GOTA 3D9QX 3ROGA 1K98A 3HDTA 3IOCA 1S2NA 2R6JA 4OAPA 2ZJBA 4B3RB 3PEVA 4NG4A 2BR3A 4HAVA 3HB4X 2CXRA 1YCFA 3ZG6A 3B6ZA 1KJ8A 5D87A 3A31A 1B14A 1DO2A 3HM2A 4EUEA 3CFIA 3BXZA 4I36A 4ZI3A 4ND4A 1MFZA 2DBRA 3D5QA 3M6FA 2DQYA 3G68A 4XDGA 5EYPA 4DWJA 3BD7A 4EHBA 1Y7PA 1K7CA 3FWHA 4S35A 2RHMA 3OCZA 2QZ4A 3RAPR 5CFMA 2NGRA 2CNLA 2BE9A 1IZ9A 1Y8QA 2LD4A 3K92A 3R3VA 4OFXA 5AJTA 2EQBA 1X14A 5ALIA 4UTOA 4MP6A 2MMGA 3BORA 1YDHA 1V95A 2H51A 4G5SA 5ALMA 5CCXA 1RDFA 1SCJA 3ABOB 1QQAA 3UW1A 2H1LA 1K06A 1ZUWA 2YJ3A 3WVNA 3D2AA 5IEBA 4KQCA 2QTLA 4F9GA 3HFJA 3RUEA 5CDHA 1VC2A 1OX4A 2JJMA 2XXBA 3TR5A 4QDUA 4RHCA 4PC7A 5EHNA 5E6RA 3SX4A 1K7FB 3C3AA 1B0PA 3LYAA 2YVLA 1MT3A 2QJWA 2R6CA 5TC4A 2QE6A 5DSTA 3WJ7A 3HU5A 4ZJYA 3HL6A 2Q9UA 2R0QC 3HXQA 3D5EA 1J20A 1SQSA 3NAZA 4EO9A 1P6QA 2Z08A 5D6OA 4YJDA 3C3MA 1DAGA 1Z6TA 2OCDA 4AYWA 3SQLA 5IMSA 4IV5A 1U98A 1BCSB 1E9EA 3SVZA 3H75A 2XZLA 2HMAA 4HOYA 2QTGA 5GIOE 4V1CB 4JENA 4I3GA 2JI7A 2FPSA 3I2FA 1JQLB 1G1AA 4HB2A 3ZTWA 4KV7A 3FBWA 1UFOA 2HPVA 5IBPA 2QL6A 4QSHA 4NVRA 2JH3A 3FYUA 4ZV9A 2PBZA 1E32A 1W5SA 2PLFA 1E60A 2GPNA 2A9PA 2PWZA 3ND8A 4IMJB 4R1TA 4V0QA 2IA5A 3GGCA 5J4LA 2G6BA 2PSFA 2CCGA 4GI2A 4K1XA 3TDMA 1W4BA 1R0XA 1TLTA 3KAKA 4Q7KA 1A9XB 1UZUA 3ZW9A 3DNPA 4OQNA 4QJ3A 3T95A 4UCXA 4JI6B 3VPBA 2FZKA 1YQXA 4BKOA 4FONA 5JISA 1SHUX 3RSHA 3W7AA 3IB6A 5F2OA 1ZH2A 3GMSA 4UUNA 1ZA1A 1QQ7A 1UBTS 2CUKA 4C5CA 5T4HA 4WBNB 3GFVA 3IPYA 1IJFA 4F46A 2Z8YA 4QUIA 3LCMA 5DTQA 4BV9A 4UPEA 1YRLA 3ZYZA 2FF5A 3GLHE 1WQ4A 3TRHA 4KRGA 5E2BA 6REQA 4NS1A 1MC8A 1J09A 1GA6A 3BHMA 2FSFA 2F59A 4G4JA 2FZLA 3QA3E 5IWAB 4DTCA 1FS4A 5HRAA 4Y2QA 1IPEA 4BBAA 5BQOA 4QASA 3KPUA 2WHEA 1X77A 3EAFA 3R7WB 1XQXA 1E4VA 4JVSB 5FUXA 1KI1A 4RESA 4JWKA 4X24A 3WL4A 2NG1A 2HGZA 4JT8A 1S2LA 1RPTA 4NK5A 4MP8A 1N2CE 2VJOA 3AI2A 3BGDA 2GJ8A 1XCPA 4L8FA 4M9XA 1JUDA 3VJRA 1P0MA 3V7UA 4UM5A 4CUJA 1DMSA 3RASA 3HYCA 5A4KA 1OFTA 3EY4A 2O52A 3AM3A 4M54A 4ZN6A 3W5AA 3TSAA 2O2ZA 1HE3A 2O9JA 1RJFA 5EWMB 3HA7A 3I01M 1ULHA 4DCOA 2IPLA 4GF5A 1BKDR 5BWMA 3LDGA 2BGGA 2BAGA 3TNJA 3CLSD 3NBXX 1ZD8A 4BMDA 2W6IA 1TIPA 2DFDA 4OJKA 4H9GA 1R9GA 1G7RA 3PCTA 4UJ3A 1F8UA 2WPDD 3GL9A 3VZSA 3LLMA 3G9ZA 3QG1A 4POAA 5KHAA 5AM2A 5IANA 1PZEA 2H1CA 5HJ7A 1GJRA 2X5KO 1C5KA 3ESAA 1OYWA 1LC3A 4JP5A 1R18A 4REQB 4ZGBA 4LJKA 2BF7A 4P5DA 5K3DA 3VDXA 2IVFA 4A8HA 1JR6A 1KOGA 5KAPA 2AOUB 2XEDA 1QF6A 1VPVA 3GD7A 1DCMA 3V1YA 4MULA 4L5IA 2QYHA 3QEBZ 3ZDBA 1EK2A 4DMMA 3GIDA 4HEA1 5DHQA 4MA4A 1XRSB 1I5RA 2Y27A 3NORA 5HZMA 4YJKA 3D54D 3LHDA 4DRYA 1KJYA 5TMPA 3LA8A 1GR1A 3N76A 5CX1A 3TX6A 4YRZA 3H0CA 5K0SA 5EJ5A 2V1XA 1E9AA 1QP8A 4PFSA 4N01A 1V47A 4WQMA 1CUVA 1C9JA 2WUVA 3OBIA 1CY6A 4Z0HO 3U3XA 2V4UA 1CP3A 3CCBA 4RV4A 4ZXFA 3W5HA 1XAGA 1E3EA 4L73A 4P4SB 4MIYA 5E38A 3UAWA 4HRYA 5C37A 2IITA 5ESDA 3K4PA 5TJ9A 2IZ0A 1XTIA 2BGNA 2V7EA 2YYZA 2GF9A 3N8GA 4JJKA 3H9BA 4N5HX 4YP5A 1JEYB 4YP1A 1O4VA 1RWOA 5DXJA 1D2AA 1U28A 2BHNA 4GZ5A 2NYRA 1UKCA 3CUYA 3L7CA 3V9PA 2H17A 3DXXA 3K94A 3A04A 2PZLA 4S1OA 3RUFA 3ETNA 1P0IA 3PS9A 1FDUA 1S2DA 2P9JA 3L41A 1QVVA 3LZDA 4J1TC 4M1EA 1RJDA 2WUWE 3Q3HA 5EHQA 4DNFA 5CDUA 3B85A 2DJ5A 2OK8A 5I4BA 4ZHQB 3VPAA 4E15A 1THGA 2GTHA 3W4KA 4Y9SA 6LDHA 3JD4A 1G8GA 2GBGA 3RJ9A 2AZ4A 3JAMA 5EVJA 5HKKD 2ZPUA 5FUQA 2HGSA 2PGXA 2WTEA 2E9SA 1KVUA 2RHLA 2ZIVB 3ZGOA 1REQA 1YNOA 2PKXA 4EPWA 1DC6A 1O96B 2RI1A 2DY0A 2VHZA 4OMCA 5C1IA 3UJDA 5C35A 1MIHA 4ZT2A 2FN9A 2PRIA 4XWAA 1I0ZA 1NIJA 3M6VA 2MU1A 3PC4A 1YE5A 1JQ5A 2ZTUA 4GKJB 3EXEA 3ID6C 2GD1O 4BNUA 2NTEA 5C8YA 1B8OA 1NVUQ 3C1AA 4JEIA 3E4CA 5JZOA 4J7XA 1Y8CA 2OV2A 2JLAA 1OU4A 3VYTB 5LKAA 4J4HA 3L7BA 1CEQA 1I24A 1ZVKA 3DEJA 3V7NA 4ZHQA 2ATCA 4XUCA 5FBVB 4W8HA 3ELDA 1C0LA 4V0ME 3QX7A 4FMCF 1M6HA 1Y5IA 4FYVA 4KQHA 3WLOA 2WIKA 5L53A 1G6KA 1E2UA 4F8EA 3R4CA 1YTUA 3ZE6A 3JQEA 2YJ6A 1KKMA 3NLLA 3GRFA 1SZJG 3N2LA 2QRVA 3NHWA 4KJXA 4LC0A 1NZDA 3ZWCA 1W36B 4KE8A 4BP9A 4L5YA 2C99A 2H4XA 3TBHA 1KC1A 5K3BA 5TPWB 2GAIA 2GJSA 3Q7IA 3T3GA 4M8LA 3RTGA 1NQAO 5EAIA 1YAJA 2M1XA 5E4YA 3DFMA 3NDJA 3QVJA 3SDSA 4K03A 4KSCA 5HYVA 5CNMA 4UCFA 1YMQA 3P4UA 3AKCA 2B4KA 2NSDA 5C5CA 2IDZA 3MWEB 2QMUA 3EF0A 1YMVA 4UU7A 1G0NA 5AVRA 3GRKA 1SKBA 1ABBA 1F2VA 1X9HA 2BFNA 4S0ZA 4EGQA 2B2XA 4ENTA 3Q7QA 4YT8A 1WBDA 2OUIA 4MGZR 2EU8A 1JQEA 1P18A 2XSZD 3PK0A 4WVFA 4M8NE 3W77A 4IF4A 1YDMA 1Y1SA 2QOEA 1NVFA 3O8DA 1Q0PA 4ZD6A 3ZX4A 3A2NA 3PUVA 1B23P 1NPTO 1MX1A 1VB5A 1PTKA 1V5FA 3WHIA 3UGJA 2F17A 2ATVA 4DQ0A 2B7LA 2CV2A 1AQYA 5E8JA 4HDSB 3N74A 2AFVA 2LR0A 3SSNA 1FXWA 3SKXA 4ARVA 4EH1A 1UOPA 2VK2A 4L85A 3JQ7B 5THXA 3ASYA 2P0AA 3N5KA 4GDMA 4QODA 3QKRB 5IKMA 2PZAA 1JGTA 4URFA 3CZCA 3R40A 3KQMA 2BZ1A 1YR8A 1MJFA 1UWVA 3H5OA 2SKCA 5EKUA 3A2MA 4JJIA 4W5WA 2HQOA 4TWRA 4GWKA 4F6RB 4J2OA 1XAJA 1JQDA 1USKA 1WVIA 1NXXA 3R3XA 4FN5A 4YP9A 1PW7A 1OFGA 3DOOA 1AHPA 1U8CB 4OX9Y 1K4YA 3AERA 1YZKA 2GPJA 4KIWA 3LT1A 3M33A 2LMEA 3KPJA 3TXXA 1GO2A 1Z6PA 3G9XA 5G0VA 4WOJA 4X00A 4ML3A 3A3PA 2P90A 1T5LA 2O07A 2YWBA 4YQFA 1JR3D 1QYXA 5LBTA 2AR9A 3OFVA 3O4GA 1D4FA 2GK3A 2NMVA 4I46A 1SVUA 4BNXA 2VA9A 5J40A 1FJGB 4ZCMA 3VR3A 2YHIA 1M5UA 4OP1A 5HKBA 3DEYX 1E2DA 5FA5A 3TRDA 2X23A 1BD4A 4TTPA 1Q1ZA 2MTBA 4KPFC 4GR5A 2NSLA 1IDOA 3DHNA 5KTMA 2XA2A 3LCCA 3KYJB 3AI3A 5CIYA 1DE0A 3SI7A 1YFJA 4AUNA 1TM5E 3MRSA 1LQTA 1QVWA 5F9FA 2JLUA 1EDEA 2NQ2C 4LZOA 4AM8A 5KYYA 3BIWA 2DAPA 4GGOA 3TJMA 1VMKA 1NLFA 1NNUA 3LP8A 3O4HA 1K9VF 1RLIA 4J90A 3W8NA 2GR8A 2PXXA 4QFDA 4MS3A 3KCNA 4ZAGA 1YVPA 4JYAB 3JTMA 4U2BA 1WXHA 3HXLA 4JZKA 5HRCA 5CLGA 1XZGA 1C2TA 1K8ZB 1W47A 4P7BA 3TYXA 4XSVA 1FQWA 2BMAA 3PXGA 4V0OA 4X1YB 3P26A 2PT5A 3D4LA 1RVV1 3NC4A 1GGVA 3EEQA 4X8OA 2XF8A 4H6VA 4X1IB 4UTVA 5CK4A 1GPYA 2HY7A 3DR3A 5KYYB 2Z9BA 1JJFA 1L5OA 3QPCA 3H5IA 3AVWA 4CR8A 4MJ3A 1MA3A 2ZWMA 1M6NA 4OKIA 5F35A 1KO4A 1RMQA 3L79A 4BV8A 3KJZA 4FUTA 5HIAA 1X19A 4YFYA 1C3LA 3VKGA 2HC9A 1N2CA 3HA5A 4YQEA 4BFCA 1QK4A 1Y42X 1EAYA 3OF5A 3FRJA 2JCBA 1JT9A 4X1YA 3REOA 5CCBA 1W36C 1N6LA 4EKYA 5F3DA 4EUSA 4JJZA 3W78A 1KJIA 1SCUB 2O2SA 2Z2XA 2B4TO 4EA8A 3B9RA 1D7AA 1BKSB 3SU8A 2CXXA 4AKHA 3U5ZB 4A16A 3QE3A 2E55A 4G3XA 4YLGA 4NIMA 3TEJA 1GGHA 3D7RA 2QL5A 3BB1A 4I8XA 2W58A 4QUKA 3U56A 3E3MA 5HBRA 5G0SA 4MZXA 5AW0A 1E7RA 3V97A 421PA 2PAAA 3KEFA 4TTJA 4OV6B 1ZITA 4Z2YA 1UBRS 4IYJA 5KYUA 4NBNA 4D97A 4MI3A 3ZIDA 1CQJB 5ANRB 2PYDA 4YREA 2I7CA 4NYIR 2PUAA 4LF5B 3H5NA 1Q84A 1U3GA 2YWXA 4DCTA 1XNGA 2P40A 2EJBA 2Y1EA 1H0SA 4UPVA 1A9YA 1SB8A 1YI8A 4BHTA 2CUTA 3C2QA 3R3WA 5J2TB 1QAOA 3IBSA 4JITA 3WK4A 4WKBA 2CYAA 2TMKA 4Y6SA 3URMA 3AUXA 4B6FA 5CG1A 5FL7D 3JASA 3M83A 1QX4A 3GY0A 2C2XA 2VJKA 4N48A 1O87A 3B1YA 3N86A 3PTLA 5IYZF 2H4FA 2GX6A 3O9MA 2QTTA 1JG3A 2UUCB 4Z54A 5GJBA 3SNHA 3WDLA 2WUGA 3CS3A 2GAJA 3I3OA 3OE5A 3ZDFA 1I9CA 4EJSA 1O0BA 1FU8A 4WW0A 5DN6A 4EVIA 3RRFA 1N92A 2WWRA 4HDKA 2AJ8A 4C20A 3ZI7A 5FYQA 4YPOA 3KZ1E 5FTJA 3SG0A 1SXJE 2ZDHA 2GVZC 3M1YA 3BBLA 2J6BA 4L8GA 2JHCA 1F4LA 4I3HA 3VYUB 3WO0A 1WDTA 2PVSA 5KVSA 4ZVPA 2B0JA 3W2GA 2IECA 2J9RA 4Q9JA 2RKWA 2DH5A 4PQFA 1GA1A 1AB5A 1TQ2A 1IQUA 3R7FA 1LJLA 3J80A 3UK2A 2X8BA 2DFVA 4MV1A 1XVLA 3TH5A 1XZJA 4OBWA 4MW1A 1LFAA 3BPSA 5AQ1A 5A5GA 1EDDA 1JA1A 1XDUA 1EGQA 1KPIA 1PR1A 4N0DA 2XJ4A 3HK2A 2KS6A 3Q3VA 1NVVQ 5JSYA 4GP9A 4KZKA 1E1QA 5HSGA 3EGWA 1UAAA 3OQIB 3W4JA 8ABPA 4IZ6A 3RC2A 2OV8A 1Y9EA 2V1UA 4JB3A 1QS0A 2HLDA 2VHCA 1PL6A 5E1DA 2EXXA 3NCHA 1QIJA 3AF2A 1F6WA 4WNAB 1EFCA 1J06A 2JFBA 3B52X 4Q24A 5B3KA 4CIWA 3EVEA 1H2WA 1AN9A 3WMXA 2AKEA 5K09A 5CW2A 2IPAB 2O3TA 3GCXA 3HU3A 3O95A 3PR3A 1ST2A 1T35A 4IJKA 4RJIA 4DT1A 2CHFA 2HSWA 5KAMA 2PKQP 4C4OA 2H54A 3HYSA 3DZHA 3NU1A 4KR0A 4BNKA 3O4JA 3QEOA 1MUUA 1RQ2A 1C1DA 3O74A 2OKCA 2IXDA 5JFTA 1Q14A 3WWPA 2E4UA 4PYJA 3DBVO 2OWEA 3ZLUA 3ZXYA 4EI8A 3UAYA 1XWIA 3FCXA 4TMTA 4YJ2F 4OBEA 4W1PA 3RTCA 4RGBA 3AV0B 2OUKA 2CVOA 3O1LA 5G4KB 3RNLA 1EPUA 2GXQA 3A8TA 3L7LA 4YGXB 2W5UA 3AVVA 2DBVO 4QDXA 5AK3A 3RDPA 2CW5A 5TEWA 5DM0A 5IT5A 5JXHA 4IIUA 1A5TA 3HG7A 3DKVA 3OX3A 2UXDB 2REQA 3V4SA 3OFND 3DAOA 1IZ7A 5DISB 4ALJA 4KYIB 2WDZA 2OXIA 3UMSA 1Y6ZA 1JHOA 3E58A 1RQLA 3SKVA 3ZH9B 4RVFA 3DE6X 2QVZX 2VDKB 3GB9A 1XZLA 4A2PA 2Z1NA 2YHSA 4F3YA 2H1FA 2X4LA 3MJSA 4JR1A 4WKGA 4P82A 2W4QA 1GVNB 2FHSA 4RIGA 4B9AA 5CBPA 2JA1A 3UWPA 1B7GO 1VP3A 1KEEA 1KDOA 3QEJA 4X5OA 4P31A 3OIFA 2A33A 5F77A 2V54A 2Y76A 1XZCA 3LPNA 3N8HA 4V38A 4J8PA 5BRAA 4F4CA 1CUAA 1B8PA 4HEJA 4NCNA 5CJ2A 3RK4A 4DIEA 1ID8A 2TMGA 3G0CA 4J1SA 1F2TB 2B82A 1RTKA 4HNHA 1UBMS 3CVVA 4UEQA 3K96A 3W9BA 3UK7A 1JPNA 4F5WA 3SC2A 3KZNA 5HOQA 9MHTA 3S70A 3ZOZA 5LLSA 2G7MC 3PDIB 3EQ6A 4A1FA 3GDFA 2A5LA 3SYTA 5HBGA 4L78A 1EUZA 3KQVA 4XX1A 2X0DA 4RPJA 1MH1A 4C0KA 1DKUA 1XC7A 1U4OA 4NJEA 2ONYA 5B4VA 2NVOA 1DV2A 1PEDA 3MB8A 3UGQA 5KCZA 2H3EA 3FCOA 3Q72A 1M2GA 4XX0A 3ZN2A 4JYZA 4B3BA 4ZOEA 4CTNA 5JQGB 3LCVB 5AVTA 4DN6A 3TR0A 3VVLA 2B30A 3TLJA 4E5UA 2PLAA 2XRMA 1PJAA 2IIBA 1GG8A 3B36A 2BFEA 1PFVA 3ET4A 3PNPA 4FOLA 4KXXA 3TQCA 4I3FA 3PEEA 3DP7A 2G36A 2H52A 1QOQB 2YXLA 3ED1A 3ILYA 3ISVA 1R8JA 5FWXB 1RFLA 3H0KA 3PDIA 1U2RA 4EELA 4RTQA 3I9NA 3GPDG 3ZY5A 2VHWA 3EAQA 2HSJA 1VL0A 1FNMA 4MRMB 4DCMA 2OORC 2I1WA 3NOXA 2GB4A 1BE1A 4MVJM 5DCUA 3W05A 4QEZA 4BU1A 1VCOA 5BNZA 1ABFA 3F5FA 3PWSA 4DE5A 2ZI6A 1D6JA 1Q7CA 1OB2A 2VF5X 4O4HB 1RHQA 3E9CA 2ZSFA 2CHGA 3G2MA 4NH4A 4P36A 1D2CA 4Q4JA 2O3JA 2IV3A 3VM6A 3ZWDA 4MICA 1VG0B 4DA7A 2VCEA 1N6HA 1M1NB 2WMOB 5EP4A 1M7GA 2HTFA 2IEDA 2WIDA 4BUJA 1CZNA 4HB3A 3MMPA 1W5AA 4NV0A 5HPYB 5FPTA 4FCVA 3VR2D 2YHBA 4XGRA 3IP7A 5FWXA 5GGXA 3VMFA 5LQDA 1ELOA 3U4IA 2HV8A 3EEYA 2ISQA 4QFMA 2H2DA 1AE1A 1KFBB 1MRZA 2IEIA 3ZCPA 2ZKLA 1Q1QA 4B8WA 3ELWA 3QOXA 1KMIY 3CLRC 1XXLA 1HUQA 1TQ6A 2B83A 2JAPA 2DHDA 1W4AA 4L4XA 5IN4A 2LIVA 4TUYF 5BVHA 3SYNA 3A4NA 2ZDQA 4ER7A 2VT6A 1Y1TA 3GLVA 1KO5A 1N6NA 4MS4B 5KKAA 5LXTA 3EIFA 1NW7A 2GZDA 3AL3A 4HC4A 4D92A 2ZJ5A 3DBLA 2IBMA 3IPLA 2ZVQX 3LT0A 3GLIA 5E0KB 1MF7A 1NVAA 3L0CA 3LUKA 5H0IA 4NYJQ 1OCEA 1XKXA 3UF0A 3DA8A 3WYCA 2Q8NA 3OUUA 4J49A 1MRSA 2Y0CA 4Z9FA 1HETA 1T1RA 1GIAA 2O5RA 2ID4A 5L45A 3ONEA 2VI5A 1SKUA 1X0XA 2XUQA 1D1PA 3GP3A 1KS2A 5ALLA 4BAGA 1XA0A 2WT4A 2JFNA 2YN0A 3QUAA 3VPXA 4XFDA 4UBNA 3BTVA 3BWYA 4TLEA 2J4CA 5BQ3A 2VG8A 3OM9A 2QE7A 2GCGA 5JJIA 2PAFA 2PS1A 4FX2A 2QIPA 4Y67A 1ULZA 2FW7A 2HL6A 3L6BA 4J6EA 4KBYA 2CL5A 2F43B 3BL8A 3DLIA 4CEHA 4P84A 3AG6A 1H3EA 1N7IA 1VBFA 5FHQA 3K5WA 1Y3FE 5H4HA 4OA5A 4F9TA 4UTZA 2VOEA 2WV9A 3BMXA 3IELA 1RI3A 2J46A 1SFRA 2Q3LA 1Z5UA 4QAJA 1P7WA 1M2NA 3K9QO 3HCOA 4P8RA 1V8DA 4ZZ2A 1W8DA 2CNDA 2D0IA 2GK4A 3DMTA 4HDMB 1FSFA 3A14A 3LCJA 4OM7A 5EP2A 3T99A 4ETMA 5JS7A 5JYCA 2HF8A 2CL7X 3TG2A 3FLMA 1X7ZB 1KEWA 3AUUA 4LF4B 2CC2A 1NJ8A 3BD9A 2Q2WA 4DM3A 4BQEA 3PB3A 1OB5A 4IRXA 4Z99A 1ZJ5A 3ZWWA 2WU1A 4RA6B 1KBQA 2C3OA 2NU9A 2PBRA 2JZCA 3VU1A 5B2EA 3K0SA 2A0WA 3HKCB 5SZHB 2HJRA 2JD0A 4ME6A 3IB3A 1NOIA 2GBLA 4I50A 1ZYUA 3DO6A 3BE6A 3F9IA 4OTZA 4Q1AA 5C3MA 3PF8A 5EJFA 4EPVA 2CMDA 5ISMA 1XMOB 4KDCA 1XZBA 2VJYA 2Q2QA 4LK3A 1F6BA 1UQUA 3OFKA 1YCGA 2XE8A 4E13A 4GPBA 1HWYA 4A8JC 1FSSA 1LLFA 3BA1A 4QTTB 2Z2ZA 2XLCA 3WIUA 4C07A 1KQGA 2OAP1 3GFQA 1YRQA 4M9RA 1GRVA 1MX3A 3W3AH 4AX8A 7MHTA 4HJRA 1O6BA 2YXDA 1KVSA 4OK5A 2EKBA 4I50F 3NAQA 1CDDA 4OUDB 3BMQB 5E4JA 3SYRA 1WZEA 3A28A 5LYJA 3D6UA 4HBGA 4HFNA 4EI2A 4BMVA 5LUAA 4DLUA 4LDQA 5AFSA 1CVIA 1E1YA 2D5AA 3JD1A 1KQ3A 1GFWA 3NUZA 2ETXA 4QNNA 4RZIA 1V7ZA 2MIIA 2VDVE 3QEKA 1SOWA 5HTKA 1TTHA 3QMPA 1Z62A 2GWRA 1S8FA 3PFHA 3ZZMA 5KWIA 3CIFA 3LQRA 3AR9A 4QREA 2EEZA 1DBIA 4TZ0A 3GPBA 4QBTA 5A6VA 5B4UA 1Q2UA 4U0JA 4FB5A 3E9DA 3KEGA 5E6RB 4L74A 4N76A 5JAZA 4IQ8A 2ACEA 1NFQA 3TTXA 3ZXSA 4F04A 1KHHA 2HWYA 3BMQA 2I3BA 4IOMA 2QTRA 1I0IA 3T5MA 5LMNB 1R8XA 1OTHA 2M6KA 3I5YA 4MHSA 3RQIA 3WXBA 2V3WA 5JDIC 2JGEA 4M87A 3QIVA 1CUEA 1WP4A 2EOAA 4GOMD 4CMGA 5LPNA 4A4DA 5AHXA 3AHEA 4RVHA 2O8BA 3NXSA 3KQSA 1QB7A 1R9JA 1TYBE 2Y1LA 3URKA 3ONDA 2HCBA 5K4AA 3EQ8A 2INGX 1YR9A 3BQNB 3BSYA 1U8TA 2Y4NA 1E1DA 4PGFA 1EGMB 1RWMA 3D4NA 1SCKA 5K0EA 2HWUA 3Q88A 2QSZA 3ZGLA 1GWNA 1MBZA 1NJ6A 3O31A 1O95D 2E4XA 3MAAC 4ND1A 3L4KA 2JRCA 1SUSA 2YQZA